2ZL6A

Atomic resolution structural characterization of recognition of histo-blood group antigens by norwalk virus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
286
structure length
286
Chain Sequence
FTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Atomic resolution structural characterization of recognition of histo-blood group antigens by Norwalk virus
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 65
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 2zl6A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 2zl6A01
4RM0A 5BSYA 5F4OA 4X05A 3ASQA 3LQEA 4Z4YA 5IYWA 2OBSA 4QVJA 4X06A 4OPVA 2OBRA 3BY1A 3SKBA 3ASSA 4Z4TA 3Q39A 4OPSA 4P2NA 4P3IA 4Z4VA 5IYNA 3ASPA 5J3OA 4RDLA 4Z4SA 1IHMA 2ZL6A 4RDKA 3V7AA 3SJPA 4QVAA 5IYQA 3PA1A 4OOSA 3RY8A 5IYRA 4RDJA 4Z4ZA 2ZL5A 3ONYA 3Q6RA 3BY2A 4OP7A 3SLDA 4Z4WA 5HZAA 3PUNA 4WZEA 4P25A 4P1VA 3SEJA 4OOVA 5IYPA 4X7EA 4WZKA 3PUMA 3Q6QA 3PVDA 5HZBA 4X07A 3ONUA 3PA2A 5BSXA 4WZLA 5F4JA 4X7DA 4P12A 4P26A 5E6TA 3BQJA 4OPOA 3ASRA 4X7CA 4QUZA 4OOXA 2OBTA 3R6JA 5J35A 4RPDA 3LQ6A 4QV2A 2ZL7A 4Z4RA 3Q38A 5F4MA 4Z4UA 3SLNA 4ROXA 5KW9A 4RLZA 4WZTA 3ASTA 3R6KA 3D26A 3Q3AA 4X7FA 4RPBA 4X0CA
chains in the Genus database with same CATH superfamily
4HE6A 5A88A 5BSYA 4KKTA 1A8PA 3ASQA 3W2GA 1WU8A 1KK0A 1JA0A 2OBSA 3BNWA 2CW5A 2VBTA 3ZBUA 2EIXA 4X06A 1KC8D 3QSYA 2CRVA 3OOCA 3ISXA 1K73D 2OBRA 4B48A 2BGJA 3BY1A 1QFYA 1VQMB 1WPCA 3LVBA 2Q6IA 3A8JA 1NRKA 4Z4TA 1Q81D 4KKUA 1PJ5A 1QUFA 3B8HA 3OE7A 1DARA 1EFCA 4G5GA 4UZUA 5HXBA 4Q7JB 2XGJA 2PLFA 1FNCA 1Q86D 1N0VC 3QFRA 3CCRB 5FO1A 5GV7A 4R71A 2OK7A 1QGAA 4BPRA 2J7KA 1E1QA 2GJRA 3CCVB 1E62A 3J81k 2QEXB 2HLDA 1VQ9B 1SKYB 1FX0A 2ZXHA 3OKXA 3SJPA 4TMXA 5IYQA 3VR6A 4PGOA 4XKVA 3OEHA 1UD6A 1FNMA 3U6BA 2ZBUA 3KEWA 2DYIA 2RC5A 3ZPNA 2CF4A 4PAAA 3G05A 4P6YA 1FRNA 4RCYA 3FJOA 1JJ2B 5H5JA 1VF7A 1AMOA 1YJ9B 2YWHA 1VHEA 3HAGA 1H42A 4YAWA 1S72B 4NNJA 1I8DA 1QUEA 2D9RA 2VJIA 1GR1A 3BY2A 3NE5B 4RD3A 4Y9RA 3ZZ0A 1YLOA 4OP7A 4ACAA 1G7RA 3GVLA 4P22A 3CPWB 1KTVA 3PUNA 2BPOA 3FPKA 2YWGA 4P25A 5A8AA 1FDRA 4M53A 4LBVA 2DCUA 3CW2A 3CC2B 1COWA 1KMHA 2C5BA 4XN3A 4X7EA 1ZM2A 4C0SA 3ZBTA 1K9MD 2HCJB 3ZC3A 3VNUA 1EP3B 1WSVA 1HVXA 1KK3A 4LBWA 1Q7YD 4P3YA 4X07A 3ONUA 1HA3A 4IW3B 1I18A 1ZM3A 1OGJA 4M4SA 3AGQA 2BN4A 3ZUGA 2E1RA 4XL9A 1KQSB 4B3FX 1RQPA 4Z1MA 2OTJB 1M1KD 4X7CA 3H94A 4NBSA 1S0UA 2CK3A 3OZUA 4XONA 1QGYA 4H9GA 3QFCA 1N0UA 1NB0A 2GREA 2VBSA 3WXMA 4LC0A 1H85A 4QV2A 5FO0A 2VZLA 4Z4RA 4DNRB 4XKWA 5JBQA 3A3BA 5F4MA 1JNYA 2BVNA 2QTZA 3I1FA 3FKSA 5IK2A 4B47A 1E3ZA 2X53S 4WZTA 5FNZA 2E1BA 5FIUA 4M0LA 1ZM9A 2X0KA 3Q3AA 4HE5A 4ZCIA 2DETA 1IJEA 3W5VA 2C77A 5EMNA 3A8KA 4UZEA 1FRQA 3CP8A 4RD2A 1ZUNB 1F60A 1QX4A 1VQOB 1V0FA 1W87A 5F4OA 3OP1A 1WP6A 3A35A 4Z4YA 3CXCB 5IYWA 3CMMA 4YAOA 4C43A 4XMYA 2QN6A 4PC2A 4QVJA 4TMZA 1WORA 2XZOA 2XNJA 3BCFA 4Y9UA 4II3A 2VBUA 4OPVA 4KKSA 4ACBA 1P4MA 1NDHA 4AF7A 5TR9A 1R5OA 1DG1G 2F43A 2NPFA 1G7CA 3AVYA 1YJNB 1KRHA 3I56B 1VJSA 4X8IA 2C4UA 4XR6A 4RJLA 4PC6A 4YALA 1EFRA 4ASUA 1OB5A 4G7XA 4YAUA 1QVGB 4RDLA 1D1NA 5DS0A 4LBYA 3WNBA 4XOTA 1IHMA 2ZL6A 1BLIA 1OHHA 3CCLB 2QTLA 3ES9A 2VNJA 2WPDA 4AC9A 5B6IA 4XNFA 3CP2A 2V7TA 3RY8A 2FX3A 1E64A 4DK1A 3WYAA 1GAWA 1RQRA 4RDJA 4Z4ZA 5IYRA 1VQNB 2KVOA 4N3NA 1JA1A 2YWEA 1OB2A 3T56B 2F4NA 2V7UA 3OW2B 4XD7A 4NCNA 2ZL5A 3WBKA 3BC9A 2V7VA 3Q6RA 4TMWA 3CPXA 1G7SA 2BGIA 3SLDA 5HZAA 1UD8A 4L8JA 1UD4A 3OZVA 1YX2A 2C4TA 4FN5A 4P1VA 3SEJA 2WJVA 4B3GA 2Q6OA 2WR8A 4OOVA 3B78A 3AVUA 2VNKA 3CMEB 3CMAB 3VNVA 2CBXA 1V5VA 3FPPA 4PC1A 3PA2A 4WZLA 1V0EA 2ZZEA 1VQKB 1BX0A 4P6VF 4P26A 4ZCLA 4K1XA 1G7TA 3MCAA 3A1PA 1EWYA 1T6YA 3ASRA 2PIAA 1VQ8B 4TT3A 1N06A 4QUZA 3CD6B 3QE2A 1BX1A 2AHOA 3JQRA 5H59A 1N8RD 5TV2A 4ZGNB 4U9UA 2OYNA 3LQ6A 1VQ7B 1UMKA 4HIZA 1HZEA 3CCJB 3A3GA 2GPJA 4YHBA 3DDYA 5AN9A 4Z4UA 3SLNA 3BCDA 2QDXA 4YAFA 4TMTA 3ZZTA 4B43A 1KK1A 1QG0A 1PJ6A 3MHPA 1TVCA 4WWVA 1UD2A 1M90D 1XFOA 3R6KA 3D26A 2I1LA 3MMPA 4X7FA 3GVJA 4X0CA 1T5EA 1CNEA 2X85A 1BPLA 1W0JA 2V7WA 1W34A 1FNBA 1N07A 1MRZA 3LQEA 3CCUB 2PE3A 2DEUA 1KJZA 1T6XA 2GQFA 4B44A 3CRZA 1W9XA 4F7DA 2GJKA 3AVVA 1DDIA 2BMWA 4G1BA 4PC3A 3AGPA 1AIPA 2FVGA 2ZZFA 1EP1B 3GIRA 1N08A 5DSZA 3I55B 4Y7CA 4G1VA 3ASSA 3T53B 2JDIA 2XOKA 3G4SB 3WNDA 1VQPB 5HKKA 1ZM4A 1NJID 2C2WA 1DDGA 4OPSA 5LMZA 3V76A 2W6IA 4XLCA 4DNTB 1E43A 2DOGA 5IYNA 1XQBA 2C78A 2V7QA 4XLEA 3ASPA 5J3OA 4TMVA 4Z4SA 2VJJA 5FA6A 3GVKA 2ZZQA 2JN9A 1KD1D 2OK8A 1EFTA 4ZGQB 2WJYA 3WNCA 3OJWA 3OEEA 4OOSA 1WSRA 1XB2A 1CQXA 2X8KA 2Q6KA 1S4MA 2BV3A 1VQLB 1NB9A 2WZNA 3ZZUA 5KNLA 4FWTA 2HMAA 5THXA 1H8EA 4JMQA 3WBJA 3AVXA 3JU4A 4RD4A 3P27A 1SKQA 2JJ1A 2R9VA 3B82A 4N3GA 3ONYA 3CTAA 2B7CA 5GV8A 2M5SA 2DIEA 4B3XA 3H9NA 4DQKA 4ZV4A 1W2BB 1PJ7A 2GK7A 2ZTGA 2QA4B 2DERA 3GSIA 3G6EB 2Z6BD 5IYPA 4RD1A 3WQZA 1PKVA 3PVDA 5HZBA 3CCMB 3W2EA 1BJKA 3G71B 4CQJA 1OGIA 1UD5A 5BSXA 4QHYA 1EP2B 1B2RA 4DK0A 2F1MA 2XZPA 2QGGA 5L46A 3CB4A 1YITB 1GAQA 2C5HA 4XLAA 1E63A 1D8TA 2PMDA 4OPOA 3JQQA 4MYUA 1WOPA 4G6IA 1YHQB 1OB0A 4OOXA 2OBTA 3R6JA 5J35A 3W5HA 2OTLB 1TUIA 2ZBVA 4RPDA 1U2RA 1MABA 2X6YA 1T6ZA 4RD0A 2ZL7A 1NBMA 3AVTA 2LZJA 2DY1A 2XEXA 2CNDA 1SM4A 3Q38A 4XORA 1EFUA 3QFTA 4ROXA 4XLHA 4UZFA 1VQ6B 2BM0A 4J0QA 1E1RA 3CCQB 3ASTA 3CC4B 2V4DA 1WOSA 2R6HA 3U6KA 2RC6A 1W35A 1VQ5B 3AVWA 2F1LA 4M1KA 1ELOA 3WY9A 2XNCA 2CC2A 4MYTA 4YXWA 3SJZA 1CNFA 2X6XA 5FL7A 3VMFA 3PENA 1IJFA 4RCZA 4XOPA 1EXMA 3OJXA 4RM0A 5CDFA 4TSFA 4X05A 3VO1A 1R5NA 4PC7A 2NV4A 4TN1A 3CC7B 3CCEB 3OZWA 1QGZA 3W2IA 1TTTA 4EH1A 1F20A 3OW7A 4AF6A 5A89A 2GJPA 4RD6A 3E1YE 2W6JA 4XQFA 4UAJA 1R5BA 3SKBA 1YI2B 1E79A 3OFNA 1K8AD 2JIZA 3GQBA 2V7XA 3W2HA 2HDNB 2GK6A 3Q39A 3OPOA 4WQMA 1H8HA 1IB0A 2V31A 4P2NA 4ZCMA 2B5OA 2ZZGA 4P3IA 3BH4A 4YELA 2D74A 4E0FA 2P3MA 3A8IA 4Z4VA 3ZIAA 1BQEA 1QFJA 1BMFA 2ZITA 1Q9SA 2X6WA 4RDKA 5TY0A 3W2FA 3V7AA 2D3NA 1WOOA 4QVAA 2Q6LA 2VBVA 2ZXIA 3E20A 4XM3A 1Y0RA 1YIJB 2BSAA 3PA1A 3T51B 3CESA 1GVHA 4M2LA 1K28D 2VNIA 1VLYA 2VNHA 1N05A 2BM1A 3KL9A 1VQ4B 2WYRA 1QFZA 3OAAA 2X3UA 4YEJA 3CCSB 4LBZA 4Z4WA 1W0KA 4WZEA 2ZTNA 3P26A 2JJ2A 3JQPA 3VO2A 1KK2A 4WZKA 3PUMA 4QFMA 2WZPP 1KZLA 3Q6QA 3LO8A 4PABA 1XE1A 2QMUA 1YJWB 3W5UA 4FXUA 4TKOB 5F4JA 4X7DA 1I7PA 1J9ZA 2EFGA 4P12A 2BF4A 3LNNA 1D2EA 4G7WA 1TLLA 1WTHD 2D3LA 3BQJA 5E6TA 1JB9A 1WDTA 3U2QA 1B23P 4GQNA 4XN0A 1GJRA 4B4DA 5TRDA 4II2A 1QH0A 1E3XA 2XNDA 1QVFB 3QFSA 1GO2A 1Q82D 4DQLA 4FK8A 4XLFA 5KW9A 1VLOA 4RLZA 1VHOA 2B7BA 2WSSA 2QE7A 4AVZA 1Y0YA 4P9SA 1UD3A 2XZLA 2VYQA 2YWFA 4RPBA 5DN6A 1FNDA 5KSWB
chains in the Genus database with same CATH topology
4RM0A 5BSYA 5F4OA 4X05A 3ASQA 3LQEA 4Z4YA 5IYWA 2OBSA 4QVJA 4X06A 4OPVA 2OBRA 3BY1A 3SKBA 3ASSA 4Z4TA 3Q39A 4OPSA 4P2NA 4P3IA 4Z4VA 5IYNA 3ASPA 5J3OA 4RDLA 4Z4SA 1IHMA 2ZL6A 4RDKA 3V7AA 3SJPA 4QVAA 5IYQA 3PA1A 4OOSA 3RY8A 5IYRA 4RDJA 4Z4ZA 2ZL5A 3ONYA 3Q6RA 3BY2A 4OP7A 3SLDA 4Z4WA 5HZAA 3PUNA 4WZEA 4P25A 4P1VA 3SEJA 4OOVA 5IYPA 4X7EA 4WZKA 3PUMA 3Q6QA 3PVDA 5HZBA 4X07A 3ONUA 3PA2A 5BSXA 4WZLA 5F4JA 4X7DA 4P12A 4P26A 5E6TA 3BQJA 4OPOA 3ASRA 4X7CA 4QUZA 4OOXA 2OBTA 3R6JA 5J35A 4RPDA 3LQ6A 4QV2A 2ZL7A 4Z4RA 3Q38A 5F4MA 4Z4UA 3SLNA 4ROXA 5KW9A 4RLZA 4WZTA 3ASTA 3R6KA 3D26A 3Q3AA 4X7FA 4RPBA 4X0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RM0 A;  5BSY A;  5F4O A;  4X05 A;  3ASQ A;  3LQE A;  4Z4Y A;  5IYW A;  2OBS A;  4QVJ A;  4X06 A;  4OPV A;  2OBR A;  3BY1 A;  3SKB A;  3ASS A;  4Z4T A;  3Q39 A;  4OPS A;  4P2N A;  4P3I A;  4Z4V A;  5IYN A;  3ASP A;  5J3O A;  4RDL A;  4Z4S A;  1IHM A;  2ZL6 A;  4RDK A;  3V7A A;  3SJP A;  4QVA A;  5IYQ A;  3PA1 A;  4OOS A;  3RY8 A;  5IYR A;  4RDJ A;  4Z4Z A;  2ZL5 A;  3ONY A;  3Q6R A;  3BY2 A;  4OP7 A;  3SLD A;  4Z4W A;  5HZA A;  3PUN A;  4WZE A;  4P25 A;  4P1V A;  3SEJ A;  4OOV A;  5IYP A;  4X7E A;  4WZK A;  3PUM A;  3Q6Q A;  3PVD A;  5HZB A;  4X07 A;  3ONU A;  3PA2 A;  5BSX A;  4WZL A;  5F4J A;  4X7D A;  4P12 A;  4P26 A;  5E6T A;  3BQJ A;  4OPO A;  3ASR A;  4X7C A;  4QUZ A;  4OOX A;  2OBT A;  3R6J A;  5J35 A;  4RPD A;  3LQ6 A;  4QV2 A;  2ZL7 A;  4Z4R A;  3Q38 A;  5F4M A;  4Z4U A;  3SLN A;  4ROX A;  5KW9 A;  4RLZ A;  4WZT A;  3AST A;  3R6K A;  3D26 A;  3Q3A A;  4X7F A;  4RPB A;  4X0C A; 
#chains in the Genus database with same CATH topology
 4HE6 A;  5A88 A;  5BSY A;  4KKT A;  1A8P A;  3ASQ A;  3W2G A;  1WU8 A;  1KK0 A;  1JA0 A;  2OBS A;  3BNW A;  2CW5 A;  2VBT A;  3ZBU A;  2EIX A;  4X06 A;  1KC8 D;  3QSY A;  2CRV A;  3OOC A;  3ISX A;  1K73 D;  2OBR A;  4B48 A;  2BGJ A;  3BY1 A;  1QFY A;  1VQM B;  1WPC A;  3LVB A;  2Q6I A;  3A8J A;  1NRK A;  4Z4T A;  1Q81 D;  4KKU A;  1PJ5 A;  1QUF A;  3B8H A;  3OE7 A;  1DAR A;  1EFC A;  4G5G A;  4UZU A;  5HXB A;  4Q7J B;  2XGJ A;  2PLF A;  1FNC A;  1Q86 D;  1N0V C;  3QFR A;  3CCR B;  5FO1 A;  5GV7 A;  4R71 A;  2OK7 A;  1QGA A;  4BPR A;  2J7K A;  1E1Q A;  2GJR A;  3CCV B;  1E62 A;  3J81 k;  2QEX B;  2HLD A;  1VQ9 B;  1SKY B;  1FX0 A;  2ZXH A;  3OKX A;  3SJP A;  4TMX A;  5IYQ A;  3VR6 A;  4PGO A;  4XKV A;  3OEH A;  1UD6 A;  1FNM A;  3U6B A;  2ZBU A;  3KEW A;  2DYI A;  2RC5 A;  3ZPN A;  2CF4 A;  4PAA A;  3G05 A;  4P6Y A;  1FRN A;  4RCY A;  3FJO A;  1JJ2 B;  5H5J A;  1VF7 A;  1AMO A;  1YJ9 B;  2YWH A;  1VHE A;  3HAG A;  1H42 A;  4YAW A;  1S72 B;  4NNJ A;  1I8D A;  1QUE A;  2D9R A;  2VJI A;  1GR1 A;  3BY2 A;  3NE5 B;  4RD3 A;  4Y9R A;  3ZZ0 A;  1YLO A;  4OP7 A;  4ACA A;  1G7R A;  3GVL A;  4P22 A;  3CPW B;  1KTV A;  3PUN A;  2BPO A;  3FPK A;  2YWG A;  4P25 A;  5A8A A;  1FDR A;  4M53 A;  4LBV A;  2DCU A;  3CW2 A;  3CC2 B;  1COW A;  1KMH A;  2C5B A;  4XN3 A;  4X7E A;  1ZM2 A;  4C0S A;  3ZBT A;  1K9M D;  2HCJ B;  3ZC3 A;  3VNU A;  1EP3 B;  1WSV A;  1HVX A;  1KK3 A;  4LBW A;  1Q7Y D;  4P3Y A;  4X07 A;  3ONU A;  1HA3 A;  4IW3 B;  1I18 A;  1ZM3 A;  1OGJ A;  4M4S A;  3AGQ A;  2BN4 A;  3ZUG A;  2E1R A;  4XL9 A;  1KQS B;  4B3F X;  1RQP A;  4Z1M A;  2OTJ B;  1M1K D;  4X7C A;  3H94 A;  4NBS A;  1S0U A;  2CK3 A;  3OZU A;  4XON A;  1QGY A;  4H9G A;  3QFC A;  1N0U A;  1NB0 A;  2GRE A;  2VBS A;  3WXM A;  4LC0 A;  1H85 A;  4QV2 A;  5FO0 A;  2VZL A;  4Z4R A;  4DNR B;  4XKW A;  5JBQ A;  3A3B A;  5F4M A;  1JNY A;  2BVN A;  2QTZ A;  3I1F A;  3FKS A;  5IK2 A;  4B47 A;  1E3Z A;  2X53 S;  4WZT A;  5FNZ A;  2E1B A;  5FIU A;  4M0L A;  1ZM9 A;  2X0K A;  3Q3A A;  4HE5 A;  4ZCI A;  2DET A;  1IJE A;  3W5V A;  2C77 A;  5EMN A;  3A8K A;  4UZE A;  1FRQ A;  3CP8 A;  4RD2 A;  1ZUN B;  1F60 A;  1QX4 A;  1VQO B;  1V0F A;  1W87 A;  5F4O A;  3OP1 A;  1WP6 A;  3A35 A;  4Z4Y A;  3CXC B;  5IYW A;  3CMM A;  4YAO A;  4C43 A;  4XMY A;  2QN6 A;  4PC2 A;  4QVJ A;  4TMZ A;  1WOR A;  2XZO A;  2XNJ A;  3BCF A;  4Y9U A;  4II3 A;  2VBU A;  4OPV A;  4KKS A;  4ACB A;  1P4M A;  1NDH A;  4AF7 A;  5TR9 A;  1R5O A;  1DG1 G;  2F43 A;  2NPF A;  1G7C A;  3AVY A;  1YJN B;  1KRH A;  3I56 B;  1VJS A;  4X8I A;  2C4U A;  4XR6 A;  4RJL A;  4PC6 A;  4YAL A;  1EFR A;  4ASU A;  1OB5 A;  4G7X A;  4YAU A;  1QVG B;  4RDL A;  1D1N A;  5DS0 A;  4LBY A;  3WNB A;  4XOT A;  1IHM A;  2ZL6 A;  1BLI A;  1OHH A;  3CCL B;  2QTL A;  3ES9 A;  2VNJ A;  2WPD A;  4AC9 A;  5B6I A;  4XNF A;  3CP2 A;  2V7T A;  3RY8 A;  2FX3 A;  1E64 A;  4DK1 A;  3WYA A;  1GAW A;  1RQR A;  4RDJ A;  4Z4Z A;  5IYR A;  1VQN B;  2KVO A;  4N3N A;  1JA1 A;  2YWE A;  1OB2 A;  3T56 B;  2F4N A;  2V7U A;  3OW2 B;  4XD7 A;  4NCN A;  2ZL5 A;  3WBK A;  3BC9 A;  2V7V A;  3Q6R A;  4TMW A;  3CPX A;  1G7S A;  2BGI A;  3SLD A;  5HZA A;  1UD8 A;  4L8J A;  1UD4 A;  3OZV A;  1YX2 A;  2C4T A;  4FN5 A;  4P1V A;  3SEJ A;  2WJV A;  4B3G A;  2Q6O A;  2WR8 A;  4OOV A;  3B78 A;  3AVU A;  2VNK A;  3CME B;  3CMA B;  3VNV A;  2CBX A;  1V5V A;  3FPP A;  4PC1 A;  3PA2 A;  4WZL A;  1V0E A;  2ZZE A;  1VQK B;  1BX0 A;  4P6V F;  4P26 A;  4ZCL A;  4K1X A;  1G7T A;  3MCA A;  3A1P A;  1EWY A;  1T6Y A;  3ASR A;  2PIA A;  1VQ8 B;  4TT3 A;  1N06 A;  4QUZ A;  3CD6 B;  3QE2 A;  1BX1 A;  2AHO A;  3JQR A;  5H59 A;  1N8R D;  5TV2 A;  4ZGN B;  4U9U A;  2OYN A;  3LQ6 A;  1VQ7 B;  1UMK A;  4HIZ A;  1HZE A;  3CCJ B;  3A3G A;  2GPJ A;  4YHB A;  3DDY A;  5AN9 A;  4Z4U A;  3SLN A;  3BCD A;  2QDX A;  4YAF A;  4TMT A;  3ZZT A;  4B43 A;  1KK1 A;  1QG0 A;  1PJ6 A;  3MHP A;  1TVC A;  4WWV A;  1UD2 A;  1M90 D;  1XFO A;  3R6K A;  3D26 A;  2I1L A;  3MMP A;  4X7F A;  3GVJ A;  4X0C A;  1T5E A;  1CNE A;  2X85 A;  1BPL A;  1W0J A;  2V7W A;  1W34 A;  1FNB A;  1N07 A;  1MRZ A;  3LQE A;  3CCU B;  2PE3 A;  2DEU A;  1KJZ A;  1T6X A;  2GQF A;  4B44 A;  3CRZ A;  1W9X A;  4F7D A;  2GJK A;  3AVV A;  1DDI A;  2BMW A;  4G1B A;  4PC3 A;  3AGP A;  1AIP A;  2FVG A;  2ZZF A;  1EP1 B;  3GIR A;  1N08 A;  5DSZ A;  3I55 B;  4Y7C A;  4G1V A;  3ASS A;  3T53 B;  2JDI A;  2XOK A;  3G4S B;  3WND A;  1VQP B;  5HKK A;  1ZM4 A;  1NJI D;  2C2W A;  1DDG A;  4OPS A;  5LMZ A;  3V76 A;  2W6I A;  4XLC A;  4DNT B;  1E43 A;  2DOG A;  5IYN A;  1XQB A;  2C78 A;  2V7Q A;  4XLE A;  3ASP A;  5J3O A;  4TMV A;  4Z4S A;  2VJJ A;  5FA6 A;  3GVK A;  2ZZQ A;  2JN9 A;  1KD1 D;  2OK8 A;  1EFT A;  4ZGQ B;  2WJY A;  3WNC A;  3OJW A;  3OEE A;  4OOS A;  1WSR A;  1XB2 A;  1CQX A;  2X8K A;  2Q6K A;  1S4M A;  2BV3 A;  1VQL B;  1NB9 A;  2WZN A;  3ZZU A;  5KNL A;  4FWT A;  2HMA A;  5THX A;  1H8E A;  4JMQ A;  3WBJ A;  3AVX A;  3JU4 A;  4RD4 A;  3P27 A;  1SKQ A;  2JJ1 A;  2R9V A;  3B82 A;  4N3G A;  3ONY A;  3CTA A;  2B7C A;  5GV8 A;  2M5S A;  2DIE A;  4B3X A;  3H9N A;  4DQK A;  4ZV4 A;  1W2B B;  1PJ7 A;  2GK7 A;  2ZTG A;  2QA4 B;  2DER A;  3GSI A;  3G6E B;  2Z6B D;  5IYP A;  4RD1 A;  3WQZ A;  1PKV A;  3PVD A;  5HZB A;  3CCM B;  3W2E A;  1BJK A;  3G71 B;  4CQJ A;  1OGI A;  1UD5 A;  5BSX A;  4QHY A;  1EP2 B;  1B2R A;  4DK0 A;  2F1M A;  2XZP A;  2QGG A;  5L46 A;  3CB4 A;  1YIT B;  1GAQ A;  2C5H A;  4XLA A;  1E63 A;  1D8T A;  2PMD A;  4OPO A;  3JQQ A;  4MYU A;  1WOP A;  4G6I A;  1YHQ B;  1OB0 A;  4OOX A;  2OBT A;  3R6J A;  5J35 A;  3W5H A;  2OTL B;  1TUI A;  2ZBV A;  4RPD A;  1U2R A;  1MAB A;  2X6Y A;  1T6Z A;  4RD0 A;  2ZL7 A;  1NBM A;  3AVT A;  2LZJ A;  2DY1 A;  2XEX A;  2CND A;  1SM4 A;  3Q38 A;  4XOR A;  1EFU A;  3QFT A;  4ROX A;  4XLH A;  4UZF A;  1VQ6 B;  2BM0 A;  4J0Q A;  1E1R A;  3CCQ B;  3AST A;  3CC4 B;  2V4D A;  1WOS A;  2R6H A;  3U6K A;  2RC6 A;  1W35 A;  1VQ5 B;  3AVW A;  2F1L A;  4M1K A;  1ELO A;  3WY9 A;  2XNC A;  2CC2 A;  4MYT A;  4YXW A;  3SJZ A;  1CNF A;  2X6X A;  5FL7 A;  3VMF A;  3PEN A;  1IJF A;  4RCZ A;  4XOP A;  1EXM A;  3OJX A;  4RM0 A;  5CDF A;  4TSF A;  4X05 A;  3VO1 A;  1R5N A;  4PC7 A;  2NV4 A;  4TN1 A;  3CC7 B;  3CCE B;  3OZW A;  1QGZ A;  3W2I A;  1TTT A;  4EH1 A;  1F20 A;  3OW7 A;  4AF6 A;  5A89 A;  2GJP A;  4RD6 A;  3E1Y E;  2W6J A;  4XQF A;  4UAJ A;  1R5B A;  3SKB A;  1YI2 B;  1E79 A;  3OFN A;  1K8A D;  2JIZ A;  3GQB A;  2V7X A;  3W2H A;  2HDN B;  2GK6 A;  3Q39 A;  3OPO A;  4WQM A;  1H8H A;  1IB0 A;  2V31 A;  4P2N A;  4ZCM A;  2B5O A;  2ZZG A;  4P3I A;  3BH4 A;  4YEL A;  2D74 A;  4E0F A;  2P3M A;  3A8I A;  4Z4V A;  3ZIA A;  1BQE A;  1QFJ A;  1BMF A;  2ZIT A;  1Q9S A;  2X6W A;  4RDK A;  5TY0 A;  3W2F A;  3V7A A;  2D3N A;  1WOO A;  4QVA A;  2Q6L A;  2VBV A;  2ZXI A;  3E20 A;  4XM3 A;  1Y0R A;  1YIJ B;  2BSA A;  3PA1 A;  3T51 B;  3CES A;  1GVH A;  4M2L A;  1K28 D;  2VNI A;  1VLY A;  2VNH A;  1N05 A;  2BM1 A;  3KL9 A;  1VQ4 B;  2WYR A;  1QFZ A;  3OAA A;  2X3U A;  4YEJ A;  3CCS B;  4LBZ A;  4Z4W A;  1W0K A;  4WZE A;  2ZTN A;  3P26 A;  2JJ2 A;  3JQP A;  3VO2 A;  1KK2 A;  4WZK A;  3PUM A;  4QFM A;  2WZP P;  1KZL A;  3Q6Q A;  3LO8 A;  4PAB A;  1XE1 A;  2QMU A;  1YJW B;  3W5U A;  4FXU A;  4TKO B;  5F4J A;  4X7D A;  1I7P A;  1J9Z A;  2EFG A;  4P12 A;  2BF4 A;  3LNN A;  1D2E A;  4G7W A;  1TLL A;  1WTH D;  2D3L A;  3BQJ A;  5E6T A;  1JB9 A;  1WDT A;  3U2Q A;  1B23 P;  4GQN A;  4XN0 A;  1GJR A;  4B4D A;  5TRD A;  4II2 A;  1QH0 A;  1E3X A;  2XND A;  1QVF B;  3QFS A;  1GO2 A;  1Q82 D;  4DQL A;  4FK8 A;  4XLF A;  5KW9 A;  1VLO A;  4RLZ A;  1VHO A;  2B7B A;  2WSS A;  2QE7 A;  4AVZ A;  1Y0Y A;  4P9S A;  1UD3 A;  2XZL A;  2VYQ A;  2YWF A;  4RPB A;  5DN6 A;  1FND A;  5KSW B; 
#chains in the Genus database with same CATH homology
 4RM0 A;  5BSY A;  5F4O A;  4X05 A;  3ASQ A;  3LQE A;  4Z4Y A;  5IYW A;  2OBS A;  4QVJ A;  4X06 A;  4OPV A;  2OBR A;  3BY1 A;  3SKB A;  3ASS A;  4Z4T A;  3Q39 A;  4OPS A;  4P2N A;  4P3I A;  4Z4V A;  5IYN A;  3ASP A;  5J3O A;  4RDL A;  4Z4S A;  1IHM A;  2ZL6 A;  4RDK A;  3V7A A;  3SJP A;  4QVA A;  5IYQ A;  3PA1 A;  4OOS A;  3RY8 A;  5IYR A;  4RDJ A;  4Z4Z A;  2ZL5 A;  3ONY A;  3Q6R A;  3BY2 A;  4OP7 A;  3SLD A;  4Z4W A;  5HZA A;  3PUN A;  4WZE A;  4P25 A;  4P1V A;  3SEJ A;  4OOV A;  5IYP A;  4X7E A;  4WZK A;  3PUM A;  3Q6Q A;  3PVD A;  5HZB A;  4X07 A;  3ONU A;  3PA2 A;  5BSX A;  4WZL A;  5F4J A;  4X7D A;  4P12 A;  4P26 A;  5E6T A;  3BQJ A;  4OPO A;  3ASR A;  4X7C A;  4QUZ A;  4OOX A;  2OBT A;  3R6J A;  5J35 A;  4RPD A;  3LQ6 A;  4QV2 A;  2ZL7 A;  4Z4R A;  3Q38 A;  5F4M A;  4Z4U A;  3SLN A;  4ROX A;  5KW9 A;  4RLZ A;  4WZT A;  3AST A;  3R6K A;  3D26 A;  3Q3A A;  4X7F A;  4RPB A;  4X0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...