2ZL6A

Atomic resolution structural characterization of recognition of histo-blood group antigens by norwalk virus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
286
structure length
286
Chain Sequence
b'FTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVSRFYQLKPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Atomic resolution structural characterization of recognition of histo-blood group antigens by Norwalk virus
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 65
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 2zl6A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 2zl6A01
2OBSA 4RDJA 4WZKA 4Z4VA 3V7AA 4Z4YA 4X0CA 3PA2A 4OPSA 3ASRA 4WZEA 3RY8A 5HZBA 4Z4TA 3Q38A 4RDKA 3SEJA 5BSXA 5F4JA 4RM0A 5BSYA 3BQJA 4P25A 5HZAA 2ZL5A 4P1VA 4RLZA 4QUZA 4X7EA 3Q6RA 3ASSA 4WZTA 4QVJA 4OPOA 4X7DA 3PUNA 4ROXA 4RDLA 4Z4UA 5F4MA 1IHMA 4QVAA 3ONYA 4QV2A 4WZLA 3SKBA 3SLNA 3Q3AA 5F4OA 3SLDA 5IYPA 2ZL6A 3SJPA 5J35A 4OP7A 4OOVA 4X06A 2ZL7A 4Z4ZA 5IYNA 4Z4WA 4X07A 4Z4SA 3Q39A 4Z4RA 4X7CA 3ASPA 5E6TA 4OOSA 3ASQA 4P3IA 3PA1A 3Q6QA 3PUMA 5J3OA 4P26A 4P2NA 5IYWA 3ASTA 3LQEA 4X05A 2OBRA 4OPVA 3R6JA 2OBTA 3R6KA 4OOXA 5KW9A 3PVDA 5IYRA 3LQ6A 4X7FA 4RPBA 3BY1A 5IYQA 3BY2A 3D26A 3ONUA 4RPDA 4P12A
chains in the Genus database with same CATH superfamily
1BLIA 1H8HA 4ZCLA 4Y7CA 2JIZA 4RDJA 1N05A 4YHBA 3GIRA 2DY1A 4PC3A 4XKVA 1NJID 1TUIA 4Z4VA 3U6KA 4Z4YA 1VF7A 2ZBUA 4B3GA 1OB2A 3ASRA 1P4MA 1JA1A 4HIZA 1AMOA 5HZBA 4DK1A 1BX0A 3MHPA 2D9RA 2W6IA 1DDGA 4RDKA 2XNJA 2BV3A 4M0LA 1EFUA 1N08A 1VHEA 3SEJA 5BSXA 1OB5A 1R5NA 5F4JA 4KKSA 1W9XA 2ZZFA 1EP1B 4AF7A 1MRZA 3CCMB 1WDTA 2WZPP 1YLOA 4TMXA 4YALA 5BSYA 3WXMA 1M90D 2HDNB 1HZEA 4RLZA 3Q6RA 4FWTA 1BMFA 2CW5A 4WZTA 4UAJA 3V76A 3JQPA 1ZUNB 4OPOA 1W0KA 1N0VC 3PUNA 3WYAA 1VQ5B 1K9MD 4QFMA 1KK1A 3CMEB 3W2EA 1S4MA 1T5EA 4QVAA 4WZLA 4XN3A 4XQFA 4Z1MA 5A89A 2Q6OA 1QVGB 1VQ9B 2V31A 4P22A 3FPPA 3OP1A 3Q3AA 3T56B 3OJWA 2DYIA 2X6YA 3BCFA 3ZZ0A 1EP3B 3FJOA 2QDXA 1UD3A 3U6BA 3CCRB 1H8EA 2FVGA 1KC8D 4Z4ZA 1QGYA 3G05A 2C77A 1DG1G 4II3A 4XNFA 1KMHA 1NBMA 3AVVA 4QHYA 3CC4B 4II2A 1KTVA 3Q39A 1PJ6A 3CCVB 3AVTA 1UMKA 2WR8A 3P26A 2JDIA 3CCLB 1K8AD 3PA1A 3A8KA 3B8HA 1A8PA 5FO1A 1E43A 5GV7A 1I8DA 1T6XA 3BCDA 2FX3A 2WJVA 4AVZA 1EXMA 3OZWA 3AVYA 1EFCA 3R6JA 2ZZQA 4C0SA 1BPLA 2C2WA 2D3LA 1E1RA 1V5VA 2XNDA 3WBKA 1FNMA 2HMAA 2VNJA 4OOXA 2OTJB 4P6YA 1VQKB 4XL9A 4YEJA 5IYRA 3G4SB 3AVUA 4DNTB 2VJJA 4U9UA 2HCJB 1W87A 1I7PA 2BSAA 3ZC3A 1N8RD 5IYQA 2QTZA 4XLEA 2QA4B 3ZPNA 2D74A 3BY2A 2V7WA 3AVXA 1YHQB 4UZUA 4RCYA 4H9GA 4P12A 4PGOA 4XORA 1YJNB 2ZTGA 3ZUGA 2X85A 4CQJA 2BPOA 3AGQA 3GVJA 3CPWB 3ZZTA 4RD3A 2XZLA 5L46A 1QG0A 1KK3A 3V7AA 1I18A 1E63A 5H59A 4B44A 1NRKA 2F43A 1GO2A 3B78A 4RD0A 4PC2A 4WZEA 2GPJA 3A3GA 1IJFA 2E1RA 3RY8A 1F60A 3MCAA 2X3UA 4TSFA 3DDYA 3CP8A 4HE6A 3VNUA 1XFOA 4XD7A 3WY9A 1EP2B 2BGIA 3J81k 5DN6A 1QUEA 4XONA 3CB4A 5HZAA 2PIAA 2ZZEA 5TV2A 4LBVA 3T53B 3OJXA 3WNDA 4P1VA 1WTHD 2Z6BD 4QUZA 1Q7YD 4TMVA 1R5OA 4DQLA 3W5VA 1XQBA 2D3NA 1FNBA 2PLFA 3GVLA 3HAGA 4RD1A 1B2RA 4ZV4A 2WZNA 2GQFA 2ZXIA 2F1MA 4RDLA 4ROXA 4X8IA 4Z4UA 1WOOA 3BH4A 5F4MA 3WBJA 2VBVA 3PENA 3KEWA 1PKVA 1FDRA 3FPKA 3ONYA 4QV2A 3SLNA 1WSRA 1VQPB 1QUFA 1VQ8B 4G5GA 2Q6KA 2EFGA 3OW7A 1F20A 3JQRA 1FRQA 1Q82D 4ZCMA 5FNZA 3QFRA 5F4OA 1G7TA 5IYPA 4UZFA 4TT3A 4P6VF 1E3XA 3CP2A 4B43A 4OOVA 4X06A 1KK2A 3CRZA 1QFYA 1JJ2B 4Z4SA 3FKSA 1VLYA 4HE5A 1KK0A 2F1LA 2DCUA 1WPCA 1G7RA 3A1PA 1Q86D 5E6TA 4N3NA 4OOSA 1UD4A 2B5OA 2BMWA 4R71A 2C78A 4C43A 2ZBVA 3P27A 2QN6A 2GK6A 4YAWA 4YAUA 3CMAB 1H42A 4P9SA 3PUMA 5J3OA 4P26A 1VQNB 4RD2A 4XLAA 4B3FX 3VMFA 1YJ9B 2F4NA 4Y9RA 1RQRA 4B4DA 1YIJB 2YWHA 2JN9A 2XZOA 1EWYA 3AGPA 3LQEA 3CCEB 2V7XA 1Q9SA 3I55B 1BX1A 4YXWA 5FL7A 4Q7JB 1BJKA 1ZM4A 1W34A 2V7TA 3R6KA 2DEUA 3CXCB 2WJYA 4N3GA 4XLHA 1UD5A 3QFTA 4L8JA 5TR9A 3A3BA 3LQ6A 4X7FA 4IW3B 1W2BB 1PJ7A 2KVOA 2LZJA 2VYQA 4RPBA 4M4SA 1B23P 1M1KD 2C4TA 3OW2B 1YJWB 2VBTA 3CCSB 1FRNA 2GJRA 3CTAA 3D26A 2XOKA 4B3XA 1H85A 1QGAA 2QTLA 5DS0A 1E3ZA 1XB2A 3ZIAA 1KQSB 4K1XA 3VO1A 5TY0A 3SJZA 2YWFA 1N07A 5HXBA 2VNIA 3OEHA 4UZEA 2YWEA 5HKKA 1VQLB 2BM1A 2OBSA 2PMDA 4TMZA 1ELOA 3T51B 1SM4A 3H94A 1S72B 2XGJA 3PA2A 1WOPA 1VQOB 1GR1A 4E0FA 3W2FA 4RJLA 1G7SA 4Z4TA 2GJKA 5CDFA 1UD2A 5KSWB 3Q38A 1VQ4B 2E1BA 2B7CA 1R5BA 3OFNA 3OEEA 2BF4A 3QSYA 2DOGA 1K28D 4RM0A 4YAOA 2I1LA 3JQQA 5DSZA 5IK2A 2ZTNA 4AC9A 1OGIA 1XE1A 3BQJA 4P25A 2QGGA 2X53S 4XOTA 5A8AA 3BNWA 3GSIA 3ASSA 4YAFA 3OZVA 1FNDA 4QVJA 3W5UA 1PJ5A 3OAAA 4X7DA 1WORA 1CQXA 2R6HA 5KNLA 1N0UA 3CCQB 4DNRB 2V7UA 3B82A 2GREA 4ZGQB 1Y0RA 1CNFA 1V0EA 3NE5B 1FNCA 2BM0A 3QFSA 3WNBA 2DERA 3E1YE 1BQEA 1GAQA 3G6EB 2DIEA 3QFCA 4XLFA 3SLDA 1J9ZA 5THXA 3SJPA 2GJPA 5FA6A 5A88A 2WPDA 1QGZA 4XR6A 5IYNA 2W6JA 1E79A 2VBUA 4X07A 4ZCIA 1VLOA 1E1QA 2XZPA 2M5SA 3ASPA 1D2EA 2C4UA 4LBYA 3WQZA 1ZM9A 3ASQA 4G7XA 2RC6A 3CCJB 1IB0A 2JJ1A 3KL9A 4B47A 3Q6QA 3MMPA 1ZM3A 4P2NA 4XKWA 4TN1A 5IYWA 4XMYA 1FX0A 5TRDA 4LBZA 1D1NA 4TKOB 4B48A 1W0JA 4KKUA 4TMTA 4ASUA 1QX4A 3CPXA 4OPVA 1JB9A 1DARA 1OGJA 4M1KA 1RQPA 3QE2A 5FIUA 1EFTA 1WSVA 1T6ZA 2CF4A 5KW9A 1MABA 1SKYB 1TLLA 2QEXB 3PVDA 3H9NA 2BVNA 2VJIA 1QFJA 3CW2A 4Y9UA 1KD1D 1E64A 1Y0YA 4DQKA 4AF6A 3W2IA 2AHOA 2WYRA 4F7DA 3ONUA 2NV4A 3CC2B 4GQNA 1TVCA 2C5BA 3JU4A 2CBXA 1NB9A 1KRHA 1YI2B 2X0KA 2GK7A 4NCNA 3I1FA 3ES9A 2C5HA 5AN9A 1YX2A 4WZKA 2J7KA 3LNNA 1JA0A 2R9VA 1GVHA 3ZBUA 3CD6B 4X0CA 3WNCA 2P3MA 4OPSA 4XN0A 4NNJA 1D8TA 4FXUA 2XEXA 2CNDA 4ZGNB 4MYTA 1WP6A 5EMNA 2VNKA 2HLDA 1DDIA 3GQBA 2CC2A 2X8KA 1QFZA 3OZUA 4M2LA 4YELA 1Q81D 4MYUA 2BGJA 1U2RA 4J0QA 2CRVA 2ZL5A 4XOPA 5B6IA 1KZLA 3OPOA 3ISXA 4X7EA 3W5HA 4PC7A 4LC0A 2VZLA 4PABA 4PAAA 4G6IA 3E20A 3VNVA 1COWA 2VBSA 2B7BA 3VR6A 3LVBA 1IHMA 1VQ7B 1NB0A 1UD8A 2QE7A 2YWGA 3SKBA 2Q6LA 3ZBTA 1ZM2A 3CC7B 1VQMB 1YITB 4M53A 1CNEA 2OYNA 4TMWA 4NBSA 2JJ2A 1SKQA 2V7QA 5JBQA 2ZL6A 1OHHA 1VQ6B 2EIXA 4FK8A 4DK0A 5J35A 4WWVA 1NDHA 4OP7A 1E62A 2CK3A 1IJEA 2ZL7A 1TTTA 4Z4WA 3OKXA 4PC1A 4G1VA 5FO0A 4BPRA 4EH1A 5LMZA 3A8JA 1WOSA 2NPFA 1V0FA 4Z4RA 2BN4A 2Q6IA 4X7CA 3W2HA 2ZXHA 4PC6A 3BC9A 4P3IA 2OK8A 1OB0A 1T6YA 3OE7A 1QVFB 3AVWA 2X6XA 2VNHA 4JMQA 5GV8A 4XM3A 2X6WA 4RD6A 2QMUA 3VO2A 1VHOA 3CCUB 1G7CA 3ASTA 3U2QA 2V4DA 4WQMA 3I56B 4ACBA 4KKTA 3GVKA 1S0UA 4ACAA 2ZZGA 4X05A 1VJSA 2OBRA 1GJRA 2RC5A 5H5JA 3ZZUA 1W35A 4FN5A 2OBTA 3LO8A 2ZITA 2WSSA 1AIPA 4RCZA 2PE3A 1N06A 3CESA 2V7VA 4G1BA 3G71B 2XNCA 1UD6A 4XLCA 4G7WA 1JNYA 1HVXA 3OOCA 3BY1A 1EFRA 4RD4A 2OTLB 3A8IA 2DETA 4P3YA 4LBWA 3CMMA 2OK7A 3W2GA 4RPDA 1K73D 1GAWA 1QH0A 3A35A 1HA3A 1WU8A 1KJZA
chains in the Genus database with same CATH topology
2OBSA 4RDJA 4WZKA 4Z4VA 3V7AA 4Z4YA 4X0CA 3PA2A 4OPSA 3ASRA 4WZEA 3RY8A 5HZBA 4Z4TA 3Q38A 4RDKA 3SEJA 5BSXA 5F4JA 4RM0A 5BSYA 3BQJA 4P25A 5HZAA 2ZL5A 4P1VA 4RLZA 4QUZA 4X7EA 3Q6RA 3ASSA 4WZTA 4QVJA 4OPOA 4X7DA 3PUNA 4ROXA 4RDLA 4Z4UA 5F4MA 1IHMA 4QVAA 3ONYA 4QV2A 4WZLA 3SKBA 3SLNA 3Q3AA 5F4OA 3SLDA 5IYPA 2ZL6A 3SJPA 5J35A 4OP7A 4OOVA 4X06A 2ZL7A 4Z4ZA 5IYNA 4Z4WA 4X07A 4Z4SA 3Q39A 4Z4RA 4X7CA 3ASPA 5E6TA 4OOSA 3ASQA 4P3IA 3PA1A 3Q6QA 3PUMA 5J3OA 4P26A 4P2NA 5IYWA 3ASTA 3LQEA 4X05A 2OBRA 4OPVA 3R6JA 2OBTA 3R6KA 4OOXA 5KW9A 3PVDA 5IYRA 3LQ6A 4X7FA 4RPBA 3BY1A 5IYQA 3BY2A 3D26A 3ONUA 4RPDA 4P12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBS A;  4RDJ A;  4WZK A;  4Z4V A;  3V7A A;  4Z4Y A;  4X0C A;  3PA2 A;  4OPS A;  3ASR A;  4WZE A;  3RY8 A;  5HZB A;  4Z4T A;  3Q38 A;  4RDK A;  3SEJ A;  5BSX A;  5F4J A;  4RM0 A;  5BSY A;  3BQJ A;  4P25 A;  5HZA A;  2ZL5 A;  4P1V A;  4RLZ A;  4QUZ A;  4X7E A;  3Q6R A;  3ASS A;  4WZT A;  4QVJ A;  4OPO A;  4X7D A;  3PUN A;  4ROX A;  4RDL A;  4Z4U A;  5F4M A;  1IHM A;  4QVA A;  3ONY A;  4QV2 A;  4WZL A;  3SKB A;  3SLN A;  3Q3A A;  5F4O A;  3SLD A;  5IYP A;  2ZL6 A;  3SJP A;  5J35 A;  4OP7 A;  4OOV A;  4X06 A;  2ZL7 A;  4Z4Z A;  5IYN A;  4Z4W A;  4X07 A;  4Z4S A;  3Q39 A;  4Z4R A;  4X7C A;  3ASP A;  5E6T A;  4OOS A;  3ASQ A;  4P3I A;  3PA1 A;  3Q6Q A;  3PUM A;  5J3O A;  4P26 A;  4P2N A;  5IYW A;  3AST A;  3LQE A;  4X05 A;  2OBR A;  4OPV A;  3R6J A;  2OBT A;  3R6K A;  4OOX A;  5KW9 A;  3PVD A;  5IYR A;  3LQ6 A;  4X7F A;  4RPB A;  3BY1 A;  5IYQ A;  3BY2 A;  3D26 A;  3ONU A;  4RPD A;  4P12 A; 
#chains in the Genus database with same CATH topology
 1BLI A;  1H8H A;  4ZCL A;  4Y7C A;  2JIZ A;  4RDJ A;  1N05 A;  4YHB A;  3GIR A;  2DY1 A;  4PC3 A;  4XKV A;  1NJI D;  1TUI A;  4Z4V A;  3U6K A;  4Z4Y A;  1VF7 A;  2ZBU A;  4B3G A;  1OB2 A;  3ASR A;  1P4M A;  1JA1 A;  4HIZ A;  1AMO A;  5HZB A;  4DK1 A;  1BX0 A;  3MHP A;  2D9R A;  2W6I A;  1DDG A;  4RDK A;  2XNJ A;  2BV3 A;  4M0L A;  1EFU A;  1N08 A;  1VHE A;  3SEJ A;  5BSX A;  1OB5 A;  1R5N A;  5F4J A;  4KKS A;  1W9X A;  2ZZF A;  1EP1 B;  4AF7 A;  1MRZ A;  3CCM B;  1WDT A;  2WZP P;  1YLO A;  4TMX A;  4YAL A;  5BSY A;  3WXM A;  1M90 D;  2HDN B;  1HZE A;  4RLZ A;  3Q6R A;  4FWT A;  1BMF A;  2CW5 A;  4WZT A;  4UAJ A;  3V76 A;  3JQP A;  1ZUN B;  4OPO A;  1W0K A;  1N0V C;  3PUN A;  3WYA A;  1VQ5 B;  1K9M D;  4QFM A;  1KK1 A;  3CME B;  3W2E A;  1S4M A;  1T5E A;  4QVA A;  4WZL A;  4XN3 A;  4XQF A;  4Z1M A;  5A89 A;  2Q6O A;  1QVG B;  1VQ9 B;  2V31 A;  4P22 A;  3FPP A;  3OP1 A;  3Q3A A;  3T56 B;  3OJW A;  2DYI A;  2X6Y A;  3BCF A;  3ZZ0 A;  1EP3 B;  3FJO A;  2QDX A;  1UD3 A;  3U6B A;  3CCR B;  1H8E A;  2FVG A;  1KC8 D;  4Z4Z A;  1QGY A;  3G05 A;  2C77 A;  1DG1 G;  4II3 A;  4XNF A;  1KMH A;  1NBM A;  3AVV A;  4QHY A;  3CC4 B;  4II2 A;  1KTV A;  3Q39 A;  1PJ6 A;  3CCV B;  3AVT A;  1UMK A;  2WR8 A;  3P26 A;  2JDI A;  3CCL B;  1K8A D;  3PA1 A;  3A8K A;  3B8H A;  1A8P A;  5FO1 A;  1E43 A;  5GV7 A;  1I8D A;  1T6X A;  3BCD A;  2FX3 A;  2WJV A;  4AVZ A;  1EXM A;  3OZW A;  3AVY A;  1EFC A;  3R6J A;  2ZZQ A;  4C0S A;  1BPL A;  2C2W A;  2D3L A;  1E1R A;  1V5V A;  2XND A;  3WBK A;  1FNM A;  2HMA A;  2VNJ A;  4OOX A;  2OTJ B;  4P6Y A;  1VQK B;  4XL9 A;  4YEJ A;  5IYR A;  3G4S B;  3AVU A;  4DNT B;  2VJJ A;  4U9U A;  2HCJ B;  1W87 A;  1I7P A;  2BSA A;  3ZC3 A;  1N8R D;  5IYQ A;  2QTZ A;  4XLE A;  2QA4 B;  3ZPN A;  2D74 A;  3BY2 A;  2V7W A;  3AVX A;  1YHQ B;  4UZU A;  4RCY A;  4H9G A;  4P12 A;  4PGO A;  4XOR A;  1YJN B;  2ZTG A;  3ZUG A;  2X85 A;  4CQJ A;  2BPO A;  3AGQ A;  3GVJ A;  3CPW B;  3ZZT A;  4RD3 A;  2XZL A;  5L46 A;  1QG0 A;  1KK3 A;  3V7A A;  1I18 A;  1E63 A;  5H59 A;  4B44 A;  1NRK A;  2F43 A;  1GO2 A;  3B78 A;  4RD0 A;  4PC2 A;  4WZE A;  2GPJ A;  3A3G A;  1IJF A;  2E1R A;  3RY8 A;  1F60 A;  3MCA A;  2X3U A;  4TSF A;  3DDY A;  3CP8 A;  4HE6 A;  3VNU A;  1XFO A;  4XD7 A;  3WY9 A;  1EP2 B;  2BGI A;  3J81 k;  5DN6 A;  1QUE A;  4XON A;  3CB4 A;  5HZA A;  2PIA A;  2ZZE A;  5TV2 A;  4LBV A;  3T53 B;  3OJX A;  3WND A;  4P1V A;  1WTH D;  2Z6B D;  4QUZ A;  1Q7Y D;  4TMV A;  1R5O A;  4DQL A;  3W5V A;  1XQB A;  2D3N A;  1FNB A;  2PLF A;  3GVL A;  3HAG A;  4RD1 A;  1B2R A;  4ZV4 A;  2WZN A;  2GQF A;  2ZXI A;  2F1M A;  4RDL A;  4ROX A;  4X8I A;  4Z4U A;  1WOO A;  3BH4 A;  5F4M A;  3WBJ A;  2VBV A;  3PEN A;  3KEW A;  1PKV A;  1FDR A;  3FPK A;  3ONY A;  4QV2 A;  3SLN A;  1WSR A;  1VQP B;  1QUF A;  1VQ8 B;  4G5G A;  2Q6K A;  2EFG A;  3OW7 A;  1F20 A;  3JQR A;  1FRQ A;  1Q82 D;  4ZCM A;  5FNZ A;  3QFR A;  5F4O A;  1G7T A;  5IYP A;  4UZF A;  4TT3 A;  4P6V F;  1E3X A;  3CP2 A;  4B43 A;  4OOV A;  4X06 A;  1KK2 A;  3CRZ A;  1QFY A;  1JJ2 B;  4Z4S A;  3FKS A;  1VLY A;  4HE5 A;  1KK0 A;  2F1L A;  2DCU A;  1WPC A;  1G7R A;  3A1P A;  1Q86 D;  5E6T A;  4N3N A;  4OOS A;  1UD4 A;  2B5O A;  2BMW A;  4R71 A;  2C78 A;  4C43 A;  2ZBV A;  3P27 A;  2QN6 A;  2GK6 A;  4YAW A;  4YAU A;  3CMA B;  1H42 A;  4P9S A;  3PUM A;  5J3O A;  4P26 A;  1VQN B;  4RD2 A;  4XLA A;  4B3F X;  3VMF A;  1YJ9 B;  2F4N A;  4Y9R A;  1RQR A;  4B4D A;  1YIJ B;  2YWH A;  2JN9 A;  2XZO A;  1EWY A;  3AGP A;  3LQE A;  3CCE B;  2V7X A;  1Q9S A;  3I55 B;  1BX1 A;  4YXW A;  5FL7 A;  4Q7J B;  1BJK A;  1ZM4 A;  1W34 A;  2V7T A;  3R6K A;  2DEU A;  3CXC B;  2WJY A;  4N3G A;  4XLH A;  1UD5 A;  3QFT A;  4L8J A;  5TR9 A;  3A3B A;  3LQ6 A;  4X7F A;  4IW3 B;  1W2B B;  1PJ7 A;  2KVO A;  2LZJ A;  2VYQ A;  4RPB A;  4M4S A;  1B23 P;  1M1K D;  2C4T A;  3OW2 B;  1YJW B;  2VBT A;  3CCS B;  1FRN A;  2GJR A;  3CTA A;  3D26 A;  2XOK A;  4B3X A;  1H85 A;  1QGA A;  2QTL A;  5DS0 A;  1E3Z A;  1XB2 A;  3ZIA A;  1KQS B;  4K1X A;  3VO1 A;  5TY0 A;  3SJZ A;  2YWF A;  1N07 A;  5HXB A;  2VNI A;  3OEH A;  4UZE A;  2YWE A;  5HKK A;  1VQL B;  2BM1 A;  2OBS A;  2PMD A;  4TMZ A;  1ELO A;  3T51 B;  1SM4 A;  3H94 A;  1S72 B;  2XGJ A;  3PA2 A;  1WOP A;  1VQO B;  1GR1 A;  4E0F A;  3W2F A;  4RJL A;  1G7S A;  4Z4T A;  2GJK A;  5CDF A;  1UD2 A;  5KSW B;  3Q38 A;  1VQ4 B;  2E1B A;  2B7C A;  1R5B A;  3OFN A;  3OEE A;  2BF4 A;  3QSY A;  2DOG A;  1K28 D;  4RM0 A;  4YAO A;  2I1L A;  3JQQ A;  5DSZ A;  5IK2 A;  2ZTN A;  4AC9 A;  1OGI A;  1XE1 A;  3BQJ A;  4P25 A;  2QGG A;  2X53 S;  4XOT A;  5A8A A;  3BNW A;  3GSI A;  3ASS A;  4YAF A;  3OZV A;  1FND A;  4QVJ A;  3W5U A;  1PJ5 A;  3OAA A;  4X7D A;  1WOR A;  1CQX A;  2R6H A;  5KNL A;  1N0U A;  3CCQ B;  4DNR B;  2V7U A;  3B82 A;  2GRE A;  4ZGQ B;  1Y0R A;  1CNF A;  1V0E A;  3NE5 B;  1FNC A;  2BM0 A;  3QFS A;  3WNB A;  2DER A;  3E1Y E;  1BQE A;  1GAQ A;  3G6E B;  2DIE A;  3QFC A;  4XLF A;  3SLD A;  1J9Z A;  5THX A;  3SJP A;  2GJP A;  5FA6 A;  5A88 A;  2WPD A;  1QGZ A;  4XR6 A;  5IYN A;  2W6J A;  1E79 A;  2VBU A;  4X07 A;  4ZCI A;  1VLO A;  1E1Q A;  2XZP A;  2M5S A;  3ASP A;  1D2E A;  2C4U A;  4LBY A;  3WQZ A;  1ZM9 A;  3ASQ A;  4G7X A;  2RC6 A;  3CCJ B;  1IB0 A;  2JJ1 A;  3KL9 A;  4B47 A;  3Q6Q A;  3MMP A;  1ZM3 A;  4P2N A;  4XKW A;  4TN1 A;  5IYW A;  4XMY A;  1FX0 A;  5TRD A;  4LBZ A;  1D1N A;  4TKO B;  4B48 A;  1W0J A;  4KKU A;  4TMT A;  4ASU A;  1QX4 A;  3CPX A;  4OPV A;  1JB9 A;  1DAR A;  1OGJ A;  4M1K A;  1RQP A;  3QE2 A;  5FIU A;  1EFT A;  1WSV A;  1T6Z A;  2CF4 A;  5KW9 A;  1MAB A;  1SKY B;  1TLL A;  2QEX B;  3PVD A;  3H9N A;  2BVN A;  2VJI A;  1QFJ A;  3CW2 A;  4Y9U A;  1KD1 D;  1E64 A;  1Y0Y A;  4DQK A;  4AF6 A;  3W2I A;  2AHO A;  2WYR A;  4F7D A;  3ONU A;  2NV4 A;  3CC2 B;  4GQN A;  1TVC A;  2C5B A;  3JU4 A;  2CBX A;  1NB9 A;  1KRH A;  1YI2 B;  2X0K A;  2GK7 A;  4NCN A;  3I1F A;  3ES9 A;  2C5H A;  5AN9 A;  1YX2 A;  4WZK A;  2J7K A;  3LNN A;  1JA0 A;  2R9V A;  1GVH A;  3ZBU A;  3CD6 B;  4X0C A;  3WNC A;  2P3M A;  4OPS A;  4XN0 A;  4NNJ A;  1D8T A;  4FXU A;  2XEX A;  2CND A;  4ZGN B;  4MYT A;  1WP6 A;  5EMN A;  2VNK A;  2HLD A;  1DDI A;  3GQB A;  2CC2 A;  2X8K A;  1QFZ A;  3OZU A;  4M2L A;  4YEL A;  1Q81 D;  4MYU A;  2BGJ A;  1U2R A;  4J0Q A;  2CRV A;  2ZL5 A;  4XOP A;  5B6I A;  1KZL A;  3OPO A;  3ISX A;  4X7E A;  3W5H A;  4PC7 A;  4LC0 A;  2VZL A;  4PAB A;  4PAA A;  4G6I A;  3E20 A;  3VNV A;  1COW A;  2VBS A;  2B7B A;  3VR6 A;  3LVB A;  1IHM A;  1VQ7 B;  1NB0 A;  1UD8 A;  2QE7 A;  2YWG A;  3SKB A;  2Q6L A;  3ZBT A;  1ZM2 A;  3CC7 B;  1VQM B;  1YIT B;  4M53 A;  1CNE A;  2OYN A;  4TMW A;  4NBS A;  2JJ2 A;  1SKQ A;  2V7Q A;  5JBQ A;  2ZL6 A;  1OHH A;  1VQ6 B;  2EIX A;  4FK8 A;  4DK0 A;  5J35 A;  4WWV A;  1NDH A;  4OP7 A;  1E62 A;  2CK3 A;  1IJE A;  2ZL7 A;  1TTT A;  4Z4W A;  3OKX A;  4PC1 A;  4G1V A;  5FO0 A;  4BPR A;  4EH1 A;  5LMZ A;  3A8J A;  1WOS A;  2NPF A;  1V0F A;  4Z4R A;  2BN4 A;  2Q6I A;  4X7C A;  3W2H A;  2ZXH A;  4PC6 A;  3BC9 A;  4P3I A;  2OK8 A;  1OB0 A;  1T6Y A;  3OE7 A;  1QVF B;  3AVW A;  2X6X A;  2VNH A;  4JMQ A;  5GV8 A;  4XM3 A;  2X6W A;  4RD6 A;  2QMU A;  3VO2 A;  1VHO A;  3CCU B;  1G7C A;  3AST A;  3U2Q A;  2V4D A;  4WQM A;  3I56 B;  4ACB A;  4KKT A;  3GVK A;  1S0U A;  4ACA A;  2ZZG A;  4X05 A;  1VJS A;  2OBR A;  1GJR A;  2RC5 A;  5H5J A;  3ZZU A;  1W35 A;  4FN5 A;  2OBT A;  3LO8 A;  2ZIT A;  2WSS A;  1AIP A;  4RCZ A;  2PE3 A;  1N06 A;  3CES A;  2V7V A;  4G1B A;  3G71 B;  2XNC A;  1UD6 A;  4XLC A;  4G7W A;  1JNY A;  1HVX A;  3OOC A;  3BY1 A;  1EFR A;  4RD4 A;  2OTL B;  3A8I A;  2DET A;  4P3Y A;  4LBW A;  3CMM A;  2OK7 A;  3W2G A;  4RPD A;  1K73 D;  1GAW A;  1QH0 A;  3A35 A;  1HA3 A;  1WU8 A;  1KJZ A; 
#chains in the Genus database with same CATH homology
 2OBS A;  4RDJ A;  4WZK A;  4Z4V A;  3V7A A;  4Z4Y A;  4X0C A;  3PA2 A;  4OPS A;  3ASR A;  4WZE A;  3RY8 A;  5HZB A;  4Z4T A;  3Q38 A;  4RDK A;  3SEJ A;  5BSX A;  5F4J A;  4RM0 A;  5BSY A;  3BQJ A;  4P25 A;  5HZA A;  2ZL5 A;  4P1V A;  4RLZ A;  4QUZ A;  4X7E A;  3Q6R A;  3ASS A;  4WZT A;  4QVJ A;  4OPO A;  4X7D A;  3PUN A;  4ROX A;  4RDL A;  4Z4U A;  5F4M A;  1IHM A;  4QVA A;  3ONY A;  4QV2 A;  4WZL A;  3SKB A;  3SLN A;  3Q3A A;  5F4O A;  3SLD A;  5IYP A;  2ZL6 A;  3SJP A;  5J35 A;  4OP7 A;  4OOV A;  4X06 A;  2ZL7 A;  4Z4Z A;  5IYN A;  4Z4W A;  4X07 A;  4Z4S A;  3Q39 A;  4Z4R A;  4X7C A;  3ASP A;  5E6T A;  4OOS A;  3ASQ A;  4P3I A;  3PA1 A;  3Q6Q A;  3PUM A;  5J3O A;  4P26 A;  4P2N A;  5IYW A;  3AST A;  3LQE A;  4X05 A;  2OBR A;  4OPV A;  3R6J A;  2OBT A;  3R6K A;  4OOX A;  5KW9 A;  3PVD A;  5IYR A;  3LQ6 A;  4X7F A;  4RPB A;  3BY1 A;  5IYQ A;  3BY2 A;  3D26 A;  3ONU A;  4RPD A;  4P12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...