2ZL3A

Crystal structure of h.pylori clpp s99a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
173
structure length
173
Chain Sequence
DIYSRLLKDRIVLLSGEINDSVASSIVAQLLFLEAEDPEKDIGLYINSPGGVITSGLSIYDTMNFIRPDVSTICIGQAAAMGAFLLSCGAKGKRFSLPHSRIMIHQPLGGAQGQASDIEIISNEILRLKGLMNSILAQNSGQSLEQIAKDTDRDFYMSAKEAKEYGLIDKVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the activation and peptide recognition of bacterial ClpP
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 62
structure length 173
sequence length 173
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2zl3A00
4JYJA 3MFMA 2ZL3A 1MJ3A 3H81A 1RJMA 3QMJA 4JSBA 2J5IA 4KWBA 3SLLA 3MOYA 3GF7A 3P5MA 3U9RB 2W3PA 5JBWA 3IAVA 5E0SH 1XNVA 3R6HA 5G1RA 4FN8A 3QREA 1W2XA 3H0UA 1XO6A 3MT6A 2FW2A 5E0NX 4I4ZA 1WDLA 2HW5A 3NJBA 3T8AA 1FC6A 1ON9A 4G2RA 1HZDA 3ISAA 5CTCA 2VSUF 4JOTA 4OMRA 2VSSE 5DUFA 4ELXA 1K32A 3U9SB 2VSSA 3M6NA 4FN7A 2X24A 3T88A 1HNOA 1UYTA 3TRRA 3KTGA 3QXIA 2DUBA 5G1SA 4MI2A 3HRXA 4ZDEA 3FDUA 1N6DA 2BZRA 3BPPA 3V5EA 3R9QA 5JBXA 4JCSA 1Y7OA 2VREA 2ZL4A 4FJWD 3PZKA 4FNDA 1EY3A 3TVUA 1K39A 4L8KA 3ZWAA 1J7XA 1PJHA 3IB9A 1N6EA 4I52A 4WYOB 3JU1A 4K2NA 2CBYA 5FUSA 4ELSA 1XX4A 4Z0MA 2F6IA 2Q2XA 3LAOA 1WZ8A 5E0SA 3TVWA 1UIYA 3KTJA 2PG8A 2VSUE 4EMMA 2ZQRA 1FC9A 1N6FA 3PE8A 2F9IA 4U19A 4JWVA 1UYSA 3U9TB 4GHNA 4NNQA 5KDRB 3TT7A 1Q52A 2FZSA 1Q51A 3KQFA 1SG4A 3G64A 2EJ5A 3R0OA 3RSTA 3I47A 3NJDA 3RRVA 4RCNA 3H0JA 2IEXA 4ZDCA 4U0GA 3HP0A 3Q1TA 4RYFH 4HC8A 3QK8A 2UZFA 4I42A 1FCFA 4KPKA 1WDMA 3N6RB 4QIJA 4JVTA 2VX2A 4OLQA 4Q1IA 3DJAA 5FIFA 1OD2A 3VIVA 3K50A 3GLMA 3Q0GA 5C90A 4KNPA 2F9YA 4JCTA 4ELWA 4JYLA 5DUCA 4QFEA 4JCRA 3GF3A 3OT6A 4JFCA 2QQ3A 4YLHA 1NZYB 1ON3A 3HLN1 3V5IA 4B3IA 5C9GA 4F47A 3RSIA 2A81A 4EMPA 3ST9A 3WG5A 3T8BA 2VSSF 3TDCA 2D3TA 5DL1A 2CE3A 3K8XA 5DU4A 2J5GA 4Q0GA 2NP9A 2A7SA 2FBMA 4FZWC 3SWXA 3ZW8A 3BEZA 4ZDBA 3Q0JA 3TZ3A 5DU6A 4NEKA 1FC7A 4FNBA 4U0GH 3TV5A 5INIA 3GKBA 3IBBA 4U0HA 3HINA 1EF9A 2WTBA 1PIXA 4ZDFA 5DTWA 1XNWA 4MOUA 3L3SA 4JJTA 1YG8A 4WZ8B 5DZKH 4DI1A 2F6QA 3KTKA 3KTIA 2ZL0A 4IZDA 3KTHA 3OMEA 4B3JA 3HE2A 2J5SA 3QKAA 4U18A 5INFA 4B3HA 3TLFA 2Q34A 2VSUA 4IZCA 1XNYA 2VSUC 4EMLA 1DUBA 5KDRA 1YG6A 4ASIA 5MGBA 1TYFA 5KJPA 2PBPA 1NZYA 3T3WA 4LK5A 2PPYA 3ZWBA 4GM2A 3TT6A 4MXIA 4QIIA 3R9SA 5DKPA 4HNKA 5DTPA 3QXZA 1X0UA 5INGA 5DZKA 2J5IB 3BF0A 2Q35A 4ZDDA 3MYBA 4K29A 4RYFA 1EF8A 3LKEA 1UYVA 1UYRA 4WCZA 3H0SA 3PGQA 4JCQA 4FZWA 4U1AA 1RJNA 2ZQQA 2X58A 4OG1A 4L6WA 2GTRA 1OD4A 4KD6A 1JXZA 3PEAA 3P2LA 1SZOA 3OC7A 2F9YB 5DU8A 3STAA 2J5II 1DCIA 3H02A 1HNUA 3T89A 3FF6A 2ZL2A 3H0QA 4IZBA 2A7KA 3GMAA 3M6MA 3ZW9A 4FB8A 3DORA 5G1QA 3ZWCA 3P85A 2J5GD 1O8UA 4ZU2A 5CTBA 2DEOA 3Q7HA 5IKLB 3QWDA 2F9IB 3QYRA 3R9TA 1TG6A 1WDKA 1VRGA 4K3WA 2C8TA
chains in the Genus database with same CATH superfamily
4JYJA 3MFMA 2ZL3A 1MJ3A 3H81A 1RJMA 3QMJA 4JSBA 5HUQA 2J5IA 4KWBA 3SLLA 3MOYA 3GF7A 3P5MA 3U9RB 2W3PA 5JBWA 3IAVA 5E0SH 1XNVA 3R6HA 5G1RA 4FN8A 3QREA 1W2XA 3H0UA 1XO6A 3MT6A 2FW2A 5E0NX 4I4ZA 1WDLA 2HW5A 3NJBA 3T8AA 1FC6A 1ON9A 4G2RA 1HZDA 3ISAA 5CTCA 2VSUF 4JOTA 4OMRA 2VSSE 5DUFA 4ELXA 1K32A 3U9SB 2VSSA 3M6NA 4FN7A 2X24A 3T88A 1HNOA 1UYTA 3TRRA 3KTGA 3QXIA 2DUBA 5G1SA 4MI2A 3HRXA 4ZDEA 3FDUA 1N6DA 2BZRA 3BPPA 3V5EA 3R9QA 5JBXA 4JCSA 1Y7OA 2VREA 2ZL4A 4FJWD 3PZKA 4FNDA 1EY3A 3TVUA 1K39A 4L8KA 3ZWAA 1J7XA 1PJHA 3IB9A 1N6EA 4I52A 4WYOB 3JU1A 4K2NA 2CBYA 5FUSA 4ELSA 1XX4A 4Z0MA 2F6IA 2Q2XA 3LAOA 1WZ8A 5E0SA 3TVWA 1UIYA 2YJGA 3KTJA 2PG8A 2VSUE 4EMMA 2ZQRA 1FC9A 1N6FA 3PE8A 2F9IA 4U19A 4JWVA 1UYSA 3U9TB 4GHNA 4NNQA 5KDRB 3TT7A 1Q52A 2FZSA 1Q51A 3KQFA 1SG4A 3G64A 2EJ5A 3R0OA 3RSTA 3I47A 3NJDA 3RRVA 4RCNA 3H0JA 2IEXA 4ZDCA 4U0GA 3HP0A 3Q1TA 4RYFH 4HC8A 3QK8A 2UZFA 4I42A 1FCFA 4KPKA 1WDMA 3N6RB 4QIJA 4JVTA 2VX2A 4OLQA 4Q1IA 3DJAA 5FIFA 1OD2A 3VIVA 3K50A 3GLMA 3Q0GA 5C90A 4KNPA 2F9YA 4JCTA 4ELWA 4JYLA 5DUCA 4QFEA 4JCRA 3GF3A 3OT6A 4JFCA 2QQ3A 4YLHA 1NZYB 1ON3A 3HLN1 4NARA 3V5IA 5C9GA 4B3IA 4F47A 3RSIA 2A81A 4EMPA 3ST9A 3WG5A 3T8BA 2VSSF 3TDCA 2D3TA 5DL1A 2CE3A 3K8XA 5DU4A 2J5GA 4Q0GA 2NP9A 2A7SA 2FBMA 4FZWC 3SWXA 3ZW8A 3BEZA 4ZDBA 3Q0JA 3TZ3A 5DU6A 4NEKA 1FC7A 4FNBA 4U0GH 3TV5A 5INIA 3GKBA 3IBBA 4U0HA 3HINA 1EF9A 2WTBA 1PIXA 4ZDFA 5DTWA 1XNWA 4MOUA 3L3SA 4JJTA 1YG8A 4WZ8B 5DZKH 4DI1A 4J2UA 2F6QA 3KTKA 3KTIA 2ZL0A 4IZDA 3KTHA 3OMEA 4B3JA 3HE2A 2J5SA 3QKAA 4U18A 5INFA 4B3HA 3TLFA 2Q34A 2VSUA 4IZCA 1XNYA 2VSUC 4EMLA 1DUBA 5KDRA 1YG6A 4ASIA 5MGBA 1TYFA 5KJPA 2PBPA 1NZYA 3T3WA 4LK5A 2PPYA 3ZWBA 4GM2A 3TT6A 4MXIA 4QIIA 3R9SA 5DKPA 4HNKA 5DTPA 3QXZA 1X0UA 5INGA 5DZKA 2J5IB 3BF0A 2Q35A 4ZDDA 3MYBA 4K29A 4RYFA 1EF8A 3LKEA 1UYVA 1UYRA 4WCZA 3H0SA 3PGQA 4JCQA 4FZWA 4U1AA 1RJNA 2ZQQA 2X58A 4OG1A 4L6WA 2GTRA 1OD4A 4KD6A 1JXZA 3PEAA 3P2LA 1SZOA 3OC7A 2F9YB 5DU8A 3STAA 2J5II 1DCIA 3H02A 1HNUA 3T89A 3FF6A 2ZL2A 3H0QA 4IZBA 2A7KA 3GMAA 3M6MA 4HDTA 3ZW9A 4FB8A 3DORA 5G1QA 3ZWCA 3P85A 2J5GD 1O8UA 4ZU2A 5CTBA 2DEOA 3Q7HA 5IKLB 3QWDA 2F9IB 3QYRA 3R9TA 1TG6A 1WDKA 3BPTA 1VRGA 4K3WA 2C8TA
chains in the Genus database with same CATH topology
4JYJA 3MFMA 2ZL3A 1MJ3A 3H81A 1RJMA 3QMJA 4JSBA 5HUQA 2J5IA 4KWBA 3SLLA 3MOYA 3GF7A 3P5MA 3U9RB 2W3PA 5JBWA 3IAVA 5E0SH 1XNVA 3R6HA 5G1RA 4FN8A 3QREA 1W2XA 3H0UA 1XO6A 3MT6A 2FW2A 5E0NX 4I4ZA 1WDLA 2HW5A 3NJBA 3T8AA 1FC6A 1ON9A 4G2RA 1HZDA 3ISAA 5CTCA 2VSUF 4JOTA 4OMRA 2VSSE 5DUFA 4ELXA 1K32A 3U9SB 2VSSA 3M6NA 4FN7A 2X24A 3T88A 1HNOA 1UYTA 3TRRA 3KTGA 3QXIA 2DUBA 5G1SA 4MI2A 3HRXA 4ZDEA 3FDUA 1N6DA 2BZRA 3BPPA 3V5EA 3R9QA 5JBXA 4JCSA 1Y7OA 2VREA 2ZL4A 4FJWD 3PZKA 4FNDA 1EY3A 3TVUA 1K39A 4L8KA 3ZWAA 1J7XA 1PJHA 3IB9A 1N6EA 4I52A 4WYOB 3JU1A 4K2NA 2CBYA 5FUSA 4ELSA 1XX4A 4Z0MA 2F6IA 2Q2XA 3LAOA 1WZ8A 5E0SA 3TVWA 1UIYA 2YJGA 3KTJA 2PG8A 2VSUE 4EMMA 2ZQRA 1FC9A 1N6FA 3PE8A 2F9IA 4U19A 4JWVA 1UYSA 3U9TB 4GHNA 4NNQA 5KDRB 3TT7A 1Q52A 2FZSA 1Q51A 3KQFA 1SG4A 3G64A 2EJ5A 3R0OA 3RSTA 3I47A 3NJDA 3RRVA 4RCNA 3H0JA 2IEXA 4ZDCA 4U0GA 3HP0A 3Q1TA 4RYFH 4HC8A 3QK8A 2UZFA 4I42A 1FCFA 4KPKA 1WDMA 3N6RB 4QIJA 4JVTA 2VX2A 4OLQA 4Q1IA 3DJAA 5FIFA 1OD2A 3VIVA 3K50A 3GLMA 3Q0GA 5C90A 4KNPA 2F9YA 4JCTA 4ELWA 4JYLA 5DUCA 4QFEA 4JCRA 3GF3A 3OT6A 4JFCA 2QQ3A 4YLHA 1NZYB 1ON3A 3HLN1 4NARA 3V5IA 5C9GA 4B3IA 4F47A 3RSIA 2A81A 4EMPA 3ST9A 3WG5A 3T8BA 2VSSF 3TDCA 2D3TA 5DL1A 2CE3A 3K8XA 5DU4A 2J5GA 4Q0GA 2NP9A 2A7SA 2FBMA 4FZWC 3SWXA 3ZW8A 3BEZA 4ZDBA 3Q0JA 3TZ3A 5DU6A 4NEKA 1FC7A 4FNBA 4U0GH 3TV5A 5INIA 3GKBA 3IBBA 4U0HA 3HINA 1EF9A 2WTBA 1PIXA 4ZDFA 5DTWA 1XNWA 4MOUA 3L3SA 4JJTA 1YG8A 4WZ8B 5DZKH 4DI1A 4J2UA 2F6QA 3KTKA 3KTIA 2ZL0A 4IZDA 3KTHA 3OMEA 4B3JA 3HE2A 2J5SA 3QKAA 4U18A 5INFA 4B3HA 3TLFA 2Q34A 2VSUA 4IZCA 1XNYA 2VSUC 4EMLA 1DUBA 5KDRA 1YG6A 4ASIA 5MGBA 1TYFA 5KJPA 2PBPA 1NZYA 3T3WA 4LK5A 2PPYA 3ZWBA 4GM2A 3TT6A 4MXIA 4QIIA 3R9SA 5DKPA 4HNKA 5DTPA 3QXZA 1X0UA 5INGA 5DZKA 2J5IB 3BF0A 2Q35A 4ZDDA 3MYBA 4K29A 4RYFA 1EF8A 3LKEA 1UYVA 1UYRA 4WCZA 3H0SA 3PGQA 4JCQA 4FZWA 4U1AA 1RJNA 2ZQQA 2X58A 4OG1A 4L6WA 2GTRA 1OD4A 4KD6A 1JXZA 3PEAA 3P2LA 1SZOA 3OC7A 2F9YB 5DU8A 3STAA 2J5II 1DCIA 3H02A 1HNUA 3T89A 3FF6A 2ZL2A 3H0QA 4IZBA 2A7KA 3GMAA 3M6MA 4HDTA 3ZW9A 4FB8A 3DORA 5G1QA 3ZWCA 3P85A 2J5GD 1O8UA 4ZU2A 5CTBA 2DEOA 3Q7HA 5IKLB 3QWDA 2F9IB 3QYRA 3R9TA 1TG6A 1WDKA 3BPTA 1VRGA 4K3WA 2C8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYJ A;  3MFM A;  2ZL3 A;  1MJ3 A;  3H81 A;  1RJM A;  3QMJ A;  4JSB A;  2J5I A;  4KWB A;  3SLL A;  3MOY A;  3GF7 A;  3P5M A;  3U9R B;  2W3P A;  5JBW A;  3IAV A;  5E0S H;  1XNV A;  3R6H A;  5G1R A;  4FN8 A;  3QRE A;  1W2X A;  3H0U A;  1XO6 A;  3MT6 A;  2FW2 A;  5E0N X;  4I4Z A;  1WDL A;  2HW5 A;  3NJB A;  3T8A A;  1FC6 A;  1ON9 A;  4G2R A;  1HZD A;  3ISA A;  5CTC A;  2VSU F;  4JOT A;  4OMR A;  2VSS E;  5DUF A;  4ELX A;  1K32 A;  3U9S B;  2VSS A;  3M6N A;  4FN7 A;  2X24 A;  3T88 A;  1HNO A;  1UYT A;  3TRR A;  3KTG A;  3QXI A;  2DUB A;  5G1S A;  4MI2 A;  3HRX A;  4ZDE A;  3FDU A;  1N6D A;  2BZR A;  3BPP A;  3V5E A;  3R9Q A;  5JBX A;  4JCS A;  1Y7O A;  2VRE A;  2ZL4 A;  4FJW D;  3PZK A;  4FND A;  1EY3 A;  3TVU A;  1K39 A;  4L8K A;  3ZWA A;  1J7X A;  1PJH A;  3IB9 A;  1N6E A;  4I52 A;  4WYO B;  3JU1 A;  4K2N A;  2CBY A;  5FUS A;  4ELS A;  1XX4 A;  4Z0M A;  2F6I A;  2Q2X A;  3LAO A;  1WZ8 A;  5E0S A;  3TVW A;  1UIY A;  3KTJ A;  2PG8 A;  2VSU E;  4EMM A;  2ZQR A;  1FC9 A;  1N6F A;  3PE8 A;  2F9I A;  4U19 A;  4JWV A;  1UYS A;  3U9T B;  4GHN A;  4NNQ A;  5KDR B;  3TT7 A;  1Q52 A;  2FZS A;  1Q51 A;  3KQF A;  1SG4 A;  3G64 A;  2EJ5 A;  3R0O A;  3RST A;  3I47 A;  3NJD A;  3RRV A;  4RCN A;  3H0J A;  2IEX A;  4ZDC A;  4U0G A;  3HP0 A;  3Q1T A;  4RYF H;  4HC8 A;  3QK8 A;  2UZF A;  4I42 A;  1FCF A;  4KPK A;  1WDM A;  3N6R B;  4QIJ A;  4JVT A;  2VX2 A;  4OLQ A;  4Q1I A;  3DJA A;  5FIF A;  1OD2 A;  3VIV A;  3K50 A;  3GLM A;  3Q0G A;  5C90 A;  4KNP A;  2F9Y A;  4JCT A;  4ELW A;  4JYL A;  5DUC A;  4QFE A;  4JCR A;  3GF3 A;  3OT6 A;  4JFC A;  2QQ3 A;  4YLH A;  1NZY B;  1ON3 A;  3HLN 1;  3V5I A;  4B3I A;  5C9G A;  4F47 A;  3RSI A;  2A81 A;  4EMP A;  3ST9 A;  3WG5 A;  3T8B A;  2VSS F;  3TDC A;  2D3T A;  5DL1 A;  2CE3 A;  3K8X A;  5DU4 A;  2J5G A;  4Q0G A;  2NP9 A;  2A7S A;  2FBM A;  4FZW C;  3SWX A;  3ZW8 A;  3BEZ A;  4ZDB A;  3Q0J A;  3TZ3 A;  5DU6 A;  4NEK A;  1FC7 A;  4FNB A;  4U0G H;  3TV5 A;  5INI A;  3GKB A;  3IBB A;  4U0H A;  3HIN A;  1EF9 A;  2WTB A;  1PIX A;  4ZDF A;  5DTW A;  1XNW A;  4MOU A;  3L3S A;  4JJT A;  1YG8 A;  4WZ8 B;  5DZK H;  4DI1 A;  2F6Q A;  3KTK A;  3KTI A;  2ZL0 A;  4IZD A;  3KTH A;  3OME A;  4B3J A;  3HE2 A;  2J5S A;  3QKA A;  4U18 A;  5INF A;  4B3H A;  3TLF A;  2Q34 A;  2VSU A;  4IZC A;  1XNY A;  2VSU C;  4EML A;  1DUB A;  5KDR A;  1YG6 A;  4ASI A;  5MGB A;  1TYF A;  5KJP A;  2PBP A;  1NZY A;  3T3W A;  4LK5 A;  2PPY A;  3ZWB A;  4GM2 A;  3TT6 A;  4MXI A;  4QII A;  3R9S A;  5DKP A;  4HNK A;  5DTP A;  3QXZ A;  1X0U A;  5ING A;  5DZK A;  2J5I B;  3BF0 A;  2Q35 A;  4ZDD A;  3MYB A;  4K29 A;  4RYF A;  1EF8 A;  3LKE A;  1UYV A;  1UYR A;  4WCZ A;  3H0S A;  3PGQ A;  4JCQ A;  4FZW A;  4U1A A;  1RJN A;  2ZQQ A;  2X58 A;  4OG1 A;  4L6W A;  2GTR A;  1OD4 A;  4KD6 A;  1JXZ A;  3PEA A;  3P2L A;  1SZO A;  3OC7 A;  2F9Y B;  5DU8 A;  3STA A;  2J5I I;  1DCI A;  3H02 A;  1HNU A;  3T89 A;  3FF6 A;  2ZL2 A;  3H0Q A;  4IZB A;  2A7K A;  3GMA A;  3M6M A;  3ZW9 A;  4FB8 A;  3DOR A;  5G1Q A;  3ZWC A;  3P85 A;  2J5G D;  1O8U A;  4ZU2 A;  5CTB A;  2DEO A;  3Q7H A;  5IKL B;  3QWD A;  2F9I B;  3QYR A;  3R9T A;  1TG6 A;  1WDK A;  1VRG A;  4K3W A;  2C8T A; 
#chains in the Genus database with same CATH topology
 4JYJ A;  3MFM A;  2ZL3 A;  1MJ3 A;  3H81 A;  1RJM A;  3QMJ A;  4JSB A;  5HUQ A;  2J5I A;  4KWB A;  3SLL A;  3MOY A;  3GF7 A;  3P5M A;  3U9R B;  2W3P A;  5JBW A;  3IAV A;  5E0S H;  1XNV A;  3R6H A;  5G1R A;  4FN8 A;  3QRE A;  1W2X A;  3H0U A;  1XO6 A;  3MT6 A;  2FW2 A;  5E0N X;  4I4Z A;  1WDL A;  2HW5 A;  3NJB A;  3T8A A;  1FC6 A;  1ON9 A;  4G2R A;  1HZD A;  3ISA A;  5CTC A;  2VSU F;  4JOT A;  4OMR A;  2VSS E;  5DUF A;  4ELX A;  1K32 A;  3U9S B;  2VSS A;  3M6N A;  4FN7 A;  2X24 A;  3T88 A;  1HNO A;  1UYT A;  3TRR A;  3KTG A;  3QXI A;  2DUB A;  5G1S A;  4MI2 A;  3HRX A;  4ZDE A;  3FDU A;  1N6D A;  2BZR A;  3BPP A;  3V5E A;  3R9Q A;  5JBX A;  4JCS A;  1Y7O A;  2VRE A;  2ZL4 A;  4FJW D;  3PZK A;  4FND A;  1EY3 A;  3TVU A;  1K39 A;  4L8K A;  3ZWA A;  1J7X A;  1PJH A;  3IB9 A;  1N6E A;  4I52 A;  4WYO B;  3JU1 A;  4K2N A;  2CBY A;  5FUS A;  4ELS A;  1XX4 A;  4Z0M A;  2F6I A;  2Q2X A;  3LAO A;  1WZ8 A;  5E0S A;  3TVW A;  1UIY A;  2YJG A;  3KTJ A;  2PG8 A;  2VSU E;  4EMM A;  2ZQR A;  1FC9 A;  1N6F A;  3PE8 A;  2F9I A;  4U19 A;  4JWV A;  1UYS A;  3U9T B;  4GHN A;  4NNQ A;  5KDR B;  3TT7 A;  1Q52 A;  2FZS A;  1Q51 A;  3KQF A;  1SG4 A;  3G64 A;  2EJ5 A;  3R0O A;  3RST A;  3I47 A;  3NJD A;  3RRV A;  4RCN A;  3H0J A;  2IEX A;  4ZDC A;  4U0G A;  3HP0 A;  3Q1T A;  4RYF H;  4HC8 A;  3QK8 A;  2UZF A;  4I42 A;  1FCF A;  4KPK A;  1WDM A;  3N6R B;  4QIJ A;  4JVT A;  2VX2 A;  4OLQ A;  4Q1I A;  3DJA A;  5FIF A;  1OD2 A;  3VIV A;  3K50 A;  3GLM A;  3Q0G A;  5C90 A;  4KNP A;  2F9Y A;  4JCT A;  4ELW A;  4JYL A;  5DUC A;  4QFE A;  4JCR A;  3GF3 A;  3OT6 A;  4JFC A;  2QQ3 A;  4YLH A;  1NZY B;  1ON3 A;  3HLN 1;  4NAR A;  3V5I A;  5C9G A;  4B3I A;  4F47 A;  3RSI A;  2A81 A;  4EMP A;  3ST9 A;  3WG5 A;  3T8B A;  2VSS F;  3TDC A;  2D3T A;  5DL1 A;  2CE3 A;  3K8X A;  5DU4 A;  2J5G A;  4Q0G A;  2NP9 A;  2A7S A;  2FBM A;  4FZW C;  3SWX A;  3ZW8 A;  3BEZ A;  4ZDB A;  3Q0J A;  3TZ3 A;  5DU6 A;  4NEK A;  1FC7 A;  4FNB A;  4U0G H;  3TV5 A;  5INI A;  3GKB A;  3IBB A;  4U0H A;  3HIN A;  1EF9 A;  2WTB A;  1PIX A;  4ZDF A;  5DTW A;  1XNW A;  4MOU A;  3L3S A;  4JJT A;  1YG8 A;  4WZ8 B;  5DZK H;  4DI1 A;  4J2U A;  2F6Q A;  3KTK A;  3KTI A;  2ZL0 A;  4IZD A;  3KTH A;  3OME A;  4B3J A;  3HE2 A;  2J5S A;  3QKA A;  4U18 A;  5INF A;  4B3H A;  3TLF A;  2Q34 A;  2VSU A;  4IZC A;  1XNY A;  2VSU C;  4EML A;  1DUB A;  5KDR A;  1YG6 A;  4ASI A;  5MGB A;  1TYF A;  5KJP A;  2PBP A;  1NZY A;  3T3W A;  4LK5 A;  2PPY A;  3ZWB A;  4GM2 A;  3TT6 A;  4MXI A;  4QII A;  3R9S A;  5DKP A;  4HNK A;  5DTP A;  3QXZ A;  1X0U A;  5ING A;  5DZK A;  2J5I B;  3BF0 A;  2Q35 A;  4ZDD A;  3MYB A;  4K29 A;  4RYF A;  1EF8 A;  3LKE A;  1UYV A;  1UYR A;  4WCZ A;  3H0S A;  3PGQ A;  4JCQ A;  4FZW A;  4U1A A;  1RJN A;  2ZQQ A;  2X58 A;  4OG1 A;  4L6W A;  2GTR A;  1OD4 A;  4KD6 A;  1JXZ A;  3PEA A;  3P2L A;  1SZO A;  3OC7 A;  2F9Y B;  5DU8 A;  3STA A;  2J5I I;  1DCI A;  3H02 A;  1HNU A;  3T89 A;  3FF6 A;  2ZL2 A;  3H0Q A;  4IZB A;  2A7K A;  3GMA A;  3M6M A;  4HDT A;  3ZW9 A;  4FB8 A;  3DOR A;  5G1Q A;  3ZWC A;  3P85 A;  2J5G D;  1O8U A;  4ZU2 A;  5CTB A;  2DEO A;  3Q7H A;  5IKL B;  3QWD A;  2F9I B;  3QYR A;  3R9T A;  1TG6 A;  1WDK A;  3BPT A;  1VRG A;  4K3W A;  2C8T A; 
#chains in the Genus database with same CATH homology
 4JYJ A;  3MFM A;  2ZL3 A;  1MJ3 A;  3H81 A;  1RJM A;  3QMJ A;  4JSB A;  5HUQ A;  2J5I A;  4KWB A;  3SLL A;  3MOY A;  3GF7 A;  3P5M A;  3U9R B;  2W3P A;  5JBW A;  3IAV A;  5E0S H;  1XNV A;  3R6H A;  5G1R A;  4FN8 A;  3QRE A;  1W2X A;  3H0U A;  1XO6 A;  3MT6 A;  2FW2 A;  5E0N X;  4I4Z A;  1WDL A;  2HW5 A;  3NJB A;  3T8A A;  1FC6 A;  1ON9 A;  4G2R A;  1HZD A;  3ISA A;  5CTC A;  2VSU F;  4JOT A;  4OMR A;  2VSS E;  5DUF A;  4ELX A;  1K32 A;  3U9S B;  2VSS A;  3M6N A;  4FN7 A;  2X24 A;  3T88 A;  1HNO A;  1UYT A;  3TRR A;  3KTG A;  3QXI A;  2DUB A;  5G1S A;  4MI2 A;  3HRX A;  4ZDE A;  3FDU A;  1N6D A;  2BZR A;  3BPP A;  3V5E A;  3R9Q A;  5JBX A;  4JCS A;  1Y7O A;  2VRE A;  2ZL4 A;  4FJW D;  3PZK A;  4FND A;  1EY3 A;  3TVU A;  1K39 A;  4L8K A;  3ZWA A;  1J7X A;  1PJH A;  3IB9 A;  1N6E A;  4I52 A;  4WYO B;  3JU1 A;  4K2N A;  2CBY A;  5FUS A;  4ELS A;  1XX4 A;  4Z0M A;  2F6I A;  2Q2X A;  3LAO A;  1WZ8 A;  5E0S A;  3TVW A;  1UIY A;  2YJG A;  3KTJ A;  2PG8 A;  2VSU E;  4EMM A;  2ZQR A;  1FC9 A;  1N6F A;  3PE8 A;  2F9I A;  4U19 A;  4JWV A;  1UYS A;  3U9T B;  4GHN A;  4NNQ A;  5KDR B;  3TT7 A;  1Q52 A;  2FZS A;  1Q51 A;  3KQF A;  1SG4 A;  3G64 A;  2EJ5 A;  3R0O A;  3RST A;  3I47 A;  3NJD A;  3RRV A;  4RCN A;  3H0J A;  2IEX A;  4ZDC A;  4U0G A;  3HP0 A;  3Q1T A;  4RYF H;  4HC8 A;  3QK8 A;  2UZF A;  4I42 A;  1FCF A;  4KPK A;  1WDM A;  3N6R B;  4QIJ A;  4JVT A;  2VX2 A;  4OLQ A;  4Q1I A;  3DJA A;  5FIF A;  1OD2 A;  3VIV A;  3K50 A;  3GLM A;  3Q0G A;  5C90 A;  4KNP A;  2F9Y A;  4JCT A;  4ELW A;  4JYL A;  5DUC A;  4QFE A;  4JCR A;  3GF3 A;  3OT6 A;  4JFC A;  2QQ3 A;  4YLH A;  1NZY B;  1ON3 A;  3HLN 1;  4NAR A;  3V5I A;  5C9G A;  4B3I A;  4F47 A;  3RSI A;  2A81 A;  4EMP A;  3ST9 A;  3WG5 A;  3T8B A;  2VSS F;  3TDC A;  2D3T A;  5DL1 A;  2CE3 A;  3K8X A;  5DU4 A;  2J5G A;  4Q0G A;  2NP9 A;  2A7S A;  2FBM A;  4FZW C;  3SWX A;  3ZW8 A;  3BEZ A;  4ZDB A;  3Q0J A;  3TZ3 A;  5DU6 A;  4NEK A;  1FC7 A;  4FNB A;  4U0G H;  3TV5 A;  5INI A;  3GKB A;  3IBB A;  4U0H A;  3HIN A;  1EF9 A;  2WTB A;  1PIX A;  4ZDF A;  5DTW A;  1XNW A;  4MOU A;  3L3S A;  4JJT A;  1YG8 A;  4WZ8 B;  5DZK H;  4DI1 A;  4J2U A;  2F6Q A;  3KTK A;  3KTI A;  2ZL0 A;  4IZD A;  3KTH A;  3OME A;  4B3J A;  3HE2 A;  2J5S A;  3QKA A;  4U18 A;  5INF A;  4B3H A;  3TLF A;  2Q34 A;  2VSU A;  4IZC A;  1XNY A;  2VSU C;  4EML A;  1DUB A;  5KDR A;  1YG6 A;  4ASI A;  5MGB A;  1TYF A;  5KJP A;  2PBP A;  1NZY A;  3T3W A;  4LK5 A;  2PPY A;  3ZWB A;  4GM2 A;  3TT6 A;  4MXI A;  4QII A;  3R9S A;  5DKP A;  4HNK A;  5DTP A;  3QXZ A;  1X0U A;  5ING A;  5DZK A;  2J5I B;  3BF0 A;  2Q35 A;  4ZDD A;  3MYB A;  4K29 A;  4RYF A;  1EF8 A;  3LKE A;  1UYV A;  1UYR A;  4WCZ A;  3H0S A;  3PGQ A;  4JCQ A;  4FZW A;  4U1A A;  1RJN A;  2ZQQ A;  2X58 A;  4OG1 A;  4L6W A;  2GTR A;  1OD4 A;  4KD6 A;  1JXZ A;  3PEA A;  3P2L A;  1SZO A;  3OC7 A;  2F9Y B;  5DU8 A;  3STA A;  2J5I I;  1DCI A;  3H02 A;  1HNU A;  3T89 A;  3FF6 A;  2ZL2 A;  3H0Q A;  4IZB A;  2A7K A;  3GMA A;  3M6M A;  4HDT A;  3ZW9 A;  4FB8 A;  3DOR A;  5G1Q A;  3ZWC A;  3P85 A;  2J5G D;  1O8U A;  4ZU2 A;  5CTB A;  2DEO A;  3Q7H A;  5IKL B;  3QWD A;  2F9I B;  3QYR A;  3R9T A;  1TG6 A;  1WDK A;  3BPT A;  1VRG A;  4K3W A;  2C8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...