2ZL7A

Atomic resolution structural characterization of recognition of histo-blood group antigens by norwalk virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
286
structure length
285
Chain Sequence
FTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASGPQQLPINGVFVFVSWVSRFYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
publication title Atomic resolution structural characterization of recognition of histo-blood group antigens by Norwalk virus
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 67
structure length 285
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 2zl7A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 2zl7A01
3Q38A 4X06A 4Z4SA 4WZEA 3ASTA 3RY8A 5BSXA 5J35A 3ONUA 4P1VA 4RLZA 4Z4YA 4Z4RA 5E6TA 2ZL7A 4Z4WA 1IHMA 3SLDA 4Z4TA 3D26A 3Q3AA 4P26A 5IYRA 4P12A 4QUZA 3BY2A 4RDLA 3Q39A 5HZBA 2OBSA 3LQ6A 5F4OA 4ROXA 5F4JA 4X05A 4WZLA 4RPBA 4OOXA 3PA2A 3SEJA 5F4MA 4X7FA 4X7CA 4RM0A 3R6KA 3PVDA 4X7DA 3PUNA 4WZTA 4OPOA 4QV2A 3ONYA 3BY1A 4OPVA 4OP7A 4X07A 4P3IA 4OOSA 4QVJA 5IYNA 3R6JA 3ASSA 3ASQA 4Z4UA 4OOVA 5HZAA 3SJPA 4RPDA 2ZL5A 2OBRA 2ZL6A 3PUMA 4OPSA 4WZKA 5IYQA 4Z4ZA 5KW9A 5IYWA 5IYPA 3PA1A 3Q6RA 3ASRA 4P25A 2OBTA 3ASPA 4RDKA 3Q6QA 5BSYA 3SLNA 3BQJA 4P2NA 3SKBA 3V7AA 4X0CA 4X7EA 5J3OA 4RDJA 4QVAA 3LQEA 4Z4VA
chains in the Genus database with same CATH superfamily
3FPKA 1WPCA 4XMYA 2D74A 2DEUA 3WQZA 4M2LA 2E1BA 4YALA 2V7UA 4Z4SA 1VQ7B 1WORA 3ASTA 2V7VA 3RY8A 3CCLB 3W2EA 5BSXA 1XE1A 4P1VA 5TV2A 2V4DA 5KSWB 2F4NA 4PC6A 4N3GA 4ZCLA 2YWEA 1BMFA 2W6JA 2XNDA 4B3FX 3CCRB 4B44A 1N05A 2ZZQA 5GV8A 2VNJA 1PJ5A 4Z4WA 1CNFA 1B2RA 3PENA 1YITB 3SLDA 1N06A 3Q3AA 1HA3A 4P26A 3CC2B 3AVUA 4PAAA 1HZEA 2C5HA 1W2BB 1T6YA 1E62A 3GIRA 1M1KD 3BY2A 1WSRA 2WR8A 4HE6A 2YWFA 4RD1A 3CC7B 1QX4A 3CESA 3U6BA 4OOXA 1AIPA 2B5OA 3P26A 5L46A 3QFRA 2VBSA 3DDYA 1YJNB 4K1XA 1SKYB 5AN9A 1IJEA 2XNCA 3JQPA 3MHPA 2GJPA 4DK1A 2BM0A 1AMOA 3PUNA 3OAAA 4LBWA 1VQOB 4QV2A 1UMKA 2CC2A 5IK2A 4BPRA 1VQLB 3WBJA 2BV3A 3G71B 4X07A 5DSZA 1R5OA 3CCEB 2Q6LA 4DQKA 1KTVA 1GAWA 4XN3A 1PKVA 3ASSA 2VBUA 2D9RA 4F7DA 4RD3A 3WNBA 1EFTA 4WQMA 4LBVA 2BPOA 2GPJA 3WXMA 2WPDA 3SJPA 4C43A 4M0LA 4RPDA 1K9MD 5THXA 4WWVA 3AGPA 3CXCB 4FK8A 3PUMA 2QEXB 1Y0YA 3QFSA 1RQPA 1UD5A 1WSVA 1FDRA 3A8JA 1G7CA 2HLDA 4HE5A 4XOPA 2ZBUA 2PIAA 4ZGQB 5IYQA 4Z4ZA 4XKVA 3OEEA 1KK1A 1QVFB 2X85A 3J81k 3PA1A 3FJOA 2PLFA 1W0KA 3CP2A 4RD0A 2Q6OA 1JB9A 5HKKA 1E1RA 2OBTA 3ASPA 1T6XA 4RDKA 4XLEA 4EH1A 4B47A 1Q86D 4DNTB 3JQRA 1GR1A 4XR6A 4B3XA 2XZLA 1YX2A 4YXWA 2EFGA 4B43A 3I1FA 2GREA 1MRZA 3W5HA 5J3OA 4LBZA 1NB0A 3LQEA 4Z4VA 1VQ6B 1UD3A 3VR6A 4RJLA 1QGZA 1QFJA 2C5BA 2AHOA 4X06A 4TMTA 1DDIA 4B48A 3G4SB 1GJRA 1FNDA 1ZM2A 4WZEA 3AVTA 3OJXA 5J35A 4G7XA 4Y9RA 2VNIA 5E6TA 3E20A 2C4UA 1EFRA 2JDIA 4G1VA 1BJKA 4ZCIA 3I55B 3E1YE 3WYAA 3ZC3A 1FNCA 3CCSB 1IHMA 1J9ZA 3LNNA 4KKTA 2XNJA 3QE2A 3OW7A 2XGJA 3A1PA 4TSFA 3GSIA 1QUEA 4XLHA 1UD8A 3W5VA 3T56B 1S0UA 5DN6A 4P12A 3BCFA 3ZUGA 1YHQB 1WP6A 2C77A 2QE7A 4RDLA 1A8PA 1KK0A 2Q6KA 2F43A 1I8DA 4G7WA 4XNFA 1JNYA 5HXBA 4UZUA 3OP1A 4P6VF 4KKUA 4YAOA 5CDFA 1QUFA 4ROXA 2C2WA 4RD2A 4WZLA 4RPBA 1CQXA 1DARA 1M90D 1VHEA 2PE3A 3SEJA 3CW2A 4II3A 2D3NA 1I18A 2VBTA 3QFTA 3FPPA 4X7CA 4RM0A 3W2HA 3W5UA 1E63A 1QH0A 2CNDA 2CBXA 1KZLA 4X7DA 4MYUA 1NB9A 1YIJB 3A35A 4XLCA 4OPOA 3BY1A 4DQLA 1KJZA 4AVZA 1E1QA 1E43A 1EP2B 4II2A 3OFNA 1VQ8B 1Q9SA 4P3IA 3W2FA 2BN4A 5IYNA 1Y0RA 2NV4A 3OZVA 5FL7A 2BF4A 3R6JA 2C78A 3CMAB 4TN1A 3ASQA 5FIUA 2GJKA 4IW3B 1FRQA 2OK7A 4G6IA 1IB0A 5JBQA 1D8TA 3BC9A 2BGJA 2ZTNA 4Z4UA 1PJ7A 4KKSA 3OZUA 2QN6A 4H9GA 2J7KA 3CCMB 2DCUA 4FN5A 1TTTA 5EMNA 4ZCMA 4OPSA 2OYNA 2BM1A 4LBYA 4HIZA 1YJ9B 2V7WA 5IYWA 1V0FA 2ZITA 5IYPA 1VJSA 4UAJA 1IJFA 1UD2A 3ZBUA 1E3XA 3CMEB 1N8RD 2BSAA 1F20A 3ASRA 4PC7A 1KRHA 2JJ2A 4E0FA 3GVKA 3OEHA 4YAWA 2BMWA 2YWHA 3SLNA 5H59A 1G7TA 4C0SA 3A3BA 1OHHA 4ACAA 4N3NA 4LC0A 1QGYA 3BCDA 1TLLA 3AGQA 3ZPNA 1JA1A 4QVAA 1EXMA 2WZNA 3OW2B 3Q38A 2GJRA 3GQBA 2EIXA 3W2GA 1K28D 1T5EA 3OKXA 4XORA 3LVBA 2NPFA 1YI2B 4Z4YA 4TKOB 3A8IA 1RQRA 2DETA 3OOCA 2QMUA 4GQNA 2WJYA 1ELOA 1NJID 2M5SA 2X6XA 3LO8A 3CD6B 2ZL7A 2VNHA 4XOTA 3B78A 2GQFA 2CW5A 1V5VA 2WZPP 3ZIAA 5IYRA 1KC8D 1F60A 1SM4A 4AC9A 4QUZA 4Z1MA 4ASUA 5B6IA 2QA4B 1QFZA 2X0KA 1QFYA 1MABA 3Q39A 5HZBA 3ZZ0A 1FNMA 1JJ2B 3WBKA 1VF7A 1E3ZA 1WOSA 4X05A 1GO2A 3KL9A 5F4MA 2WJVA 1XB2A 2X3UA 4X7FA 1VLOA 2I1LA 2WSSA 4Q7JB 4UZFA 1EWYA 4DK0A 1HVXA 3FKSA 1YJWB 2R6HA 1BQEA 2LZJA 3PVDA 1TVCA 1FNBA 1G7SA 1E64A 4WZTA 3V76A 3ONYA 4YAFA 4NCNA 4FXUA 1NBMA 3I56B 2WYRA 2B7BA 4OOSA 1WU8A 4QVJA 3CB4A 4AF7A 3VNUA 1N0VC 1QG0A 2VNKA 2DIEA 4L8JA 4XD7A 1N07A 4YHBA 1H42A 1Q81D 4B4DA 1W0JA 2GK6A 2VBVA 4XM3A 4QFMA 2OTJB 4OOVA 1U2RA 1W9XA 4NBSA 4G5GA 1S72B 2ZXIA 1P4MA 2QTZA 4QHYA 1ZM9A 2GK7A 2V31A 2W6IA 1KMHA 2KVOA 3CPWB 1T6ZA 2QDXA 4M4SA 2XZOA 5A88A 2X6WA 3BH4A 3CCQB 2X8KA 2HDNB 4PGOA 5DS0A 1WOOA 4P9SA 5TRDA 3QSYA 3H94A 2YWGA 3T53B 2RC5A 1KD1D 5KW9A 4UZEA 2X53S 4RCZA 4TMWA 3ZZUA 1VQMB 1V0EA 3AVVA 2X6YA 3Q6RA 2OK8A 1EFUA 1VHOA 3A8KA 1Q7YD 1VQKB 4P25A 3NE5B 2B7CA 3OE7A 3A3GA 3Q6QA 1WOPA 4DNRB 2FX3A 5GV7A 2Z6BD 4YEJA 2VJJA 3ZZTA 3H9NA 3BQJA 1BX0A 2PMDA 4PC1A 1H85A 3KEWA 1G7RA 1PJ6A 2C4TA 4X0CA 4X7EA 4XONA 2XEXA 4ACBA 1GAQA 4RD6A 3GVLA 1H8EA 2DYIA 1UD4A 1N08A 1DDGA 2BGIA 3AVYA 3QFCA 1VLYA 3OJWA 4M53A 3ONUA 4RLZA 1OGIA 1K73D 3AVXA 1CNEA 3WY9A 1QVGB 4Z4RA 1B23P 3VO1A 1WTHD 2CRVA 4RCYA 3WNCA 4XL9A 4J0QA 3JQQA 3BNWA 4RD4A 4YELA 2QTLA 2D3LA 1W87A 5KNLA 4Z4TA 4Y7CA 3D26A 4X8IA 3HAGA 3MMPA 1D1NA 3W2IA 1W34A 4B3GA 1R5NA 2ZZFA 2ZBVA 2ZTGA 3CTAA 5A89A 3AVWA 2RC6A 4XN0A 1OB2A 2OBSA 1OB0A 2ZZEA 5FNZA 3LQ6A 5F4OA 4AF6A 4ZV4A 4XLFA 5F4JA 4MYTA 4R71A 4ZGNB 1BLIA 3PA2A 5TR9A 3VO2A 1NDHA 1TUIA 2CK3A 4TT3A 1XFOA 4PC3A 1BX1A 3B8HA 3R6KA 1FX0A 3ISXA 4XQFA 2VJIA 3ZBTA 1VQ4B 4P6YA 2VYQA 2BVNA 2DY1A 4G1BA 4JMQA 4TMZA 2CF4A 5FA6A 1KQSB 1K8AD 4OPVA 4M1KA 4OP7A 4CQJA 3U6KA 1BPLA 3CRZA 1JA0A 1EP1B 1E79A 1D2EA 3GVJA 1YLOA 2XOKA 1KK3A 2HMAA 1VQ5B 1Q82D 3VMFA 2JJ1A 2Q6IA 1UD6A 1GVHA 3P27A 5HZAA 1W35A 3CCVB 1ZUNB 1VQNB 2V7QA 4TMXA 3B82A 2VZLA 2ZZGA 1VQ9B 1S4MA 1QGAA 1NRKA 1KK2A 2F1MA 1FRNA 2OBRA 2ZL6A 2ZL5A 3CPXA 3CP8A 1ZM4A 1XQBA 4PABA 5A8AA 2FVGA 1WDTA 2P3MA 2R9VA 2ZXHA 3CMMA 1DG1G 2OTLB 2QGGA 5H5JA 3MCAA 4WZKA 3ES9A 4Y9UA 4U9UA 4YAUA 4PC2A 1EP3B 2XZPA 3JU4A 3OZWA 1H8HA 2JN9A 3CCJB 2JIZA 5TY0A 2F1LA 4NNJA 4XLAA 5FO1A 1OGJA 2DOGA 4FWTA 1VQPB 1I7PA 3SJZA 4TMVA 3G05A 2V7XA 2DERA 4P22A 5LMZA 5BSYA 3OPOA 4P2NA 1ZM3A 2V7TA 3SKBA 3WNDA 3CCUB 1SKQA 3T51B 3V7AA 1OB5A 1R5BA 2E1RA 4P3YA 3G6EB 3CC4B 3VNVA 1COWA 2HCJB 1N0UA 4XKWA 4RDJA 1EFCA 3U2QA 5FO0A
chains in the Genus database with same CATH topology
3Q38A 4X06A 4Z4SA 4WZEA 3ASTA 3RY8A 5BSXA 5J35A 3ONUA 4P1VA 4RLZA 4Z4YA 4Z4RA 5E6TA 2ZL7A 4Z4WA 1IHMA 3SLDA 4Z4TA 3D26A 3Q3AA 4P26A 5IYRA 4P12A 4QUZA 3BY2A 4RDLA 3Q39A 5HZBA 2OBSA 3LQ6A 5F4OA 4ROXA 5F4JA 4X05A 4WZLA 4RPBA 4OOXA 3PA2A 3SEJA 5F4MA 4X7FA 4X7CA 4RM0A 3R6KA 3PVDA 4X7DA 3PUNA 4WZTA 4OPOA 4QV2A 3ONYA 3BY1A 4OPVA 4OP7A 4X07A 4P3IA 4OOSA 4QVJA 5IYNA 3R6JA 3ASSA 3ASQA 4Z4UA 4OOVA 5HZAA 3SJPA 4RPDA 2ZL5A 2OBRA 2ZL6A 3PUMA 4OPSA 4WZKA 5IYQA 4Z4ZA 5KW9A 5IYWA 5IYPA 3PA1A 3Q6RA 3ASRA 4P25A 2OBTA 3ASPA 4RDKA 3Q6QA 5BSYA 3SLNA 3BQJA 4P2NA 3SKBA 3V7AA 4X0CA 4X7EA 5J3OA 4RDJA 4QVAA 3LQEA 4Z4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q38 A;  4X06 A;  4Z4S A;  4WZE A;  3AST A;  3RY8 A;  5BSX A;  5J35 A;  3ONU A;  4P1V A;  4RLZ A;  4Z4Y A;  4Z4R A;  5E6T A;  2ZL7 A;  4Z4W A;  1IHM A;  3SLD A;  4Z4T A;  3D26 A;  3Q3A A;  4P26 A;  5IYR A;  4P12 A;  4QUZ A;  3BY2 A;  4RDL A;  3Q39 A;  5HZB A;  2OBS A;  3LQ6 A;  5F4O A;  4ROX A;  5F4J A;  4X05 A;  4WZL A;  4RPB A;  4OOX A;  3PA2 A;  3SEJ A;  5F4M A;  4X7F A;  4X7C A;  4RM0 A;  3R6K A;  3PVD A;  4X7D A;  3PUN A;  4WZT A;  4OPO A;  4QV2 A;  3ONY A;  3BY1 A;  4OPV A;  4OP7 A;  4X07 A;  4P3I A;  4OOS A;  4QVJ A;  5IYN A;  3R6J A;  3ASS A;  3ASQ A;  4Z4U A;  4OOV A;  5HZA A;  3SJP A;  4RPD A;  2ZL5 A;  2OBR A;  2ZL6 A;  3PUM A;  4OPS A;  4WZK A;  5IYQ A;  4Z4Z A;  5KW9 A;  5IYW A;  5IYP A;  3PA1 A;  3Q6R A;  3ASR A;  4P25 A;  2OBT A;  3ASP A;  4RDK A;  3Q6Q A;  5BSY A;  3SLN A;  3BQJ A;  4P2N A;  3SKB A;  3V7A A;  4X0C A;  4X7E A;  5J3O A;  4RDJ A;  4QVA A;  3LQE A;  4Z4V A; 
#chains in the Genus database with same CATH topology
 3FPK A;  1WPC A;  4XMY A;  2D74 A;  2DEU A;  3WQZ A;  4M2L A;  2E1B A;  4YAL A;  2V7U A;  4Z4S A;  1VQ7 B;  1WOR A;  3AST A;  2V7V A;  3RY8 A;  3CCL B;  3W2E A;  5BSX A;  1XE1 A;  4P1V A;  5TV2 A;  2V4D A;  5KSW B;  2F4N A;  4PC6 A;  4N3G A;  4ZCL A;  2YWE A;  1BMF A;  2W6J A;  2XND A;  4B3F X;  3CCR B;  4B44 A;  1N05 A;  2ZZQ A;  5GV8 A;  2VNJ A;  1PJ5 A;  4Z4W A;  1CNF A;  1B2R A;  3PEN A;  1YIT B;  3SLD A;  1N06 A;  3Q3A A;  1HA3 A;  4P26 A;  3CC2 B;  3AVU A;  4PAA A;  1HZE A;  2C5H A;  1W2B B;  1T6Y A;  1E62 A;  3GIR A;  1M1K D;  3BY2 A;  1WSR A;  2WR8 A;  4HE6 A;  2YWF A;  4RD1 A;  3CC7 B;  1QX4 A;  3CES A;  3U6B A;  4OOX A;  1AIP A;  2B5O A;  3P26 A;  5L46 A;  3QFR A;  2VBS A;  3DDY A;  1YJN B;  4K1X A;  1SKY B;  5AN9 A;  1IJE A;  2XNC A;  3JQP A;  3MHP A;  2GJP A;  4DK1 A;  2BM0 A;  1AMO A;  3PUN A;  3OAA A;  4LBW A;  1VQO B;  4QV2 A;  1UMK A;  2CC2 A;  5IK2 A;  4BPR A;  1VQL B;  3WBJ A;  2BV3 A;  3G71 B;  4X07 A;  5DSZ A;  1R5O A;  3CCE B;  2Q6L A;  4DQK A;  1KTV A;  1GAW A;  4XN3 A;  1PKV A;  3ASS A;  2VBU A;  2D9R A;  4F7D A;  4RD3 A;  3WNB A;  1EFT A;  4WQM A;  4LBV A;  2BPO A;  2GPJ A;  3WXM A;  2WPD A;  3SJP A;  4C43 A;  4M0L A;  4RPD A;  1K9M D;  5THX A;  4WWV A;  3AGP A;  3CXC B;  4FK8 A;  3PUM A;  2QEX B;  1Y0Y A;  3QFS A;  1RQP A;  1UD5 A;  1WSV A;  1FDR A;  3A8J A;  1G7C A;  2HLD A;  4HE5 A;  4XOP A;  2ZBU A;  2PIA A;  4ZGQ B;  5IYQ A;  4Z4Z A;  4XKV A;  3OEE A;  1KK1 A;  1QVF B;  2X85 A;  3J81 k;  3PA1 A;  3FJO A;  2PLF A;  1W0K A;  3CP2 A;  4RD0 A;  2Q6O A;  1JB9 A;  5HKK A;  1E1R A;  2OBT A;  3ASP A;  1T6X A;  4RDK A;  4XLE A;  4EH1 A;  4B47 A;  1Q86 D;  4DNT B;  3JQR A;  1GR1 A;  4XR6 A;  4B3X A;  2XZL A;  1YX2 A;  4YXW A;  2EFG A;  4B43 A;  3I1F A;  2GRE A;  1MRZ A;  3W5H A;  5J3O A;  4LBZ A;  1NB0 A;  3LQE A;  4Z4V A;  1VQ6 B;  1UD3 A;  3VR6 A;  4RJL A;  1QGZ A;  1QFJ A;  2C5B A;  2AHO A;  4X06 A;  4TMT A;  1DDI A;  4B48 A;  3G4S B;  1GJR A;  1FND A;  1ZM2 A;  4WZE A;  3AVT A;  3OJX A;  5J35 A;  4G7X A;  4Y9R A;  2VNI A;  5E6T A;  3E20 A;  2C4U A;  1EFR A;  2JDI A;  4G1V A;  1BJK A;  4ZCI A;  3I55 B;  3E1Y E;  3WYA A;  3ZC3 A;  1FNC A;  3CCS B;  1IHM A;  1J9Z A;  3LNN A;  4KKT A;  2XNJ A;  3QE2 A;  3OW7 A;  2XGJ A;  3A1P A;  4TSF A;  3GSI A;  1QUE A;  4XLH A;  1UD8 A;  3W5V A;  3T56 B;  1S0U A;  5DN6 A;  4P12 A;  3BCF A;  3ZUG A;  1YHQ B;  1WP6 A;  2C77 A;  2QE7 A;  4RDL A;  1A8P A;  1KK0 A;  2Q6K A;  2F43 A;  1I8D A;  4G7W A;  4XNF A;  1JNY A;  5HXB A;  4UZU A;  3OP1 A;  4P6V F;  4KKU A;  4YAO A;  5CDF A;  1QUF A;  4ROX A;  2C2W A;  4RD2 A;  4WZL A;  4RPB A;  1CQX A;  1DAR A;  1M90 D;  1VHE A;  2PE3 A;  3SEJ A;  3CW2 A;  4II3 A;  2D3N A;  1I18 A;  2VBT A;  3QFT A;  3FPP A;  4X7C A;  4RM0 A;  3W2H A;  3W5U A;  1E63 A;  1QH0 A;  2CND A;  2CBX A;  1KZL A;  4X7D A;  4MYU A;  1NB9 A;  1YIJ B;  3A35 A;  4XLC A;  4OPO A;  3BY1 A;  4DQL A;  1KJZ A;  4AVZ A;  1E1Q A;  1E43 A;  1EP2 B;  4II2 A;  3OFN A;  1VQ8 B;  1Q9S A;  4P3I A;  3W2F A;  2BN4 A;  5IYN A;  1Y0R A;  2NV4 A;  3OZV A;  5FL7 A;  2BF4 A;  3R6J A;  2C78 A;  3CMA B;  4TN1 A;  3ASQ A;  5FIU A;  2GJK A;  4IW3 B;  1FRQ A;  2OK7 A;  4G6I A;  1IB0 A;  5JBQ A;  1D8T A;  3BC9 A;  2BGJ A;  2ZTN A;  4Z4U A;  1PJ7 A;  4KKS A;  3OZU A;  2QN6 A;  4H9G A;  2J7K A;  3CCM B;  2DCU A;  4FN5 A;  1TTT A;  5EMN A;  4ZCM A;  4OPS A;  2OYN A;  2BM1 A;  4LBY A;  4HIZ A;  1YJ9 B;  2V7W A;  5IYW A;  1V0F A;  2ZIT A;  5IYP A;  1VJS A;  4UAJ A;  1IJF A;  1UD2 A;  3ZBU A;  1E3X A;  3CME B;  1N8R D;  2BSA A;  1F20 A;  3ASR A;  4PC7 A;  1KRH A;  2JJ2 A;  4E0F A;  3GVK A;  3OEH A;  4YAW A;  2BMW A;  2YWH A;  3SLN A;  5H59 A;  1G7T A;  4C0S A;  3A3B A;  1OHH A;  4ACA A;  4N3N A;  4LC0 A;  1QGY A;  3BCD A;  1TLL A;  3AGQ A;  3ZPN A;  1JA1 A;  4QVA A;  1EXM A;  2WZN A;  3OW2 B;  3Q38 A;  2GJR A;  3GQB A;  2EIX A;  3W2G A;  1K28 D;  1T5E A;  3OKX A;  4XOR A;  3LVB A;  2NPF A;  1YI2 B;  4Z4Y A;  4TKO B;  3A8I A;  1RQR A;  2DET A;  3OOC A;  2QMU A;  4GQN A;  2WJY A;  1ELO A;  1NJI D;  2M5S A;  2X6X A;  3LO8 A;  3CD6 B;  2ZL7 A;  2VNH A;  4XOT A;  3B78 A;  2GQF A;  2CW5 A;  1V5V A;  2WZP P;  3ZIA A;  5IYR A;  1KC8 D;  1F60 A;  1SM4 A;  4AC9 A;  4QUZ A;  4Z1M A;  4ASU A;  5B6I A;  2QA4 B;  1QFZ A;  2X0K A;  1QFY A;  1MAB A;  3Q39 A;  5HZB A;  3ZZ0 A;  1FNM A;  1JJ2 B;  3WBK A;  1VF7 A;  1E3Z A;  1WOS A;  4X05 A;  1GO2 A;  3KL9 A;  5F4M A;  2WJV A;  1XB2 A;  2X3U A;  4X7F A;  1VLO A;  2I1L A;  2WSS A;  4Q7J B;  4UZF A;  1EWY A;  4DK0 A;  1HVX A;  3FKS A;  1YJW B;  2R6H A;  1BQE A;  2LZJ A;  3PVD A;  1TVC A;  1FNB A;  1G7S A;  1E64 A;  4WZT A;  3V76 A;  3ONY A;  4YAF A;  4NCN A;  4FXU A;  1NBM A;  3I56 B;  2WYR A;  2B7B A;  4OOS A;  1WU8 A;  4QVJ A;  3CB4 A;  4AF7 A;  3VNU A;  1N0V C;  1QG0 A;  2VNK A;  2DIE A;  4L8J A;  4XD7 A;  1N07 A;  4YHB A;  1H42 A;  1Q81 D;  4B4D A;  1W0J A;  2GK6 A;  2VBV A;  4XM3 A;  4QFM A;  2OTJ B;  4OOV A;  1U2R A;  1W9X A;  4NBS A;  4G5G A;  1S72 B;  2ZXI A;  1P4M A;  2QTZ A;  4QHY A;  1ZM9 A;  2GK7 A;  2V31 A;  2W6I A;  1KMH A;  2KVO A;  3CPW B;  1T6Z A;  2QDX A;  4M4S A;  2XZO A;  5A88 A;  2X6W A;  3BH4 A;  3CCQ B;  2X8K A;  2HDN B;  4PGO A;  5DS0 A;  1WOO A;  4P9S A;  5TRD A;  3QSY A;  3H94 A;  2YWG A;  3T53 B;  2RC5 A;  1KD1 D;  5KW9 A;  4UZE A;  2X53 S;  4RCZ A;  4TMW A;  3ZZU A;  1VQM B;  1V0E A;  3AVV A;  2X6Y A;  3Q6R A;  2OK8 A;  1EFU A;  1VHO A;  3A8K A;  1Q7Y D;  1VQK B;  4P25 A;  3NE5 B;  2B7C A;  3OE7 A;  3A3G A;  3Q6Q A;  1WOP A;  4DNR B;  2FX3 A;  5GV7 A;  2Z6B D;  4YEJ A;  2VJJ A;  3ZZT A;  3H9N A;  3BQJ A;  1BX0 A;  2PMD A;  4PC1 A;  1H85 A;  3KEW A;  1G7R A;  1PJ6 A;  2C4T A;  4X0C A;  4X7E A;  4XON A;  2XEX A;  4ACB A;  1GAQ A;  4RD6 A;  3GVL A;  1H8E A;  2DYI A;  1UD4 A;  1N08 A;  1DDG A;  2BGI A;  3AVY A;  3QFC A;  1VLY A;  3OJW A;  4M53 A;  3ONU A;  4RLZ A;  1OGI A;  1K73 D;  3AVX A;  1CNE A;  3WY9 A;  1QVG B;  4Z4R A;  1B23 P;  3VO1 A;  1WTH D;  2CRV A;  4RCY A;  3WNC A;  4XL9 A;  4J0Q A;  3JQQ A;  3BNW A;  4RD4 A;  4YEL A;  2QTL A;  2D3L A;  1W87 A;  5KNL A;  4Z4T A;  4Y7C A;  3D26 A;  4X8I A;  3HAG A;  3MMP A;  1D1N A;  3W2I A;  1W34 A;  4B3G A;  1R5N A;  2ZZF A;  2ZBV A;  2ZTG A;  3CTA A;  5A89 A;  3AVW A;  2RC6 A;  4XN0 A;  1OB2 A;  2OBS A;  1OB0 A;  2ZZE A;  5FNZ A;  3LQ6 A;  5F4O A;  4AF6 A;  4ZV4 A;  4XLF A;  5F4J A;  4MYT A;  4R71 A;  4ZGN B;  1BLI A;  3PA2 A;  5TR9 A;  3VO2 A;  1NDH A;  1TUI A;  2CK3 A;  4TT3 A;  1XFO A;  4PC3 A;  1BX1 A;  3B8H A;  3R6K A;  1FX0 A;  3ISX A;  4XQF A;  2VJI A;  3ZBT A;  1VQ4 B;  4P6Y A;  2VYQ A;  2BVN A;  2DY1 A;  4G1B A;  4JMQ A;  4TMZ A;  2CF4 A;  5FA6 A;  1KQS B;  1K8A D;  4OPV A;  4M1K A;  4OP7 A;  4CQJ A;  3U6K A;  1BPL A;  3CRZ A;  1JA0 A;  1EP1 B;  1E79 A;  1D2E A;  3GVJ A;  1YLO A;  2XOK A;  1KK3 A;  2HMA A;  1VQ5 B;  1Q82 D;  3VMF A;  2JJ1 A;  2Q6I A;  1UD6 A;  1GVH A;  3P27 A;  5HZA A;  1W35 A;  3CCV B;  1ZUN B;  1VQN B;  2V7Q A;  4TMX A;  3B82 A;  2VZL A;  2ZZG A;  1VQ9 B;  1S4M A;  1QGA A;  1NRK A;  1KK2 A;  2F1M A;  1FRN A;  2OBR A;  2ZL6 A;  2ZL5 A;  3CPX A;  3CP8 A;  1ZM4 A;  1XQB A;  4PAB A;  5A8A A;  2FVG A;  1WDT A;  2P3M A;  2R9V A;  2ZXH A;  3CMM A;  1DG1 G;  2OTL B;  2QGG A;  5H5J A;  3MCA A;  4WZK A;  3ES9 A;  4Y9U A;  4U9U A;  4YAU A;  4PC2 A;  1EP3 B;  2XZP A;  3JU4 A;  3OZW A;  1H8H A;  2JN9 A;  3CCJ B;  2JIZ A;  5TY0 A;  2F1L A;  4NNJ A;  4XLA A;  5FO1 A;  1OGJ A;  2DOG A;  4FWT A;  1VQP B;  1I7P A;  3SJZ A;  4TMV A;  3G05 A;  2V7X A;  2DER A;  4P22 A;  5LMZ A;  5BSY A;  3OPO A;  4P2N A;  1ZM3 A;  2V7T A;  3SKB A;  3WND A;  3CCU B;  1SKQ A;  3T51 B;  3V7A A;  1OB5 A;  1R5B A;  2E1R A;  4P3Y A;  3G6E B;  3CC4 B;  3VNV A;  1COW A;  2HCJ B;  1N0U A;  4XKW A;  4RDJ A;  1EFC A;  3U2Q A;  5FO0 A; 
#chains in the Genus database with same CATH homology
 3Q38 A;  4X06 A;  4Z4S A;  4WZE A;  3AST A;  3RY8 A;  5BSX A;  5J35 A;  3ONU A;  4P1V A;  4RLZ A;  4Z4Y A;  4Z4R A;  5E6T A;  2ZL7 A;  4Z4W A;  1IHM A;  3SLD A;  4Z4T A;  3D26 A;  3Q3A A;  4P26 A;  5IYR A;  4P12 A;  4QUZ A;  3BY2 A;  4RDL A;  3Q39 A;  5HZB A;  2OBS A;  3LQ6 A;  5F4O A;  4ROX A;  5F4J A;  4X05 A;  4WZL A;  4RPB A;  4OOX A;  3PA2 A;  3SEJ A;  5F4M A;  4X7F A;  4X7C A;  4RM0 A;  3R6K A;  3PVD A;  4X7D A;  3PUN A;  4WZT A;  4OPO A;  4QV2 A;  3ONY A;  3BY1 A;  4OPV A;  4OP7 A;  4X07 A;  4P3I A;  4OOS A;  4QVJ A;  5IYN A;  3R6J A;  3ASS A;  3ASQ A;  4Z4U A;  4OOV A;  5HZA A;  3SJP A;  4RPD A;  2ZL5 A;  2OBR A;  2ZL6 A;  3PUM A;  4OPS A;  4WZK A;  5IYQ A;  4Z4Z A;  5KW9 A;  5IYW A;  5IYP A;  3PA1 A;  3Q6R A;  3ASR A;  4P25 A;  2OBT A;  3ASP A;  4RDK A;  3Q6Q A;  5BSY A;  3SLN A;  3BQJ A;  4P2N A;  3SKB A;  3V7A A;  4X0C A;  4X7E A;  5J3O A;  4RDJ A;  4QVA A;  3LQE A;  4Z4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...