2ZKYA

Crystal structure of human cu-zn superoxide dismutase mutant g93a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
152
structure length
152
Chain Sequence
b'TKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structure of human Cu-Zn superoxide dismutase mutant G93A
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 152
sequence length 152
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2zkyA00
2Z7YA 3K91A 1TO5A 1Z9NA 1BA9A 3GQFA 3CQPA 2XJLA 2WZ6A 1MFMA 2JLPA 4BCYA 4OJAA 2E47A 3T5WA 4OH2A 1S4IA 1YAZA 1JK9B 4FF9A 2Z7UA 2Q2LA 3HOGA 3GTVA 2AQNA 3KBFA 2JCWA 1P1VA 1UXMA 1COBA 4MCNA 1JCVA 1TO4A 1KMGA 1PU0A 1SDYA 3CE1A 1SDAB 2AQQA 2XJKA 1UXLA 1BZOA 3KH4A 3L9YA 1OAJA 3QQDA 2C9SA 3GZPA 4BD4A 1DSWA 4N3TA 4A7VA 3ECUA 1E9OA 3ECVA 1SXZA 1E9PB 4BCZA 3GZOA 1B4LA 1PZSA 1SPDA 2R27A 2WYZA 3MKGA 2WKOF 2GBUA 1SXSA 2WWNA 2C9VA 1EQWA 4A7SA 1SRDA 3KM1A 1SXCA 2VR6A 4A7GA 2AQPA 1E9QA 3ECWA 3KM2A 2AQTA 1N19A 1IB5A 3SODB 1RK7A 2ZKXA 1XSOA 1U3NA 1F18A 5KBLA 4A7TA 1XTLA 2LU5A 1XTMA 2VR7A 2E46A 2WZ0A 3GZQA 2NNXA 1PTZA 3HW7A 2C9UA 4MCMA 2AQRA 1OALA 1IBHA 2APSA 1IBBA 5KBKA 4B3EA 1JK9A 3LTVA 3QQDB 3CQQA 2AEOA 2AF2A 2ZKWA 3L9EA 3F7KA 4A7UA 1HL5A 1OZUA 1E9OB 1N18A 5KBMA 1YAIA 1IBFA 2GBTA 3F7LA 2AQSA 1SXNA 1F1DA 3PU7A 1IBDA 1B4TA 1SOSA 4L05A 2ZOWA 1OZTG 2GBVA 2WKOA 1F1AA 1SXAA 1AZVA 2WYTA 1E9PA 5CU9A 1FUNA 3MNDA 1Q0EA 1CB4A 2K4WA 1OEZW 3H2PA 4N3UA 2Z7WA 4A7QA 2WWOA 2Z7ZA 3KBEA 1SXBA 2SODB 3RE0A 1YSOA 1E9QB 1EJ8A 2VR8A 1ESOA 3H2QA 1Z9PA 4U4IA 1F1GA 1DO5A 2ZKYA 1HL4A 3KH3A 1CBJA 2WZ5A 1L3NA 3S0PA 4A7GF 3HFFA 2V0AA 3GTTA 1QUPA
chains in the Genus database with same CATH superfamily
3VWKB 1NGQH 2EYRB 3MRBA 5GS2D 1P7KB 2D2OA 2ODHA 3L4UA 5KVEH 4TLKA 4BJLA 2CM6A 1FZJB 1MW1A 2YARA 5D7LB 3H3PL 3VQ1C 2IWGA 1E7VA 2F7RA 4KZDH 3VG9C 4LLYA 3ZE1B 1NPUA 1HINL 4ZW5A 1QFHA 5FF6B 1T04A 1XCTA 3US9A 4NQEB 4HJ1A 5I8EA 1AGBB 1QLFA 5F1IA 2CK0L 1CD8A 3C8DA 1HILB 3WXVH 5TQ0L 4A2MA 5GQBA 3GZPA 1QWNA 1WBZB 4JZNB 2R2EB 4FFTA 4QCIA 5EOCH 1NCWL 3P4OB 1YRKA 4D94A 2IOOA 3LZQA 1BXUA 2NY6C 1OL0A 2Y7SA 2DWDB 3QXUA 3U2SB 4Z7VE 1IBYA 4MCYA 3JXAA 3ZKMD 1IRAY 3I50L 3ZXAC 4G1MA 4LF3A 1JF6A 4Z8FH 5EORL 2A99A 3FUMA 1KBGL 5E9DB 5HDQH 5BUPA 5E5LA 2NSXA 4A2FA 1AC6A 4R8WH 4RH4A 3CBRA 1F4WL 3QH3B 1FFNA 1WAAA 5DZAA 4OCNC 3Q0HA 4DVBB 2VWEE 1EH9A 5AVVB 3HI1A 3ARDB 3SGEH 4G80A 1FPTL 3WXWL 3U79A 5T5FH 2HFFB 1EEZA 4DGIH 3G6DL 2YUWA 3RTLA 2CXKA 4IM8A 4FQHB 5DMGD 1I85C 1TLKA 3IJEA 3BWUF 1HI6A 43C9A 3ULVD 1I3VA 3IU3A 4PVNA 2WMPB 5LCVA 4BQCA 2UZXA 1HJCA 3I6KB 1NLBL 1P4IL 1QMUA 2CKBA 4NAMA 2DQMA 2CKBL 4P8QA 2V3DA 3SDCA 1SVBA 2MHAA 4OT1H 2A6KB 3D34A 4FFWC 5EZIL 4UQ2B 1T0NB 1SF5A 4J1UB 3V4UL 5KZCB 5DF0A 2P7TA 1Z0NA 2IPTL 3DARA 4Y16A 1ZEAL 3QFJE 4LCIL 2Z31A 1SLWA 3ETBF 3ATAA 5H94A 4DP8X 3ZO9A 2W5PA 2FT6A 5J5EA 3WN5C 4Z7NB 2VSKB 4K2UH 1FDLH 1MOEA 3EW3B 1CDBA 2J8HA 2X6AA 4UM8A 1NMCC 5T1LB 4U4IA 2IAND 1UH3A 4CMHB 5HJ3B 4DKEL 4OFKA 4XMKL 1DUZB 1XIWC 4IRSD 3MNWA 1FBIH 2FEEL 1NDMB 3MLTA 4ZPVA 1DVFD 3FFDB 5E8NA 5KSBE 1YNLL 5JHDE 4TLTA 2XWTA 2FBJL 4OBRA 1TCRA 3FQYA 5ANMB 3BP4B 1UT1A 2XN9D 1FCGA 5E6YA 5D7IB 4FFVD 4WW1A 3KS0J 1JWMB 3LQMA 3ARPA 5E4IA 4OV5A 5ADOL 2R8SH 2HH0H 1MI5A 1JZEA 2XTSA 4E41D 3UYOD 3AWFA 2A4EA 3NIFB 5AWNH 2EE3A 2GUOA 5DHVA 3R8BB 3RB7A 3ARGA 3SOBL 5E9NA 3MNZB 5JHBA 4U1MB 1ACCA 3QCTH 3B2PA 3QEQB 1FL6B 3GMMB 1YJDL 2APVA 3BGAA 3PGCB 5HJBA 3ROOB 1KT2B 1JXDA 1U8LB 3RWGA 4U1JA 1MCKA 5EV7A 3FB6A 4WW2F 4N8PA 5GGVL 1K6QH 3QA3B 1GZPB 1SYVB 1ZV5A 3DETD 1AMXA 3ZVVA 3A3YB 1PBYA 4OFYA 1E5YA 4IRJD 3U46B 3KM1A 1F3JB 1H3PH 3PXJA 1AQKH 3MYZA 1XF4A 3RL2A 4WO0A 3U9UA 1UZ6E 4FXTA 1WTGT 4IJ3B 3FHQA 3L1OL 1KTJA 4Z1PA 3BX7C 1HAWA 3GSUB 3WELA 3L3GA 3HC0B 1ACYH 2BIQA 2CO6B 3NEOA 1I1AB 1P1ZA 3LY6A 1ZLSH 3UEZA 3ZSTA 3WSQL 4AJYV 4BFIB 1XR9B 2J5LC 1C7SA 4QF1A 2ZXBA 1CBVH 3HS9A 3S3DB 1QTSA 3EJYD 5IFAH 1QEXA 4OZGB 1CR9L 3I3EA 1X4XA 1IKOP 5FO7B 1IFHH 2VAAB 3QUZB 3OGCA 3RNKA 4U6XA 5EF0A 2C34A 3C09B 3F85A 3F7KA 4U3SB 3OLIA 4W70A 4O9HL 5KN5A 2C3VA 3OQ3B 5J6GA 4MD0A 3L3IA 4OF5A 3QORB 3UZEA 3D39A 2HKFL 2IQAB 2PUQT 2XG5B 4KUZL 5IVZA 1G9NL 3ZDYE 2FQEA 4KKNA 5EF2A 3BOVA 4WAFA 1T22B 3EADA 1X9RA 1ZTMA 4UQAA 1OTSD 4JO4L 4OAWA 5EU7E 2CD0A 3LZRA 3QZWG 3SIKA 2DI9A 4URKA 1AR1D 3H2PA 4ZSOE 3EBHA 1P5UB 4HDIB 2LFGA 3KS0H 3KBEA 2NW3A 2WO3B 2HRLA 4XB7A 2VLJA 4FKEA 4M6MH 4GP5B 4FXKA 1F1GA 4MA3B 1Y6KR 4P99A 3BFQG 5CIPB 3QRGL 5I1LA 4OZIA 1E0OB 1S7SB 4NKMA 5GS3A 5IIEA 2BNQB 3FU6A 4FG2A 1JV5A 4JFHE 2DQTH 3GHBL 1E5UI 3BE1H 1RZJH 1O9WA 4NPJA 1YY9C 1W6LA 5T1KB 3UO1L 5FDWA 2ARWA 4G6AD 1DQML 4TPRL 1RZKL 1YECL 2EKSB 5DSCB 1XBDA 2F7PA 4TLUA 2Z7UA 4Y4KB 1GGCL 4XBPA 4XTRC 5I75C 1XF3B 1P53A 1JDDA 4EDXA 1LVEA 3WFZA 1F86A 5HGDA 1MSPA 2VH5H 4HZAA 5F7DA 1NCBH 2QPEB 4R97B 3S8FB 3X11B 2FJFB 3I85A 5E2VH 2F7IA 4B9YA 3KYAA 2PWEA 4RRPM 5JA9A 4GQPH 4NP4L 4LQFH 3GEWB 4FEIA 3C6LD 2VZSA 1PZSA 3ZW3A 2ZXDA 3GSXA 1SEBB 2WLIB 3QEGL 4M5YL 4N0YH 3LRSA 5FYKD 5F9JB 1IAKA 5I1HH 4GLRI 5F21B 3W37A 1KDJA 4UQ9A 3KWXA 3VTMA 4BYHA 2GHZA 5E1HB 2NLJB 4TVPH 4GKSB 5AW9B 4HWBL 4LT7A 1U95A 1EAOA 4WIQA 1JXKA 1QRNE 4FQPA 3MGOB 4PRNB 5TQ2H 5AYUH 4KITB 1RUPL 2EECA 5EUOB 1UJ3A 5ESVA 4XMUA 4X5XA 2XFXA 3HPLB 1ZCRA 1NSNH 3CNKA 4RWYH 2GB2A 1Q1JL 1Z66A 3EYUH 5B3JE 4UT9L 5BRZE 2IIJA 4NX0A 1Z5LB 1PTZA 3HG4A 2NUTA 1MHCA 3LV3A 4DFIA 2I69A 4A1RA 4Q4EA 2IFFL 3CC5B 2IQ9L 4FZ8H 2VDML 4I48A 5D2LB 4UUJA 4F33A 3FRPG 4PJ5A 5D7JA 2NY7H 4EBQH 2AEQH 2J72A 3RVTC 1HYRC 4PWKA 3AS1A 15C8H 1KLFA 5H2BA 2YXWA 5F96H 2QV4A 1MJJA 4NFCA 5J0BA 5J3HC 4NXKA 4XMZA 3SCMD 5F1NA 3PAZA 3CDGB 3VD0A 1BFVH 3EJZC 4JDTH 4NNYB 4OY9A 5CZKA 3PAVA 1FUNA 1DLFL 4Z7WE 3KD4A 5J1AA 3EG9A 2KS0A 2R4RL 4NS0A 1MFBL 3UYPB 5CBAA 2PYEB 3CFBA 4M8VA 4KGLA 3FQRB 4RGOL 3ZU8A 3FO9A 3FN0H 3KPNB 5IMKA 2OSXA 3RGVC 2WXQA 2AGJH 3L9RA 2C8NA 4LLMB 4TOYL 1OOWA 3TV3L 2LV4A 5HTSA 4PJEB 4EI5A 4DESA 4JRXA 3WFHB 2QQNH 3MFFA 5FX3A 4JBSA 1OM9A 2LAGB 4YDLB 3STLB 5ISZB 1KCRH 1UKTA 1I8AA 1ZV2A 2ADGA 2WP3T 4OUUB 3K4ZA 4KPHH 4R4BA 2XXGA 4HX1A 2D3JA 4XOEA 1ZGLP 1XH3A 2EIEA 4V2BA 2YK1H 3CSTA 5EU5B 3W0WB 4QKXB 4ZMQA 1JK8B 1MIEL 1TT6A 2ERJB 1B3IA 3QXTA 4RGNC 1S7VA 4OM1H 3QNXB 4XE5B 2FATH 1UACL 1ZT7B 4WEMB 1WIUA 2EDHA 2OJEB 3U30C 5HVHB 5CN3A 3GDCA 1NGZA 2JJUA 3ECVA 1SXZA 3MLPA 3WFEH 2B1HL 3VTAA 2FJGA 5C0GB 3AWEA 1BBJB 1V7NH 3LQAL 4GSDL 1ANUA 1GOHA 2COVD 2FECI 3BXNA 4I3SL 2W65A 3FBQA 1IQWL 5C97A 3P4MB 4B9KC 4I1PA 1ZA6B 4LEOA 4OZFH 3KJ6H 5ICYB 4NNPL 3MV9B 4OZ4A 2BVTA 2ICWJ 2CBQA 5JIQA 1IKFL 3D2UB 3CZLA 2EUXA 4YK4B 2HJFA 4PJBA 5CP7B 4YHIB 3WIIL 4D7PA 4EDWH 3FK3A 2BSTB 1M1SA 3KL0A 4L29B 1C5BL 4APQA 4D9RD 2GQHA 5E2WL 1IBGL 1I8MB 1JGEA 4K7PL 2BC4A 2FQGA 2OTUA 1OPGL 5DS8A 5KSAA 2LVEA 3ROLB 2WLHA 5E94B 3NTCH 4IQHA 1IEAA 1A6VL 2BY3A 3OKLA 2GIYA 3TU6A 3H9SD 1PZBA 4DP6X 1A7OL 4OUOA 4J3VA 1KV3A 3KXFA 4LL9A 2V37A 4P3CL 1OGTA 4NIKB 4ODWB 4G8GE 5AW8B 3O2DH 1J8SA 2KH2B 2DQCL 3VD4A 3ZPDA 4WDIB 4XCFL 4NQUA 5HDBE 1A2YB 2BP8A 4NQDB 1G4MA 2MCMA 1LE9A 3X2QB 5BV7H 2HT2C 3BPCA 1P0SE 3IVKA 1DQIA 1TZOA 4TSBH 2YUVA 3IYLW 4DTGH 1F13A 5AW3B 3IDNA 2PR9A 2N1TE 4AIZA 1KPRB 1FIGL 1OCOB 3I9AA 3DJZA 2MKWA 4X5WB 3GUTA 2K4AA 2FX7H 2R9HD 2UZYA 2XVLA 2C9RA 4KKZA 2CJTA 4JZOB 3IXAB 5DK0B 4GUPA 4XXCC 1F41A 2BHZA 2FGWH 2J6EH 4V1DB 1X5FA 3VGFA 2A9NH 4EN3B 4NRYB 1M3JA 2BP5M 4WHYG 3TN0C 2LR4A 3EUDA 4F7EB 3O8XC 2WSDA 3VXOA 3FTGA 4LZKA 2GJPA 1O5PA 3SE4A 1TQUA 2QHRL 5FV1L 3QO1A 2VB5A 2JB6B 4LHQB 4AMWA 4HIHA 5EU6E 4JFZH 2BCKA 2VXSL 4TUJB 2X1PA 1KB5B 1UWGL 4AY0A 4D2NA 1H3TA 5AAPA 5I1JL 3US0A 5CBEB 1FZKB 2ALWA 2WZPA 3P3UA 1E4KA 3B2MA 3C75A 2Y3NA 3OKYA 3C5JA 3E6FB 3TS8A 2MRYA 1K85A 3AG3B 3EO0A 4N0FA 1BOGB 2Z8SA 4FCHA 1HIML 1MZYA 4TSAL 2IFGA 3U1SL 1CG9A 2QV2A 3NCYP 1QFPA 3TVMA 4F8LA 4DQOH 5FYLH 1H3XA 1QTPA 1XF2B 2YMXH 3AY4C 2R69A 3DVIA 3LKRB 5DVKA 4LL1A 3B83A 1QKZL 5ETUB 3UBXA 2HP4A 3DSFL 3UG4A 2RACA 4XH2B 4YIQB 4Y5XB 3K3QA 3N04A 1E67A 1W0VB 3QJRB 1KENL 4LVNC 5CLTA 4E9WA 1VIWA 2DKUA 3FF8A 5EOTA 4ZX6A 4IS6B 1JFQL 2QL1A 2GAZA 2N59A 2A9BA 4G9DA 5C09B 1WFOA 2BVQA 4PREA 4HD9A 1XGUB 2Y7NA 1EK3A 1JD9A 1Z6JT 2OMBA 2E27H 3L3HB 5DD5L 4Y2OA 3VWKC 4J6IA 2QHLA 3D6GA 4LDEB 5I19L 5EIIG 5K9QI 4GG6E 3WMSA 4AMKL 4AQEA 3Q8CA 4WEEA 4KOCA 4NO5B 5KW9L 3SDCD 4YBHA 2EIZA 1WS7A 3VXPA 4RAVA 1PZ3A 4LIQE 1WE5A 4P06A 4Z18A 5EC1A 1MFCH 2FBRA 1S9KC 1OGAE 5KANG 1E5ZA 1MLCA 5HI3D 5JIKA 2Z31D 1A7RH 1ZHKB 2X12A 1JZ3A 2IOIA 3GXUB 4JRYB 3N1PC 4HW6A 2OJZL 3TJHD 4YSSA 4WHDA 2D03L 1V27A 3BVNB 1WC7B 3AW5A 1E27A 4PWGA 4Z3IA 4F2ME 4PS4H 3MAWA 2FJHA 3LXCA 2EVGA 1OB1A 3ZE2F 1BAFL 5FEBA 1AGFB 1NMBL 3SDXA 3T4YB 4DCQA 4AUUA 5SWZE 5FYJU 1NC2B 4LCWA 5D1XA 1BQRA 1MELA 3GM8A 1II4E 4J3OC 2DH3A 1JYWA 1AS7A 5I1GL 4L3CA 1EUTA 4ZPTB 3IFOB 1GMIA 4ZNEA 2PP8A 1NFDA 2OMVB 3X12B 5CP3A 1KGJA 4G5AA 3RKDC 5BOJA 3NSJA 2JIXA 4C8XA 3FMGH 5DHYB 2H6OA 1HDMA 1CF8L 4WEBL 3IDGB 3BZFA 2V8LA 3W9EB 4DN3H 5LHDA 2C3HA 1WGOA 4JPKL 1QW8A 1WVZA 1ZA3B 3ARDC 4FZEL 2R1YB 3GXPA 4W9LC 2AJUL 1MI5D 2APFA 4HXAH 2ZX8A 1N5YH 4XMLH 3HZMB 1TZAA 1J1OH 4MAYB 1PFCA 5JIMA 2YPVA 1AXIB 1R5IA 1OPOA 3RAJH 1RIHH 2C1OB 3B5GA 2CA3A 1G9ML 4ZJ9A 4MQ7A 3GMOB 4DQAA 4YHML 5L7XH 3QUMB 4YLCA 25C8H 4LKCA 3MRLB 2CUMA 3ZE0B 1T80A 4KTDH 3MREB 5MERB 2UWEE 1LEGA 5D7KD 1CFVL 4H13C 1TQBB 1J05A 1I7UA 4FGMA 4OFYD 4P2AA 1UT9A 4FLQA 4M9PA 4PEEA 2OXHB 2CK2A 1ETZA 4HGWA 3V55A 5EPMA 2DQFB 4Z0BH 2WN3A 1N64L 1T66D 3QQXA 5C0BA 3WUWA 5JOEA 3QB7C 4UOW0 4HIEA 1JXGA 1RZ8A 4KMQA 2Q7NA 3FN9A 2R59A 2PCXA 4GFTB 3INUH 1NGWA 3V0WH 3UGXA 3R7RA 2J88H 4YE0A 1V5JA 1BCIA 4A7TA 4LK4A 1JXJA 1YEJL 2MEJB 4I85A 4CMHC 1RK0A 2FL5A 4KVNL 4KI1A 1DVUA 1Y6NR 5DRXB 3C2AL 2B15A 4NUGL 2VW4A 1VA9A 3KDMB 3TO2A 5BZZA 3UG5A 3ZKXB 4MSWB 1U8CA 4X5LA 2XTJE 3FQXA 2ZUUA 4KRNA 5GSVB 1DFBL 2CR6A 1CDUA 4UTAH 2OMNA 3D39D 1CLCA 3IU4L 3MA7B 2ZX9A 3KPSA 5FGCB 5JPMC 1SBSL 1IL1B 4KBPA 4L9DA 2E6JA 3VI4E 3FO1B 1MAML 4G8EA 1CFSA 1VADB 2GBVA 5MENA 1DQQA 2H26B 1XQ4A 1J8RA 4HUUB 2ITDA 4I9WE 3TURA 2YAQA 2VLJD 2XRAH 4K5PA 4XP9L 4A7QA 5EN3A 3DOSB 2VUOA 1G87A 1O9VA 2B59B 3K6NA 4AM0Q 1E9QB 1Q9KA 1SN2A 5GGVY 4M29A 2ZG3A 1HOCA 2ICCA 4IHBA 4EEEA 1QI5A 3S34H 3K2KA 2WBJA 1EBAA 1TYRA 2OYLA 3CVHA 1YDPA 3D4ZA 2ADJB 2DQIH 1RJZB 1OGSA 3KVDD 2G60H 3CVHL 3F7YA 3G5VB 4RNRB 4FKKA 1T1ZB 2Z34A 4IJ3C 3C8KA 1VZGA 1WT5A 5DRWA 5HJDA 1B0RB 3QHFL 4F7PB 4XCNB 3A6BL 1QFUL 5FYJD 3FU8A 3F3HA 3PAYA 4M1CC 3U0PA 2AQNA 5ICXB 1I1AC 4R7DB 3VDCA 2VDPH 3PPEA 2EXYC 1SDYA 3L4CA 3KPOB 4BK8A 4XC3L 2BERA 3CCHB 3SDDB 2Y6SD 3VB9A 4RQQB 3WDJA 2Y06L 4IGBA 4JN2B 4Q4IA 4WW2B 3VXMB 1QPKA 3QUZC 1NWPA 4LLDA 3S97C 3MCKB 2GC4C 2DLHA 4P2RB 3RX5A 5C0RH 1M2VA 2ARJB 4GAYB 1CGYA 2EE6A 3DVFA 4TYUA 3QORC 3V52L 1ND0B 2X4SA 1YC7A 1XGYL 1W9XA 1FP5A 4UINH 4PRAB 2GTZB 3L4XA 4M6AA 1I3GL 2GCYB 4JFUA 3FB7A 4R96A 4L4VA 1R17A 3ILQC 2P48B 3O2WL 3QBTB 4CMMA 2GEQA 3PABA 5JO5B 4OLYL 2KPWA 2GK0B 3QNFA 3SYCA 1P5UC 4Q9CA 5FLVA 1U2HA 3T0XA 3J2PA 5DZOA 3H55A 2BOBA 3AWGA 2XIDA 3BVVA 3QPKA 4PJXA 5EA0L 2WBWB 1KLUB 4H1LG 5DVLA 5A16A 4K5LA 1RQ5A 4JMXA 1XV8A 5DDHB 5HHNB 4LASL 5K9QG 1S7WA 1RJLA 1EVTC 2WXIA 5DRZA 2JLLA 4PJ5D 2D7MA 5D7JD 4IKNA 5KWYC 5EEUA 2UY7B 5FOBA 5DR5H 2YMOA 5C9JB 4K07A 3BWAB 5HYJE 2P8MA 5FWRA 1IGYB 3VQLA 4LEXH 5DJ2A 3FL7A 4RA3A 1U58A 3B34A 3WKPA 2MNJB 4R97C 1VZIA 4CUCA 1N12A 1QFWL 4AL8L 3QULB 5TF0A 1JZ4A 4PVLA 3SDAB 3VQMA 1Z2KA 2FSEB 1ZLWH 4Y2NA 4LSTH 5JXAL 2Z7WA 5F7BA 3WDIA 4PIBA 1QQDB 3BUPA 1K5NB 1J0ZA 1X4ZA 1IO4C 4WFGE 4PIRF 1F90H 5IBLD 1NAKL 2ZT9C 1F5WA 3P4NB 4ZX4A 1CS6A 4JRXD 3EF4A 1WWBX 1UEMA 4B27A 2P47B 2LLLA 4FTVB 1XF5B 3LRLA 3MLYL 3QJSB 2V2WA 3NT0A 5GS0D 3G04A 1A8ZA 2HLFD 4H7VA 2H8PB 2R1XB 4CADB 3E8UH 5EEVA 2X1XR 4L8BB 4ZDHB 1VGEL 1KJ2A 2ED9A 2AJXL 3GXTA 2IDSA 4HULB 4OLWL 1Z9LA 1KJ2L 4WI7A 2D3VA 2V2XA 2XQ0A 2LHAA 4S1DD 1M7XA 2EEFA 3LRMA 3QZMA 3BUTA 3T0EC 2UY6A 4HC1A 4LRIC 4EF3A 3JVGA 2QQLL 5DO2D 5GHWL 1YYML 4HC1L 2AVFA 4J39A 2X4RB 3MYJB 1T20B 3DUHA 2UZIH 1H19A 3NJGA 3V4PA 2VNCA 4AV0A 1X6LA 4EKXA 3TF7C 3MLRH 3N9GH 4PJCE 3V4PL 1EUUA 1TJXA 4HUKB 3ES6A 4Z7UB 2JI1A 5F71A 1HHKA 5HJGA 5FB8A 1P5VB 1GGIL 1MJ7L 2HVKB 4IOFC 5LGYA 3NIGF 1JPST 1J88A 4NWTL 2CLRB 2Z0BA 4EJ1C 4OCXL 3BAXA 3CAFA 5FKAA 5LXGH 3B2UD 2YD4A 2EEDA 2AK4A 1VFUA 4LFHD 4U6HA 1RMFH 2IANB 3L2MA 4QRRA 4XP6L 4NQCE 4APQD 2X0UA 3HIZA 2Q7YB 3MJ8A 4H40A 4IRSB 1BG9A 3APDA 5AOZA 3I6LE 3UL4A 4Z7QE 4KX8A 4OZIF 5JXEC 1BLNA 4Z78A 1DVFB 3BEVA 1MHEA 5JQHC 2WBKA 4LDCA 4QUOA 5F9DC 3BWSA 1ZY9A 3MRFB 3KGRA 1HK6A 2G75B 3CVBA 2A6IA 2F53B 2HFGL 4BE6A 3WS3B 2Q8AL 2CRZA 3HC4L 4G7QB 4TRPH 3GK8L 3H53A 4JLRA 1UA6L 1SFDA 2F5AL 4YDLC 5A6MA 3VH8A 4Y5VA 1KTCA 3KXFD 2AJZA 5KYNA 3UJJH 3PREA 4E41B 3LZOA 5D1ZC 4B97A 1G94A 2BP3A 2DQ6A 2J55A 2JTDA 3DX0A 4QT5B 3F7LA 2B20A 2ERJC 3FUKA 5LBSA 5CILL 4RMWA 4AOFA 3N55A 4ZYKB 3GSNH 1XGQA 3WEXA 1MVUB 4KJWC 1A3LH 3GPSA 3TWCL 4RGNE 1E9PA 4ZFZB 4H8UA 4J28A 4YMPA 1G6RB 3AADB 1BD2D 4R0LA 5I8KL 1VACA 4ZX5A 1DSFH 3S8GB 1E30A 4IRJB 2B2XH 2VDQB 1BZ7B 3BH9B 4JX0A 2WV3A 5IQOA 4OB5H 4QHUA 4YR6B 2X4QA 1EIBA 3DTXB 1N7MH 1J5CA 2NZ9C 1WHOA 3MXVL 5ECGA 5BQDA 2QQKL 4YDIH 4FQXD 5I2IA 3IFPB 3WY2A 3LIZH 3JUYA 4YK4C 3PXLA 1HL8A 2I85A 2YD9A 3UROR 1JNNH 4ALAL 3I6SA 5DMYA 3DPDA 3QDGA 3BSZL 2J3SA 1A1NB 5JDSB 4YUEH 4BH8A 4K7PY 5SWSA 3PLYA 4PLNC 3BP7B 5C0CE 4TSCL 4HKBA 1OANA 5JR1L 5FA3B 4Q89A 4TUKH 2RFXB 2WZPD 2NTFA 3BGMB 1E6OL 3QQDA 3IJHB 3MJWA 1CFQB 3D48R 2P80A 4KQ4L 1A1MB 2DLEA 1T89C 5HDRA 3RA7L 1I8KB 1V55B 2I9LA 2GTQA 3TVMD 1PZDA 1KJVB 1NFIA 4PYGA 2XWJA 2V5MA 3NJVA 3NCJL 2O5XL 3MKGA 4PRIE 4XRCA 1SHSA 1AR1B 4N90D 2Z1KA 1OTUD 1I4FA 4GXUM 2Z92B 1TF4A 1N5AB 5H35A 4JFFD 2CLZB 4CN4A 2X0WA 1IE5A 5E23A 4JFYB 2AQTA 3NABL 1UWEH 1FVCA 3MC0A 3ASWA 2NYYD 2A5UA 2ADFL 1N70A 3VFOA 1RL1A 4KJQD 1XGRA 2H6UA 3T3PE 4HLZG 2KI6A 3HI6L 1L0PA 4PJ9A 1UKQA 2VMFA 4ZD3H 5C0FA 4K23H 5A2AA 4ZO8A 4XXDA 5HVFB 2GI7A 2YPLA 2Z3FA 3LN4B 1SY6H 1DN0A 2ZE0A 4M7KL 4B3VA 1ZWIA 4JPVL 7PCYA 1FGVL 3M1BA 4XN1A 3UYRL 3C5ZA 5BUAA 3ZR6A 5DI8A 4P9HC 3UTTD 3O6ML 4XPFH 4S1SL 1UH4A 1S9XA 1EEUA 3JV6B 2YAMA 1E42A 3DX9B 3C6LB 4HAFA 1LO4L 1PQZB 1QSVA 2I07B 2Q20A 2PWHA 4LSSL 4NKDA 4OLUL 5T5NF 3TH3T 5J4MA 4LRNL 5GGUB 3WKNA 1LNUA 3UBFA 2M26A 1ZTXL 3Q05A 4Y5YB 5D1XD 4G8FB 2CCVA 5JLZA 1LO0H 4PRDA 4LL4A 3QIUA 4WWPA 3FT0A 1J86A 4EIGB 4R26L 4AQ1A 3B9DA 3NJIA 4JVWA 1IAOA 1A6WH 5IG7A 1AHWA 3BAYA 1BVNT 4J3WA 2JIXD 4QY8A 5FK9B 4CILA 4RSYA 4PJBF 4Q52A 2OA9A 1KXVC 4FC3E 3S35X 4F92B 2P8PA 4Z23A 4Y5XC 2R0LH 3WO4B 3WY3A 3PWJB 2K3HA 2PYFB 4UZSA 3T6XA 1CD0A 2Z4TA 4ZW8A 5GJSL 5IW1A 2VITA 2QVKA 4ILDA 4G82A 1TNNA 2OR9H 3BN9D 5ICUA 4HKJA 3EOTL 1JCVA 4RSVA 3OMZA 3ULUC 1RK1B 1PGRB 2VIRA 4A6YB 3PP3K 3L5XH 3KCWA 1AJ7L 2R0KH 4MKMA 3WNNA 1AFVL 1DSWA 1DBJL 2Z8RA 4LLVA 2VABB 4BFNA 2ZQKA 3SKOA 1CYXA 3SCMB 4KKAC 1HYSC 5D7LE 2OTWB 1H0DA 4N2DA 2V17L 1MCOL 3R4DA 5DK3A 3WE6A 3BPNB 3V5HB 2IBZX 5C0BD 4LHUG 3BZEA 1FHGA 3MJGX 4K3EL 1H5BA 5IHBA 5IGXL 3GLAA 4C59B 1TZHB 2NT1A 5C3IA 2NY1D 5EUKB 4Y9FA 4NKIH 5HHVH 3OM3B 3HAEH 1G1KA 1Z7JA 4LHUA 1CDYA 2ZXWB 1MEXH 5KBLA 4RFOL 4MHHG 5IBTH 1PG7L 1NCDL 3V0FA 4MZIA 4NC0B 3WMPA 2FDBP 4P05A 4MNQE 1IFRA 5DQ9A 4DSYA 4FNLL 1CFTB 5CUSH 1KULA 1JPFB 3MV8D 1AQDB 1K4CA 1TYJA 1IBHA 1R5WB 2B16A 2X3CA 4M8QA 3BAJA 3DJSA 5E9DE 1ITCA 4OCSL 3ME0A 1I53A 4Q2ZA 3RDTD 3L9EA 5E2UL 5D96B 2VXQH 2VDRH 3FOLA 4PI0A 3CZJA 4LAQL 3QUYC 1GKEA 2C1PB 5BMFL 2YBGA 4HUXB 4HF5L 2GW5A 4XT1C 3MX0A 2VZTA 3KAAA 5MEND 3ZE2B 3N85L 4JCLA 3VXQB 1D5IL 3KLHC 4XPHH 2GYSA 2NYZA 1U9KA 4WHTB 2KQNA 3GMRB 4TMPA 1HEZB 1ZLUK 4O02B 3S88L 3RPIA 3RVVC 5T3XH 4ATWA 4XNMB 5HI4D 4D9LL 2DWXA 5DHXB 3OHXB 2JJSA 3T2NH 2C5DC 1S9WB 1DEEB 2CKNA 1WWCA 3D09A 3HR5B 1P4BH 2VXTL 4U6TA 3K1DA 4WI6A 1PFOA 3CWGA 1R33A 2WBJD 3FO2B 4WY7L 1TQBC 1I1FA 2Y36H 1HHIB 2BZCA 3L3JA 4NENA 4B53A 1AH1A 1ZVNA 1HZLA 2G0LA 1Q94A 3VI3A 4RWHA 1G7HA 2K0RA 4F7CB 5B38B 3VSVA 2DWEA 4GRLD 1EVUA 4DOHB 1XB6A 2YAOA 5ICZA 4Z7NE 3R19A 4NERA 3LOWA 1BECA 1KTDB 2AEPL 3VXSD 3KL3A 4AMXA 4ZUWB 4WGKA 1S3KH 2EDFA 2EDEA 2PTUA 2IAMA 1U3HA 4XCCH 2FHBA 3QXWA 4BKTC 3H9SB 4W9FC 2MTAA 3CXDH 4P9HH 1T5XA 4GW1A 1KOAA 5G5DA 1FO0L 3HPJA 3ZKXC 1BZOA 4ADIA 1BQHG 4YPJA 3QEHA 2WXFA 3VXRA 5I26A 1IIIA 3MJ7A 3QW9A 2EJ1A 5AW6B 5H37G 2NCEA 4Q6KA 4YPGA 2QADD 2XKNA 3OPUA 4AC4A 3GI8L 4LMQE 3ZSSA 3STZA 3DBSA 1B0GB 3RFZC 2CUAA 2ZJSH 3KLAA 3VFPA 1U8JA 4KZDL 5FCUH 3IMTA 4JFDB 2I60H 4TNWK 1SRDA 4RCAA 5LQBH 4XNQA 4WK0B 3D9AH 1MWAH 4R2GC 1I1YA 1OKEA 1DTUA 1QBMH 3IWVA 3NIFE 4O2EA 3SDXF 3IDXL 3MV01 3S3SA 3MRBB 3WXVL 1QSFD 4O2FA 5MHSD 3QEQE 5DO8A 1OQOA 1JWSA 1PZUB 1QD0A 1UURA 1SJHA 5DD1L 5EOCL 2ZKXA 5HHOD 2BRQA 1GPOH 3U9WA 1DBML 4HKXA 3OD3A 3ZHLA 2WXKA 3ALWA 1NFDF 3GBNH 4KJPC 3KYKH 3V0EA 3ZRFC 1T04B 1XCTB 2C9UA 1OSYA 1K5WA 5I8EB 4XO8A 2EDMA 4S1RH 3ULUH 2WO2B 1TJMA 1QLFB 1YN6A 5F1IB 2XQBH 5DHEA 4Z8FL 5AW0B 2EDOA 3CLEH 3CQQA 4TNGA 1JI1A 5HDQL 1JPGA 1M57B 2NSQA 4QCIB 1BF5A 1ZT1A 4R8WL 1N18A 3FB8A 2OAAA 3LCYA 2DL2A 4IKLA 1HEJC 3LB6C 4MCYB 4BXSV 1JOIA 5T5FA 4L8SA 1OM3L 1BF2A 2DWSA 4XP5H 1M3IA 1QBBA 3MRNA 3SDDC 5T5FL 3HG2A 4G1MB 3EO1A 4LF3B 1J0KA 3ML9A 4DGIL 4IK6A 4RDBA 2O6EA 4YHZH 2UXGA 5DVPA 5J1TC 4OZGE 4PRHD 3U0TA 4PG2A 1CI5A 2NNCA 3LDBB 1J5HA 1C1EH 1N6VA 1FFNB 4FNSA 4TF4A 3DTDA 4IMKC 1ACZA 5C2UB 4HWEH 3L81A 4DEUA 3HI1B 2WZ5A 1NIBA 4R7NA 3HFFA 3KPPA 4G80B 1A4JA 2BY0A 1EEZB 4HWUA 4I0KA 1SLVA 2A74A 1DL7H 1T5WA 1AD0A 2IBGA 1G9EA 3IJEB 1HI6B 43C9B 3IU3B 5C7XL 3WN5A 2UZXB 1GJUA 2CKBB 1OWRM 3P40A 5LG6A 4LLQA 5T1DH 1FDLL 4NBZB 4NGHH 3SDCB 4XC1L 2MHAB 3RIFF 2PPAA 5D1QA 4IKKA 2W07A 2BNQE 1OGPA 2P7TB 3MJ6A 3HFML 4Y16B 3IKKA 1KTKE 4F80A 2Z31B 3PYCA 3MACH 2CSPA 2BJMH 3KGTA 3QISA 4UZGA 1NCAH 4E9XA 5H94B 1FBIL 2ZX6A 3S5YA 4X9GA 2Y72A 4E9QA 1ZVSA 4GT7A 2VLKA 3D06A 4UM8B 4AH2A 4HQQL 4X98A 2WWNA 3RIAK 3LRKA 4L1SA 1H6EA 4LGSB 4N8VA 4QWWC 4UT7H 5EIVA 2AK4D 2FX9L 5EB9A 4QRRD 1S78D 3SDAC 3BUDA 3UPCA 3ISRA 4PTTA 1CK0H 2NY2B 1AZRA 3MNWB 1L6ZA 4WFHE 5HHPA 3MLTB 4ZPVB 3LH2H 5E8NB 4UILH 3KLKA 4N25A 2XWTB 2ESVE 3MLWL 1U3NA 3QCTL 2IJ0C 1TCRB 5T33H 4KHTH 3T2LA 3QHTC 4BGLA 5I71B 3WTTA 2WNWA 1GYWA 1WFIA 4WW1B 1Y1UA 5ALBH 1EO5A 3L2NA 3VD2A 4OV5B 1MI5B 3KWWA 4LPUA 5K33A 3GT6A 4M9OA 3WV0A 4ZZKA 2AXWA 5C0IA 3A0OA 4A7UA 3TA3D 2GUOB 4KZCA 5DHVB 4YHYB 3D0AA 1RU9L 4M4RA 2BW5A 5EULV 3QQ9D 5EUOE 4ZAKD 1KEMH 1NL0H 1OT4A 4N2FA 2CLVA 3HHMA 4U1JB 2FNWA 3LS5H 1WZ1H 4M5SA 4WFEE 3ZTDC 3FB6B 1I1CA 4EMZA 1U8HA 3B7YA 2NMSA 1AZVA 3VFWA 1QP1A 5JQ6L 1ZMYA 4HHWA 4GUCA 4IKIA 4R7VA 2JJWA 4L48A 4TUUA 1XF4B 3FFCA 3RL2B 5D2LE 1W0YT 3U9UB 2YWZA 3CX5J 4KH9A 1JTPA 1DO6A 4NQQA 3CDCA 4EUPG 1EXHA 4Q74A 3L3GB 4D8PA 1P1ZB 4WI9A 1NBZA 3II1A 1JHKH 5JMOC 2BNRA 4XPAH 3GBMH 2QGEA 4QF1B 4PRPE 4B50A 3QDGD 4DP1X 4PJXF 5BW7A 3LQZA 5SWSD 4IRSC 2P5ED 4MDIA 2QKIA 1EJOL 3OGCB 3RNKB 1C5CH 3ZN6A 1CXHA 4U6XB 3EXLA 1UTDA 4NO3A 5IHZA 2QQQA 5J6GB 2C3VB 5KN5B 4MD0B 3L3IB 3GJFH 3D39B 4WZ9A 5IVZB 4Z7OF 3OC5A 4U0QB 5KVGL 4PGJA 4OZHA 4FFVC 1RJYA 4Y1AE 3L1GA 2PPDA 5I6PA 2NX5A 2E56A 3QVAA 4OAWB 5ISZE 1WIOA 2H0EA 2OM5A 3W2DH 3H9HA 1YZZA 1RZJL 4QMEA 2VDOL 4PQXA 5L4FA 2NW3B 4I13B 4JG5A 1XCWA 4PR5A 3RJDA 2LGNA 2VLJB 3CJJA 3L45A 3W0WE 1R24A 4FXKB 4ENED 3FH5A 2XCMC 4OCLC 3VMPA 1MFDH 5I1LB 4OZIB 3VFGH 4F8QA 4NKMB 2H0FA 2VH5L 4OF8A 5IIEB 1F11A 1JV5B 4UQ3A 4HCIA 3GFUA 3D08A 3NSYA 5L4IA 4IRJC 5A6LA 2ZOTA 1UFGA 2NYKA 2DBLH 3DO3A 3QWQB 4BH7B 4B0MM 3GSVA 3BDYH 3OKDA 2LU5A 4JG0H 4N8CH 4PJ9D 5FDWB 3FXIC 4GKLA 2WQXA 4J3UA 4M48L 4WRLA 4LQFL 4CKQA 4XBPB 3U36A 3CFKA 4Y9BA 2D2CC 1WFUA 1AZUA 4R3SA 4EDXB 2YPLD 2EDJA 5HGDB 1EZVX 3VWJC 5F7DB 1KB9J 3MV9E 1DJGA 5CEZH 3CMOH 1MCLA 2HG5A 1MFVA 3VFRA 2B3IA 3FSVA 3H42L 5CJ5A 2KZWA 4N6RA 5E9AA 3DGCR 3EJYC 3CFUA 4YDVA 4WEUD 3NZUA 1T21A 1MJ8L 5AYUL 4JGNA 4JM2A 5DHDA 5FM5O 3GSXB 2O1AA 2VM3A 3DYPA 3LRSB 4UWQB 6PCYA 2WYTA 1IAKB 1NSNL 1PSKH 3J8F7 5CU9A 3DO7A 2ZXGA 3EYUL 4X7FC 3CGTA 1SF3A 2AXGA 5A1AA 3UBXI 3IAPA 3UTPE 3QIUD 4DPCX 2Z1PA 2N1KA 3WJLA 2N4IA 3OAYK 1U95B 2NY5L 3D87B 5B1CA 4NC2B 3DECA 1K9TA 3FHAA 4FZ8L 2H3NA 1AR1C 4M7LH 2FT8A 4IEFA 4W68A 4KRPD 3MUY1 1UJ3B 2ZUTA 1L9OA 2AEQL 5ESVB 2WCGA 3FFOA 4OQ1A 5ID1A 4TNVK 4X5XB 2XFXB 15C8L 3DTUB 1T3FA 5AVUB 4MJIE 4LPYA 2Z7YA 3EGXA 5BO1L 2BVYA 4NQDE 2NUTB 2EYTA 2E3VA 2B08A 5DVNA 1MHCB 3LV3B 5B39A 2W9LA 2E47A 2XZCH 4JDTL 4L9LA 3BP5A 4MS8D 5DUPH 4LSVL 1EANA 4I48B 4UUJB 4NOFA 4F33B 2BLFA 4PJ5B 1OSEA 3MTRA 5D7JB 2XACC 2V2TA 1QBLL 5H2BB 1KLFB 1ZANH 2OMUA 4UQCA 1MJJB 2ID5A 3SE8L 2AGJL 2EC9T 3MCYA 5F1NB 4N2BA 4HH9A 4V1DE 3HNSH 2HMID 1KCSL 4KKQA 5EG6C 2QQNL 4OD3L 5E4EC 2PW2A 2Y1ZA 4HU8A 5J1AB 1TCMA 5TH2A 1MW3A 1GXEA 1KCRL 1SVZA 5CBAB 1BQKA 1MFEL 4BHUA 3CFBB 2FEDC 3D07A 4CJ0A 1RZFH 2JVUA 3R8QA 4H88H 2PWDA 5B8CA 2F58L 3FO9B 1JGLL 5IMKB 1UG9A 2H1LM 4QXGH 1M6UA 3L9RB 1REIA 4K9EC 2FHCA 35C8L 1PKQE 2YEQA 4HK0A 5FFGA 4EI5B 4OM1L 4JRXB 4Y5YC 5GPRA 3MFFB 3T3MF 5DFAA 1XSIA 2HRGA 2B8OT 2ADGB 4RZKA 3CZGA 4R4BB 4POUB 4X7TA 3T6QC 4HX1B 3CSYA 5D2NA 1YC8A 3ELQA 3FH8A 3ZY7A 4CVXA 1XH3B 2KZKA 4G9FA 1V7NL 3DOIA 3QR1A 1GL4B 5IESH 1VPOH 2H3KA 1IGCH 2HUEA 2JKXA 2X2UA 5EBGA 5IVXA 2EAEA 4PJAA 5F6IB 4OZFA 2H2PC 3SE9L 3WO4C 4FADA 5EHFA 4YNYA 1CXKA 3IF1A 3S4SA 1N8OE 1HX0A 3MCG1 4M8UA 1NGZB 4ZTOL 1N68A 1NEPA 4BDVA 4U7SA 2WB7A 4AG4L 4YXKL 4HIQA 5BJTA 5E08H 1G1OA 2WOYA 2FJGB 4KZ0A 2BSCA 4POZD 4QHLA 5C09E 2O6DA 3X1GA 1MCCA 3BXNB 3WKQA 2W65B 1IM3A 4LEOB 3CSPA 5SX5K 4KXAA 1KF9B 4L4TA 4OZ4B 4XE0A 1P7BA 4HJGA 3SCMC 4X4XA 3WFBH 4LFHG 5EEWA 1KYOJ 3MDJA 1MRFL 1P4UA 4R7XA 4NBYB 2VN7A 5GZNC 2J5WA 4JO2H 4GSRA 3GNML 4NXSA 4PJBB 1EHNA 5JYMA 2BMKA 3V6OE 4ZK8A 2FK9A 3MFGB 1PIFA 3TCLA 1FNGA 4LHJB 1HXYA 1R6VA 3F62A 1QAWA 5D70L 1D7CA 1DBBH 4APQB 3NDZE 4MXQC 4JRYE 4QGYA 1YG9A 3O2DA 5TFSH 4X7CC 5I0XA 1JGEB 2B3RA 2E6PA 2BC4B 3LS4H 1KV7A 2OTUB 1TO5A 5DS8B 3N3EA 5KSAB 5LNGA 4AYBA 1IGMH 4DK3A 3MNMA 1HE8A 3BQUA 1IEAB 4WVRA 1U3HD 5BV7L 3OKLB 3BPOB 4IMLA 2DKSA 2WLMA 4UTBL 1E4XL 5ERWA 4YX2H 2EUVA 4D3CH 2LABA 3KXFB 5A2FA 4ZI8A 2ENYA 1OGTB 1SDAB 5MP6H 1ECZA 4XO5A 1KY6A 3SQBA 3V0IA 4FE9A 3T1FA 3IPEA 5FDYA 1I7RA 1N3NA 2W9EH 3RHWF 3W1ZA 2BP8B 4JAMA 2DQJH 5D96C 2IDTA 1LE9B 2J6EA 3Q8AA 4JB9H 3IVKB 3BPCB 2PKDA 3OC8A 2J6EL 2X1QA 1QACA 1DQLH 2A9NL 2XX0A 3IDNB 5HYIA 4FYTA 1O7VA 4JY6A 4AIZB 3PHOA 4YFLF 4MGXA 2MSPA 5ESAA 3B2DC 2ICWA 3GUTB 2J7LA 1R46A 4UNUA 2UZYB 3EKCA 3LJ3A 2ZTBA 3OHXC 2W38A 4JFZL 2LT9A 3LKOA 1KFAH 4GUPB 4XN5A 4CBPA 5EC2A 3G6JF 3ZE0E 4GRWH 5D6CB 4BE5A 4FA8A 3DMMA 3LIUA 3VD5A 4GIAA 3VXOB 3FTGB 2J8OA 3WHXA 1W72H 1A9VA 3GTNA 2DIJA 3ASNB 5LB1A 2F08A 3DX1A 3QO1B 4WHCA 1SOXA 3L4VA 2FIRT 3MTXA 3VAEA 2Q87A 4JQVC 3BRDA 4GFXA 5FYLL 3RGVA 4HIHB 1ZRUA 2BCKB 2YMXL 12E8L 1GIGH 4B3EA 1JGUL 3CVIL 3O9WD 5CGMA 2XTLA 3ATFA 3K6SA 2BDNH 4ODVH 1OK0A 4CN6A 3VSUA 1JNLH 2I27N 5E03A 3C5JB 4Z7AA 1TPXB 1EHXA 3EO0B 4N0FB 1KGXA 3KNBA 5ESQA 1NDGA 2OMWA 2X70A 5DQJA 1CG9B 3RTQA 5AVSB 4XR8C 2D7NA 3TVMB 1KGWA 4K94C 3BD4A 4Z0XA 2EADA 4PU2A 3A21A 1PLCA 3FTVA 4HAKA 1HHHA 5AKVA 3X14A 3KHOA 1CLVA 4LQ1A 4K9EH 3UBXB 1EFXA 1CF1A 5FGCE 3WEMA 4PUBH 5EOTB 3OKOA 4DW2H 4G9DB 1MFCL 2GAZB 1URLA 4P2CG 1TUPA 1TETL 3WS6C 4OI9A 2BVEA 4AW4A 2BVQB 4PREB 1CGTA 3A67H 1BGXH 1A7RL 4KV5E 1OT2A 3HI5H 5JW5A 4NC1C 4NZRH 4Y2OB 5JPNA 4QXUH 5E7FA 3AXLA 2IAAC 4JO3L 4AQEB 4KTEH 4JDVA 4PS4L 1RZQA 2ZZUT 2E8YA 2JH2A 2EIZB 2TSBA 4L3EA 3VXPB 4RAVB 3AXHA 2CA4A 3CSGA 5D1QD 4QRUA 5EC1B 3FTWA 1E50A 4F58L 1HCYA 4AKOA 1L7TL 1MLCB 2J56A 2X6BA 2X0VA 4YZFF 3D51A 2E5EA 3IWUA 2JKTM 1PZ5A 2VR5A 5KS9A 2DJ4A 4PD4J 4QAWA 1NIDA 1LWJA 4O51A 4RLDA 5IBUG 5K69A 4GI6A 2FQFA 5DD3H 2VLKD 2CU9A 2FJHB 3QWNA 1OB1B 4MS6A 2A73A 1SN5A 4WUKL 1PJ9A 4XMVA 4JE0A 3SDXB 3UZVA 1SOQA 4DCQB 2ENQA 4UQBA 3M7OA 5DA0B 3L17A 4LCWB 5D1XB 3NACL 3OZKA 3HHSA 3CHSA 4WTZG 3ZR5A 4K3JH 3F2LA 3AACA 1NOFA 4HXAL 5F6HJ 3UIZA 4ODTL 3RVUD 4MMXA 4XMLL 1N5YL 4W9GC 2ATPA 1OAUH 1XMWA 4L3CB 5CINH 5DEFA 1HEHC 1NFDB 3LDBC 1G84A 5LGJA 1KJMA 4QOKA 2JIXB 1XSKA 5B4MD 3RAJL 3M46A 4JY5H 2HTKC 1HDMB 1RIHL 2KPNA 3GKWH 1FNEA 1PLGL 3BZFB 3O3UN 3VI3F 2VR7A 5E6IA 1T1WA 2UUDK 3MRPA 3BAWA 4KTDL 1KLGA 3FAWA 3APCA 3UH8A 1Z32X 2WQRA 4MQXC 3RU8H 4E5XA 1AYOA 3H1ZA 4JO1H 3ZX1A 3DIDA 4FYRA 4OF6A 4JFXA 3OR7A 1R5IB 2DLGA 5CHNA 4MQ7B 3K4DA 5AW7B 3AQZA 4LKCB 1PDKA 4H5SA 5K1JA 3TOPA 1RUAH 2AQSA 2EDBA 2ZOUA 3INUL 3TN0A 4DN4H 1LEGB 2ZNXA 2J88L 3C08H 4B5EA 1J05B 1I7UB 1SXAA 1MCQA 3GSOA 2AFNA 3LEYL 4QRTA 4Y16C 1P7HL 3VFVA 1ETZB 3HB3C 2Z31C 4HGWB 3FFCD 5EPMB 2ENJA 5DFVD 2EQDA 1SZNA 3WUWB 5C0BB 1AAJA 1I3UA 2CIKA 4JUTA 4OLVL 3H56A 4KXCA 1OP3H 4HIEB 4UTAA 4XP1L 1RZ8B 2NY6D 4M7ZB 4UTAL 2NY1B 2CQVA 2APBA 1N6QH 1NGWB 1FFRA 1L3NA 2X9ZA 2CDGA 3N50A 3MRDA 2BNRD 1F42A 1DFXA 1RK0B 2FL5B 1JGVH 3P9LA 4TL4A 2NY2C 2CRIA 4J8QA 1MFUA 3TO2B 1I31A 3FNKA 3RILA 3AY4A 4X42A 4J27A 3FQXB 5EZPA 1A21A 4ZOCA 3S36X 1QPXA 1MDTA 4E42A 5MEOA 2Y2WA 4KK9D 3KPSB 1OD7A 5I71C 2F5BL 4KK8C 3QI9A 4X5RA 2NX5D 3ZMRA 4G8EB 1CFSB 5L6YL 3GI9H 5BS0E 2CIIA 2NOYA 1NKRA 2EZ0D 5MENB 4MASA 1DQQB 5IZ7A 5FUZH 2BHYA 4WSGA 2DQIL 2WQUA 2XN1A 3ARGC 4QO1A 2ITDB 1YJDC 2G60L 4YHYC 4AE1A 3QJHA 2XN0A 1U8PA 3AAZA 3OAUL 2QTVA 1Q9KB 3ULVE 3AMKA 4G7RB 3F6JA 1HOCB 4F5CE 3NRPA 4FFWD 3N2JA 4NLAA 2JCCE 1V3MA 2PWFA 4GJTB 4H0IA 3LN9A 4PS7A 4GI8A 1BM3H 2VR6A 2WBJB 2VDPL 1FI8C 1IV8A 1QW9A 1MREH 3CVHB 1YDPB 5I0YA 1SHWA 3FT4A 5D7SL 1YHPA 2N01B 3LYRA 4RMRA 4W6XB 2X44D 3K2UH 4LLAA 4Z7UE 3C8KB 1JFHA 5K5YA 4FNRA 5DRWB 5EU3A 3TZVC 1OP4A 1S7QA 1XTMA 3CDYA 3H3PH 2IDCA 4PJIE 3SPJA 2BXZA 4O2CA 5C0RL 4HXBH 5EEZA 3X3FL 2EEBA 5H4YA 3U0PB 3J27A 5HYSA 4UINL 1MCWW 3QQ3A 4TVPD 1Q9WB 1XIWD 2GSMB 2CK0H 4XX1G 2IANE 5TQ0H 2IV8A 4IGBB 3QDMA 5D4HA 1R19A 4LLDB 2DEXX 1WCBA 2I32A 4PWJA 5KBMA 4XGZA 1M2VB 1RHHA 4B9PA 2JMRA 4AWJC 1W16A 5SV3A 2GFBB 2AXFB 1G9NC 2BZDA 3V0VA 4MJJA 4AQ8A 3WJJA 1V8HA 1QHPA 2X4SB 4DUXA 3GINA 1KY7A 2WTPA 4PV1C 3MXWL 2DLTA 3OLEA 4KQ3L 1R3JA 3FB7B 4ANVA 4R96B 4L4VB 3ISWA 2XN9E 2XPGA 1VENA 2FLRT 5GGRA 3EJUA 5E6RB 4CMMB 1KBGH 3PABB 4IU2A 2YFOA 1GGTA 3Q6FA 1KUMA 2WSKA 4UU9A 2OBGA 2BOBB 3G5ZA 3QJTB 1J0IA 1CQYA 5DR5L 3WE1A 2JJVA 3WGUB 4PJXB 3WO3B 4FL4B 3CFDA 4FXKC 5AAMC 1VERA 1FPTH 5IOPA 5A16B 2CDFA 4LEXL 3G6DH 3W39A 3N5AA 1S7WB 2K7QA 1RJLB 2R1WA 1DJWA 5D5MA 5DRZB 4Z7OB 4HOXA 4FA7B 2KT6A 1M53A 4GOSA 2PABA 3IJ9A 3VX1A 5FOBB 4AC2A 5EOQL 4HEMA 2P8MB 4AJ0A 1F90L 5E00A 5DJ2B 1AQMA 1U4EA 1A7NL 1D5XA 3FQ2A 2IPTH 5AOMA 1JIBA 1ZEAH 4LCIH 4YSEA 1MW2A 4Y8AA 3K2IA 1HCFX 4W9KC 1WISA 2E74C 4JVPA 3Q44A 2WVSA 3B9AA 1XL4A 3SPVA 5KVDL 2LLNA 1KZQA 1PLAA 1O9ZA 3ARTA 2FIKA 3Q2NA 4PP1C 5JPMA 3EIFA 3Q13A 4AXWA 1RUKL 4A7GA 1YEIL 1NA8A 3UTOA 1F4AA 1INQA 2QDWA 3NGBB 2V2WB 4XMKH 3SPHA 3G04B 3GYRA 2BCMA 3TWYA 4LBEA 4PJ7A 1NUNB 3ZO0A 4TQ8A 4HUNB 2FBJH 5A7EA 2YD0A 1KJ2B 4CSPA 4Q14A 2LLGA 4XNUH 4X83A 2V2XB 4CW1A 1QBAA 3FQ1A 5CD3A 5ES4B 4NEHB 3ML8A 5ADOH 2UY6B 5GS1A 4M1DH 4I8DA 2K45A 5GJTL 5HGAA 4NNXA 2C4FT 3V4PB 3QWRA 3SOBH 3U83A 5J12B 1E2ZA 4BINA 4MDJA 3ES6B 1F3DJ 3HE6A 5KJ7E 1HHKB 2Y07L 1U8MA 4OZHF 1D7FA 4JPIA 5FB8B 1EZSA 3DRTA 4TXVB 4L4TD 5BZDA 2P42B 1CL7H 2VDLL 4NPYA 5FKAB 1KEGL 4X0KA 3IMWA 4TRPL 2AK4B 4U6HB 1BJ8A 5C0NC 4QRRB 1QABA 4Y1SA 1Y7VA 3MRRA 5GRUL 4IK7A 5GGTL 3T0BA 5GGSA 1BLNB 4Z78B 3MRMA 4GEJA 4WV1A 3BEVB 1MHEB 5I1JH 3AROA 5GRYA 2A6IB 4UMSA 2PCYA 3GSNA 2AQ3A 5DHMC 3T0DA 5IFHH 4EI5C 3UC2A 3GSNL 1A3LL 1ERNA 3PWPA 4JLRB 1JZ2A 5FYKE 4OJAA 1CR9H 1DBKH 3VH8B 5I1IH 4Y5VB 1QX1A 2HLFC 1BZEA 2AJZB 4X4ME 4FQ1H 2CR0A 1V3JA 4MB1A 1E43A 4JNXA 3BEWA 4WGWB 2P28B 2B2XL 1JAEA 4ODBD 4KUZH 3RP1A 2CHDA 5F6IC 1ZK9A 1N7ML 3P1VA 1A4BA 4NAQA 1XGQB 3ECUA 3WEXB 2XXCB 4W9CC 1E9PB 4JO4H 3LIZA 3ELAT 4YDIL 4QXTA 2IADA 4Z3HA 3QNZA 5CGTA 3LIZL 2HJKA 1ADWA 4R0LB 4JM2F 3RVTD 1JNNL 2UX6A 3ATBA 1MQ8A 4QHUB 5ABDE 2EXWC 3B56A 2X4QB 5EMYA 4U6VH 3MZGB 5BO0D 5AOJA 3QRGH 3RDJA 3TP4A 5E6ZA 4LBAA 4TUKL 3EJZD 2OL3L 1F3DH 3H4FA 4UT6H 2Z8VC 1WPCA 3DMMD 5C2BH 3B2UC 3VVWA 4XWGH 2X89A 3TO4A 2PXYA 2XVKA 4LESA 1NJ9A 3Q2VA 5FYLD 3QDGB 1DQMH 3OXSA 1KJ3H 4APQC 1RZKH 1YECH 2W92A 4KI5C 5DZVA 4BH8B 5SWSB 1GGCH 1IIKA 3RGVD 1TJGL 3IDYB 4HKBB 3DKHA 4AQZA 5KSAC 2EYSA 1DJXA 1V3KA 4F1SA 4GY4A 5FCSH 2NTFB 2B5IC 3QQDB 1A65A 1HVXA 3S96A 2WLJA 3EYQC 2H3XC 3RTQD 2I9LB 1FLRL 4LOVA 1BDYA 1NFIB 2FGZA 1I75A 4JHAL 1CXFA 5HY9A 4D9QD 1DVXA 4XRCB 4M5YH 4CJ1A 2QMKA 3NJJA 3UGEA 3CH1A 1AS8A 1I4FB 4X99A 2O6FA 3I84A 3B7SA 3T0EA 1ZHNA 3DX8A 1CE1L 2V3FA 4U3HA 3MRCA 4FQQA 3AB0B 1SY6A 3OSKA 4K23L 4HWBH 5I9QB 4P4RA 4KHXL 1FVCB 3FYIB 4XCEA 4Q58C 3VFOB 1CJYA 3THMH 1GZQB 1XGRB 1Q1JH 4XPFL 4UT9H 4R6UA 1BA9A 3EDKA 4PJ9B 5B1JA 1S7TA 4ZS6C 5HDOA 3AMLA 1D2PA 2JLPA 4GSUA 4JFED 4L3ED 4ODSL 3VCLA 5C0FB 1MPAL 2OI9C 4XXDB 2YPLB 1MJUL 4IHOA 1DN0B 2IQ9H 2OKMA 2VDMH 1ZWIB 1G5AA 4XNXH 2VO5A 4BK5A 4B96A 3M1BB 2BO0A 4R5XA 3SE4C 5CAYB 3C5ZB 5IVXF 4PJAF 5DI8B 4AIXA 3GIVA 4YEFA 3IJYA 4HUVA 2KC0A 1WS8A 3NAAL 3SGEI 4RRPG 3UEQA 3MLXH 2XXMB 1S9XB 3NCBB 4RMUA 4X6FA 3RJOA 5L4JA 3ARFC 1M7IA 4D9RE 5J9PA 4NKDB 4EIUA 1U8NA 4BCZA 1G1YA 1DLFH 3QSKB 3EZJB 3EH5B 1LNUB 5TE7H 3UAJA 3K6IA 2BIOA 5E8DL 1CLZH 2R4RH 1MFBH 3O3EA 5JLZB 4PRDB 4PW4A 3QIUB 2O26U 2BHUA 5D1ZA 4RGOH 3H9SE 4N2HA 3F64A 4LNRA 2Q3XA 4QYAA 3I2CH 4AQ1B 2Y7LA 1A4AA 1IAOB 4ZSOA 2QFPA 1AHWB 3TV3H 2R4SH 4QOKD 2IGTA 4QY8B 4TOYH 5KYWA 1OTUC 2ZUSA 3L5XL 4KRPB 4OIFA 2P8PB 4Y4FC 4B9ZA 5E6ID 3CSBA 3BPLB 3NEXA 2VDNH 4PCKA 5F7EH 5IW1B 2FNBA 2VITB 1MZZA 3FAXA 5CLWA 3FQ4A 2XWZA 3IDJA 5LKNA 3EYFA 2QPDB 2ZOLA 2NYYC 1MIEH 5F88A 5A3IC 5SX4I 2VIRB 5DZNA 5IB4A 4NC1E 1HL5A 3QDJE 3QJOA 3HAEA 4FG6C 1G7JA 3TN0D 4HT1L 4LLVB 5HHVL 3SKOB 1QATA 3G7TA 2B1HH 3NIDF 1BVKA 2W0FA 2AJVH 2YA0A 1H0DB 2VLRD 3RPKA 3LQAH 1FJ1A 1OLZA 3L2LA 1MEXL 3WE6B 3DSNA 3VMNA 5IBTL 1FA4A 3HZYA 3BZEB 1H5BB 3KL5A 4C57C 5HSFA 1OV8A 1JRHI 4NNPH 3WTXA 3WNPA 1IKFH 3V0HA 2VXQA 4PV9A 3Q5OA 3WIIH 1OTTC 2VXQL 5IT2L 2VDRL 4LHUB 4HSCX 3U4AA 4ETYA 5D1XC 2MOVA 2MNUA 2EH7H 1A47A 1IBGH 4PCTA 4K7PH 5DQ9B 3IGUA 2E6QA 1OPGH 5BRQA 1K4CB 3WOVA 3FUEA 1BG1A 2KLTA 4IBTA 2R56H 4M8QB 3QIBC 3IS1X 4AZUA 5DUML 3WTWA 1HL9A 3I3BA 3ME0B 1A6VH 3N43F 2WWKO 2FH6A 4Q2ZB 4OVUA 4RGMB 1WAAE 2CHXA 3QI9D 3T2NL 4F15B 4Z3TA 3FOLB 3O0RH 2DTMH 1P4BL 4M6NL 5KAQF 3MX0B 3WBDA 2PW1A 1PD6A 2YD2A 5C6TL 4FXGC 2Y36L 1AO7A 2C9SA 2DQCH 2BOLA 3DJTA 1CUOA 2H9GA 4XCFH 3RWIA 1NUDA 1UD5A 4OTXH 3RPIB 1G9MC 4U1NA 2WUBL 1WAEA 3P0VL 3K2MC 1FE8L 3ZRCC 4PLJC 1DCLA 3BLKA 4IBZA 4AM0A 1HS6A 2DI8A 2YS4A 1WK0A 4NQED 3QE5A 3AUVA 1I1FB 3L3JB 5DMKA 2J8UA 1S3KL 3AG4B 3B9VA 4NENB 1IGFH 5DJAA 5I6LA 3U7AA 2WQWA 1Q94B 4XCCL 3VI3B 2DQEL 3B7TA 3IGFA 3KM2A 3CXDL 1G7HB 2GIXA 1N2RA 3WIFA 2DWEB 2QVMA 5ICZB 4GIOA 3LH8A 1M6OB 2EIBA 3VDAA 1BZQK 1DANU 2WD0A 2IAMB 1U3HB 1ONQA 3I74A 3NPZB 3PFUA 2ENPA 4J3OD 4B7IA 5DA4A 1KELH 5G5DB 5JHMA 3HPJB 2I60L 1MWAA 3QEHB 1UWGH 4YL9A 1A1OA 5C08A 2OYPA 2E4FA 2FO4A 2WUCH 3EH4B 3FQNA 3MJ7B 3D9AL 1MWAL 1TQSA 4AVJA 5JTWA 1FFPA 3FYEB 2WJ7A 4W6YB 1YAIA 4YPGB 2XKNB 1XZWA 5FPIA 4LLWA 3ZHKA 4WO4A 2FTAA 2VM4A 3STZB 3FN3A 5KS9F 4YGVA 5B22A 2D3LA 4FN0A 3KLAB 3NUKA 3VFPB 4L0YA 1U8JB 2EIKB 2GABA 3E7JA 4X2UA 4JKKA 4AV5A 1QUNA 4WFFD 5FC9A 3GWJA 1MI5E 4XNQB 2RD0A 2D9QB 3PHAA 2L04A 1QKZH 1I1YB 4RBPH 2G9KA 2HCZX 4O2EB 2Q3AA 3ABZA 3TX4A 3DC0A 3WTSA 2XQBL 1ZS8A 3R18A 3RWCA 3VE0A 3CLEL 4KUCD 4O2FB 5MEQA 4E9SA 4GLRH 1TTUA 2IG2H 1JWSB 2EC8A 1W0WA 1SJHB 2YD7A 3O3DA 3TL5A 1JFQH 1WO2A 4B95C 3BT0A 4EVNA 1K8IA 4I18C 1ASOA 3UFIA 4HKXB 1LGVA 1C9SA 4TKWA 5D7KE 5DD5H 2DIEA 4LEEA 1JVLA 5CN1A 2X3AA 1YN6B 4ANUA 4EN2A 3TJPA 2X41A 5IJVA 4QLRA 1WT5C 2K6WA 1JPGB 3RWGB 5AAWA 4DO4A 1QSEA 2BFVL 2C4XA 3L5IA 1BQ5A 1ZT1B 1FSKB 5GIRA 3FB8B 3S3PA 4WJKB 1QNIA 1R3IH 4L1LA 3FCBA 4HWEL 4L8SB 1Q38A 4W9HC 3AS2A 4G71B 3MRNB 3BYTA 2D03H 4G6KH 4G72B 1AIFA 3EO1B 4MA7H 4IGBC 4UF7C 2Y0SA 7PAZA 5MI0C 1E3ZA 1TVHA 3GZKA 4J3SA 9PCYA 2Q6WA 4L8CA 1IUZA 3U0TB 4QHMA 4CDGC 5CLYA 2K70A 4JKNA 1BAFH 4G8GA 3T4AA 2R27A 2QPSA 1F56A 1NMBH 1KCVL 2MCPL 3U2JA 2RQEA 3QDAA 4UDTA 2IXQA 1ZHLA 2BIHA 3JSSA 3BVDB 3MUUA 3D39E 3QUYA 5T1DL 2BVOA 3HVNA 3NFNA 4R7NB 3KPPB 1CFMA 1A4JB 2EDQA 2YGPA 4I3RH 4MNGA 1WTLA 4DZ8A 5I1GH 1BREA 4ZODA 2YD1A 3SYQA 4LCUA 1YNTA 1K72A 2A74B 1T5WB 1XGPA 1AD0B 3ZGIA 4AVKA 1NCAL 1CF8H 2NXZB 1JPSL 2VR4A 4JPKH 4FL4C 4LLQB 4LVOB 2VLJE 5DEGA 3R1GL 4Y2DA 4ADJA 2HTLC 4H0GA 5T1MA 3QWRD 5D1QB 4UT7L 1AGCA 2KZ1B 3B6SB 3RY6A 2W07B 3O4OB 4ICXA 1TR7A 1TTCA 3CLFL 4AE0A 2OLDA 2VDKL 3L1EA 3L16A 4IRZL 4ELMA 1CK0L 4LDLB 5HPMA 3B37A 3PGFL 4PN6A 2WJ5A 3LH2L 1FC2D 4UILL 4M1CD 5EU6A 3ZZ1A 5AVTB 1ZVSB 1I1AD 2VLKB 4BHUI 4ZFOA 1CFVH 5F1SA 1Y0LA 2EXYD 4KHTL 4AH2B 1B4JL 4X98B 4ZFOL 2DV6A 4GW5A 4N8VB 4R4ND 1N6UA 5FYJE 3MNDA 5MEPA 1U92A 2HX8A 2YQBA 5AG8A 2GJZA 3ZDZF 5IMLA 2D0HA 2V5RA 4KKPA 1N64H 4PTTB 5HHPB 3MJ9H 4FQ2H 3QORD 5D93B 5FS5A 2X6VA 3TCXA 3LMJL 4JPSA 3MLUH 4GUOA 1B6DA 1YMMA 3ISYA 1A7QL 1MH5A 1YEJH 5L0QB 4JQIH 3FRUA 1KEML 3E3QE 1NL0L 3SKJL 3PWPD 2QLYA 4RAHA 3LS5L 1WZ1L 2ITFA 1SNRA 3ILQD 1N0XH 2CO4A 3C2AH 3NGBC 4ICWA 4NUGH 5DJXA 1GZHC 3CQPA 5EWIH 2OMTA 4OGYH 5LAXB 1OE3A 2XI9A 2N7AA 4H20L 4JFPA 3KWWB 3OZLA 4OCWL 4MLSA 5C0IB 2Q2LA 3IU4H 3SE3C 1EAPA 4G8AC 4M4RB 1XR8A 1AP2A 5J6HA 1EXUA 2I7OA 1UYWH 1PF3A 4G8IA 5JDJA 2CLVB 4GG6A 1IZKA 2J21A 4U1KA 4BD4A 3JVGC 1LXMA 3PGDA 1F4HA 1U8HB 4PJGA 5JORA 1NPNA 3VFWB 2ICES 3H54A 1U0QA 1S6NA 3ZUCA 2WIIA 1JHKL 2P5PA 4XPAL 5J12C 1L0QA 3CH8A 3CU7A 3GBML 3EF7A 3FFCB 2JI2A 5DZPA 4X4KA 2QSCH 3VGGA 4PJ5E 2E59A 4PGCA 4ELKA 4GAJH 1C5CL 1WD8A 3NSFA 3GJFA 4BXVA 3GS4A 4K3HA 2NY6B 4PLKD 4XN9A 2SEBA 4PJDF 4D8PB 4DKTA 3FOMA 5K1VA 2X89D 2YHGA 1BM7A 1NBZB 1UT2A 4GMTL 5JA8B 1VFMA 2BNRB 3L54A 1S78C 5SWZA 1TITA 4B9CA 2BY1A 3FSOA 5EO1A 4K0OA 3LQZB 3QXDA 1SN0A 2QKIB 5GGSY 2VMCA 5KTEH 3A6BH 1MVFA 1QFUH 3V4LA 3W2DL 2PPFA 4NO3B 3QS3A 5IHZB 1X5JA 4IMKA 5D5MF 2BINA 5IQ7H 5EO0A 4CVZA 3QIWA 4MQSB 5HGBA 3T8MA 1G1CA 4U6YA 1E7UA 1GYAA 4OZHB 3G5WA 1RJYB 2Y06H 4JRXE 3VFGL 3EJJX 4Y5VC 4E9TA 2HKAA 2NX5B 3M17A 4JQXC 4HLEA 1JVKA 1ZLVH 3H9HB 3GMLA 3V52H 3KYOA 4MWFA 2DBLL 2DMCA 1O6VA 2G5BA 5KJRL 2E7LA 4PR5B 3SJVA 3T0ED 5BQ7A 1I3GH 1R24B 1IFGA 2ICWI 5TDPA 4HS6A 2F2HA 3O2WH 5E51A 4CSSA 4DP9X 1RPUA 4OFVA 3FUHA 3IS0X 4I0PA 1WFNA 1F11B 4UQ3B 1FL3A 1FYTA 3B3BA 4R0LC 3FT9A 1OAKH 4NO2A 4P2QA 4M5ZH 4A7GF 3GSVB 5EA0H 3OKDB 1AKJD 3WN5B 4ZNCD 1RV6X 2AJYH 3AM8A 1DQVA 5AZ2H 3CFEA 3OSVA 3CFKB 4LASH 3U36B 4R3SB 5F7AA 2F8XC 4PJ7F 1PSKL 5LVEA 4P5TA 4ALAC 2HG5B 4ONGH 5E1GA 3FC8A 4MXWH 2PYED 1N59A 2FUQA 3VFRB 4H1LH 2K6ZA 4N5EC 4N6RB 4PJBE 3U6RA 4RX4A 5JXED 1MCBA 2IH9A 1O6TA 3WY1A 1W8NA 1PG7W 5CCGE 4YDVB 5DJ6A 2ALAA 4P2OC 5FUCC 1T21B 1OP5K 4M7LL 2P8LB 1Q72H 1GY1A 1X9QA 1NBQA 1I7ZA 4JM2B 3W82A 1JVOA 1BMWA 4AL8H 3IGAA 4LSUL 3DO7B 3WIAA 2GEEA 3CDZA 6CGTA 1O5DT 2AXGB 4JKWA 3VD1A 2R2BA 3F12A 5AEAA 3UMNA 3ZQXA 2OCJA 3EGDA 5D1ZD 3OB0H 2D73A 2XZCL 3WKYA 2WQSA 3V6ZA 5DUPL 3KXFE 4K4KA 1NAKH 2H3NB 1CFNA 2IWKA 4IEFB 5ID1B 2R15A 4KJWD 3WFDL 2FSDA 4Z7VF 1T3FB 1ZANL 3MLYH 3EGXB 4RZCA 3P9MA 3VNYA 4A2EA 2EYTB 1B9KA 1RURH 3DV6A 1ZT4A 2WKGA 5B39B 3US1A 3D69A 5I9QC 1C16A 1LHZA 5AQ0A 3M07A 3HNSL 1B0WA 1VGEH 2WZ0A 3AG2B 3BP5B 4L9LB 5A43C 1NCHA 3BHBA 4PBXA 1S8DA 3HW7A 4X4ZA 1BD2E 3BT2L 4A37A 2R7EA 2GIMA 2CBMA 2NZ9D 2V2TB 1SMAA 2KBGA 1RZFL 3EOYG 2X4PA 4H88L 5G4MA 3ARYA 5KG9B 2OMUB 2QQLH 3LEVH 5F8QC 1YYMH 4QXGL 1IM9A 1CTNA 4PW3A 5AKTA 3ULVH 1JPEA 3QFGA 2A9DA 4HH9B 1HWHB 2X10A 3FW6A 4PCSA 4QRBA 2PW2B 2J1XA 2LU3A 3C5ZC 3NP3A 5TH2B 2JWYA 1Q0XL 4KWUA 4X6CE 2NW2A 4NWUL 5I1DA 2XETA 3MOAH 5IK3A 4JN1L 1MJ7H 3R4RA 1RUQL 5B8CB 3ZJAA 3GMQA 1QA9A 3IKCA 4X8JA 3ZQWA 3P30H 4U1SA 1IGCL 3JWNC 5JW3L 4HK0B 5IKCA 3WD5L 2JELL 2E0PA 1BYPA 3MO1A 4ZMLA 4X7TB 3C12A 4YQXH 3CSYB 4FFZL 2E8ZA 5D2NB 1A02N 4CVXB 4AQ1C 1GA2A 5T3XD 4EZMA 5CLZA 2BS8A 2HFGH 1AHWC 1T4KA 3WIHH 1IVTA 3HC4H 4XVTH 5IVXB 4PJAB 3GK8H 4N90E 3D0VA 4MJHA 4OZFB 4WQOA 2F5AH 5E5RB 4ZMAT 2D8KA 4YNYB 3GDBA 3IF1B 2EDTA 4HJJH 2CRYA 3S4SB 5DWPA 4JFFE 5IB2A 1DDHA 2X1WL 1H3UA 2ZP8A 3WFBL 2KDYA 4WGVB 3AITA 4BDVB 1AO7D 4YGAB 1H6UA 3Q6GL 5FOJA 3CU1A 5BJTB 3KGSA 4QHLB 1XH1A 1A3QA 3X3GL 1E9OA 3ZL4L 1J9CT 5TFSL 2DJUA 1IM3B 4KY1L 3LKNA 4MB5A 3LS4L 5FM4A 3TWCH 4DKDC 3SGDH 2VJ0A 4PY8I 4L4TB 3VWJA 1X5HA 2EDWA 3SGKA 3QNYA 3EJQA 4HJGB 4DKAA 4X4XB 1IGML 2ATKA 5I8KH 3PJNA 1UEYA 4BM7A 1KIUA 4AI7A 4YDZA 2BMKB 3TCLB 1FNGB 4YX2L 1HXYB 2R0ZH 1D6EA 1LP9A 1H5BC 3MXVH 3UTTE 5MP6L 4XPTL 2NXYD 5C0JA 3S5LA 4ONFL 2FHFA 3MV7A 2ZKMX 5BV7B 1INEH 4WK2B 2EVIA 2W9EL 4J8RA 4XPBL 3BQUB 2WCSA 3CBJB 2RQ8A 4G43A 5ENWA 5BXFA 3GKZA 2MCG1 2W95A 4IMLB 3FUDA 3BSZH 1HXMA 1DQLL 5ERWB 2EE2A 5J7CC 4OJYA 5DJZA 5CFHA 5D1XE 4L37A 5C08D 5JR1H 3TXAA 3KPRD 2YRPA 3NIDB 4P4KA 4XAWH 3SQBB 2AEOA 3T1FB 1E6OH 3ARQA 3EAKA 3VD9A 3FZUC 1LTXA 1I7RB 1N3NB 5EZJA 4WO4D 4PB9H 4JAMB 4F15C 3RA7H 1KPVA 4DEWA 3JT0A 1KFAL 5CGYC 5LLIC 3V5KA 2CJSA 4QJ4B 4Y89A 2WKOA 1F1AA 3NCJH 4JY6B 1W72A 3ULUD 3PHOB 1NGYA 5E4OA 3JTTA 1RZGA 5ESAB 4POZC 2ICWB 1NBCA 2VSCA 3ZZSA 3N1QC 3ZDYF 2WWOA 1DQJA 3OG4B 2YFNA 2JJSC 3L95A 1GIGL 3LKOB 3FCUB 2QVFB 4ZRGA 2P3YA 1XGTA 4KKAD 1Q90A 1HYSD 2ZKYA 1HL4A 2AANA 5EC2B 3NABH 2BDNL 1OAYH 3PL6C 3CQFA 1JNLL 2ADFH 3HMXH 4WI8A 2GPZA 3DMMB 3N43B 3WHXB 1YEKH 2NTSP 1CVRA 4GB9A 1TTFA 1DR9A 4FQCH 1BMZA 1CIUA 1T2JA 1OSZA 4N6QA 4NQCA 2WZ6A 3DVGA 3OMAB 1BWWA 1RULL 1UH2A 5INCA 3RGVB 4YN3A 1A6TA 1QSED 2QKSA 5C0BE 1FFOA 1CQKA 1GW6A 3IRZA 3K6SB 2JCWA 4N22A 2BSRA 4M7KH 4NYLA 4PJFA 1HWGB 4JPVH 2BPBA 1NC2D 1FGVH 4XN8A 4XI5C 1ORQA 2APWA 1U3HC 2IAMC 5EN2A 4PI2A 2FB4H 3KNBB 4PUBL 5ESQB 4RIRA 1NDGB 2H2SC 2OMWB 1QI3A 1KCLA 1RVFL 2X70B 4O58H 5CMAA 5DQJB 5F7FA 3RTQB 1BBDH 4KROB 4Z0XB 3IGLA 4RMVA 2DJMA 1LO4H 4OLUH 1HHHB 1MF2L 2G3NA 3X14B 3HI5L 3A4AA 3ZT7A 4LRNH 3MV8E 4OW6A 5E8OA 4MJ6A 2BOCA 2D7OA 2WYZA 4WNQA 1KXTA 2JQAA 3QUYD 1SJMA 1EFXB 3UBHA 3H7LA 4CA4A 1E3FA 3SPGA 3AGVA 5JHAA 4JK0D 2VJ8A 2ZUQB 3OKOB 5FYKH 5F89A 4LDOB 3ATDA 4PHXA 1OIOA 4JFOA 4KNTA 1HCVA 3RVVD 1DJZA 3UCRA 6PAZA 4JFWA 3HZKA 5MENE 2I9TA 1B88A 1QWUA 2XFGB 1T2QL 2ITCA 4NCDA 2FD6L 5JW5B 1MUJA 3RWJA 4N1HB 3AXLB 1MCDA 3BKYH 1WF5A 3BP6A 3A6CH 4K7PX 2P49B 4HYTB 4MAZA 1FN4A 1BFOA 3P3TA 1OOAA 1NOAA 4L3EB 1U30A 2G4EA 2AV7A 3LPFA 4QRUB 1YEFL 3EOTH 3KYNA 4CC4C 5L8KB 5JYLA 2VMEA 2F74A 4NZTL 3D85A 3BKJL 3HUJB 4PGEB 1AJ7H 1PZ5B 2F6AA 1NEZA 4K3JL 1AFVH 5GZOA 5KS9B 4WENB 4GBXA 1DBJH 4HMDA 2DMBA 4M03A 4O51B 3VGHA 5CINL 3TBVA 3RVWC 1PD0A 3LZPA 1NM9A 1FSKC 2A73B 1NH6A 4JY5L 3CIQA 1EAQA 3MRKB 5DYOA 3UZVB 1MCOH 5D7HA 3ESOA 3X1NA 5KJ4A 1QO3A 3VXSE 4L8SC 4GNKB 3CXHJ 3HHSB 4ZFGH 1Z5YD 2V5TA 4K3EH 3VACA 5IGXH 1SXBA 1ZD6A 4MMXB 4ANWA 2HRHA 2ATPB 5DEFB 3RU8L 2EVHA 4U2ZA 3TYGL 3DO4A 5FA4A 4AENA 4S11A 1BIIA 1YMMD 5LGJB 2OMXA 1KJMB 2J8UF 3FB5A 3KH3A 4QOKB 2BSEA 3U6XS 3RI5F 4EI6A 4Z7WF 3ZYOA 1FNEB 1UWXH 4NJ9H 5E6IB 4G6JL 4KDTA 1PG7H 2ZX7A 5LQBL 3MRPB 1RUAL 4M56A 1I8LC 1OHQA 3ZTNH 1KLGB 4DN4L 4FNLH 1SGKA 4R2GD 4PW9A 2A74C 2YEVB 3DVNA 2CO2A 3S98A 5CEXB 2AZAA 4JFXB 4JL1A 2NXZC 3OR7B 5E2UH 3BSGA 5CHNB 5T3ZH 4M61A 2V5SA 4XOBA 4LAQH 4LVOC 5BMFH 1PDKB 1UXLA 2PCPA 4H5SB 4PLOB 1QSFE 1GC1L 3V9EA 4KJPD 5MHSE 3TN0B 3POCA 5DLLA 5LNDA 1D5IH 5EU4A 2X88A 5D1QC 5HHOE 3ULSA 4FMFA 1HHJA 2IBBA 3O4OC 3BFOA 3GSOB 2ZKHH 4QRTB 1CLYL 4KVCL 3VFVB 3WTUA 4M43L 3ABGA 4H26A 4Z7OE 3TEYA 4D9LH 4JQVA 1QOKA 2CIKB 4U4BA 4AQOA 2YO3A 2WXJA 3FT1A 4WY7H 4ZXBA 4NUPA 3LB6D 2CDGB 2AQPA 2X2IA 3UG3A 2JJTA 3MRDB 4RDQF 1J9SA 3BVTA 1OF0A 2IV9A 2EDKA 3SDDD 4ZQTA 3P9LB 3VXMD 1OWWA 1IARB 2FZ3A 3L3DA 2X9XA 4P2RD 5A2LH 1MIML 3G08A 3MCLL 2MQ0A 4KXZH 3B5HA 5FUZL 5D93C 4JRWA 2AEPH 4GO6B 5AB0A 4PRHE 3DPBA 2QPFA 4E42B 5MEOB 5L0QC 3PUUA 1JHLH 2BIMA 3V7AE 3QI9B 5CWSA 2RMNA 2LU7A 1FO0H 3EFOA 2CIIB 2JKSA 4X80L 2VE6A 2XZZA 1PCSA 2WQVA 1MREL 2E9WA 4KOBA 2GSGA 5IV2A 2DYPA 3SJVD 1YNKH 1CDGA 3B5TA 4QNPE 3GI8H 3ZDZB 3QJHB 5D72L 3K2UL 1C8PA 1U8PB 3AAZB 2HX7A 2L7UA 4FABH 2X2JA 2ICEA 5DFTA 1P7KA 5CEZD 3CDFA 3MRJB 4HXBL 5CJOH 3WLWC 4N0CD 5H37H 1MVYA 2VDPB 3ECBA 5TPWL 5F97E 1FYTD 3SB3A 3PWUA 2CHZA 5CKGA 2ZWKA 4P2QD 3DK2A 4YS4A 1L9NA 4NQVA 3FT4B 3IDXH 3MRIA 4XOAA 3U48A 3BKCH 5B1BB 2XHNA 5HDBF 5DFVC 3S5ZA 3SZ6A 2YD5A 1OCRB 1KCKA 5F7HA 2W0KA 1QFWM 2CG9X 5DD1H 3M7FB 5EU3B 1MW0A 4JJ5A 1S7QB 5J57B 4O2CB 1DBMH 2Q3ZA 4QWWD 1YNTF 4MTMA 2XQYG 4P5TD 5BVPH 1A9EB 5HYSB 3LEXA 3SDAD 3BN3B 3QQ3B 1NCUA 1WCQA 2XSKA 1NCCL 5BW7C 1AACA 2AK4E 3F65A 3OAZH 4RX4D 2GBAA 3GTVA 4QRRE 3QDMB 5DS2A 1R1CA 3TGXA 1R9FA 2QKIC 3GSRA 4MNQA 1J0YA 1WCBB 2XQYA 4C4KO 4XGZB 4HGMA 3GLDA 3V0VB 4UAOB 4FTVD 3RX8A 4ELMF 5IWLA 4G7SB 1XDTT 4KK9C 1OM3H 1T0OA 1D5ZA 4OCYH 2HVJA 4KNSA 1GVIA 1R3JB 4JHVA 5KBDA 2O61A 2XPGB 5TDOB 5GGRB 4W9JC 4AKQA 5JZ7D 1MCJA 3BUBA 1D5BA 1RZJC 2EZ0C 4IU2B 3Q6FB 3QDHA 4UU9B 4OJFL 1GOGA 1R5VA 4N86A 3G5ZB 3S37H 4XMWA 3CFDB 2YAEA 5IOPB 2CDFB 5I1AB 5J11B 3W39B 4N0RA 1N26A 3U7WL 5BZXA 3R0MA 5ITBH 4NZ8A 2CPCA 2R1WB 5B7EA 4RFEA 5D5MB 3L5WA 1YEHH 2O30A 1ADQH 4FNTA 5C7XH 1N10A 2BS9A 2I26N 1MHHA 2DMKA 5KVMC 5AVYB 3REWA 1XZ0A 4YH6A 3VRIA 3BVWA 4XC1H 1IM9D 4GYBA 5E00B 1EGJL 4R83A