2ZL7A

Atomic resolution structural characterization of recognition of histo-blood group antigens by norwalk virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
286
structure length
285
Chain Sequence
FTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASGPQQLPINGVFVFVSWVSRFYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structural characterization of recognition of histo-blood group antigens by Norwalk virus
pubmed doi rcsb
molecule keywords 58 kd capsid protein
molecule tags Viral protein
source organism Norwalk virus
total genus 67
structure length 285
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 2zl7A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 2zl7A01
4Z4ZA 4Z4SA 5HZAA 4QVJA 2ZL7A 5HZBA 2ZL5A 5F4MA 4WZTA 4OPSA 3RY8A 4RDKA 5KW9A 5IYRA 3BY1A 4RLZA 4Z4WA 3PVDA 3LQ6A 1IHMA 4RDLA 3BQJA 5BSYA 3SLNA 5J35A 4P1VA 3Q6RA 4RM0A 4RDJA 3Q39A 4X7CA 4Z4UA 4Z4YA 4P26A 3BY2A 3Q38A 3R6KA 2ZL6A 4WZKA 4X06A 4X7EA 4OPVA 2OBRA 4X07A 5F4OA 4OOXA 4X0CA 4OP7A 4OPOA 3PUMA 4OOVA 4RPBA 3ONUA 5IYPA 4P2NA 3PUNA 4P12A 4QV2A 4X05A 3SJPA 5IYNA 5E6TA 5IYQA 3ASTA 3SKBA 3Q3AA 5BSXA 2OBTA 3LQEA 4QUZA 5J3OA 3R6JA 3ASPA 4P3IA 3SEJA 4Z4TA 3ASSA 4QVAA 2OBSA 3ASQA 4P25A 3SLDA 3ONYA 3ASRA 3PA2A 4WZEA 4Z4VA 4WZLA 4OOSA 4RPDA 5IYWA 3D26A 3PA1A 3Q6QA 4X7FA 4X7DA 3V7AA 4ROXA 5F4JA 4Z4RA
chains in the Genus database with same CATH superfamily
1S0UA 5FIUA 3A8KA 1OB0A 2NPFA 2B5OA 3W5VA 1Q7YD 4PAAA 2V7QA 4B3FX 5HZAA 1KK1A 1G7CA 4QVJA 2ZL7A 1WORA 1EFCA 2PLFA 3AVXA 2W6JA 1YX2A 4M1KA 1XB2A 4OPSA 3W2HA 2VNHA 4NCNA 3OJWA 2DY1A 4Y7CA 1UD3A 3QFRA 1QUFA 3ZZTA 2BGIA 2Q6IA 1N8RD 4UZEA 1V5VA 3ES9A 2C5HA 1E79A 4TKOB 2QTLA 4RJLA 5GV8A 2HLDA 4TMVA 4P1VA 1VQ4B 2WJYA 3ZIAA 2CRVA 1IB0A 2CBXA 3CCMB 1VQOB 2BPOA 4RD1A 4BPRA 1D8TA 1DDGA 4RM0A 2RC6A 2J7KA 1E63A 3P27A 4G6IA 3KEWA 2YWHA 1G7RA 2JN9A 3H9NA 2WZNA 4YELA 1AMOA 3AVUA 4LBZA 4PC1A 4XLAA 3BY2A 4XOTA 1YHQB 4P6YA 2DIEA 1K73D 4FN5A 1UD4A 1YITB 4TSFA 2DETA 1UD2A 4X06A 3WXMA 1Q9SA 2EIXA 1W0JA 1QVFB 2OBRA 3OOCA 2QN6A 4Y9UA 1JA0A 4X07A 2FX3A 3A35A 3BCDA 1KJZA 2QEXB 1TUIA 3OEHA 4Z1MA 2D74A 3U6KA 3ISXA 4M4SA 2GJKA 3LNNA 3ZBUA 2WJVA 5KSWB 3AVWA 1D1NA 4ZGQB 1WSRA 1WU8A 2I1LA 4ACBA 3ONUA 1GAQA 2VBTA 2X3UA 3CW2A 1NB9A 2CW5A 4P2NA 2JDIA 4PGOA 2OK8A 3CCUB 5TR9A 2Q6LA 2GPJA 3WQZA 1E64A 1E43A 3W5UA 1N0UA 2ZXIA 5IK2A 4RCYA 3OZVA 5IYQA 1OB2A 1YLOA 1UD5A 4XQFA 2YWEA 2OBTA 3OP1A 1FNCA 2ZZFA 5A88A 4L8JA 2ZBVA 3QE2A 5CDFA 4K1XA 1HA3A 1AIPA 3T53B 1EP2B 3E1YE 4ZGNB 3DDYA 3FJOA 4P3YA 3W2GA 2OYNA 2R6HA 2ZITA 1B2RA 1G7SA 4RD3A 3CPXA 3KL9A 4M2LA 1XE1A 2PE3A 3SLDA 1B23P 2ZBUA 1HZEA 3VO1A 3VO2A 3CCEB 1KQSB 3U2QA 1WOOA 5IYWA 3D26A 4AC9A 2C5BA 4XR6A 2W6IA 3WYAA 4F7DA 4G7XA 1COWA 4WQMA 2X8KA 3Q6QA 2VYQA 2F4NA 2VNIA 4P22A 5AN9A 2BVNA 5F4JA 3CPWB 4X8IA 1KMHA 1G7TA 4RD4A 4Z4ZA 1FNBA 3A3BA 4FXUA 3AVTA 3FKSA 2ZZQA 3AGQA 4FK8A 5JBQA 1VQ6B 1QUEA 5HZBA 2R9VA 1P4MA 1FRQA 1NDHA 4PC2A 1VQ5B 1T6ZA 4AF7A 2WYRA 1QVGB 5HKKA 1TLLA 1F20A 5TV2A 3HAGA 4RLZA 2V4DA 4CQJA 2VNJA 1JA1A 4PC6A 1YJ9B 1VQLB 3LQ6A 1IHMA 2CK3A 3CC4B 1VQMB 1IJFA 3QSYA 3BQJA 5BSYA 4ZCMA 2YWFA 1K8AD 2DEUA 4LC0A 4C0SA 2WPDA 1PKVA 3NE5B 4RDJA 2V7VA 4B43A 4P6VF 2QA4B 5EMNA 3Q39A 4X7CA 2V7XA 3OEEA 1WOSA 2DERA 4Z4UA 1E62A 4XL9A 1BMFA 2XNCA 2BGJA 1SKYB 4G1VA 3OAAA 1M90D 1VLYA 2NV4A 4N3NA 3CCSB 2C2WA 3OPOA 1VLOA 2XZPA 4R71A 1WSVA 2BM0A 1EP1B 1PJ7A 1QFJA 3A3GA 3CMMA 4AF6A 3GVLA 4U9UA 2QE7A 2C77A 1KTVA 2ZL6A 3B78A 4RD2A 1VQ8B 4XONA 1PJ5A 3G4SB 3OW7A 4OPVA 5A89A 1T6XA 1R5BA 1VQ9B 1T5EA 3BC9A 2ZZGA 4NBSA 4OOXA 4X0CA 1VF7A 2QTZA 4XD7A 1N08A 1DG1G 1WP6A 3OW2B 2Q6KA 4XKWA 4RPBA 3JQRA 1T6YA 2XOKA 5H59A 4J0QA 3CP8A 2BN4A 4KKSA 4B47A 1NB0A 1OGJA 1QGYA 1W87A 4DQKA 1YJNB 4P12A 1EFUA 3AGPA 1E3XA 4X05A 1ZUNB 3U6BA 1CNEA 3SJPA 3VR6A 1TVCA 1H8HA 3GVJA 1FRNA 3SKBA 2D9RA 2ZZEA 3Q3AA 5BSXA 3MCAA 3CC2B 4QFMA 4QUZA 2P3MA 3ZPNA 3SEJA 1HVXA 1UMKA 1OGIA 3CCRB 2WZPP 3CXCB 1BQEA 4HIZA 2OTJB 2GQFA 1IJEA 1EWYA 2E1RA 2CC2A 3ZBTA 1QG0A 1VQPB 1EP3B 2PIAA 3QFSA 4LBWA 2XZLA 2QMUA 4Y9RA 4Z4VA 2F43A 4WZLA 4DK0A 4RPDA 1K9MD 3PA1A 1MRZA 1I7PA 1QH0A 2E1BA 2GJRA 4EH1A 1N06A 4P9SA 4X7DA 5THXA 2VNKA 3I56B 3I1FA 3P26A 4B4DA 4ACAA 1NRKA 1VHEA 3CP2A 2V7UA 4XOPA 4M0LA 4XORA 3LO8A 2EFGA 1R5OA 2VJJA 3OZWA 3W2EA 4DNTB 5HXBA 1FDRA 4LBYA 2C4UA 2JJ2A 5IYRA 3BY1A 3MMPA 5LMZA 4Z4WA 3G71B 4ZCLA 1KC8D 5KNLA 1KK0A 2XGJA 1JB9A 2VBUA 2XNJA 1GAWA 1KK3A 3G05A 1XFOA 3SLNA 1RQRA 5FO1A 3CMAB 4FWTA 4M53A 2D3LA 3A8JA 4TT3A 3ZZUA 2DOGA 3A8IA 1VJSA 5H5JA 1OB5A 3CRZA 3CC7B 2F1LA 3G6EB 1EFTA 2GK7A 4ZV4A 4N3GA 3T51B 4XNFA 1F60A 1CQXA 3BCFA 3PENA 5L46A 3CTAA 5GV7A 3JU4A 4YHBA 3Q38A 3QFCA 3OZUA 4RD0A 4WZKA 5A8AA 4X7EA 5DSZA 1BX1A 1ZM9A 5FL7A 1S4MA 2QDXA 5F4OA 4B48A 3JQPA 3WNBA 1XQBA 4MYTA 1RQPA 2HCJB 4OP7A 1WTHD 1H8EA 3B8HA 4YXWA 4OPOA 3A1PA 1UD8A 4OOVA 1YI2B 2GREA 3OFNA 2C78A 4XMYA 2GK6A 2F1MA 1GR1A 3OE7A 1NJID 4QV2A 3I55B 2FVGA 2BV3A 1YJWB 3ZUGA 1V0FA 1QGZA 4XN0A 5IYNA 1KZLA 1WDTA 1W9XA 2QGGA 4YAUA 1YIJB 1VQ7B 1I8DA 3WBKA 3CMEB 1FX0A 2BM1A 1EFRA 3LQEA 5J3OA 3ASPA 3BH4A 1W34A 2CNDA 4GQNA 2X53S 1ZM3A 3QFTA 3CCQB 3WY9A 1GO2A 2PMDA 4KKUA 1H85A 4QVAA 4ASUA 5DS0A 4LBVA 2D3NA 4P25A 2C4TA 3GIRA 4DQLA 5FNZA 1QFZA 1J9ZA 2BSAA 2Q6OA 3GSIA 1ELOA 4XKVA 1E1RA 1FNMA 3ASRA 4E0FA 2BMWA 4WZEA 2VBVA 1Q86D 2GJPA 2VZLA 4OOSA 3T56B 1VQNB 3LVBA 2JJ1A 1QFYA 2ZXHA 4PC7A 3V7AA 4X7FA 1Y0RA 4ROXA 4KKTA 4Z4RA 2KVOA 3CCLB 1VQKB 3W2FA 4H9GA 2AHOA 4Z4SA 1KK2A 4TMWA 2XZOA 3JQQA 1QX4A 4YAOA 4XLHA 1MABA 5FA6A 1GJRA 2WSSA 3SJZA 1BJKA 2DYIA 2Z6BD 2ZL5A 3CD6B 2WR8A 4G5GA 5F4MA 4WZTA 2X6XA 3RY8A 3CB4A 4RDKA 3AVYA 5KW9A 4YAWA 1ZM2A 1KD1D 2V31A 3CESA 3VMFA 4ZCIA 1M1KD 3PVDA 3VNUA 1EXMA 1DDIA 4JMQA 4WWVA 3GQBA 4RDLA 3GVKA 3BNWA 4MYUA 4YEJA 1JJ2B 1FNDA 5J35A 3WNCA 1N05A 1R5NA 2HDNB 3Q6RA 3WBJA 4DK1A 3W5HA 1WOPA 3ZZ0A 4Z4YA 4XLEA 1A8PA 2OK7A 4B44A 1I18A 4P26A 2M5SA 1KRHA 1DARA 4B3GA 1OHHA 2HMAA 3FPPA 4PC3A 1VHOA 1E3ZA 2X0KA 1PJ6A 2CF4A 3FPKA 3R6KA 2X6YA 1JNYA 2OTLB 1N07A 4XLFA 3E20A 2RC5A 4NNJA 4TMZA 4RD6A 4XN3A 2BF4A 3VNVA 1ZM4A 4TMXA 4HE5A 3J81k 3PUMA 4II2A 4QHYA 1CNFA 4TMTA 4TN1A 1GVHA 4UZFA 4G1BA 4XLCA 5IYPA 2ZTNA 3PUNA 1BPLA 3V76A 4YALA 2DCUA 1D2EA 1V0EA 3MHPA 2LZJA 4PABA 5E6TA 3ASTA 1NBMA 1N0VC 1W2BB 1W35A 1E1QA 5TRDA 2V7WA 4AVZA 2VJIA 2XNDA 4G7WA 1H42A 4II3A 4UZUA 1Q82D 1TTTA 4XM3A 4YAFA 3R6JA 5FO0A 3CCVB 4UAJA 4P3IA 3B82A 2JIZA 4DNRB 5B6IA 4Z4TA 3ASSA 4RCZA 1SM4A 2OBSA 3CCJB 1K28D 1BLIA 4Q7JB 2ZTGA 1U2RA 3ASQA 3OJXA 2XEXA 1BX0A 4C43A 1SKQA 5DN6A 3ZC3A 3H94A 1Y0YA 1Q81D 3OKXA 2B7BA 3ONYA 1UD6A 3PA2A 3AVVA 5TY0A 4B3XA 2B7CA 4HE6A 2VBSA 3W2IA 3WNDA 1QGAA 2X85A 2X6WA 1W0KA 2V7TA 1S72B 1WPCA 2YWGA 4IW3B
chains in the Genus database with same CATH topology
4Z4ZA 4Z4SA 5HZAA 4QVJA 2ZL7A 5HZBA 2ZL5A 5F4MA 4WZTA 4OPSA 3RY8A 4RDKA 5KW9A 5IYRA 3BY1A 4RLZA 4Z4WA 3PVDA 3LQ6A 1IHMA 4RDLA 3BQJA 5BSYA 3SLNA 5J35A 4P1VA 3Q6RA 4RM0A 4RDJA 3Q39A 4X7CA 4Z4UA 4Z4YA 4P26A 3BY2A 3Q38A 3R6KA 2ZL6A 4WZKA 4X06A 4X7EA 4OPVA 2OBRA 4X07A 5F4OA 4OOXA 4X0CA 4OP7A 4OPOA 3PUMA 4OOVA 4RPBA 3ONUA 5IYPA 4P2NA 3PUNA 4P12A 4QV2A 4X05A 3SJPA 5IYNA 5E6TA 5IYQA 3ASTA 3SKBA 3Q3AA 5BSXA 2OBTA 3LQEA 4QUZA 5J3OA 3R6JA 3ASPA 4P3IA 3SEJA 4Z4TA 3ASSA 4QVAA 2OBSA 3ASQA 4P25A 3SLDA 3ONYA 3ASRA 3PA2A 4WZEA 4Z4VA 4WZLA 4OOSA 4RPDA 5IYWA 3D26A 3PA1A 3Q6QA 4X7FA 4X7DA 3V7AA 4ROXA 5F4JA 4Z4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4Z A;  4Z4S A;  5HZA A;  4QVJ A;  2ZL7 A;  5HZB A;  2ZL5 A;  5F4M A;  4WZT A;  4OPS A;  3RY8 A;  4RDK A;  5KW9 A;  5IYR A;  3BY1 A;  4RLZ A;  4Z4W A;  3PVD A;  3LQ6 A;  1IHM A;  4RDL A;  3BQJ A;  5BSY A;  3SLN A;  5J35 A;  4P1V A;  3Q6R A;  4RM0 A;  4RDJ A;  3Q39 A;  4X7C A;  4Z4U A;  4Z4Y A;  4P26 A;  3BY2 A;  3Q38 A;  3R6K A;  2ZL6 A;  4WZK A;  4X06 A;  4X7E A;  4OPV A;  2OBR A;  4X07 A;  5F4O A;  4OOX A;  4X0C A;  4OP7 A;  4OPO A;  3PUM A;  4OOV A;  4RPB A;  3ONU A;  5IYP A;  4P2N A;  3PUN A;  4P12 A;  4QV2 A;  4X05 A;  3SJP A;  5IYN A;  5E6T A;  5IYQ A;  3AST A;  3SKB A;  3Q3A A;  5BSX A;  2OBT A;  3LQE A;  4QUZ A;  5J3O A;  3R6J A;  3ASP A;  4P3I A;  3SEJ A;  4Z4T A;  3ASS A;  4QVA A;  2OBS A;  3ASQ A;  4P25 A;  3SLD A;  3ONY A;  3ASR A;  3PA2 A;  4WZE A;  4Z4V A;  4WZL A;  4OOS A;  4RPD A;  5IYW A;  3D26 A;  3PA1 A;  3Q6Q A;  4X7F A;  4X7D A;  3V7A A;  4ROX A;  5F4J A;  4Z4R A; 
#chains in the Genus database with same CATH topology
 1S0U A;  5FIU A;  3A8K A;  1OB0 A;  2NPF A;  2B5O A;  3W5V A;  1Q7Y D;  4PAA A;  2V7Q A;  4B3F X;  5HZA A;  1KK1 A;  1G7C A;  4QVJ A;  2ZL7 A;  1WOR A;  1EFC A;  2PLF A;  3AVX A;  2W6J A;  1YX2 A;  4M1K A;  1XB2 A;  4OPS A;  3W2H A;  2VNH A;  4NCN A;  3OJW A;  2DY1 A;  4Y7C A;  1UD3 A;  3QFR A;  1QUF A;  3ZZT A;  2BGI A;  2Q6I A;  1N8R D;  4UZE A;  1V5V A;  3ES9 A;  2C5H A;  1E79 A;  4TKO B;  2QTL A;  4RJL A;  5GV8 A;  2HLD A;  4TMV A;  4P1V A;  1VQ4 B;  2WJY A;  3ZIA A;  2CRV A;  1IB0 A;  2CBX A;  3CCM B;  1VQO B;  2BPO A;  4RD1 A;  4BPR A;  1D8T A;  1DDG A;  4RM0 A;  2RC6 A;  2J7K A;  1E63 A;  3P27 A;  4G6I A;  3KEW A;  2YWH A;  1G7R A;  2JN9 A;  3H9N A;  2WZN A;  4YEL A;  1AMO A;  3AVU A;  4LBZ A;  4PC1 A;  4XLA A;  3BY2 A;  4XOT A;  1YHQ B;  4P6Y A;  2DIE A;  1K73 D;  4FN5 A;  1UD4 A;  1YIT B;  4TSF A;  2DET A;  1UD2 A;  4X06 A;  3WXM A;  1Q9S A;  2EIX A;  1W0J A;  1QVF B;  2OBR A;  3OOC A;  2QN6 A;  4Y9U A;  1JA0 A;  4X07 A;  2FX3 A;  3A35 A;  3BCD A;  1KJZ A;  2QEX B;  1TUI A;  3OEH A;  4Z1M A;  2D74 A;  3U6K A;  3ISX A;  4M4S A;  2GJK A;  3LNN A;  3ZBU A;  2WJV A;  5KSW B;  3AVW A;  1D1N A;  4ZGQ B;  1WSR A;  1WU8 A;  2I1L A;  4ACB A;  3ONU A;  1GAQ A;  2VBT A;  2X3U A;  3CW2 A;  1NB9 A;  2CW5 A;  4P2N A;  2JDI A;  4PGO A;  2OK8 A;  3CCU B;  5TR9 A;  2Q6L A;  2GPJ A;  3WQZ A;  1E64 A;  1E43 A;  3W5U A;  1N0U A;  2ZXI A;  5IK2 A;  4RCY A;  3OZV A;  5IYQ A;  1OB2 A;  1YLO A;  1UD5 A;  4XQF A;  2YWE A;  2OBT A;  3OP1 A;  1FNC A;  2ZZF A;  5A88 A;  4L8J A;  2ZBV A;  3QE2 A;  5CDF A;  4K1X A;  1HA3 A;  1AIP A;  3T53 B;  1EP2 B;  3E1Y E;  4ZGN B;  3DDY A;  3FJO A;  4P3Y A;  3W2G A;  2OYN A;  2R6H A;  2ZIT A;  1B2R A;  1G7S A;  4RD3 A;  3CPX A;  3KL9 A;  4M2L A;  1XE1 A;  2PE3 A;  3SLD A;  1B23 P;  2ZBU A;  1HZE A;  3VO1 A;  3VO2 A;  3CCE B;  1KQS B;  3U2Q A;  1WOO A;  5IYW A;  3D26 A;  4AC9 A;  2C5B A;  4XR6 A;  2W6I A;  3WYA A;  4F7D A;  4G7X A;  1COW A;  4WQM A;  2X8K A;  3Q6Q A;  2VYQ A;  2F4N A;  2VNI A;  4P22 A;  5AN9 A;  2BVN A;  5F4J A;  3CPW B;  4X8I A;  1KMH A;  1G7T A;  4RD4 A;  4Z4Z A;  1FNB A;  3A3B A;  4FXU A;  3AVT A;  3FKS A;  2ZZQ A;  3AGQ A;  4FK8 A;  5JBQ A;  1VQ6 B;  1QUE A;  5HZB A;  2R9V A;  1P4M A;  1FRQ A;  1NDH A;  4PC2 A;  1VQ5 B;  1T6Z A;  4AF7 A;  2WYR A;  1QVG B;  5HKK A;  1TLL A;  1F20 A;  5TV2 A;  3HAG A;  4RLZ A;  2V4D A;  4CQJ A;  2VNJ A;  1JA1 A;  4PC6 A;  1YJ9 B;  1VQL B;  3LQ6 A;  1IHM A;  2CK3 A;  3CC4 B;  1VQM B;  1IJF A;  3QSY A;  3BQJ A;  5BSY A;  4ZCM A;  2YWF A;  1K8A D;  2DEU A;  4LC0 A;  4C0S A;  2WPD A;  1PKV A;  3NE5 B;  4RDJ A;  2V7V A;  4B43 A;  4P6V F;  2QA4 B;  5EMN A;  3Q39 A;  4X7C A;  2V7X A;  3OEE A;  1WOS A;  2DER A;  4Z4U A;  1E62 A;  4XL9 A;  1BMF A;  2XNC A;  2BGJ A;  1SKY B;  4G1V A;  3OAA A;  1M90 D;  1VLY A;  2NV4 A;  4N3N A;  3CCS B;  2C2W A;  3OPO A;  1VLO A;  2XZP A;  4R71 A;  1WSV A;  2BM0 A;  1EP1 B;  1PJ7 A;  1QFJ A;  3A3G A;  3CMM A;  4AF6 A;  3GVL A;  4U9U A;  2QE7 A;  2C77 A;  1KTV A;  2ZL6 A;  3B78 A;  4RD2 A;  1VQ8 B;  4XON A;  1PJ5 A;  3G4S B;  3OW7 A;  4OPV A;  5A89 A;  1T6X A;  1R5B A;  1VQ9 B;  1T5E A;  3BC9 A;  2ZZG A;  4NBS A;  4OOX A;  4X0C A;  1VF7 A;  2QTZ A;  4XD7 A;  1N08 A;  1DG1 G;  1WP6 A;  3OW2 B;  2Q6K A;  4XKW A;  4RPB A;  3JQR A;  1T6Y A;  2XOK A;  5H59 A;  4J0Q A;  3CP8 A;  2BN4 A;  4KKS A;  4B47 A;  1NB0 A;  1OGJ A;  1QGY A;  1W87 A;  4DQK A;  1YJN B;  4P12 A;  1EFU A;  3AGP A;  1E3X A;  4X05 A;  1ZUN B;  3U6B A;  1CNE A;  3SJP A;  3VR6 A;  1TVC A;  1H8H A;  3GVJ A;  1FRN A;  3SKB A;  2D9R A;  2ZZE A;  3Q3A A;  5BSX A;  3MCA A;  3CC2 B;  4QFM A;  4QUZ A;  2P3M A;  3ZPN A;  3SEJ A;  1HVX A;  1UMK A;  1OGI A;  3CCR B;  2WZP P;  3CXC B;  1BQE A;  4HIZ A;  2OTJ B;  2GQF A;  1IJE A;  1EWY A;  2E1R A;  2CC2 A;  3ZBT A;  1QG0 A;  1VQP B;  1EP3 B;  2PIA A;  3QFS A;  4LBW A;  2XZL A;  2QMU A;  4Y9R A;  4Z4V A;  2F43 A;  4WZL A;  4DK0 A;  4RPD A;  1K9M D;  3PA1 A;  1MRZ A;  1I7P A;  1QH0 A;  2E1B A;  2GJR A;  4EH1 A;  1N06 A;  4P9S A;  4X7D A;  5THX A;  2VNK A;  3I56 B;  3I1F A;  3P26 A;  4B4D A;  4ACA A;  1NRK A;  1VHE A;  3CP2 A;  2V7U A;  4XOP A;  4M0L A;  4XOR A;  3LO8 A;  2EFG A;  1R5O A;  2VJJ A;  3OZW A;  3W2E A;  4DNT B;  5HXB A;  1FDR A;  4LBY A;  2C4U A;  2JJ2 A;  5IYR A;  3BY1 A;  3MMP A;  5LMZ A;  4Z4W A;  3G71 B;  4ZCL A;  1KC8 D;  5KNL A;  1KK0 A;  2XGJ A;  1JB9 A;  2VBU A;  2XNJ A;  1GAW A;  1KK3 A;  3G05 A;  1XFO A;  3SLN A;  1RQR A;  5FO1 A;  3CMA B;  4FWT A;  4M53 A;  2D3L A;  3A8J A;  4TT3 A;  3ZZU A;  2DOG A;  3A8I A;  1VJS A;  5H5J A;  1OB5 A;  3CRZ A;  3CC7 B;  2F1L A;  3G6E B;  1EFT A;  2GK7 A;  4ZV4 A;  4N3G A;  3T51 B;  4XNF A;  1F60 A;  1CQX A;  3BCF A;  3PEN A;  5L46 A;  3CTA A;  5GV7 A;  3JU4 A;  4YHB A;  3Q38 A;  3QFC A;  3OZU A;  4RD0 A;  4WZK A;  5A8A A;  4X7E A;  5DSZ A;  1BX1 A;  1ZM9 A;  5FL7 A;  1S4M A;  2QDX A;  5F4O A;  4B48 A;  3JQP A;  3WNB A;  1XQB A;  4MYT A;  1RQP A;  2HCJ B;  4OP7 A;  1WTH D;  1H8E A;  3B8H A;  4YXW A;  4OPO A;  3A1P A;  1UD8 A;  4OOV A;  1YI2 B;  2GRE A;  3OFN A;  2C78 A;  4XMY A;  2GK6 A;  2F1M A;  1GR1 A;  3OE7 A;  1NJI D;  4QV2 A;  3I55 B;  2FVG A;  2BV3 A;  1YJW B;  3ZUG A;  1V0F A;  1QGZ A;  4XN0 A;  5IYN A;  1KZL A;  1WDT A;  1W9X A;  2QGG A;  4YAU A;  1YIJ B;  1VQ7 B;  1I8D A;  3WBK A;  3CME B;  1FX0 A;  2BM1 A;  1EFR A;  3LQE A;  5J3O A;  3ASP A;  3BH4 A;  1W34 A;  2CND A;  4GQN A;  2X53 S;  1ZM3 A;  3QFT A;  3CCQ B;  3WY9 A;  1GO2 A;  2PMD A;  4KKU A;  1H85 A;  4QVA A;  4ASU A;  5DS0 A;  4LBV A;  2D3N A;  4P25 A;  2C4T A;  3GIR A;  4DQL A;  5FNZ A;  1QFZ A;  1J9Z A;  2BSA A;  2Q6O A;  3GSI A;  1ELO A;  4XKV A;  1E1R A;  1FNM A;  3ASR A;  4E0F A;  2BMW A;  4WZE A;  2VBV A;  1Q86 D;  2GJP A;  2VZL A;  4OOS A;  3T56 B;  1VQN B;  3LVB A;  2JJ1 A;  1QFY A;  2ZXH A;  4PC7 A;  3V7A A;  4X7F A;  1Y0R A;  4ROX A;  4KKT A;  4Z4R A;  2KVO A;  3CCL B;  1VQK B;  3W2F A;  4H9G A;  2AHO A;  4Z4S A;  1KK2 A;  4TMW A;  2XZO A;  3JQQ A;  1QX4 A;  4YAO A;  4XLH A;  1MAB A;  5FA6 A;  1GJR A;  2WSS A;  3SJZ A;  1BJK A;  2DYI A;  2Z6B D;  2ZL5 A;  3CD6 B;  2WR8 A;  4G5G A;  5F4M A;  4WZT A;  2X6X A;  3RY8 A;  3CB4 A;  4RDK A;  3AVY A;  5KW9 A;  4YAW A;  1ZM2 A;  1KD1 D;  2V31 A;  3CES A;  3VMF A;  4ZCI A;  1M1K D;  3PVD A;  3VNU A;  1EXM A;  1DDI A;  4JMQ A;  4WWV A;  3GQB A;  4RDL A;  3GVK A;  3BNW A;  4MYU A;  4YEJ A;  1JJ2 B;  1FND A;  5J35 A;  3WNC A;  1N05 A;  1R5N A;  2HDN B;  3Q6R A;  3WBJ A;  4DK1 A;  3W5H A;  1WOP A;  3ZZ0 A;  4Z4Y A;  4XLE A;  1A8P A;  2OK7 A;  4B44 A;  1I18 A;  4P26 A;  2M5S A;  1KRH A;  1DAR A;  4B3G A;  1OHH A;  2HMA A;  3FPP A;  4PC3 A;  1VHO A;  1E3Z A;  2X0K A;  1PJ6 A;  2CF4 A;  3FPK A;  3R6K A;  2X6Y A;  1JNY A;  2OTL B;  1N07 A;  4XLF A;  3E20 A;  2RC5 A;  4NNJ A;  4TMZ A;  4RD6 A;  4XN3 A;  2BF4 A;  3VNV A;  1ZM4 A;  4TMX A;  4HE5 A;  3J81 k;  3PUM A;  4II2 A;  4QHY A;  1CNF A;  4TMT A;  4TN1 A;  1GVH A;  4UZF A;  4G1B A;  4XLC A;  5IYP A;  2ZTN A;  3PUN A;  1BPL A;  3V76 A;  4YAL A;  2DCU A;  1D2E A;  1V0E A;  3MHP A;  2LZJ A;  4PAB A;  5E6T A;  3AST A;  1NBM A;  1N0V C;  1W2B B;  1W35 A;  1E1Q A;  5TRD A;  2V7W A;  4AVZ A;  2VJI A;  2XND A;  4G7W A;  1H42 A;  4II3 A;  4UZU A;  1Q82 D;  1TTT A;  4XM3 A;  4YAF A;  3R6J A;  5FO0 A;  3CCV B;  4UAJ A;  4P3I A;  3B82 A;  2JIZ A;  4DNR B;  5B6I A;  4Z4T A;  3ASS A;  4RCZ A;  1SM4 A;  2OBS A;  3CCJ B;  1K28 D;  1BLI A;  4Q7J B;  2ZTG A;  1U2R A;  3ASQ A;  3OJX A;  2XEX A;  1BX0 A;  4C43 A;  1SKQ A;  5DN6 A;  3ZC3 A;  3H94 A;  1Y0Y A;  1Q81 D;  3OKX A;  2B7B A;  3ONY A;  1UD6 A;  3PA2 A;  3AVV A;  5TY0 A;  4B3X A;  2B7C A;  4HE6 A;  2VBS A;  3W2I A;  3WND A;  1QGA A;  2X85 A;  2X6W A;  1W0K A;  2V7T A;  1S72 B;  1WPC A;  2YWG A;  4IW3 B; 
#chains in the Genus database with same CATH homology
 4Z4Z A;  4Z4S A;  5HZA A;  4QVJ A;  2ZL7 A;  5HZB A;  2ZL5 A;  5F4M A;  4WZT A;  4OPS A;  3RY8 A;  4RDK A;  5KW9 A;  5IYR A;  3BY1 A;  4RLZ A;  4Z4W A;  3PVD A;  3LQ6 A;  1IHM A;  4RDL A;  3BQJ A;  5BSY A;  3SLN A;  5J35 A;  4P1V A;  3Q6R A;  4RM0 A;  4RDJ A;  3Q39 A;  4X7C A;  4Z4U A;  4Z4Y A;  4P26 A;  3BY2 A;  3Q38 A;  3R6K A;  2ZL6 A;  4WZK A;  4X06 A;  4X7E A;  4OPV A;  2OBR A;  4X07 A;  5F4O A;  4OOX A;  4X0C A;  4OP7 A;  4OPO A;  3PUM A;  4OOV A;  4RPB A;  3ONU A;  5IYP A;  4P2N A;  3PUN A;  4P12 A;  4QV2 A;  4X05 A;  3SJP A;  5IYN A;  5E6T A;  5IYQ A;  3AST A;  3SKB A;  3Q3A A;  5BSX A;  2OBT A;  3LQE A;  4QUZ A;  5J3O A;  3R6J A;  3ASP A;  4P3I A;  3SEJ A;  4Z4T A;  3ASS A;  4QVA A;  2OBS A;  3ASQ A;  4P25 A;  3SLD A;  3ONY A;  3ASR A;  3PA2 A;  4WZE A;  4Z4V A;  4WZL A;  4OOS A;  4RPD A;  5IYW A;  3D26 A;  3PA1 A;  3Q6Q A;  4X7F A;  4X7D A;  3V7A A;  4ROX A;  5F4J A;  4Z4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...