2ZL0A

Crystal structure of h.pylori clpp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
173
Chain Sequence
DIYSRLLKDRIVLLSGEINDSVASSIVAQLLFLEAEDPEKDIGLYINSPGGVITSGLSIYDTMNFIRPDVSTICIGQAASMGAFLLSCGAKGKRFSLPHSRIMIHQPLGGAQGQASDIEIISNEILRLKGLMNSILAQNSGQSLEQIAKDTDRDFYMSAKEAKEYGLIDKVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the activation and peptide recognition of bacterial ClpP
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 59
structure length 173
sequence length 173
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2zl0A00
4HNKA 5DTPA 2A81A 1UYTA 3MT6A 1YG8A 4K29A 2WTBA 1MJ3A 3RRVA 1K32A 4ELSA 4NEKA 1N6DA 2VSUC 2ZQQA 3STAA 3L3SA 4FZWA 3K8XA 4FZWC 3BF0A 3ST9A 2FW2A 5G1RA 4GHNA 4FN8A 2F9IB 3H0UA 3NJBA 3TT7A 3H0JA 4Q1IA 3IBBA 2BZRA 3PE8A 4FNDA 4JOTA 4B3HA 5INIA 4MOUA 2A7KA 2J5SA 4JYLA 5DKPA 1J7XA 2VSUE 1JXZA 4I4ZA 5FIFA 4FNBA 3KTGA 4WCZA 3ZW9A 3Q1TA 5KDRA 4ZDEA 4IZBA 5FUSA 3JU1A 3T3WA 3TDCA 4FB8A 5DU4A 1VRGA 3OMEA 3TZ3A 5INFA 3FF6A 4ZU2A 2GTRA 4U18A 3GKBA 5DZKH 3VIVA 5CTCA 3TVUA 3R9TA 1XNYA 4FN7A 1UYSA 1Y7OA 3MOYA 4I52A 4B3JA 3IB9A 1N6EA 3GLMA 1EY3A 3HINA 4YLHA 4GM2A 4JVTA 1XNVA 2X58A 1OD2A 1N6FA 1PJHA 1Q52A 4IZDA 1PIXA 2J5IA 3RSIA 4RYFA 3GMAA 3T8AA 3SWXA 2D3TA 1HNUA 4U0GA 4RCNA 4HC8A 1HZDA 5DU6A 3K50A 3V5EA 3ZWAA 5INGA 2ZQRA 4RYFH 5DUFA 5CTBA 3QYRA 4Z0MA 3I47A 1HNOA 4KWBA 2FBMA 3KQFA 2F9YB 1TYFA 1NZYA 2CE3A 1OD4A 3DORA 4JCSA 2Q2XA 4K2NA 2PG8A 3TT6A 4NNQA 5E0SA 2ZL0A 3DJAA 3P85A 4JCTA 3ZWCA 2PBPA 1K39A 1RJNA 1FC7A 1WDMA 4EMLA 4JJTA 3H0QA 1XX4A 4LK5A 4EMMA 3SLLA 2VSSE 4KPKA 3LKEA 2DEOA 3R6HA 1WDKA 5G1QA 4WZ8B 1SG4A 3MYBA 4DI1A 4U0HA 2ZL2A 3HRXA 3TRRA 3QWDA 4WYOB 2J5GD 2J5GA 1W2XA 3RSTA 5E0SH 2X24A 3BEZA 3WG5A 4JSBA 3ZW8A 3R9QA 3H0SA 4U1AA 4ZDDA 3OC7A 1X0UA 3M6MA 2ZL4A 4MI2A 1YG6A 4B3IA 3IAVA 5DL1A 3OT6A 1DUBA 2J5IB 5IKLB 4ELXA 4U19A 1UIYA 4OG1A 3QXZA 1Q51A 5C90A 2C8TA 5MGBA 1UYRA 3P2LA 4L6WA 3KTJA 3HE2A 3PEAA 4JCQA 3U9TB 2PPYA 1ON9A 1RJMA 2F9IA 3T89A 3H81A 3PGQA 3KTHA 4JFCA 4JWVA 3MFMA 2W3PA 4OMRA 5DUCA 1ON3A 2A7SA 2F9YA 3Q7HA 4ASIA 1NZYB 2Q35A 3HLN1 3P5MA 5DZKA 2VSSA 4Q0GA 5G1SA 2F6QA 3R9SA 5KDRB 2ZL3A 2IEXA 3TV5A 2VSSF 3M6NA 1WDLA 2J5II 1FC6A 3Q0GA 2VSUA 4ZDFA 2NP9A 4K3WA 1XO6A 1EF8A 1FC9A 3BPPA 3H02A 4QIIA 3FDUA 5JBXA 3LAOA 3QMJA 4OLQA 3QK8A 3U9RB 3KTKA 4ELWA 4JCRA 2VX2A 2F6IA 5DU8A 1EF9A 3TLFA 4ZDBA 4KNPA 3QXIA 4F47A 2CBYA 5KJPA 4EMPA 5C9GA 5E0NX 3ZWBA 5DTWA 3ISAA 3Q0JA 3QKAA 4I42A 3T8BA 4L8KA 4IZCA 3TVWA 3PZKA 4G2RA 5JBWA 3GF3A 1SZOA 3NJDA 1UYVA 1FCFA 3G64A 1DCIA 2FZSA 2UZFA 4MXIA 3T88A 4KD6A 3V5IA 3R0OA 3HP0A 2QQ3A 2VSUF 3U9SB 4QIJA 4FJWD 2DUBA 2VREA 4QFEA 2HW5A 1WZ8A 3KTIA 1XNWA 1O8UA 2EJ5A 4ZDCA 3GF7A 4U0GH 2Q34A 1TG6A 4JYJA 3N6RB 3QREA
chains in the Genus database with same CATH superfamily
4HNKA 5DTPA 2A81A 1UYTA 3MT6A 1YG8A 4K29A 2WTBA 1MJ3A 3RRVA 1K32A 4ELSA 4NEKA 1N6DA 2VSUC 2ZQQA 3STAA 3L3SA 4FZWA 3K8XA 4FZWC 3BF0A 3ST9A 2FW2A 5G1RA 4GHNA 4FN8A 2F9IB 3H0UA 3NJBA 3TT7A 3H0JA 4Q1IA 3IBBA 2BZRA 3PE8A 4FNDA 4JOTA 4B3HA 5INIA 4MOUA 2A7KA 2J5SA 4JYLA 5DKPA 1J7XA 2VSUE 1JXZA 4I4ZA 5FIFA 4FNBA 3KTGA 4WCZA 3ZW9A 3Q1TA 5KDRA 4ZDEA 4IZBA 5FUSA 3JU1A 3T3WA 3TDCA 4FB8A 5DU4A 1VRGA 3OMEA 3BPTA 3TZ3A 5INFA 3FF6A 4ZU2A 2GTRA 4U18A 3GKBA 5DZKH 3VIVA 5CTCA 3TVUA 3R9TA 1XNYA 4FN7A 1UYSA 1Y7OA 3MOYA 4I52A 4B3JA 3IB9A 1N6EA 3GLMA 1EY3A 3HINA 4YLHA 4GM2A 4JVTA 1XNVA 2X58A 1OD2A 1N6FA 1PJHA 1Q52A 4IZDA 1PIXA 3RSIA 2J5IA 4RYFA 3GMAA 3T8AA 3SWXA 2D3TA 1HNUA 4U0GA 4RCNA 4HC8A 1HZDA 5DU6A 3K50A 3V5EA 3ZWAA 5INGA 2ZQRA 4RYFH 5DUFA 5CTBA 3QYRA 4Z0MA 3I47A 1HNOA 4KWBA 2FBMA 3KQFA 2F9YB 1TYFA 1NZYA 2CE3A 1OD4A 3DORA 4JCSA 2Q2XA 4K2NA 2PG8A 3TT6A 4NNQA 5E0SA 2ZL0A 3DJAA 3P85A 4JCTA 3ZWCA 2PBPA 1K39A 1RJNA 1FC7A 1WDMA 4EMLA 4JJTA 3H0QA 1XX4A 4LK5A 4EMMA 3SLLA 4NARA 2VSSE 4KPKA 3LKEA 2DEOA 3R6HA 1WDKA 5G1QA 4WZ8B 1SG4A 3MYBA 4DI1A 4U0HA 2ZL2A 3HRXA 5HUQA 3TRRA 3QWDA 4WYOB 2J5GD 2J5GA 1W2XA 3RSTA 5E0SH 2X24A 3BEZA 3WG5A 4JSBA 3ZW8A 3R9QA 3H0SA 4U1AA 4ZDDA 3OC7A 4J2UA 1X0UA 3M6MA 2ZL4A 4MI2A 1YG6A 4B3IA 3IAVA 5DL1A 3OT6A 1DUBA 2J5IB 5IKLB 4ELXA 4U19A 1UIYA 4OG1A 3QXZA 1Q51A 5C90A 2C8TA 5MGBA 1UYRA 3P2LA 4L6WA 3KTJA 3HE2A 3PEAA 4JCQA 3U9TB 2PPYA 1ON9A 1RJMA 2F9IA 3T89A 3H81A 3PGQA 3KTHA 4JFCA 4JWVA 3MFMA 2W3PA 4OMRA 5DUCA 1ON3A 2A7SA 2F9YA 3Q7HA 4ASIA 1NZYB 2Q35A 3HLN1 3P5MA 5DZKA 2VSSA 4Q0GA 5G1SA 2F6QA 3R9SA 5KDRB 2ZL3A 2IEXA 3TV5A 2VSSF 3M6NA 1WDLA 2J5II 1FC6A 3Q0GA 2VSUA 4ZDFA 2NP9A 4K3WA 1XO6A 1EF8A 1FC9A 3BPPA 3H02A 4QIIA 3FDUA 5JBXA 2YJGA 3LAOA 3QMJA 4OLQA 3QK8A 3U9RB 3KTKA 4ELWA 4JCRA 2VX2A 2F6IA 5DU8A 1EF9A 3TLFA 4ZDBA 4KNPA 3QXIA 4HDTA 4F47A 2CBYA 5KJPA 4EMPA 5C9GA 5E0NX 3ZWBA 5DTWA 3ISAA 3Q0JA 3QKAA 4I42A 3T8BA 4L8KA 4IZCA 3TVWA 3PZKA 4G2RA 5JBWA 3GF3A 1SZOA 3NJDA 1UYVA 1FCFA 3G64A 1DCIA 2FZSA 2UZFA 4MXIA 3T88A 4KD6A 3V5IA 3R0OA 3HP0A 2QQ3A 2VSUF 3U9SB 4QIJA 4FJWD 2DUBA 2VREA 4QFEA 2HW5A 1WZ8A 3KTIA 1XNWA 1O8UA 2EJ5A 4ZDCA 3GF7A 4U0GH 2Q34A 1TG6A 4JYJA 3N6RB 3QREA
chains in the Genus database with same CATH topology
4HNKA 5DTPA 2A81A 1UYTA 3MT6A 1YG8A 4K29A 2WTBA 1MJ3A 3RRVA 1K32A 4ELSA 4NEKA 1N6DA 2VSUC 2ZQQA 3STAA 3L3SA 4FZWA 3K8XA 4FZWC 3BF0A 3ST9A 2FW2A 5G1RA 4GHNA 4FN8A 2F9IB 3H0UA 3NJBA 3TT7A 3H0JA 4Q1IA 3IBBA 2BZRA 3PE8A 4FNDA 4JOTA 4B3HA 5INIA 4MOUA 2A7KA 2J5SA 4JYLA 5DKPA 1J7XA 2VSUE 1JXZA 4I4ZA 5FIFA 4FNBA 3KTGA 4WCZA 3ZW9A 3Q1TA 5KDRA 4ZDEA 4IZBA 5FUSA 3JU1A 3T3WA 3TDCA 4FB8A 5DU4A 1VRGA 3OMEA 3BPTA 3TZ3A 5INFA 3FF6A 4ZU2A 2GTRA 4U18A 3GKBA 5DZKH 3VIVA 5CTCA 3TVUA 3R9TA 1XNYA 4FN7A 1UYSA 1Y7OA 3MOYA 4I52A 4B3JA 3IB9A 1N6EA 3GLMA 1EY3A 3HINA 4YLHA 4GM2A 4JVTA 1XNVA 2X58A 1OD2A 1N6FA 1PJHA 1Q52A 4IZDA 1PIXA 3RSIA 2J5IA 4RYFA 3GMAA 3T8AA 3SWXA 2D3TA 1HNUA 4U0GA 4RCNA 4HC8A 1HZDA 5DU6A 3K50A 3V5EA 3ZWAA 5INGA 2ZQRA 4RYFH 5DUFA 5CTBA 3QYRA 4Z0MA 3I47A 1HNOA 4KWBA 2FBMA 3KQFA 2F9YB 1TYFA 1NZYA 2CE3A 1OD4A 3DORA 4JCSA 2Q2XA 4K2NA 2PG8A 3TT6A 4NNQA 5E0SA 2ZL0A 3DJAA 3P85A 4JCTA 3ZWCA 2PBPA 1K39A 1RJNA 1FC7A 1WDMA 4EMLA 4JJTA 3H0QA 1XX4A 4LK5A 4EMMA 3SLLA 4NARA 2VSSE 4KPKA 3LKEA 2DEOA 3R6HA 1WDKA 5G1QA 4WZ8B 1SG4A 3MYBA 4DI1A 4U0HA 2ZL2A 3HRXA 5HUQA 3TRRA 3QWDA 4WYOB 2J5GD 2J5GA 1W2XA 3RSTA 5E0SH 2X24A 3BEZA 3WG5A 4JSBA 3ZW8A 3R9QA 3H0SA 4U1AA 4ZDDA 3OC7A 4J2UA 1X0UA 3M6MA 2ZL4A 4MI2A 1YG6A 4B3IA 3IAVA 5DL1A 3OT6A 1DUBA 2J5IB 5IKLB 4ELXA 4U19A 1UIYA 4OG1A 3QXZA 1Q51A 5C90A 2C8TA 5MGBA 1UYRA 3P2LA 4L6WA 3KTJA 3HE2A 3PEAA 4JCQA 3U9TB 2PPYA 1ON9A 1RJMA 2F9IA 3T89A 3H81A 3PGQA 3KTHA 4JFCA 4JWVA 3MFMA 2W3PA 4OMRA 5DUCA 1ON3A 2A7SA 2F9YA 3Q7HA 4ASIA 1NZYB 2Q35A 3HLN1 3P5MA 5DZKA 2VSSA 4Q0GA 5G1SA 2F6QA 3R9SA 5KDRB 2ZL3A 2IEXA 3TV5A 2VSSF 3M6NA 1WDLA 2J5II 1FC6A 3Q0GA 2VSUA 4ZDFA 2NP9A 4K3WA 1XO6A 1EF8A 1FC9A 3BPPA 3H02A 4QIIA 3FDUA 5JBXA 2YJGA 3LAOA 3QMJA 4OLQA 3QK8A 3U9RB 3KTKA 4ELWA 4JCRA 2VX2A 2F6IA 5DU8A 1EF9A 3TLFA 4ZDBA 4KNPA 3QXIA 4HDTA 4F47A 2CBYA 5KJPA 4EMPA 5C9GA 5E0NX 3ZWBA 5DTWA 3ISAA 3Q0JA 3QKAA 4I42A 3T8BA 4L8KA 4IZCA 3TVWA 3PZKA 4G2RA 5JBWA 3GF3A 1SZOA 3NJDA 1UYVA 1FCFA 3G64A 1DCIA 2FZSA 2UZFA 4MXIA 3T88A 4KD6A 3V5IA 3R0OA 3HP0A 2QQ3A 2VSUF 3U9SB 4QIJA 4FJWD 2DUBA 2VREA 4QFEA 2HW5A 1WZ8A 3KTIA 1XNWA 1O8UA 2EJ5A 4ZDCA 3GF7A 4U0GH 2Q34A 1TG6A 4JYJA 3N6RB 3QREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNK A;  5DTP A;  2A81 A;  1UYT A;  3MT6 A;  1YG8 A;  4K29 A;  2WTB A;  1MJ3 A;  3RRV A;  1K32 A;  4ELS A;  4NEK A;  1N6D A;  2VSU C;  2ZQQ A;  3STA A;  3L3S A;  4FZW A;  3K8X A;  4FZW C;  3BF0 A;  3ST9 A;  2FW2 A;  5G1R A;  4GHN A;  4FN8 A;  2F9I B;  3H0U A;  3NJB A;  3TT7 A;  3H0J A;  4Q1I A;  3IBB A;  2BZR A;  3PE8 A;  4FND A;  4JOT A;  4B3H A;  5INI A;  4MOU A;  2A7K A;  2J5S A;  4JYL A;  5DKP A;  1J7X A;  2VSU E;  1JXZ A;  4I4Z A;  5FIF A;  4FNB A;  3KTG A;  4WCZ A;  3ZW9 A;  3Q1T A;  5KDR A;  4ZDE A;  4IZB A;  5FUS A;  3JU1 A;  3T3W A;  3TDC A;  4FB8 A;  5DU4 A;  1VRG A;  3OME A;  3TZ3 A;  5INF A;  3FF6 A;  4ZU2 A;  2GTR A;  4U18 A;  3GKB A;  5DZK H;  3VIV A;  5CTC A;  3TVU A;  3R9T A;  1XNY A;  4FN7 A;  1UYS A;  1Y7O A;  3MOY A;  4I52 A;  4B3J A;  3IB9 A;  1N6E A;  3GLM A;  1EY3 A;  3HIN A;  4YLH A;  4GM2 A;  4JVT A;  1XNV A;  2X58 A;  1OD2 A;  1N6F A;  1PJH A;  1Q52 A;  4IZD A;  1PIX A;  2J5I A;  3RSI A;  4RYF A;  3GMA A;  3T8A A;  3SWX A;  2D3T A;  1HNU A;  4U0G A;  4RCN A;  4HC8 A;  1HZD A;  5DU6 A;  3K50 A;  3V5E A;  3ZWA A;  5ING A;  2ZQR A;  4RYF H;  5DUF A;  5CTB A;  3QYR A;  4Z0M A;  3I47 A;  1HNO A;  4KWB A;  2FBM A;  3KQF A;  2F9Y B;  1TYF A;  1NZY A;  2CE3 A;  1OD4 A;  3DOR A;  4JCS A;  2Q2X A;  4K2N A;  2PG8 A;  3TT6 A;  4NNQ A;  5E0S A;  2ZL0 A;  3DJA A;  3P85 A;  4JCT A;  3ZWC A;  2PBP A;  1K39 A;  1RJN A;  1FC7 A;  1WDM A;  4EML A;  4JJT A;  3H0Q A;  1XX4 A;  4LK5 A;  4EMM A;  3SLL A;  2VSS E;  4KPK A;  3LKE A;  2DEO A;  3R6H A;  1WDK A;  5G1Q A;  4WZ8 B;  1SG4 A;  3MYB A;  4DI1 A;  4U0H A;  2ZL2 A;  3HRX A;  3TRR A;  3QWD A;  4WYO B;  2J5G D;  2J5G A;  1W2X A;  3RST A;  5E0S H;  2X24 A;  3BEZ A;  3WG5 A;  4JSB A;  3ZW8 A;  3R9Q A;  3H0S A;  4U1A A;  4ZDD A;  3OC7 A;  1X0U A;  3M6M A;  2ZL4 A;  4MI2 A;  1YG6 A;  4B3I A;  3IAV A;  5DL1 A;  3OT6 A;  1DUB A;  2J5I B;  5IKL B;  4ELX A;  4U19 A;  1UIY A;  4OG1 A;  3QXZ A;  1Q51 A;  5C90 A;  2C8T A;  5MGB A;  1UYR A;  3P2L A;  4L6W A;  3KTJ A;  3HE2 A;  3PEA A;  4JCQ A;  3U9T B;  2PPY A;  1ON9 A;  1RJM A;  2F9I A;  3T89 A;  3H81 A;  3PGQ A;  3KTH A;  4JFC A;  4JWV A;  3MFM A;  2W3P A;  4OMR A;  5DUC A;  1ON3 A;  2A7S A;  2F9Y A;  3Q7H A;  4ASI A;  1NZY B;  2Q35 A;  3HLN 1;  3P5M A;  5DZK A;  2VSS A;  4Q0G A;  5G1S A;  2F6Q A;  3R9S A;  5KDR B;  2ZL3 A;  2IEX A;  3TV5 A;  2VSS F;  3M6N A;  1WDL A;  2J5I I;  1FC6 A;  3Q0G A;  2VSU A;  4ZDF A;  2NP9 A;  4K3W A;  1XO6 A;  1EF8 A;  1FC9 A;  3BPP A;  3H02 A;  4QII A;  3FDU A;  5JBX A;  3LAO A;  3QMJ A;  4OLQ A;  3QK8 A;  3U9R B;  3KTK A;  4ELW A;  4JCR A;  2VX2 A;  2F6I A;  5DU8 A;  1EF9 A;  3TLF A;  4ZDB A;  4KNP A;  3QXI A;  4F47 A;  2CBY A;  5KJP A;  4EMP A;  5C9G A;  5E0N X;  3ZWB A;  5DTW A;  3ISA A;  3Q0J A;  3QKA A;  4I42 A;  3T8B A;  4L8K A;  4IZC A;  3TVW A;  3PZK A;  4G2R A;  5JBW A;  3GF3 A;  1SZO A;  3NJD A;  1UYV A;  1FCF A;  3G64 A;  1DCI A;  2FZS A;  2UZF A;  4MXI A;  3T88 A;  4KD6 A;  3V5I A;  3R0O A;  3HP0 A;  2QQ3 A;  2VSU F;  3U9S B;  4QIJ A;  4FJW D;  2DUB A;  2VRE A;  4QFE A;  2HW5 A;  1WZ8 A;  3KTI A;  1XNW A;  1O8U A;  2EJ5 A;  4ZDC A;  3GF7 A;  4U0G H;  2Q34 A;  1TG6 A;  4JYJ A;  3N6R B;  3QRE A; 
#chains in the Genus database with same CATH topology
 4HNK A;  5DTP A;  2A81 A;  1UYT A;  3MT6 A;  1YG8 A;  4K29 A;  2WTB A;  1MJ3 A;  3RRV A;  1K32 A;  4ELS A;  4NEK A;  1N6D A;  2VSU C;  2ZQQ A;  3STA A;  3L3S A;  4FZW A;  3K8X A;  4FZW C;  3BF0 A;  3ST9 A;  2FW2 A;  5G1R A;  4GHN A;  4FN8 A;  2F9I B;  3H0U A;  3NJB A;  3TT7 A;  3H0J A;  4Q1I A;  3IBB A;  2BZR A;  3PE8 A;  4FND A;  4JOT A;  4B3H A;  5INI A;  4MOU A;  2A7K A;  2J5S A;  4JYL A;  5DKP A;  1J7X A;  2VSU E;  1JXZ A;  4I4Z A;  5FIF A;  4FNB A;  3KTG A;  4WCZ A;  3ZW9 A;  3Q1T A;  5KDR A;  4ZDE A;  4IZB A;  5FUS A;  3JU1 A;  3T3W A;  3TDC A;  4FB8 A;  5DU4 A;  1VRG A;  3OME A;  3BPT A;  3TZ3 A;  5INF A;  3FF6 A;  4ZU2 A;  2GTR A;  4U18 A;  3GKB A;  5DZK H;  3VIV A;  5CTC A;  3TVU A;  3R9T A;  1XNY A;  4FN7 A;  1UYS A;  1Y7O A;  3MOY A;  4I52 A;  4B3J A;  3IB9 A;  1N6E A;  3GLM A;  1EY3 A;  3HIN A;  4YLH A;  4GM2 A;  4JVT A;  1XNV A;  2X58 A;  1OD2 A;  1N6F A;  1PJH A;  1Q52 A;  4IZD A;  1PIX A;  3RSI A;  2J5I A;  4RYF A;  3GMA A;  3T8A A;  3SWX A;  2D3T A;  1HNU A;  4U0G A;  4RCN A;  4HC8 A;  1HZD A;  5DU6 A;  3K50 A;  3V5E A;  3ZWA A;  5ING A;  2ZQR A;  4RYF H;  5DUF A;  5CTB A;  3QYR A;  4Z0M A;  3I47 A;  1HNO A;  4KWB A;  2FBM A;  3KQF A;  2F9Y B;  1TYF A;  1NZY A;  2CE3 A;  1OD4 A;  3DOR A;  4JCS A;  2Q2X A;  4K2N A;  2PG8 A;  3TT6 A;  4NNQ A;  5E0S A;  2ZL0 A;  3DJA A;  3P85 A;  4JCT A;  3ZWC A;  2PBP A;  1K39 A;  1RJN A;  1FC7 A;  1WDM A;  4EML A;  4JJT A;  3H0Q A;  1XX4 A;  4LK5 A;  4EMM A;  3SLL A;  4NAR A;  2VSS E;  4KPK A;  3LKE A;  2DEO A;  3R6H A;  1WDK A;  5G1Q A;  4WZ8 B;  1SG4 A;  3MYB A;  4DI1 A;  4U0H A;  2ZL2 A;  3HRX A;  5HUQ A;  3TRR A;  3QWD A;  4WYO B;  2J5G D;  2J5G A;  1W2X A;  3RST A;  5E0S H;  2X24 A;  3BEZ A;  3WG5 A;  4JSB A;  3ZW8 A;  3R9Q A;  3H0S A;  4U1A A;  4ZDD A;  3OC7 A;  4J2U A;  1X0U A;  3M6M A;  2ZL4 A;  4MI2 A;  1YG6 A;  4B3I A;  3IAV A;  5DL1 A;  3OT6 A;  1DUB A;  2J5I B;  5IKL B;  4ELX A;  4U19 A;  1UIY A;  4OG1 A;  3QXZ A;  1Q51 A;  5C90 A;  2C8T A;  5MGB A;  1UYR A;  3P2L A;  4L6W A;  3KTJ A;  3HE2 A;  3PEA A;  4JCQ A;  3U9T B;  2PPY A;  1ON9 A;  1RJM A;  2F9I A;  3T89 A;  3H81 A;  3PGQ A;  3KTH A;  4JFC A;  4JWV A;  3MFM A;  2W3P A;  4OMR A;  5DUC A;  1ON3 A;  2A7S A;  2F9Y A;  3Q7H A;  4ASI A;  1NZY B;  2Q35 A;  3HLN 1;  3P5M A;  5DZK A;  2VSS A;  4Q0G A;  5G1S A;  2F6Q A;  3R9S A;  5KDR B;  2ZL3 A;  2IEX A;  3TV5 A;  2VSS F;  3M6N A;  1WDL A;  2J5I I;  1FC6 A;  3Q0G A;  2VSU A;  4ZDF A;  2NP9 A;  4K3W A;  1XO6 A;  1EF8 A;  1FC9 A;  3BPP A;  3H02 A;  4QII A;  3FDU A;  5JBX A;  2YJG A;  3LAO A;  3QMJ A;  4OLQ A;  3QK8 A;  3U9R B;  3KTK A;  4ELW A;  4JCR A;  2VX2 A;  2F6I A;  5DU8 A;  1EF9 A;  3TLF A;  4ZDB A;  4KNP A;  3QXI A;  4HDT A;  4F47 A;  2CBY A;  5KJP A;  4EMP A;  5C9G A;  5E0N X;  3ZWB A;  5DTW A;  3ISA A;  3Q0J A;  3QKA A;  4I42 A;  3T8B A;  4L8K A;  4IZC A;  3TVW A;  3PZK A;  4G2R A;  5JBW A;  3GF3 A;  1SZO A;  3NJD A;  1UYV A;  1FCF A;  3G64 A;  1DCI A;  2FZS A;  2UZF A;  4MXI A;  3T88 A;  4KD6 A;  3V5I A;  3R0O A;  3HP0 A;  2QQ3 A;  2VSU F;  3U9S B;  4QIJ A;  4FJW D;  2DUB A;  2VRE A;  4QFE A;  2HW5 A;  1WZ8 A;  3KTI A;  1XNW A;  1O8U A;  2EJ5 A;  4ZDC A;  3GF7 A;  4U0G H;  2Q34 A;  1TG6 A;  4JYJ A;  3N6R B;  3QRE A; 
#chains in the Genus database with same CATH homology
 4HNK A;  5DTP A;  2A81 A;  1UYT A;  3MT6 A;  1YG8 A;  4K29 A;  2WTB A;  1MJ3 A;  3RRV A;  1K32 A;  4ELS A;  4NEK A;  1N6D A;  2VSU C;  2ZQQ A;  3STA A;  3L3S A;  4FZW A;  3K8X A;  4FZW C;  3BF0 A;  3ST9 A;  2FW2 A;  5G1R A;  4GHN A;  4FN8 A;  2F9I B;  3H0U A;  3NJB A;  3TT7 A;  3H0J A;  4Q1I A;  3IBB A;  2BZR A;  3PE8 A;  4FND A;  4JOT A;  4B3H A;  5INI A;  4MOU A;  2A7K A;  2J5S A;  4JYL A;  5DKP A;  1J7X A;  2VSU E;  1JXZ A;  4I4Z A;  5FIF A;  4FNB A;  3KTG A;  4WCZ A;  3ZW9 A;  3Q1T A;  5KDR A;  4ZDE A;  4IZB A;  5FUS A;  3JU1 A;  3T3W A;  3TDC A;  4FB8 A;  5DU4 A;  1VRG A;  3OME A;  3BPT A;  3TZ3 A;  5INF A;  3FF6 A;  4ZU2 A;  2GTR A;  4U18 A;  3GKB A;  5DZK H;  3VIV A;  5CTC A;  3TVU A;  3R9T A;  1XNY A;  4FN7 A;  1UYS A;  1Y7O A;  3MOY A;  4I52 A;  4B3J A;  3IB9 A;  1N6E A;  3GLM A;  1EY3 A;  3HIN A;  4YLH A;  4GM2 A;  4JVT A;  1XNV A;  2X58 A;  1OD2 A;  1N6F A;  1PJH A;  1Q52 A;  4IZD A;  1PIX A;  3RSI A;  2J5I A;  4RYF A;  3GMA A;  3T8A A;  3SWX A;  2D3T A;  1HNU A;  4U0G A;  4RCN A;  4HC8 A;  1HZD A;  5DU6 A;  3K50 A;  3V5E A;  3ZWA A;  5ING A;  2ZQR A;  4RYF H;  5DUF A;  5CTB A;  3QYR A;  4Z0M A;  3I47 A;  1HNO A;  4KWB A;  2FBM A;  3KQF A;  2F9Y B;  1TYF A;  1NZY A;  2CE3 A;  1OD4 A;  3DOR A;  4JCS A;  2Q2X A;  4K2N A;  2PG8 A;  3TT6 A;  4NNQ A;  5E0S A;  2ZL0 A;  3DJA A;  3P85 A;  4JCT A;  3ZWC A;  2PBP A;  1K39 A;  1RJN A;  1FC7 A;  1WDM A;  4EML A;  4JJT A;  3H0Q A;  1XX4 A;  4LK5 A;  4EMM A;  3SLL A;  4NAR A;  2VSS E;  4KPK A;  3LKE A;  2DEO A;  3R6H A;  1WDK A;  5G1Q A;  4WZ8 B;  1SG4 A;  3MYB A;  4DI1 A;  4U0H A;  2ZL2 A;  3HRX A;  5HUQ A;  3TRR A;  3QWD A;  4WYO B;  2J5G D;  2J5G A;  1W2X A;  3RST A;  5E0S H;  2X24 A;  3BEZ A;  3WG5 A;  4JSB A;  3ZW8 A;  3R9Q A;  3H0S A;  4U1A A;  4ZDD A;  3OC7 A;  4J2U A;  1X0U A;  3M6M A;  2ZL4 A;  4MI2 A;  1YG6 A;  4B3I A;  3IAV A;  5DL1 A;  3OT6 A;  1DUB A;  2J5I B;  5IKL B;  4ELX A;  4U19 A;  1UIY A;  4OG1 A;  3QXZ A;  1Q51 A;  5C90 A;  2C8T A;  5MGB A;  1UYR A;  3P2L A;  4L6W A;  3KTJ A;  3HE2 A;  3PEA A;  4JCQ A;  3U9T B;  2PPY A;  1ON9 A;  1RJM A;  2F9I A;  3T89 A;  3H81 A;  3PGQ A;  3KTH A;  4JFC A;  4JWV A;  3MFM A;  2W3P A;  4OMR A;  5DUC A;  1ON3 A;  2A7S A;  2F9Y A;  3Q7H A;  4ASI A;  1NZY B;  2Q35 A;  3HLN 1;  3P5M A;  5DZK A;  2VSS A;  4Q0G A;  5G1S A;  2F6Q A;  3R9S A;  5KDR B;  2ZL3 A;  2IEX A;  3TV5 A;  2VSS F;  3M6N A;  1WDL A;  2J5I I;  1FC6 A;  3Q0G A;  2VSU A;  4ZDF A;  2NP9 A;  4K3W A;  1XO6 A;  1EF8 A;  1FC9 A;  3BPP A;  3H02 A;  4QII A;  3FDU A;  5JBX A;  2YJG A;  3LAO A;  3QMJ A;  4OLQ A;  3QK8 A;  3U9R B;  3KTK A;  4ELW A;  4JCR A;  2VX2 A;  2F6I A;  5DU8 A;  1EF9 A;  3TLF A;  4ZDB A;  4KNP A;  3QXI A;  4HDT A;  4F47 A;  2CBY A;  5KJP A;  4EMP A;  5C9G A;  5E0N X;  3ZWB A;  5DTW A;  3ISA A;  3Q0J A;  3QKA A;  4I42 A;  3T8B A;  4L8K A;  4IZC A;  3TVW A;  3PZK A;  4G2R A;  5JBW A;  3GF3 A;  1SZO A;  3NJD A;  1UYV A;  1FCF A;  3G64 A;  1DCI A;  2FZS A;  2UZF A;  4MXI A;  3T88 A;  4KD6 A;  3V5I A;  3R0O A;  3HP0 A;  2QQ3 A;  2VSU F;  3U9S B;  4QIJ A;  4FJW D;  2DUB A;  2VRE A;  4QFE A;  2HW5 A;  1WZ8 A;  3KTI A;  1XNW A;  1O8U A;  2EJ5 A;  4ZDC A;  3GF7 A;  4U0G H;  2Q34 A;  1TG6 A;  4JYJ A;  3N6R B;  3QRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...