2ZL7A

Atomic resolution structural characterization of recognition of histo-blood group antigens by norwalk virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
286
structure length
285
Chain Sequence
FTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASGPQQLPINGVFVFVSWVSRFYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structural characterization of recognition of histo-blood group antigens by Norwalk virus
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords 58 kd capsid protein
total genus 67
structure length 285
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 2zl7A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 2zl7A01
5BSYA 4WZEA 4Z4UA 4ROXA 3Q6QA 4X05A 3PUNA 2ZL7A 4Z4TA 5J3OA 4RPBA 4QUZA 4Z4ZA 3Q39A 3V7AA 4P26A 4OPSA 4WZKA 4RDJA 5F4OA 3ASRA 5J35A 3D26A 4Z4VA 2OBSA 4X7EA 5HZAA 3SEJA 3PUMA 3R6KA 4RPDA 4QVJA 4X07A 3ASPA 3BQJA 4RDLA 4OOXA 4Z4SA 5BSXA 4Z4YA 4Z4WA 5HZBA 4OOVA 4P3IA 4RLZA 3ONUA 4OOSA 4Z4RA 5E6TA 2ZL6A 5IYQA 3BY1A 3ASQA 3SJPA 4X7FA 3Q38A 5IYWA 4OP7A 3PVDA 4QV2A 2OBTA 4OPOA 4P25A 3PA1A 4P1VA 1IHMA 2OBRA 4X7DA 3R6JA 3ONYA 5KW9A 4WZLA 3Q3AA 5IYPA 4RM0A 2ZL5A 3ASTA 4P2NA 5IYNA 3Q6RA 3LQEA 4X0CA 3SLDA 5F4MA 4X06A 4QVAA 4RDKA 3BY2A 3PA2A 3LQ6A 5F4JA 3RY8A 3SKBA 5IYRA 3ASSA 4P12A 4WZTA 4X7CA 3SLNA 4OPVA
chains in the Genus database with same CATH superfamily
3OEEA 1TLLA 5BSYA 2QN6A 1Y0YA 2ZZFA 3H9NA 4MYUA 4Z4UA 1VQ7B 4X05A 3PUNA 4LBZA 3VR6A 3ZBTA 2J7KA 1GJRA 2QMUA 2C2WA 4FWTA 4RPBA 1KQSB 2VJIA 1OB5A 3CB4A 2GJRA 3A8IA 3Q39A 5FO0A 3V7AA 5KNLA 1B23P 3QSYA 3CXCB 4AF6A 3JU4A 4WZKA 2HCJB 1XB2A 2VBUA 4RD6A 4FXUA 3HAGA 2CW5A 4XORA 2M5SA 5J35A 4Z4VA 2WJYA 3ES9A 2XZPA 1UD4A 5HZAA 1XQBA 2JJ1A 4M2LA 4Y9UA 3R6KA 1H8HA 4N3GA 1E3XA 1QFJA 2F1LA 4P6VF 4Z4SA 4K1XA 3CCUB 4QHYA 1BX0A 4P3YA 4XLEA 1QVFB 4P6YA 1GR1A 5L46A 4RCYA 1W0JA 2OTJB 4XLHA 3FPKA 2BMWA 2WJVA 3OE7A 3BH4A 4RLZA 2PMDA 3WNDA 4XLFA 5A8AA 1TTTA 3ONUA 4XMYA 2ZBVA 4II3A 4Q7JB 5E6TA 5H5JA 2PLFA 2BGIA 4UZUA 2NV4A 1K9MD 2VBTA 2GJKA 2W6JA 3BY1A 4R71A 3MMPA 3B8HA 1WSRA 1VQNB 1QGAA 5IYWA 4OP7A 2ZZEA 1YIJB 2YWFA 2OBTA 1GAWA 4PC3A 5KSWB 3ZIAA 5TRDA 4OPOA 2V7QA 1V0FA 3CD6B 1EP2B 4YAFA 2XNJA 4XD7A 3A8JA 1Q7YD 4DQKA 5CDFA 4PGOA 4BPRA 4NBSA 1QX4A 1WORA 1CNFA 4WZLA 3CPXA 2PE3A 2R6HA 4WQMA 2BVNA 1FNDA 5HXBA 2QTLA 3ASTA 4H9GA 2VNHA 3VMFA 5THXA 4ACAA 3Q6RA 1K28D 1JNYA 4X06A 1WDTA 2B7BA 3AVUA 4RDKA 1G7CA 4Y9RA 1ZUNB 3LQ6A 3CTAA 2VJJA 3FJOA 3VNUA 1S0UA 3ASSA 4KKTA 4B3GA 1KK0A 2GJPA 4HIZA 3GQBA 5FNZA 1S72B 4B43A 3SLNA 2B7CA 3BC9A 1GAQA 3QFSA 1WOOA 4RD3A 4TMWA 4ZCLA 4RD4A 4JMQA 4ROXA 1OB2A 1NDHA 3SJZA 4TMXA 2WZNA 2ZL7A 4Z4TA 4ZGQB 2BM1A 2E1RA 3A3GA 4XLCA 1KTVA 3OPOA 3WQZA 4QUZA 2X85A 4M0LA 3CMEB 3WXMA 1QGYA 1WTHD 2VNJA 2F1MA 2X6XA 3WYAA 2ZITA 3LVBA 1JA0A 4XN3A 4OPSA 1Q86D 1TUIA 4RDJA 3GVJA 4YAUA 3E1YE 1BLIA 2QA4B 1RQRA 1KZLA 2OBSA 1QFYA 4E0FA 3OZVA 2HLDA 5TY0A 4PC6A 1VHOA 3PUMA 1EP1B 1W9XA 4RPDA 3MCAA 4QVJA 1DDIA 4X07A 1N0VC 4XLAA 1AIPA 1NB9A 2VBVA 3OW2B 1ZM4A 2B5OA 3G6EB 1E64A 2LZJA 3OJWA 4G6IA 2X0KA 4Z4YA 1UD6A 3LO8A 1N8RD 1RQPA 2XGJA 1N06A 2I1LA 1ELOA 2V7WA 4RD0A 4FK8A 3I55B 2WYRA 4XKVA 3WBJA 4XM3A 3T51B 2ZL6A 1IJFA 5IK2A 1PJ7A 1YJ9B 5A89A 2DCUA 3A1PA 3ASQA 2GREA 3SJPA 4X7FA 4YHBA 1H42A 4B48A 2V7VA 4RD2A 1N0UA 2XZLA 4TMVA 4ZCMA 2WR8A 3OZWA 4LBWA 1WP6A 4ZV4A 1SM4A 1UD2A 1AMOA 4B3FX 1GVHA 3OW7A 3GVLA 1COWA 1Y0RA 3CCEB 1N05A 1UD8A 2VNIA 2ZZGA 4YAWA 1K73D 1VQ5B 3B78A 2OBRA 1YJNB 2Q6IA 1DDGA 1UMKA 2GPJA 1GO2A 4YAOA 1PKVA 3ONYA 4N3NA 5KW9A 2OTLB 4IW3B 4B44A 1SKYB 1D1NA 5IYPA 1OGIA 4RCZA 1TVCA 2ZL5A 3NE5B 1W87A 1FNMA 1N07A 1YX2A 1W35A 5IYNA 2CRVA 3AVVA 2CNDA 3VO2A 4AC9A 4Z1MA 3J81k 1VQPB 4B4DA 2D9RA 2XOKA 3SKBA 1FNCA 3RY8A 4P22A 5DN6A 3AVXA 2RC6A 3P27A 3WNBA 2CC2A 2ZTGA 1UD3A 4II2A 2V7UA 2F43A 1G7RA 3KL9A 4WZTA 1D8TA 2VBSA 2YWGA 3ZC3A 2QE7A 3CC7B 1H8EA 2JJ2A 4WZEA 1BJKA 1WPCA 4XONA 3W5UA 4LBYA 2DETA 4AF7A 3W2EA 3MHPA 3CCMB 2EFGA 3U2QA 1E63A 5AN9A 5DSZA 2JDIA 3VO1A 3QFTA 3JQQA 1VLOA 2BPOA 2E1BA 3WBKA 1S4MA 3CPWB 4PC7A 3ISXA 2P3MA 2X53S 3FPPA 4M53A 3ASRA 4HE5A 5F4OA 3CCRB 1Q81D 3H94A 5B6IA 1HZEA 4KKSA 4X7EA 1M90D 3CRZA 2DY1A 5LMZA 4U9UA 5GV7A 4KKUA 3SEJA 3CCVB 1EXMA 2W6IA 1IB0A 1T6ZA 1QG0A 1XE1A 3FKSA 1IJEA 3OFNA 3T56B 4EH1A 1OB0A 3BQJA 2QDXA 4FN5A 1YLOA 2ZBUA 1WU8A 3PENA 2X6WA 4XR6A 1FRNA 2DEUA 4NCNA 1G7SA 1XFOA 4G5GA 4ZCIA 3GVKA 2Q6KA 2WZPP 5HZBA 1WOSA 2AHOA 2Q6OA 3QFRA 4OOVA 4ASUA 2XZOA 4UZEA 5FO1A 2C77A 1V5VA 4WWVA 4OOSA 2CF4A 1NBMA 4Z4RA 4L8JA 1EFTA 1VJSA 3AVWA 1NJID 2DIEA 1CNEA 1D2EA 2XNCA 1W0KA 1KJZA 1KC8D 4TMZA 4TT3A 4G1VA 1V0EA 1NB0A 2VZLA 1E1RA 1EFRA 3Q38A 1EFUA 2V7XA 3PVDA 4QV2A 4DNRB 1FRQA 4QFMA 1HA3A 1VF7A 4C0SA 5A88A 1YJWB 4XOPA 3B82A 4P25A 2GQFA 2RC5A 3PA1A 2ZXIA 1W34A 4UZFA 1VQMB 1VQLB 2V31A 3CCJB 1IHMA 4YXWA 2DERA 2DOGA 3OJXA 1ZM3A 3CMAB 2BV3A 2V7TA 4X8IA 1G7TA 4PC1A 2X6YA 3OEHA 5FA6A 1U2RA 2C5HA 3R6JA 2X8KA 4DK1A 1K8AD 1M1KD 1E79A 3G05A 3Q3AA 3OKXA 4ZGNB 1B2RA 5EMNA 3BNWA 5GV8A 2D3LA 2YWEA 3W2FA 4RM0A 5FIUA 2GK7A 4B3XA 1BPLA 4RD1A 2OK8A 2ZTNA 4P2NA 2Q6LA 1R5BA 2C4TA 3LQEA 4X0CA 3SLDA 4DK0A 1WSVA 5FL7A 4QVAA 1KK3A 4DQLA 3W5HA 2X3UA 1DG1G 1I7PA 3U6BA 2V4DA 1JJ2B 3AGPA 3PA2A 5HKKA 4PAAA 3CESA 3A35A 5F4JA 3JQPA 1VQOB 3CC4B 1PJ5A 1W2BB 1FDRA 2PIAA 2GK6A 1OGJA 3U6KA 3QFCA 3BCFA 4TSFA 3W2IA 2FX3A 3CCQB 2XNDA 3CW2A 3W2HA 2D3NA 5TV2A 3CCLB 1T6YA 2CBXA 4OPVA 4NNJA 3W5VA 2FVGA 2OYNA 2WPDA 3DDYA 1BMFA 3Q6QA 5J3OA 2XEXA 1OHHA 1F60A 2C4UA 3LNNA 4RJLA 4Z4ZA 3CMMA 1BX1A 3KEWA 3I56B 4P26A 1EWYA 1MRZA 1YHQB 4XN0A 3JQRA 1JB9A 1WOPA 4PABA 1VLYA 1KMHA 3OOCA 1PJ6A 3D26A 2OK7A 1YI2B 4ACBA 1H85A 2ZXHA 4CQJA 1BQEA 2EIXA 4P9SA 4G7XA 1E43A 1YITB 1VQ6B 4B47A 3V76A 1A8PA 3AVYA 3ASPA 4RDLA 4OOXA 5BSXA 1F20A 3VNVA 1VHEA 1KK2A 3A3BA 4Z4WA 1J9ZA 3WNCA 1VQ9B 2BM0A 4TMTA 4GQNA 1ZM9A 1QFZA 3GIRA 3OZUA 3T53B 4J0QA 4F7DA 4P3IA 3P26A 3ZZTA 1SKQA 4MYTA 1DARA 4XOTA 1E3ZA 1KRHA 2Z6BD 3CP8A 1CQXA 3ZZUA 3G71B 3GSIA 4M4SA 2JN9A 1R5NA 2D74A 1T6XA 1MABA 4TKOB 3W2GA 1T5EA 1QGZA 5IYQA 4M1KA 4YALA 4YEJA 2KVOA 2CK3A 1HVXA 1KD1D 1N08A 1QVGB 2BSAA 4G1BA 2R9VA 2QEXB 3WY9A 3ZUGA 2JIZA 4LBVA 2BF4A 4Y7CA 1FX0A 1ZM2A 4XNFA 4AVZA 4P1VA 3CCSB 3ZBUA 3OAAA 4XL9A 4X7DA 2NPFA 2WSSA 1QUFA 3QE2A 3BCDA 2C78A 3A8KA 2QTZA 2ZZQA 2BGJA 5TR9A 3AGQA 3I1FA 1Q9SA 3G4SB 1JA1A 1NRKA 1R5OA 1I8DA 1UD5A 5H59A 4DNTB 3AVTA 1EP3B 2HDNB 1Q82D 4LC0A 1QUEA 4XKWA 4HE6A 1I18A 4G7WA 2HMAA 2F4NA 5F4MA 5DS0A 4UAJA 2DYIA 3CP2A 1E1QA 5JBQA 2QGGA 3CC2B 3OP1A 3BY2A 3E20A 2VYQA 4YELA 3ZPNA 4XQFA 2C5BA 5IYRA 2BN4A 1VQ4B 1QH0A 1E62A 4C43A 4PC2A 1VQ8B 2VNKA 1VQKB 1FNBA 4P12A 3ZZ0A 4X7CA 4TN1A 1KK1A 1EFCA 1P4MA 2YWHA
chains in the Genus database with same CATH topology
5BSYA 4WZEA 4Z4UA 4ROXA 3Q6QA 4X05A 3PUNA 2ZL7A 4Z4TA 5J3OA 4RPBA 4QUZA 4Z4ZA 3Q39A 3V7AA 4P26A 4OPSA 4WZKA 4RDJA 5F4OA 3ASRA 5J35A 3D26A 4Z4VA 2OBSA 4X7EA 5HZAA 3SEJA 3PUMA 3R6KA 4RPDA 4QVJA 4X07A 3ASPA 3BQJA 4RDLA 4OOXA 4Z4SA 5BSXA 4Z4YA 4Z4WA 5HZBA 4OOVA 4P3IA 4RLZA 3ONUA 4OOSA 4Z4RA 5E6TA 2ZL6A 5IYQA 3BY1A 3ASQA 3SJPA 4X7FA 3Q38A 5IYWA 4OP7A 3PVDA 4QV2A 2OBTA 4OPOA 4P25A 3PA1A 4P1VA 1IHMA 2OBRA 4X7DA 3R6JA 3ONYA 5KW9A 4WZLA 3Q3AA 5IYPA 4RM0A 2ZL5A 3ASTA 4P2NA 5IYNA 3Q6RA 3LQEA 4X0CA 3SLDA 5F4MA 4X06A 4QVAA 4RDKA 3BY2A 3PA2A 3LQ6A 5F4JA 3RY8A 3SKBA 5IYRA 3ASSA 4P12A 4WZTA 4X7CA 3SLNA 4OPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BSY A;  4WZE A;  4Z4U A;  4ROX A;  3Q6Q A;  4X05 A;  3PUN A;  2ZL7 A;  4Z4T A;  5J3O A;  4RPB A;  4QUZ A;  4Z4Z A;  3Q39 A;  3V7A A;  4P26 A;  4OPS A;  4WZK A;  4RDJ A;  5F4O A;  3ASR A;  5J35 A;  3D26 A;  4Z4V A;  2OBS A;  4X7E A;  5HZA A;  3SEJ A;  3PUM A;  3R6K A;  4RPD A;  4QVJ A;  4X07 A;  3ASP A;  3BQJ A;  4RDL A;  4OOX A;  4Z4S A;  5BSX A;  4Z4Y A;  4Z4W A;  5HZB A;  4OOV A;  4P3I A;  4RLZ A;  3ONU A;  4OOS A;  4Z4R A;  5E6T A;  2ZL6 A;  5IYQ A;  3BY1 A;  3ASQ A;  3SJP A;  4X7F A;  3Q38 A;  5IYW A;  4OP7 A;  3PVD A;  4QV2 A;  2OBT A;  4OPO A;  4P25 A;  3PA1 A;  4P1V A;  1IHM A;  2OBR A;  4X7D A;  3R6J A;  3ONY A;  5KW9 A;  4WZL A;  3Q3A A;  5IYP A;  4RM0 A;  2ZL5 A;  3AST A;  4P2N A;  5IYN A;  3Q6R A;  3LQE A;  4X0C A;  3SLD A;  5F4M A;  4X06 A;  4QVA A;  4RDK A;  3BY2 A;  3PA2 A;  3LQ6 A;  5F4J A;  3RY8 A;  3SKB A;  5IYR A;  3ASS A;  4P12 A;  4WZT A;  4X7C A;  3SLN A;  4OPV A; 
#chains in the Genus database with same CATH topology
 3OEE A;  1TLL A;  5BSY A;  2QN6 A;  1Y0Y A;  2ZZF A;  3H9N A;  4MYU A;  4Z4U A;  1VQ7 B;  4X05 A;  3PUN A;  4LBZ A;  3VR6 A;  3ZBT A;  2J7K A;  1GJR A;  2QMU A;  2C2W A;  4FWT A;  4RPB A;  1KQS B;  2VJI A;  1OB5 A;  3CB4 A;  2GJR A;  3A8I A;  3Q39 A;  5FO0 A;  3V7A A;  5KNL A;  1B23 P;  3QSY A;  3CXC B;  4AF6 A;  3JU4 A;  4WZK A;  2HCJ B;  1XB2 A;  2VBU A;  4RD6 A;  4FXU A;  3HAG A;  2CW5 A;  4XOR A;  2M5S A;  5J35 A;  4Z4V A;  2WJY A;  3ES9 A;  2XZP A;  1UD4 A;  5HZA A;  1XQB A;  2JJ1 A;  4M2L A;  4Y9U A;  3R6K A;  1H8H A;  4N3G A;  1E3X A;  1QFJ A;  2F1L A;  4P6V F;  4Z4S A;  4K1X A;  3CCU B;  4QHY A;  1BX0 A;  4P3Y A;  4XLE A;  1QVF B;  4P6Y A;  1GR1 A;  5L46 A;  4RCY A;  1W0J A;  2OTJ B;  4XLH A;  3FPK A;  2BMW A;  2WJV A;  3OE7 A;  3BH4 A;  4RLZ A;  2PMD A;  3WND A;  4XLF A;  5A8A A;  1TTT A;  3ONU A;  4XMY A;  2ZBV A;  4II3 A;  4Q7J B;  5E6T A;  5H5J A;  2PLF A;  2BGI A;  4UZU A;  2NV4 A;  1K9M D;  2VBT A;  2GJK A;  2W6J A;  3BY1 A;  4R71 A;  3MMP A;  3B8H A;  1WSR A;  1VQN B;  1QGA A;  5IYW A;  4OP7 A;  2ZZE A;  1YIJ B;  2YWF A;  2OBT A;  1GAW A;  4PC3 A;  5KSW B;  3ZIA A;  5TRD A;  4OPO A;  2V7Q A;  1V0F A;  3CD6 B;  1EP2 B;  4YAF A;  2XNJ A;  4XD7 A;  3A8J A;  1Q7Y D;  4DQK A;  5CDF A;  4PGO A;  4BPR A;  4NBS A;  1QX4 A;  1WOR A;  1CNF A;  4WZL A;  3CPX A;  2PE3 A;  2R6H A;  4WQM A;  2BVN A;  1FND A;  5HXB A;  2QTL A;  3AST A;  4H9G A;  2VNH A;  3VMF A;  5THX A;  4ACA A;  3Q6R A;  1K28 D;  1JNY A;  4X06 A;  1WDT A;  2B7B A;  3AVU A;  4RDK A;  1G7C A;  4Y9R A;  1ZUN B;  3LQ6 A;  3CTA A;  2VJJ A;  3FJO A;  3VNU A;  1S0U A;  3ASS A;  4KKT A;  4B3G A;  1KK0 A;  2GJP A;  4HIZ A;  3GQB A;  5FNZ A;  1S72 B;  4B43 A;  3SLN A;  2B7C A;  3BC9 A;  1GAQ A;  3QFS A;  1WOO A;  4RD3 A;  4TMW A;  4ZCL A;  4RD4 A;  4JMQ A;  4ROX A;  1OB2 A;  1NDH A;  3SJZ A;  4TMX A;  2WZN A;  2ZL7 A;  4Z4T A;  4ZGQ B;  2BM1 A;  2E1R A;  3A3G A;  4XLC A;  1KTV A;  3OPO A;  3WQZ A;  4QUZ A;  2X85 A;  4M0L A;  3CME B;  3WXM A;  1QGY A;  1WTH D;  2VNJ A;  2F1M A;  2X6X A;  3WYA A;  2ZIT A;  3LVB A;  1JA0 A;  4XN3 A;  4OPS A;  1Q86 D;  1TUI A;  4RDJ A;  3GVJ A;  4YAU A;  3E1Y E;  1BLI A;  2QA4 B;  1RQR A;  1KZL A;  2OBS A;  1QFY A;  4E0F A;  3OZV A;  2HLD A;  5TY0 A;  4PC6 A;  1VHO A;  3PUM A;  1EP1 B;  1W9X A;  4RPD A;  3MCA A;  4QVJ A;  1DDI A;  4X07 A;  1N0V C;  4XLA A;  1AIP A;  1NB9 A;  2VBV A;  3OW2 B;  1ZM4 A;  2B5O A;  3G6E B;  1E64 A;  2LZJ A;  3OJW A;  4G6I A;  2X0K A;  4Z4Y A;  1UD6 A;  3LO8 A;  1N8R D;  1RQP A;  2XGJ A;  1N06 A;  2I1L A;  1ELO A;  2V7W A;  4RD0 A;  4FK8 A;  3I55 B;  2WYR A;  4XKV A;  3WBJ A;  4XM3 A;  3T51 B;  2ZL6 A;  1IJF A;  5IK2 A;  1PJ7 A;  1YJ9 B;  5A89 A;  2DCU A;  3A1P A;  3ASQ A;  2GRE A;  3SJP A;  4X7F A;  4YHB A;  1H42 A;  4B48 A;  2V7V A;  4RD2 A;  1N0U A;  2XZL A;  4TMV A;  4ZCM A;  2WR8 A;  3OZW A;  4LBW A;  1WP6 A;  4ZV4 A;  1SM4 A;  1UD2 A;  1AMO A;  4B3F X;  1GVH A;  3OW7 A;  3GVL A;  1COW A;  1Y0R A;  3CCE B;  1N05 A;  1UD8 A;  2VNI A;  2ZZG A;  4YAW A;  1K73 D;  1VQ5 B;  3B78 A;  2OBR A;  1YJN B;  2Q6I A;  1DDG A;  1UMK A;  2GPJ A;  1GO2 A;  4YAO A;  1PKV A;  3ONY A;  4N3N A;  5KW9 A;  2OTL B;  4IW3 B;  4B44 A;  1SKY B;  1D1N A;  5IYP A;  1OGI A;  4RCZ A;  1TVC A;  2ZL5 A;  3NE5 B;  1W87 A;  1FNM A;  1N07 A;  1YX2 A;  1W35 A;  5IYN A;  2CRV A;  3AVV A;  2CND A;  3VO2 A;  4AC9 A;  4Z1M A;  3J81 k;  1VQP B;  4B4D A;  2D9R A;  2XOK A;  3SKB A;  1FNC A;  3RY8 A;  4P22 A;  5DN6 A;  3AVX A;  2RC6 A;  3P27 A;  3WNB A;  2CC2 A;  2ZTG A;  1UD3 A;  4II2 A;  2V7U A;  2F43 A;  1G7R A;  3KL9 A;  4WZT A;  1D8T A;  2VBS A;  2YWG A;  3ZC3 A;  2QE7 A;  3CC7 B;  1H8E A;  2JJ2 A;  4WZE A;  1BJK A;  1WPC A;  4XON A;  3W5U A;  4LBY A;  2DET A;  4AF7 A;  3W2E A;  3MHP A;  3CCM B;  2EFG A;  3U2Q A;  1E63 A;  5AN9 A;  5DSZ A;  2JDI A;  3VO1 A;  3QFT A;  3JQQ A;  1VLO A;  2BPO A;  2E1B A;  3WBK A;  1S4M A;  3CPW B;  4PC7 A;  3ISX A;  2P3M A;  2X53 S;  3FPP A;  4M53 A;  3ASR A;  4HE5 A;  5F4O A;  3CCR B;  1Q81 D;  3H94 A;  5B6I A;  1HZE A;  4KKS A;  4X7E A;  1M90 D;  3CRZ A;  2DY1 A;  5LMZ A;  4U9U A;  5GV7 A;  4KKU A;  3SEJ A;  3CCV B;  1EXM A;  2W6I A;  1IB0 A;  1T6Z A;  1QG0 A;  1XE1 A;  3FKS A;  1IJE A;  3OFN A;  3T56 B;  4EH1 A;  1OB0 A;  3BQJ A;  2QDX A;  4FN5 A;  1YLO A;  2ZBU A;  1WU8 A;  3PEN A;  2X6W A;  4XR6 A;  1FRN A;  2DEU A;  4NCN A;  1G7S A;  1XFO A;  4G5G A;  4ZCI A;  3GVK A;  2Q6K A;  2WZP P;  5HZB A;  1WOS A;  2AHO A;  2Q6O A;  3QFR A;  4OOV A;  4ASU A;  2XZO A;  4UZE A;  5FO1 A;  2C77 A;  1V5V A;  4WWV A;  4OOS A;  2CF4 A;  1NBM A;  4Z4R A;  4L8J A;  1EFT A;  1VJS A;  3AVW A;  1NJI D;  2DIE A;  1CNE A;  1D2E A;  2XNC A;  1W0K A;  1KJZ A;  1KC8 D;  4TMZ A;  4TT3 A;  4G1V A;  1V0E A;  1NB0 A;  2VZL A;  1E1R A;  1EFR A;  3Q38 A;  1EFU A;  2V7X A;  3PVD A;  4QV2 A;  4DNR B;  1FRQ A;  4QFM A;  1HA3 A;  1VF7 A;  4C0S A;  5A88 A;  1YJW B;  4XOP A;  3B82 A;  4P25 A;  2GQF A;  2RC5 A;  3PA1 A;  2ZXI A;  1W34 A;  4UZF A;  1VQM B;  1VQL B;  2V31 A;  3CCJ B;  1IHM A;  4YXW A;  2DER A;  2DOG A;  3OJX A;  1ZM3 A;  3CMA B;  2BV3 A;  2V7T A;  4X8I A;  1G7T A;  4PC1 A;  2X6Y A;  3OEH A;  5FA6 A;  1U2R A;  2C5H A;  3R6J A;  2X8K A;  4DK1 A;  1K8A D;  1M1K D;  1E79 A;  3G05 A;  3Q3A A;  3OKX A;  4ZGN B;  1B2R A;  5EMN A;  3BNW A;  5GV8 A;  2D3L A;  2YWE A;  3W2F A;  4RM0 A;  5FIU A;  2GK7 A;  4B3X A;  1BPL A;  4RD1 A;  2OK8 A;  2ZTN A;  4P2N A;  2Q6L A;  1R5B A;  2C4T A;  3LQE A;  4X0C A;  3SLD A;  4DK0 A;  1WSV A;  5FL7 A;  4QVA A;  1KK3 A;  4DQL A;  3W5H A;  2X3U A;  1DG1 G;  1I7P A;  3U6B A;  2V4D A;  1JJ2 B;  3AGP A;  3PA2 A;  5HKK A;  4PAA A;  3CES A;  3A35 A;  5F4J A;  3JQP A;  1VQO B;  3CC4 B;  1PJ5 A;  1W2B B;  1FDR A;  2PIA A;  2GK6 A;  1OGJ A;  3U6K A;  3QFC A;  3BCF A;  4TSF A;  3W2I A;  2FX3 A;  3CCQ B;  2XND A;  3CW2 A;  3W2H A;  2D3N A;  5TV2 A;  3CCL B;  1T6Y A;  2CBX A;  4OPV A;  4NNJ A;  3W5V A;  2FVG A;  2OYN A;  2WPD A;  3DDY A;  1BMF A;  3Q6Q A;  5J3O A;  2XEX A;  1OHH A;  1F60 A;  2C4U A;  3LNN A;  4RJL A;  4Z4Z A;  3CMM A;  1BX1 A;  3KEW A;  3I56 B;  4P26 A;  1EWY A;  1MRZ A;  1YHQ B;  4XN0 A;  3JQR A;  1JB9 A;  1WOP A;  4PAB A;  1VLY A;  1KMH A;  3OOC A;  1PJ6 A;  3D26 A;  2OK7 A;  1YI2 B;  4ACB A;  1H85 A;  2ZXH A;  4CQJ A;  1BQE A;  2EIX A;  4P9S A;  4G7X A;  1E43 A;  1YIT B;  1VQ6 B;  4B47 A;  3V76 A;  1A8P A;  3AVY A;  3ASP A;  4RDL A;  4OOX A;  5BSX A;  1F20 A;  3VNV A;  1VHE A;  1KK2 A;  3A3B A;  4Z4W A;  1J9Z A;  3WNC A;  1VQ9 B;  2BM0 A;  4TMT A;  4GQN A;  1ZM9 A;  1QFZ A;  3GIR A;  3OZU A;  3T53 B;  4J0Q A;  4F7D A;  4P3I A;  3P26 A;  3ZZT A;  1SKQ A;  4MYT A;  1DAR A;  4XOT A;  1E3Z A;  1KRH A;  2Z6B D;  3CP8 A;  1CQX A;  3ZZU A;  3G71 B;  3GSI A;  4M4S A;  2JN9 A;  1R5N A;  2D74 A;  1T6X A;  1MAB A;  4TKO B;  3W2G A;  1T5E A;  1QGZ A;  5IYQ A;  4M1K A;  4YAL A;  4YEJ A;  2KVO A;  2CK3 A;  1HVX A;  1KD1 D;  1N08 A;  1QVG B;  2BSA A;  4G1B A;  2R9V A;  2QEX B;  3WY9 A;  3ZUG A;  2JIZ A;  4LBV A;  2BF4 A;  4Y7C A;  1FX0 A;  1ZM2 A;  4XNF A;  4AVZ A;  4P1V A;  3CCS B;  3ZBU A;  3OAA A;  4XL9 A;  4X7D A;  2NPF A;  2WSS A;  1QUF A;  3QE2 A;  3BCD A;  2C78 A;  3A8K A;  2QTZ A;  2ZZQ A;  2BGJ A;  5TR9 A;  3AGQ A;  3I1F A;  1Q9S A;  3G4S B;  1JA1 A;  1NRK A;  1R5O A;  1I8D A;  1UD5 A;  5H59 A;  4DNT B;  3AVT A;  1EP3 B;  2HDN B;  1Q82 D;  4LC0 A;  1QUE A;  4XKW A;  4HE6 A;  1I18 A;  4G7W A;  2HMA A;  2F4N A;  5F4M A;  5DS0 A;  4UAJ A;  2DYI A;  3CP2 A;  1E1Q A;  5JBQ A;  2QGG A;  3CC2 B;  3OP1 A;  3BY2 A;  3E20 A;  2VYQ A;  4YEL A;  3ZPN A;  4XQF A;  2C5B A;  5IYR A;  2BN4 A;  1VQ4 B;  1QH0 A;  1E62 A;  4C43 A;  4PC2 A;  1VQ8 B;  2VNK A;  1VQK B;  1FNB A;  4P12 A;  3ZZ0 A;  4X7C A;  4TN1 A;  1KK1 A;  1EFC A;  1P4M A;  2YWH A; 
#chains in the Genus database with same CATH homology
 5BSY A;  4WZE A;  4Z4U A;  4ROX A;  3Q6Q A;  4X05 A;  3PUN A;  2ZL7 A;  4Z4T A;  5J3O A;  4RPB A;  4QUZ A;  4Z4Z A;  3Q39 A;  3V7A A;  4P26 A;  4OPS A;  4WZK A;  4RDJ A;  5F4O A;  3ASR A;  5J35 A;  3D26 A;  4Z4V A;  2OBS A;  4X7E A;  5HZA A;  3SEJ A;  3PUM A;  3R6K A;  4RPD A;  4QVJ A;  4X07 A;  3ASP A;  3BQJ A;  4RDL A;  4OOX A;  4Z4S A;  5BSX A;  4Z4Y A;  4Z4W A;  5HZB A;  4OOV A;  4P3I A;  4RLZ A;  3ONU A;  4OOS A;  4Z4R A;  5E6T A;  2ZL6 A;  5IYQ A;  3BY1 A;  3ASQ A;  3SJP A;  4X7F A;  3Q38 A;  5IYW A;  4OP7 A;  3PVD A;  4QV2 A;  2OBT A;  4OPO A;  4P25 A;  3PA1 A;  4P1V A;  1IHM A;  2OBR A;  4X7D A;  3R6J A;  3ONY A;  5KW9 A;  4WZL A;  3Q3A A;  5IYP A;  4RM0 A;  2ZL5 A;  3AST A;  4P2N A;  5IYN A;  3Q6R A;  3LQE A;  4X0C A;  3SLD A;  5F4M A;  4X06 A;  4QVA A;  4RDK A;  3BY2 A;  3PA2 A;  3LQ6 A;  5F4J A;  3RY8 A;  3SKB A;  5IYR A;  3ASS A;  4P12 A;  4WZT A;  4X7C A;  3SLN A;  4OPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...