2ZL4A

Crystal structure of h.pylori clpp s99a in complex with the peptide aaaa
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
173
structure length
173
Chain Sequence
b'DIYSRLLKDRIVLLSGEINDSVASSIVAQLLFLEAEDPEKDIGLYINSPGGVITSGLSIYDTMNFIRPDVSTICIGQAAAMGAFLLSCGAKGKRFSLPHSRIMIHQPLGGAQGQASDIEIISNEILRLKGLMNSILAQNSGQSLEQIAKDTDRDFYMSAKEAKEYGLIDKVLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title The structural basis for the activation and peptide recognition of bacterial ClpP
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 64
structure length 173
sequence length 173
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2zl4A00
1XNYA 1N6FA 3P5MA 1EF9A 3PGQA 4ZDEA 3T89A 2VX2A 2IEXA 3OC7A 4JYJA 5DZKA 1UYSA 5CTBA 3L3SA 4FNBA 3N6RB 4MOUA 4Q0GA 1ON9A 4B3JA 4JCSA 3ST9A 5E0SH 3QWDA 2UZFA 5KDRA 3VIVA 3SLLA 2BZRA 3I47A 2J5IB 2D3TA 2ZQQA 2DEOA 4JOTA 3R6HA 4FZWC 3ZW9A 1UYRA 4U1AA 2VSUA 5INGA 3TVUA 4FJWD 5JBWA 5INIA 1XO6A 5DU6A 3NJDA 2EJ5A 4JWVA 3MYBA 3T88A 3OT6A 1UIYA 2A7KA 1OD4A 4U0HA 5DTWA 3KTGA 3H0UA 2X58A 5DZKH 3H02A 2Q2XA 3U9TB 3BF0A 3STAA 3IAVA 1XNWA 3HRXA 1N6DA 3LAOA 5DUFA 4NNQA 2J5GA 3QREA 2VSSF 4WZ8B 2J5SA 4IZCA 3WG5A 4FN7A 4EMMA 1PJHA 4KWBA 4ZDBA 1YG8A 1N6EA 3H0JA 5DUCA 3Q1TA 1VRGA 4JFCA 4EMLA 4F47A 1FC9A 4L8KA 2CBYA 5CTCA 3JU1A 4QIIA 4KNPA 1NZYB 4G2RA 3K50A 3PEAA 4L6WA 3Q7HA 4HC8A 4U0GA 5C9GA 5IKLB 3QXIA 2F9YB 3LKEA 4K2NA 5KDRB 2VSUE 1NZYA 4RCNA 3GF7A 3MFMA 4FN8A 2VSUC 4I52A 2DUBA 5DU8A 5DL1A 1X0UA 3SWXA 4Q1IA 4OG1A 3HE2A 3M6MA 3DJAA 3QYRA 4K3WA 3H0QA 1W2XA 2F9YA 1K32A 3TDCA 4U18A 3GLMA 3TLFA 3BPPA 4LK5A 4EMPA 3RRVA 3DORA 2PPYA 1ON3A 4OLQA 4U0GH 2F6IA 3KTKA 1EF8A 3TT7A 4OMRA 1Q51A 3Q0GA 3FF6A 4I4ZA 1WDLA 2F9IB 1OD2A 3U9SB 3ZW8A 3P85A 1UYTA 4IZDA 2VREA 1O8UA 3H0SA 3ZWAA 2GTRA 3QKAA 1WDMA 3T8AA 4FNDA 5FUSA 4ELWA 2A81A 3TZ3A 5MGBA 3G64A 4FZWA 4IZBA 2F9IA 3M6NA 1PIXA 4JJTA 1Y7OA 3OMEA 3R9SA 5E0NX 3TT6A 3ISAA 1RJMA 3IB9A 1XX4A 2PG8A 2Q34A 1MJ3A 1DCIA 1TYFA 4WCZA 5C90A 4FB8A 2WTBA 3BEZA 4DI1A 2F6QA 4QIJA 3HINA 4RYFA 2W3PA 4GM2A 3V5EA 3P2LA 3PZKA 5DKPA 3KTJA 3Q0JA 2ZL0A 4B3HA 1RJNA 2J5II 1K39A 4B3IA 3K8XA 4ZDFA 4K29A 3RSIA 4GHNA 3MT6A 2ZL2A 3IBBA 3MOYA 2VSUF 1FC7A 1HZDA 4JSBA 2ZQRA 4JYLA 5KJPA 3KQFA 4KD6A 2Q35A 4RYFH 4JVTA 3HP0A 3ZWCA 3R9QA 4QFEA 1FCFA 3FDUA 5G1SA 3T3WA 1WZ8A 1WDKA 3TV5A 4MI2A 3TVWA 3HLN1 4I42A 4ZDDA 3TRRA 1UYVA 4ELXA 2QQ3A 2FZSA 3V5IA 4JCRA 1J7XA 1SG4A 2VSSE 2J5IA 1TG6A 3T8BA 5INFA 5G1QA 3RSTA 3QMJA 4NEKA 1FC6A 4JCQA 1EY3A 2NP9A 2FBMA 1SZOA 3KTIA 3R9TA 1HNOA 1DUBA 4HNKA 5DU4A 1Q52A 2VSSA 3GF3A 5JBXA 1HNUA 3U9RB 4ZDCA 5DTPA 3KTHA 4ZU2A 1JXZA 3GMAA 3NJBA 4KPKA 4ELSA 1YG6A 5E0SA 3QK8A 2C8TA 2FW2A 5FIFA 5G1RA 3R0OA 4U19A 2J5GD 2X24A 3GKBA 2CE3A 2ZL4A 3H81A 4MXIA 1XNVA 2HW5A 2A7SA 4WYOB 4YLHA 3ZWBA 4ASIA 2ZL3A 3QXZA 3PE8A 4Z0MA 4JCTA 2PBPA
chains in the Genus database with same CATH superfamily
1XNYA 1N6FA 3P5MA 1EF9A 3PGQA 4ZDEA 3T89A 2VX2A 2IEXA 3OC7A 4JYJA 5DZKA 1UYSA 5CTBA 3L3SA 4FNBA 3N6RB 4MOUA 4Q0GA 1ON9A 4B3JA 4JCSA 3ST9A 5E0SH 3QWDA 2UZFA 5KDRA 3VIVA 3SLLA 2BZRA 3I47A 2J5IB 2D3TA 2ZQQA 2DEOA 4JOTA 3R6HA 4FZWC 3ZW9A 1UYRA 4U1AA 2VSUA 5INGA 3TVUA 4FJWD 5JBWA 5INIA 1XO6A 5DU6A 3NJDA 2EJ5A 4JWVA 3MYBA 3T88A 3OT6A 1UIYA 2A7KA 1OD4A 4U0HA 5DTWA 3KTGA 3H0UA 2X58A 5DZKH 3H02A 2Q2XA 3U9TB 3BF0A 3STAA 3IAVA 1XNWA 3HRXA 1N6DA 3LAOA 5DUFA 4NNQA 2J5GA 3QREA 4NARA 2VSSF 4WZ8B 2J5SA 4IZCA 3WG5A 4FN7A 4EMMA 1PJHA 4KWBA 4ZDBA 1YG8A 1N6EA 3H0JA 5DUCA 3Q1TA 1VRGA 4JFCA 4EMLA 4F47A 1FC9A 4L8KA 2CBYA 5CTCA 3JU1A 4QIIA 4KNPA 1NZYB 4G2RA 3K50A 3PEAA 4L6WA 3Q7HA 4HC8A 4U0GA 5C9GA 5IKLB 3QXIA 2F9YB 3LKEA 4K2NA 5KDRB 2VSUE 1NZYA 4RCNA 3GF7A 3MFMA 4FN8A 2VSUC 4I52A 2DUBA 5DU8A 5DL1A 1X0UA 3SWXA 4Q1IA 4OG1A 3HE2A 3M6MA 3DJAA 3QYRA 4K3WA 3H0QA 1W2XA 2F9YA 1K32A 4J2UA 3TDCA 4U18A 3GLMA 3TLFA 3BPPA 4LK5A 4EMPA 3RRVA 3DORA 2PPYA 1ON3A 4OLQA 4U0GH 2F6IA 3KTKA 1EF8A 3TT7A 4OMRA 1Q51A 3Q0GA 3FF6A 4I4ZA 1WDLA 2YJGA 2F9IB 1OD2A 3U9SB 3ZW8A 3P85A 1UYTA 4IZDA 2VREA 1O8UA 3H0SA 3ZWAA 2GTRA 3QKAA 1WDMA 3T8AA 4FNDA 5FUSA 4ELWA 2A81A 3TZ3A 5MGBA 3G64A 4FZWA 4IZBA 2F9IA 3M6NA 1PIXA 4JJTA 1Y7OA 3OMEA 3R9SA 5E0NX 3TT6A 3ISAA 1RJMA 3IB9A 1XX4A 2PG8A 2Q34A 1MJ3A 1DCIA 1TYFA 4WCZA 5C90A 4FB8A 2WTBA 3BEZA 4DI1A 2F6QA 4QIJA 3HINA 4RYFA 2W3PA 4GM2A 3V5EA 3P2LA 3PZKA 5DKPA 3KTJA 3Q0JA 2ZL0A 4B3HA 1RJNA 2J5II 1K39A 4B3IA 3K8XA 4ZDFA 4K29A 3RSIA 4GHNA 3MT6A 2ZL2A 3IBBA 4HDTA 3MOYA 2VSUF 1FC7A 1HZDA 4JSBA 2ZQRA 4JYLA 5KJPA 3KQFA 4KD6A 2Q35A 4RYFH 4JVTA 3HP0A 3ZWCA 3R9QA 4QFEA 1FCFA 3FDUA 5G1SA 3T3WA 1WZ8A 1WDKA 3BPTA 3TV5A 4MI2A 3TVWA 3HLN1 4I42A 4ZDDA 3TRRA 1UYVA 4ELXA 2QQ3A 2FZSA 3V5IA 4JCRA 1J7XA 1SG4A 2VSSE 2J5IA 1TG6A 3T8BA 5INFA 5G1QA 3RSTA 3QMJA 4NEKA 1FC6A 4JCQA 1EY3A 2NP9A 2FBMA 1SZOA 3KTIA 3R9TA 1HNOA 1DUBA 4HNKA 5HUQA 5DU4A 1Q52A 2VSSA 3GF3A 5JBXA 1HNUA 3U9RB 4ZDCA 5DTPA 3KTHA 4ZU2A 1JXZA 3GMAA 3NJBA 4KPKA 4ELSA 1YG6A 5E0SA 3QK8A 2C8TA 2FW2A 5FIFA 5G1RA 3R0OA 4U19A 2J5GD 2X24A 3GKBA 2CE3A 2ZL4A 3H81A 4MXIA 1XNVA 2HW5A 2A7SA 4WYOB 4YLHA 3ZWBA 4ASIA 2ZL3A 3QXZA 3PE8A 4Z0MA 4JCTA 2PBPA
chains in the Genus database with same CATH topology
1XNYA 1N6FA 3P5MA 1EF9A 3PGQA 4ZDEA 3T89A 2VX2A 2IEXA 3OC7A 4JYJA 5DZKA 1UYSA 5CTBA 3L3SA 4FNBA 3N6RB 4MOUA 4Q0GA 1ON9A 4B3JA 4JCSA 3ST9A 5E0SH 3QWDA 2UZFA 5KDRA 3VIVA 3SLLA 2BZRA 3I47A 2J5IB 2D3TA 2ZQQA 2DEOA 4JOTA 3R6HA 4FZWC 3ZW9A 1UYRA 4U1AA 2VSUA 5INGA 3TVUA 4FJWD 5JBWA 5INIA 1XO6A 5DU6A 3NJDA 2EJ5A 4JWVA 3MYBA 3T88A 3OT6A 1UIYA 2A7KA 1OD4A 4U0HA 5DTWA 3KTGA 3H0UA 2X58A 5DZKH 3H02A 2Q2XA 3U9TB 3BF0A 3STAA 3IAVA 1XNWA 3HRXA 1N6DA 3LAOA 5DUFA 4NNQA 2J5GA 3QREA 4NARA 2VSSF 4WZ8B 2J5SA 4IZCA 3WG5A 4FN7A 4EMMA 1PJHA 4KWBA 4ZDBA 1YG8A 1N6EA 3H0JA 5DUCA 3Q1TA 1VRGA 4JFCA 4EMLA 4F47A 1FC9A 4L8KA 2CBYA 5CTCA 3JU1A 4QIIA 4KNPA 1NZYB 4G2RA 3K50A 3PEAA 4L6WA 3Q7HA 4HC8A 4U0GA 5C9GA 5IKLB 3QXIA 2F9YB 3LKEA 4K2NA 5KDRB 2VSUE 1NZYA 4RCNA 3GF7A 3MFMA 4FN8A 2VSUC 4I52A 2DUBA 5DU8A 5DL1A 1X0UA 3SWXA 4Q1IA 4OG1A 3HE2A 3M6MA 3DJAA 3QYRA 4K3WA 3H0QA 1W2XA 2F9YA 1K32A 4J2UA 3TDCA 4U18A 3GLMA 3TLFA 3BPPA 4LK5A 4EMPA 3RRVA 3DORA 2PPYA 1ON3A 4OLQA 4U0GH 2F6IA 3KTKA 1EF8A 3TT7A 4OMRA 1Q51A 3Q0GA 3FF6A 4I4ZA 1WDLA 2YJGA 2F9IB 1OD2A 3U9SB 3ZW8A 3P85A 1UYTA 4IZDA 2VREA 1O8UA 3H0SA 3ZWAA 2GTRA 3QKAA 1WDMA 3T8AA 4FNDA 5FUSA 4ELWA 2A81A 3TZ3A 5MGBA 3G64A 4FZWA 4IZBA 2F9IA 3M6NA 1PIXA 4JJTA 1Y7OA 3OMEA 3R9SA 5E0NX 3TT6A 3ISAA 1RJMA 3IB9A 1XX4A 2PG8A 2Q34A 1MJ3A 1DCIA 1TYFA 4WCZA 5C90A 4FB8A 2WTBA 3BEZA 4DI1A 2F6QA 4QIJA 3HINA 4RYFA 2W3PA 4GM2A 3V5EA 3P2LA 3PZKA 5DKPA 3KTJA 3Q0JA 2ZL0A 4B3HA 1RJNA 2J5II 1K39A 4B3IA 3K8XA 4ZDFA 4K29A 3RSIA 4GHNA 3MT6A 2ZL2A 3IBBA 4HDTA 3MOYA 2VSUF 1FC7A 1HZDA 4JSBA 2ZQRA 4JYLA 5KJPA 3KQFA 4KD6A 2Q35A 4RYFH 4JVTA 3HP0A 3ZWCA 3R9QA 4QFEA 1FCFA 3FDUA 5G1SA 3T3WA 1WZ8A 1WDKA 3BPTA 3TV5A 4MI2A 3TVWA 3HLN1 4I42A 4ZDDA 3TRRA 1UYVA 4ELXA 2QQ3A 2FZSA 3V5IA 4JCRA 1J7XA 1SG4A 2VSSE 2J5IA 1TG6A 3T8BA 5INFA 5G1QA 3RSTA 3QMJA 4NEKA 1FC6A 4JCQA 1EY3A 2NP9A 2FBMA 1SZOA 3KTIA 3R9TA 1HNOA 1DUBA 4HNKA 5HUQA 5DU4A 1Q52A 2VSSA 3GF3A 5JBXA 1HNUA 3U9RB 4ZDCA 5DTPA 3KTHA 4ZU2A 1JXZA 3GMAA 3NJBA 4KPKA 4ELSA 1YG6A 5E0SA 3QK8A 2C8TA 2FW2A 5FIFA 5G1RA 3R0OA 4U19A 2J5GD 2X24A 3GKBA 2CE3A 2ZL4A 3H81A 4MXIA 1XNVA 2HW5A 2A7SA 4WYOB 4YLHA 3ZWBA 4ASIA 2ZL3A 3QXZA 3PE8A 4Z0MA 4JCTA 2PBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNY A;  1N6F A;  3P5M A;  1EF9 A;  3PGQ A;  4ZDE A;  3T89 A;  2VX2 A;  2IEX A;  3OC7 A;  4JYJ A;  5DZK A;  1UYS A;  5CTB A;  3L3S A;  4FNB A;  3N6R B;  4MOU A;  4Q0G A;  1ON9 A;  4B3J A;  4JCS A;  3ST9 A;  5E0S H;  3QWD A;  2UZF A;  5KDR A;  3VIV A;  3SLL A;  2BZR A;  3I47 A;  2J5I B;  2D3T A;  2ZQQ A;  2DEO A;  4JOT A;  3R6H A;  4FZW C;  3ZW9 A;  1UYR A;  4U1A A;  2VSU A;  5ING A;  3TVU A;  4FJW D;  5JBW A;  5INI A;  1XO6 A;  5DU6 A;  3NJD A;  2EJ5 A;  4JWV A;  3MYB A;  3T88 A;  3OT6 A;  1UIY A;  2A7K A;  1OD4 A;  4U0H A;  5DTW A;  3KTG A;  3H0U A;  2X58 A;  5DZK H;  3H02 A;  2Q2X A;  3U9T B;  3BF0 A;  3STA A;  3IAV A;  1XNW A;  3HRX A;  1N6D A;  3LAO A;  5DUF A;  4NNQ A;  2J5G A;  3QRE A;  2VSS F;  4WZ8 B;  2J5S A;  4IZC A;  3WG5 A;  4FN7 A;  4EMM A;  1PJH A;  4KWB A;  4ZDB A;  1YG8 A;  1N6E A;  3H0J A;  5DUC A;  3Q1T A;  1VRG A;  4JFC A;  4EML A;  4F47 A;  1FC9 A;  4L8K A;  2CBY A;  5CTC A;  3JU1 A;  4QII A;  4KNP A;  1NZY B;  4G2R A;  3K50 A;  3PEA A;  4L6W A;  3Q7H A;  4HC8 A;  4U0G A;  5C9G A;  5IKL B;  3QXI A;  2F9Y B;  3LKE A;  4K2N A;  5KDR B;  2VSU E;  1NZY A;  4RCN A;  3GF7 A;  3MFM A;  4FN8 A;  2VSU C;  4I52 A;  2DUB A;  5DU8 A;  5DL1 A;  1X0U A;  3SWX A;  4Q1I A;  4OG1 A;  3HE2 A;  3M6M A;  3DJA A;  3QYR A;  4K3W A;  3H0Q A;  1W2X A;  2F9Y A;  1K32 A;  3TDC A;  4U18 A;  3GLM A;  3TLF A;  3BPP A;  4LK5 A;  4EMP A;  3RRV A;  3DOR A;  2PPY A;  1ON3 A;  4OLQ A;  4U0G H;  2F6I A;  3KTK A;  1EF8 A;  3TT7 A;  4OMR A;  1Q51 A;  3Q0G A;  3FF6 A;  4I4Z A;  1WDL A;  2F9I B;  1OD2 A;  3U9S B;  3ZW8 A;  3P85 A;  1UYT A;  4IZD A;  2VRE A;  1O8U A;  3H0S A;  3ZWA A;  2GTR A;  3QKA A;  1WDM A;  3T8A A;  4FND A;  5FUS A;  4ELW A;  2A81 A;  3TZ3 A;  5MGB A;  3G64 A;  4FZW A;  4IZB A;  2F9I A;  3M6N A;  1PIX A;  4JJT A;  1Y7O A;  3OME A;  3R9S A;  5E0N X;  3TT6 A;  3ISA A;  1RJM A;  3IB9 A;  1XX4 A;  2PG8 A;  2Q34 A;  1MJ3 A;  1DCI A;  1TYF A;  4WCZ A;  5C90 A;  4FB8 A;  2WTB A;  3BEZ A;  4DI1 A;  2F6Q A;  4QIJ A;  3HIN A;  4RYF A;  2W3P A;  4GM2 A;  3V5E A;  3P2L A;  3PZK A;  5DKP A;  3KTJ A;  3Q0J A;  2ZL0 A;  4B3H A;  1RJN A;  2J5I I;  1K39 A;  4B3I A;  3K8X A;  4ZDF A;  4K29 A;  3RSI A;  4GHN A;  3MT6 A;  2ZL2 A;  3IBB A;  3MOY A;  2VSU F;  1FC7 A;  1HZD A;  4JSB A;  2ZQR A;  4JYL A;  5KJP A;  3KQF A;  4KD6 A;  2Q35 A;  4RYF H;  4JVT A;  3HP0 A;  3ZWC A;  3R9Q A;  4QFE A;  1FCF A;  3FDU A;  5G1S A;  3T3W A;  1WZ8 A;  1WDK A;  3TV5 A;  4MI2 A;  3TVW A;  3HLN 1;  4I42 A;  4ZDD A;  3TRR A;  1UYV A;  4ELX A;  2QQ3 A;  2FZS A;  3V5I A;  4JCR A;  1J7X A;  1SG4 A;  2VSS E;  2J5I A;  1TG6 A;  3T8B A;  5INF A;  5G1Q A;  3RST A;  3QMJ A;  4NEK A;  1FC6 A;  4JCQ A;  1EY3 A;  2NP9 A;  2FBM A;  1SZO A;  3KTI A;  3R9T A;  1HNO A;  1DUB A;  4HNK A;  5DU4 A;  1Q52 A;  2VSS A;  3GF3 A;  5JBX A;  1HNU A;  3U9R B;  4ZDC A;  5DTP A;  3KTH A;  4ZU2 A;  1JXZ A;  3GMA A;  3NJB A;  4KPK A;  4ELS A;  1YG6 A;  5E0S A;  3QK8 A;  2C8T A;  2FW2 A;  5FIF A;  5G1R A;  3R0O A;  4U19 A;  2J5G D;  2X24 A;  3GKB A;  2CE3 A;  2ZL4 A;  3H81 A;  4MXI A;  1XNV A;  2HW5 A;  2A7S A;  4WYO B;  4YLH A;  3ZWB A;  4ASI A;  2ZL3 A;  3QXZ A;  3PE8 A;  4Z0M A;  4JCT A;  2PBP A; 
#chains in the Genus database with same CATH topology
 1XNY A;  1N6F A;  3P5M A;  1EF9 A;  3PGQ A;  4ZDE A;  3T89 A;  2VX2 A;  2IEX A;  3OC7 A;  4JYJ A;  5DZK A;  1UYS A;  5CTB A;  3L3S A;  4FNB A;  3N6R B;  4MOU A;  4Q0G A;  1ON9 A;  4B3J A;  4JCS A;  3ST9 A;  5E0S H;  3QWD A;  2UZF A;  5KDR A;  3VIV A;  3SLL A;  2BZR A;  3I47 A;  2J5I B;  2D3T A;  2ZQQ A;  2DEO A;  4JOT A;  3R6H A;  4FZW C;  3ZW9 A;  1UYR A;  4U1A A;  2VSU A;  5ING A;  3TVU A;  4FJW D;  5JBW A;  5INI A;  1XO6 A;  5DU6 A;  3NJD A;  2EJ5 A;  4JWV A;  3MYB A;  3T88 A;  3OT6 A;  1UIY A;  2A7K A;  1OD4 A;  4U0H A;  5DTW A;  3KTG A;  3H0U A;  2X58 A;  5DZK H;  3H02 A;  2Q2X A;  3U9T B;  3BF0 A;  3STA A;  3IAV A;  1XNW A;  3HRX A;  1N6D A;  3LAO A;  5DUF A;  4NNQ A;  2J5G A;  3QRE A;  4NAR A;  2VSS F;  4WZ8 B;  2J5S A;  4IZC A;  3WG5 A;  4FN7 A;  4EMM A;  1PJH A;  4KWB A;  4ZDB A;  1YG8 A;  1N6E A;  3H0J A;  5DUC A;  3Q1T A;  1VRG A;  4JFC A;  4EML A;  4F47 A;  1FC9 A;  4L8K A;  2CBY A;  5CTC A;  3JU1 A;  4QII A;  4KNP A;  1NZY B;  4G2R A;  3K50 A;  3PEA A;  4L6W A;  3Q7H A;  4HC8 A;  4U0G A;  5C9G A;  5IKL B;  3QXI A;  2F9Y B;  3LKE A;  4K2N A;  5KDR B;  2VSU E;  1NZY A;  4RCN A;  3GF7 A;  3MFM A;  4FN8 A;  2VSU C;  4I52 A;  2DUB A;  5DU8 A;  5DL1 A;  1X0U A;  3SWX A;  4Q1I A;  4OG1 A;  3HE2 A;  3M6M A;  3DJA A;  3QYR A;  4K3W A;  3H0Q A;  1W2X A;  2F9Y A;  1K32 A;  4J2U A;  3TDC A;  4U18 A;  3GLM A;  3TLF A;  3BPP A;  4LK5 A;  4EMP A;  3RRV A;  3DOR A;  2PPY A;  1ON3 A;  4OLQ A;  4U0G H;  2F6I A;  3KTK A;  1EF8 A;  3TT7 A;  4OMR A;  1Q51 A;  3Q0G A;  3FF6 A;  4I4Z A;  1WDL A;  2YJG A;  2F9I B;  1OD2 A;  3U9S B;  3ZW8 A;  3P85 A;  1UYT A;  4IZD A;  2VRE A;  1O8U A;  3H0S A;  3ZWA A;  2GTR A;  3QKA A;  1WDM A;  3T8A A;  4FND A;  5FUS A;  4ELW A;  2A81 A;  3TZ3 A;  5MGB A;  3G64 A;  4FZW A;  4IZB A;  2F9I A;  3M6N A;  1PIX A;  4JJT A;  1Y7O A;  3OME A;  3R9S A;  5E0N X;  3TT6 A;  3ISA A;  1RJM A;  3IB9 A;  1XX4 A;  2PG8 A;  2Q34 A;  1MJ3 A;  1DCI A;  1TYF A;  4WCZ A;  5C90 A;  4FB8 A;  2WTB A;  3BEZ A;  4DI1 A;  2F6Q A;  4QIJ A;  3HIN A;  4RYF A;  2W3P A;  4GM2 A;  3V5E A;  3P2L A;  3PZK A;  5DKP A;  3KTJ A;  3Q0J A;  2ZL0 A;  4B3H A;  1RJN A;  2J5I I;  1K39 A;  4B3I A;  3K8X A;  4ZDF A;  4K29 A;  3RSI A;  4GHN A;  3MT6 A;  2ZL2 A;  3IBB A;  4HDT A;  3MOY A;  2VSU F;  1FC7 A;  1HZD A;  4JSB A;  2ZQR A;  4JYL A;  5KJP A;  3KQF A;  4KD6 A;  2Q35 A;  4RYF H;  4JVT A;  3HP0 A;  3ZWC A;  3R9Q A;  4QFE A;  1FCF A;  3FDU A;  5G1S A;  3T3W A;  1WZ8 A;  1WDK A;  3BPT A;  3TV5 A;  4MI2 A;  3TVW A;  3HLN 1;  4I42 A;  4ZDD A;  3TRR A;  1UYV A;  4ELX A;  2QQ3 A;  2FZS A;  3V5I A;  4JCR A;  1J7X A;  1SG4 A;  2VSS E;  2J5I A;  1TG6 A;  3T8B A;  5INF A;  5G1Q A;  3RST A;  3QMJ A;  4NEK A;  1FC6 A;  4JCQ A;  1EY3 A;  2NP9 A;  2FBM A;  1SZO A;  3KTI A;  3R9T A;  1HNO A;  1DUB A;  4HNK A;  5HUQ A;  5DU4 A;  1Q52 A;  2VSS A;  3GF3 A;  5JBX A;  1HNU A;  3U9R B;  4ZDC A;  5DTP A;  3KTH A;  4ZU2 A;  1JXZ A;  3GMA A;  3NJB A;  4KPK A;  4ELS A;  1YG6 A;  5E0S A;  3QK8 A;  2C8T A;  2FW2 A;  5FIF A;  5G1R A;  3R0O A;  4U19 A;  2J5G D;  2X24 A;  3GKB A;  2CE3 A;  2ZL4 A;  3H81 A;  4MXI A;  1XNV A;  2HW5 A;  2A7S A;  4WYO B;  4YLH A;  3ZWB A;  4ASI A;  2ZL3 A;  3QXZ A;  3PE8 A;  4Z0M A;  4JCT A;  2PBP A; 
#chains in the Genus database with same CATH homology
 1XNY A;  1N6F A;  3P5M A;  1EF9 A;  3PGQ A;  4ZDE A;  3T89 A;  2VX2 A;  2IEX A;  3OC7 A;  4JYJ A;  5DZK A;  1UYS A;  5CTB A;  3L3S A;  4FNB A;  3N6R B;  4MOU A;  4Q0G A;  1ON9 A;  4B3J A;  4JCS A;  3ST9 A;  5E0S H;  3QWD A;  2UZF A;  5KDR A;  3VIV A;  3SLL A;  2BZR A;  3I47 A;  2J5I B;  2D3T A;  2ZQQ A;  2DEO A;  4JOT A;  3R6H A;  4FZW C;  3ZW9 A;  1UYR A;  4U1A A;  2VSU A;  5ING A;  3TVU A;  4FJW D;  5JBW A;  5INI A;  1XO6 A;  5DU6 A;  3NJD A;  2EJ5 A;  4JWV A;  3MYB A;  3T88 A;  3OT6 A;  1UIY A;  2A7K A;  1OD4 A;  4U0H A;  5DTW A;  3KTG A;  3H0U A;  2X58 A;  5DZK H;  3H02 A;  2Q2X A;  3U9T B;  3BF0 A;  3STA A;  3IAV A;  1XNW A;  3HRX A;  1N6D A;  3LAO A;  5DUF A;  4NNQ A;  2J5G A;  3QRE A;  4NAR A;  2VSS F;  4WZ8 B;  2J5S A;  4IZC A;  3WG5 A;  4FN7 A;  4EMM A;  1PJH A;  4KWB A;  4ZDB A;  1YG8 A;  1N6E A;  3H0J A;  5DUC A;  3Q1T A;  1VRG A;  4JFC A;  4EML A;  4F47 A;  1FC9 A;  4L8K A;  2CBY A;  5CTC A;  3JU1 A;  4QII A;  4KNP A;  1NZY B;  4G2R A;  3K50 A;  3PEA A;  4L6W A;  3Q7H A;  4HC8 A;  4U0G A;  5C9G A;  5IKL B;  3QXI A;  2F9Y B;  3LKE A;  4K2N A;  5KDR B;  2VSU E;  1NZY A;  4RCN A;  3GF7 A;  3MFM A;  4FN8 A;  2VSU C;  4I52 A;  2DUB A;  5DU8 A;  5DL1 A;  1X0U A;  3SWX A;  4Q1I A;  4OG1 A;  3HE2 A;  3M6M A;  3DJA A;  3QYR A;  4K3W A;  3H0Q A;  1W2X A;  2F9Y A;  1K32 A;  4J2U A;  3TDC A;  4U18 A;  3GLM A;  3TLF A;  3BPP A;  4LK5 A;  4EMP A;  3RRV A;  3DOR A;  2PPY A;  1ON3 A;  4OLQ A;  4U0G H;  2F6I A;  3KTK A;  1EF8 A;  3TT7 A;  4OMR A;  1Q51 A;  3Q0G A;  3FF6 A;  4I4Z A;  1WDL A;  2YJG A;  2F9I B;  1OD2 A;  3U9S B;  3ZW8 A;  3P85 A;  1UYT A;  4IZD A;  2VRE A;  1O8U A;  3H0S A;  3ZWA A;  2GTR A;  3QKA A;  1WDM A;  3T8A A;  4FND A;  5FUS A;  4ELW A;  2A81 A;  3TZ3 A;  5MGB A;  3G64 A;  4FZW A;  4IZB A;  2F9I A;  3M6N A;  1PIX A;  4JJT A;  1Y7O A;  3OME A;  3R9S A;  5E0N X;  3TT6 A;  3ISA A;  1RJM A;  3IB9 A;  1XX4 A;  2PG8 A;  2Q34 A;  1MJ3 A;  1DCI A;  1TYF A;  4WCZ A;  5C90 A;  4FB8 A;  2WTB A;  3BEZ A;  4DI1 A;  2F6Q A;  4QIJ A;  3HIN A;  4RYF A;  2W3P A;  4GM2 A;  3V5E A;  3P2L A;  3PZK A;  5DKP A;  3KTJ A;  3Q0J A;  2ZL0 A;  4B3H A;  1RJN A;  2J5I I;  1K39 A;  4B3I A;  3K8X A;  4ZDF A;  4K29 A;  3RSI A;  4GHN A;  3MT6 A;  2ZL2 A;  3IBB A;  4HDT A;  3MOY A;  2VSU F;  1FC7 A;  1HZD A;  4JSB A;  2ZQR A;  4JYL A;  5KJP A;  3KQF A;  4KD6 A;  2Q35 A;  4RYF H;  4JVT A;  3HP0 A;  3ZWC A;  3R9Q A;  4QFE A;  1FCF A;  3FDU A;  5G1S A;  3T3W A;  1WZ8 A;  1WDK A;  3BPT A;  3TV5 A;  4MI2 A;  3TVW A;  3HLN 1;  4I42 A;  4ZDD A;  3TRR A;  1UYV A;  4ELX A;  2QQ3 A;  2FZS A;  3V5I A;  4JCR A;  1J7X A;  1SG4 A;  2VSS E;  2J5I A;  1TG6 A;  3T8B A;  5INF A;  5G1Q A;  3RST A;  3QMJ A;  4NEK A;  1FC6 A;  4JCQ A;  1EY3 A;  2NP9 A;  2FBM A;  1SZO A;  3KTI A;  3R9T A;  1HNO A;  1DUB A;  4HNK A;  5HUQ A;  5DU4 A;  1Q52 A;  2VSS A;  3GF3 A;  5JBX A;  1HNU A;  3U9R B;  4ZDC A;  5DTP A;  3KTH A;  4ZU2 A;  1JXZ A;  3GMA A;  3NJB A;  4KPK A;  4ELS A;  1YG6 A;  5E0S A;  3QK8 A;  2C8T A;  2FW2 A;  5FIF A;  5G1R A;  3R0O A;  4U19 A;  2J5G D;  2X24 A;  3GKB A;  2CE3 A;  2ZL4 A;  3H81 A;  4MXI A;  1XNV A;  2HW5 A;  2A7S A;  4WYO B;  4YLH A;  3ZWB A;  4ASI A;  2ZL3 A;  3QXZ A;  3PE8 A;  4Z0M A;  4JCT A;  2PBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...