2ZL7A

Atomic resolution structural characterization of recognition of histo-blood group antigens by norwalk virus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
286
structure length
285
Chain Sequence
b'FTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRLVGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQFGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKIPNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQAPTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASGPQQLPINGVFVFVSWVSRFYQLKPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 58 kd capsid protein
molecule tags Viral protein
source organism Norwalk virus
publication title Atomic resolution structural characterization of recognition of histo-blood group antigens by Norwalk virus
pubmed doi rcsb
total genus 67
structure length 285
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 2zl7A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 2zl7A01
2OBSA 3BY1A 3ASPA 3SLNA 3RY8A 3ASTA 4QVJA 4P3IA 4RM0A 3ASSA 5F4OA 3ASQA 3Q6RA 4WZTA 4P26A 4QUZA 4X06A 3PVDA 5IYWA 3PA1A 4RDLA 4OP7A 4Z4RA 3LQEA 4OOXA 3SEJA 3BQJA 3R6JA 4Z4TA 4P2NA 4X05A 3Q39A 4Z4ZA 5IYNA 4OPSA 4ROXA 5J3OA 4Z4SA 3D26A 3BY2A 4RLZA 5HZBA 3PUNA 2OBRA 4Z4YA 3R6KA 3V7AA 4P12A 4WZLA 5BSYA 2ZL6A 4X7DA 3ONUA 5IYQA 3Q6QA 4WZEA 4P25A 4Z4UA 4QVAA 3ASRA 4X7FA 3Q38A 4RDJA 2ZL5A 3SKBA 5BSXA 5E6TA 3ONYA 3PUMA 2ZL7A 4OOSA 3SLDA 4Z4VA 5F4JA 5KW9A 4OPVA 4QV2A 4RDKA 5F4MA 1IHMA 4X0CA 4X07A 3Q3AA 5J35A 4OOVA 4P1VA 4RPDA 4Z4WA 5HZAA 4X7CA 4OPOA 2OBTA 4X7EA 4RPBA 5IYRA 3SJPA 3LQ6A 3PA2A 4WZKA 5IYPA
chains in the Genus database with same CATH superfamily
1UD6A 2HMAA 1BMFA 1COWA 1E63A 3BNWA 2GJKA 4PGOA 4HIZA 4ACBA 4TKOB 3SLNA 3W2IA 1HA3A 3AVXA 1V5VA 1J9ZA 1QFYA 3ISXA 1WOSA 1QFJA 5FIUA 3CCLB 3CCMB 1E3XA 1VQ4B 2KVOA 1JA0A 1D1NA 3CB4A 2V7WA 4P3IA 2JN9A 3ASSA 3LNNA 5TV2A 5F4OA 1ZM2A 3ASQA 2X6YA 1DDGA 2Z6BD 4Y7CA 1VQPB 4B3GA 4ZV4A 3I56B 3W5UA 3OJWA 4ACAA 1S72B 4P26A 4QUZA 4X06A 1XE1A 4II2A 5IYWA 1BLIA 2VNIA 4C0SA 1EP3B 4MYUA 1Q86D 4E0FA 3PENA 3W5HA 1N07A 5B6IA 4K1XA 3SEJA 3R6JA 1EP2B 1WORA 1RQPA 2PE3A 2VYQA 2QN6A 1SKYB 1GO2A 4PC7A 4Z4TA 1K9MD 2B7BA 4X05A 3OW2B 2M5SA 2XZPA 1N05A 3OZWA 1N0VC 1XB2A 5FNZA 3JQPA 2RC5A 3AVWA 2V7XA 1BX1A 4DNRB 4TN1A 3WYAA 3H94A 4Z4SA 1CNEA 3D26A 2F43A 3OE7A 1BJKA 1T6YA 3A35A 4RCYA 4RLZA 2V7UA 3HAGA 4YEJA 1UD3A 2GQFA 1NDHA 4G6IA 4WZLA 1GJRA 2E1RA 3CCSB 2ZL6A 4X7DA 4XLFA 1NJID 1QGAA 5EMNA 2EFGA 3CRZA 2QEXB 3Q6QA 2BV3A 4J0QA 4LC0A 1QUFA 3OPOA 2FVGA 1PJ5A 3OKXA 3FPKA 1QH0A 2X6WA 4B3XA 2CNDA 3AVVA 2VNHA 4P22A 3GQBA 5TRDA 5CDFA 4XD7A 3PUMA 1VQ9B 2ZL7A 4Z4VA 4XKWA 3OAAA 1D2EA 2PMDA 4OPVA 3ZC3A 4X8IA 3W5VA 3FKSA 4F7DA 3OOCA 4RJLA 3CW2A 3Q3AA 4TMVA 3I55B 4LBYA 1YX2A 4ZGQB 4AVZA 3W2EA 4Z4WA 1JA1A 2BGJA 3B78A 3GVJA 2V7QA 1PKVA 1Y0YA 3P27A 3ZZUA 1I7PA 1S4MA 1K28D 2VZLA 4QFMA 3ES9A 4TT3A 5KSWB 3VNVA 2VJIA 1HZEA 3SJPA 1WOPA 4ZCMA 1VQ5B 1VLOA 2BM1A 3QFRA 4WZKA 2CK3A 4XQFA 4P3YA 3ZZTA 1VQMB 2DYIA 1UMKA 2OBSA 2BMWA 2C2WA 3OZUA 1QVGB 1QGYA 2C77A 2YWEA 1IJEA 3ASPA 3RY8A 2YWFA 1D8TA 2DY1A 2X8KA 5FO0A 1G7TA 1VHEA 3OEEA 3SJZA 5L46A 3CP2A 4XNFA 1E1RA 3ASTA 4XOTA 2XNCA 2X0KA 3QE2A 4RM0A 1N8RD 3ZUGA 4B44A 3VO2A 1ZM4A 3FPPA 1T6XA 2C5HA 4RD4A 3Q6RA 2W6JA 1GAWA 1SKQA 2YWGA 4PC2A 1HVXA 3J81k 1QG0A 2BSAA 1E62A 1F60A 4XL9A 3G71B 3BCFA 1E79A 5A88A 2J7KA 4Z4RA 2HLDA 1OHHA 2XNJA 2JIZA 4G7WA 4BPRA 1YJWB 1P4MA 2W6IA 1ZM3A 2F1LA 1QX4A 1Q9SA 3OZVA 4N3GA 3V76A 2OK7A 4B43A 3WXMA 1H8HA 1YLOA 3Q39A 1DG1G 2WZNA 4NBSA 2WZPP 1B2RA 2VNJA 2XGJA 5A8AA 2DOGA 1AMOA 1WSVA 2BPOA 2D3NA 3E20A 3ZZ0A 2WJVA 2I1LA 1WOOA 2ZXIA 1VQ8B 4Y9RA 1ZM9A 1QFZA 2DEUA 4B3FX 5GV8A 3VO1A 4FN5A 3R6KA 3V7AA 1R5OA 3W2HA 4P12A 4KKSA 2XNDA 2LZJA 2WPDA 4WWVA 1FX0A 3OW7A 3ONUA 4XLAA 4Z1MA 4L8JA 1VHOA 4M1KA 2V4DA 4YELA 1BQEA 1DARA 2ZXHA 4WZEA 3WNCA 1KMHA 2ZTNA 1Q81D 2XZLA 4Z4UA 1BX0A 4QVAA 5JBQA 4TMWA 4XM3A 1S0UA 1Y0RA 3ASRA 3E1YE 1TUIA 1OB5A 3QFCA 3A3BA 4RDJA 5AN9A 5BSXA 2V7TA 3AVYA 3JQRA 1E1QA 2VBVA 3CESA 2C78A 2ZZQA 5F4JA 2GK6A 3VR6A 3BC9A 1TLLA 4RDKA 2GPJA 4M4SA 1GVHA 1IHMA 1KK2A 2D3LA 4X0CA 5A89A 3CP8A 2B7CA 1E64A 1ZUNB 4YXWA 4N3NA 1EP1B 4DQKA 4LBWA 4XMYA 4XR6A 4B48A 3NE5B 2NV4A 5H5JA 1AIPA 2WJYA 1DDIA 1FRNA 2GK7A 4GQNA 4ZCIA 4IW3B 2OK8A 1WDTA 2R9VA 2GJRA 4RPBA 4X7EA 4RD6A 2ZBUA 1EFTA 4YAFA 1YHQB 1W0KA 1N08A 4DK0A 2XZOA 4P6VF 1W34A 1KJZA 5IYPA 1N06A 3T53B 2FX3A 4QHYA 4XOPA 2X53S 5DN6A 1TVCA 1U2RA 2C4UA 4XKVA 4LBZA 3BY1A 4KKUA 1I18A 1FNCA 2PIAA 2Q6KA 4XN3A 2QGGA 3KL9A 3G4SB 2OYNA 1CNFA 3ZBUA 4Y9UA 4AF6A 1VF7A 1NB0A 4B4DA 1PJ7A 1UD2A 4Q7JB 2NPFA 2DETA 3VMFA 1EWYA 1M90D 2BF4A 1FNMA 4PABA 1VQLB 4WZTA 4R71A 1H8EA 2EIXA 1BPLA 2ZZFA 4OP7A 3CMEB 3LQEA 3CC7B 2QTZA 4OOXA 1N0UA 1VJSA 4P2NA 3B82A 1Q82D 4P6YA 2B5OA 4ZGNB 2RC6A 3CPWB 3CPXA 1KTVA 4HE6A 2CBXA 2VBUA 3P26A 4II3A 4G7XA 4YAWA 4C43A 4FXUA 1VLYA 4ASUA 2WR8A 2VJJA 2ZTGA 3MCAA 5DSZA 1NB9A 2BVNA 1JB9A 3B8HA 1YJ9B 5J3OA 1XQBA 2V7VA 4M53A 3BY2A 2QA4B 3PUNA 4WQMA 2OBRA 3CCVB 2D9RA 4NCNA 4PC6A 4UZEA 5GV7A 4XLHA 1FDRA 1G7CA 5THXA 2VNKA 3CC2B 1E43A 1UD4A 3DDYA 1WU8A 2BGIA 2QDXA 2ZBVA 2X6XA 3W2GA 1IB0A 2P3MA 3GVKA 4TMZA 4H9GA 3CXCB 1QUEA 4PC1A 3JQQA 3JU4A 2ZL5A 2OTLB 1JNYA 5E6TA 1KRHA 3QFTA 1FNBA 5FO1A 3T56B 1W0JA 3VNUA 4OOSA 1VQNB 3SLDA 3WNDA 4NNJA 5KW9A 3CC4B 4QV2A 5F4MA 1OGJA 2QE7A 4YHBA 3WBJA 4EH1A 5H59A 1KK1A 1YIJB 1VQ7B 3CD6B 4RD3A 1H42A 4X07A 2YWHA 5IK2A 5J35A 1OB2A 1JJ2B 1W87A 1GAQA 2JJ2A 1F20A 4P1VA 3T51B 1UD5A 5HZAA 3WNBA 1EFRA 3QSYA 4UZFA 4CQJA 4OPOA 2DERA 1KK0A 1EFCA 1MABA 2DIEA 3GSIA 5IYRA 4XLCA 1KZLA 1M1KD 3OJXA 3AGPA 1KQSB 4G1BA 3U6BA 3LQ6A 2OTJB 1ELOA 2DCUA 4XN0A 1UD8A 3WBKA 3CCJB 2QMUA 4TMTA 1NRKA 3AVTA 3CCUB 3CMMA 4RD1A 3AGQA 4UAJA 3A1PA 1G7SA 3ZBTA 2V31A 2JDIA 2X3UA 4TMXA 4QVJA 1B23P 4M2LA 2F1MA 4HE5A 1OGIA 4PAAA 4RD2A 3H9NA 1YITB 2CW5A 2R6HA 2ZZEA 3BCDA 3U2QA 4AF7A 1K8AD 3AVUA 4G5GA 4XONA 2F4NA 1PJ6A 3PVDA 1WTHD 3MMPA 3ZIAA 3PA1A 3CCQB 4RDLA 3CCEB 3GIRA 4P9SA 2CC2A 3A3GA 3CTAA 1K73D 2GJPA 3BQJA 3OP1A 3A8KA 4DQLA 3ZPNA 2XEXA 4JMQA 2BM0A 1W9XA 3BH4A 2CF4A 5LMZA 4Z4ZA 5HKKA 4M0LA 5IYNA 4OPSA 2C5BA 1NBMA 3A8JA 4ROXA 4DNTB 5HZBA 3FJOA 1VQOB 4Z4YA 2XOKA 4KKTA 1E3ZA 1EFUA 4TSFA 1W2BB 1XFOA 5BSYA 4U9UA 4YAOA 5IYQA 1VQKB 2HDNB 2D74A 3CCRB 4P25A 5DS0A 4AC9A 5FL7A 3WQZA 1IJFA 4ZCLA 1MRZA 1KD1D 1GR1A 1WP6A 1H85A 2VBTA 2BN4A 3U6KA 1T5EA 4X7FA 3Q38A 1V0EA 3QFSA 4RCZA 3I1FA 5HXBA 3SKBA 2E1BA 2X85A 2Q6OA 2HCJB 3ONYA 2QTLA 1QVFB 2WSSA 5TR9A 1QGZA 2JJ1A 2ZITA 4XLEA 2WYRA 1A8PA 2Q6LA 1W35A 1WPCA 1YI2B 5KNLA 1RQRA 3G6EB 2GREA 1EXMA 1V0FA 2AHOA 1Q7YD 4FWTA 1R5NA 4UZUA 4RD0A 4XORA 4B47A 1VQ6B 3KEWA 4FK8A 2VBSA 3CMAB 1R5BA 1FNDA 2ZZGA 4LBVA 4OOVA 4G1VA 1KK3A 3A8IA 4RPDA 1FRQA 1I8DA 1SM4A 4MYTA 4YALA 1CQXA 2C4TA 4X7CA 4YAUA 1YJNB 1T6ZA 4DK1A 3MHPA 1WSRA 2PLFA 3LVBA 3OFNA 5TY0A 2OBTA 3W2FA 1OB0A 3WY9A 3OEHA 1TTTA 4PC3A 3G05A 5FA6A 2Q6IA 3PA2A 3LO8A 3GVLA 1KC8D 2CRVA 1G7RA
chains in the Genus database with same CATH topology
2OBSA 3BY1A 3ASPA 3SLNA 3RY8A 3ASTA 4QVJA 4P3IA 4RM0A 3ASSA 5F4OA 3ASQA 3Q6RA 4WZTA 4P26A 4QUZA 4X06A 3PVDA 5IYWA 3PA1A 4RDLA 4OP7A 4Z4RA 3LQEA 4OOXA 3SEJA 3BQJA 3R6JA 4Z4TA 4P2NA 4X05A 3Q39A 4Z4ZA 5IYNA 4OPSA 4ROXA 5J3OA 4Z4SA 3D26A 3BY2A 4RLZA 5HZBA 3PUNA 2OBRA 4Z4YA 3R6KA 3V7AA 4P12A 4WZLA 5BSYA 2ZL6A 4X7DA 3ONUA 5IYQA 3Q6QA 4WZEA 4P25A 4Z4UA 4QVAA 3ASRA 4X7FA 3Q38A 4RDJA 2ZL5A 3SKBA 5BSXA 5E6TA 3ONYA 3PUMA 2ZL7A 4OOSA 3SLDA 4Z4VA 5F4JA 5KW9A 4OPVA 4QV2A 4RDKA 5F4MA 1IHMA 4X0CA 4X07A 3Q3AA 5J35A 4OOVA 4P1VA 4RPDA 4Z4WA 5HZAA 4X7CA 4OPOA 2OBTA 4X7EA 4RPBA 5IYRA 3SJPA 3LQ6A 3PA2A 4WZKA 5IYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBS A;  3BY1 A;  3ASP A;  3SLN A;  3RY8 A;  3AST A;  4QVJ A;  4P3I A;  4RM0 A;  3ASS A;  5F4O A;  3ASQ A;  3Q6R A;  4WZT A;  4P26 A;  4QUZ A;  4X06 A;  3PVD A;  5IYW A;  3PA1 A;  4RDL A;  4OP7 A;  4Z4R A;  3LQE A;  4OOX A;  3SEJ A;  3BQJ A;  3R6J A;  4Z4T A;  4P2N A;  4X05 A;  3Q39 A;  4Z4Z A;  5IYN A;  4OPS A;  4ROX A;  5J3O A;  4Z4S A;  3D26 A;  3BY2 A;  4RLZ A;  5HZB A;  3PUN A;  2OBR A;  4Z4Y A;  3R6K A;  3V7A A;  4P12 A;  4WZL A;  5BSY A;  2ZL6 A;  4X7D A;  3ONU A;  5IYQ A;  3Q6Q A;  4WZE A;  4P25 A;  4Z4U A;  4QVA A;  3ASR A;  4X7F A;  3Q38 A;  4RDJ A;  2ZL5 A;  3SKB A;  5BSX A;  5E6T A;  3ONY A;  3PUM A;  2ZL7 A;  4OOS A;  3SLD A;  4Z4V A;  5F4J A;  5KW9 A;  4OPV A;  4QV2 A;  4RDK A;  5F4M A;  1IHM A;  4X0C A;  4X07 A;  3Q3A A;  5J35 A;  4OOV A;  4P1V A;  4RPD A;  4Z4W A;  5HZA A;  4X7C A;  4OPO A;  2OBT A;  4X7E A;  4RPB A;  5IYR A;  3SJP A;  3LQ6 A;  3PA2 A;  4WZK A;  5IYP A; 
#chains in the Genus database with same CATH topology
 1UD6 A;  2HMA A;  1BMF A;  1COW A;  1E63 A;  3BNW A;  2GJK A;  4PGO A;  4HIZ A;  4ACB A;  4TKO B;  3SLN A;  3W2I A;  1HA3 A;  3AVX A;  1V5V A;  1J9Z A;  1QFY A;  3ISX A;  1WOS A;  1QFJ A;  5FIU A;  3CCL B;  3CCM B;  1E3X A;  1VQ4 B;  2KVO A;  1JA0 A;  1D1N A;  3CB4 A;  2V7W A;  4P3I A;  2JN9 A;  3ASS A;  3LNN A;  5TV2 A;  5F4O A;  1ZM2 A;  3ASQ A;  2X6Y A;  1DDG A;  2Z6B D;  4Y7C A;  1VQP B;  4B3G A;  4ZV4 A;  3I56 B;  3W5U A;  3OJW A;  4ACA A;  1S72 B;  4P26 A;  4QUZ A;  4X06 A;  1XE1 A;  4II2 A;  5IYW A;  1BLI A;  2VNI A;  4C0S A;  1EP3 B;  4MYU A;  1Q86 D;  4E0F A;  3PEN A;  3W5H A;  1N07 A;  5B6I A;  4K1X A;  3SEJ A;  3R6J A;  1EP2 B;  1WOR A;  1RQP A;  2PE3 A;  2VYQ A;  2QN6 A;  1SKY B;  1GO2 A;  4PC7 A;  4Z4T A;  1K9M D;  2B7B A;  4X05 A;  3OW2 B;  2M5S A;  2XZP A;  1N05 A;  3OZW A;  1N0V C;  1XB2 A;  5FNZ A;  3JQP A;  2RC5 A;  3AVW A;  2V7X A;  1BX1 A;  4DNR B;  4TN1 A;  3WYA A;  3H94 A;  4Z4S A;  1CNE A;  3D26 A;  2F43 A;  3OE7 A;  1BJK A;  1T6Y A;  3A35 A;  4RCY A;  4RLZ A;  2V7U A;  3HAG A;  4YEJ A;  1UD3 A;  2GQF A;  1NDH A;  4G6I A;  4WZL A;  1GJR A;  2E1R A;  3CCS B;  2ZL6 A;  4X7D A;  4XLF A;  1NJI D;  1QGA A;  5EMN A;  2EFG A;  3CRZ A;  2QEX B;  3Q6Q A;  2BV3 A;  4J0Q A;  4LC0 A;  1QUF A;  3OPO A;  2FVG A;  1PJ5 A;  3OKX A;  3FPK A;  1QH0 A;  2X6W A;  4B3X A;  2CND A;  3AVV A;  2VNH A;  4P22 A;  3GQB A;  5TRD A;  5CDF A;  4XD7 A;  3PUM A;  1VQ9 B;  2ZL7 A;  4Z4V A;  4XKW A;  3OAA A;  1D2E A;  2PMD A;  4OPV A;  3ZC3 A;  4X8I A;  3W5V A;  3FKS A;  4F7D A;  3OOC A;  4RJL A;  3CW2 A;  3Q3A A;  4TMV A;  3I55 B;  4LBY A;  1YX2 A;  4ZGQ B;  4AVZ A;  3W2E A;  4Z4W A;  1JA1 A;  2BGJ A;  3B78 A;  3GVJ A;  2V7Q A;  1PKV A;  1Y0Y A;  3P27 A;  3ZZU A;  1I7P A;  1S4M A;  1K28 D;  2VZL A;  4QFM A;  3ES9 A;  4TT3 A;  5KSW B;  3VNV A;  2VJI A;  1HZE A;  3SJP A;  1WOP A;  4ZCM A;  1VQ5 B;  1VLO A;  2BM1 A;  3QFR A;  4WZK A;  2CK3 A;  4XQF A;  4P3Y A;  3ZZT A;  1VQM B;  2DYI A;  1UMK A;  2OBS A;  2BMW A;  2C2W A;  3OZU A;  1QVG B;  1QGY A;  2C77 A;  2YWE A;  1IJE A;  3ASP A;  3RY8 A;  2YWF A;  1D8T A;  2DY1 A;  2X8K A;  5FO0 A;  1G7T A;  1VHE A;  3OEE A;  3SJZ A;  5L46 A;  3CP2 A;  4XNF A;  1E1R A;  3AST A;  4XOT A;  2XNC A;  2X0K A;  3QE2 A;  4RM0 A;  1N8R D;  3ZUG A;  4B44 A;  3VO2 A;  1ZM4 A;  3FPP A;  1T6X A;  2C5H A;  4RD4 A;  3Q6R A;  2W6J A;  1GAW A;  1SKQ A;  2YWG A;  4PC2 A;  1HVX A;  3J81 k;  1QG0 A;  2BSA A;  1E62 A;  1F60 A;  4XL9 A;  3G71 B;  3BCF A;  1E79 A;  5A88 A;  2J7K A;  4Z4R A;  2HLD A;  1OHH A;  2XNJ A;  2JIZ A;  4G7W A;  4BPR A;  1YJW B;  1P4M A;  2W6I A;  1ZM3 A;  2F1L A;  1QX4 A;  1Q9S A;  3OZV A;  4N3G A;  3V76 A;  2OK7 A;  4B43 A;  3WXM A;  1H8H A;  1YLO A;  3Q39 A;  1DG1 G;  2WZN A;  4NBS A;  2WZP P;  1B2R A;  2VNJ A;  2XGJ A;  5A8A A;  2DOG A;  1AMO A;  1WSV A;  2BPO A;  2D3N A;  3E20 A;  3ZZ0 A;  2WJV A;  2I1L A;  1WOO A;  2ZXI A;  1VQ8 B;  4Y9R A;  1ZM9 A;  1QFZ A;  2DEU A;  4B3F X;  5GV8 A;  3VO1 A;  4FN5 A;  3R6K A;  3V7A A;  1R5O A;  3W2H A;  4P12 A;  4KKS A;  2XND A;  2LZJ A;  2WPD A;  4WWV A;  1FX0 A;  3OW7 A;  3ONU A;  4XLA A;  4Z1M A;  4L8J A;  1VHO A;  4M1K A;  2V4D A;  4YEL A;  1BQE A;  1DAR A;  2ZXH A;  4WZE A;  3WNC A;  1KMH A;  2ZTN A;  1Q81 D;  2XZL A;  4Z4U A;  1BX0 A;  4QVA A;  5JBQ A;  4TMW A;  4XM3 A;  1S0U A;  1Y0R A;  3ASR A;  3E1Y E;  1TUI A;  1OB5 A;  3QFC A;  3A3B A;  4RDJ A;  5AN9 A;  5BSX A;  2V7T A;  3AVY A;  3JQR A;  1E1Q A;  2VBV A;  3CES A;  2C78 A;  2ZZQ A;  5F4J A;  2GK6 A;  3VR6 A;  3BC9 A;  1TLL A;  4RDK A;  2GPJ A;  4M4S A;  1GVH A;  1IHM A;  1KK2 A;  2D3L A;  4X0C A;  5A89 A;  3CP8 A;  2B7C A;  1E64 A;  1ZUN B;  4YXW A;  4N3N A;  1EP1 B;  4DQK A;  4LBW A;  4XMY A;  4XR6 A;  4B48 A;  3NE5 B;  2NV4 A;  5H5J A;  1AIP A;  2WJY A;  1DDI A;  1FRN A;  2GK7 A;  4GQN A;  4ZCI A;  4IW3 B;  2OK8 A;  1WDT A;  2R9V A;  2GJR A;  4RPB A;  4X7E A;  4RD6 A;  2ZBU A;  1EFT A;  4YAF A;  1YHQ B;  1W0K A;  1N08 A;  4DK0 A;  2XZO A;  4P6V F;  1W34 A;  1KJZ A;  5IYP A;  1N06 A;  3T53 B;  2FX3 A;  4QHY A;  4XOP A;  2X53 S;  5DN6 A;  1TVC A;  1U2R A;  2C4U A;  4XKV A;  4LBZ A;  3BY1 A;  4KKU A;  1I18 A;  1FNC A;  2PIA A;  2Q6K A;  4XN3 A;  2QGG A;  3KL9 A;  3G4S B;  2OYN A;  1CNF A;  3ZBU A;  4Y9U A;  4AF6 A;  1VF7 A;  1NB0 A;  4B4D A;  1PJ7 A;  1UD2 A;  4Q7J B;  2NPF A;  2DET A;  3VMF A;  1EWY A;  1M90 D;  2BF4 A;  1FNM A;  4PAB A;  1VQL B;  4WZT A;  4R71 A;  1H8E A;  2EIX A;  1BPL A;  2ZZF A;  4OP7 A;  3CME B;  3LQE A;  3CC7 B;  2QTZ A;  4OOX A;  1N0U A;  1VJS A;  4P2N A;  3B82 A;  1Q82 D;  4P6Y A;  2B5O A;  4ZGN B;  2RC6 A;  3CPW B;  3CPX A;  1KTV A;  4HE6 A;  2CBX A;  2VBU A;  3P26 A;  4II3 A;  4G7X A;  4YAW A;  4C43 A;  4FXU A;  1VLY A;  4ASU A;  2WR8 A;  2VJJ A;  2ZTG A;  3MCA A;  5DSZ A;  1NB9 A;  2BVN A;  1JB9 A;  3B8H A;  1YJ9 B;  5J3O A;  1XQB A;  2V7V A;  4M53 A;  3BY2 A;  2QA4 B;  3PUN A;  4WQM A;  2OBR A;  3CCV B;  2D9R A;  4NCN A;  4PC6 A;  4UZE A;  5GV7 A;  4XLH A;  1FDR A;  1G7C A;  5THX A;  2VNK A;  3CC2 B;  1E43 A;  1UD4 A;  3DDY A;  1WU8 A;  2BGI A;  2QDX A;  2ZBV A;  2X6X A;  3W2G A;  1IB0 A;  2P3M A;  3GVK A;  4TMZ A;  4H9G A;  3CXC B;  1QUE A;  4PC1 A;  3JQQ A;  3JU4 A;  2ZL5 A;  2OTL B;  1JNY A;  5E6T A;  1KRH A;  3QFT A;  1FNB A;  5FO1 A;  3T56 B;  1W0J A;  3VNU A;  4OOS A;  1VQN B;  3SLD A;  3WND A;  4NNJ A;  5KW9 A;  3CC4 B;  4QV2 A;  5F4M A;  1OGJ A;  2QE7 A;  4YHB A;  3WBJ A;  4EH1 A;  5H59 A;  1KK1 A;  1YIJ B;  1VQ7 B;  3CD6 B;  4RD3 A;  1H42 A;  4X07 A;  2YWH A;  5IK2 A;  5J35 A;  1OB2 A;  1JJ2 B;  1W87 A;  1GAQ A;  2JJ2 A;  1F20 A;  4P1V A;  3T51 B;  1UD5 A;  5HZA A;  3WNB A;  1EFR A;  3QSY A;  4UZF A;  4CQJ A;  4OPO A;  2DER A;  1KK0 A;  1EFC A;  1MAB A;  2DIE A;  3GSI A;  5IYR A;  4XLC A;  1KZL A;  1M1K D;  3OJX A;  3AGP A;  1KQS B;  4G1B A;  3U6B A;  3LQ6 A;  2OTJ B;  1ELO A;  2DCU A;  4XN0 A;  1UD8 A;  3WBK A;  3CCJ B;  2QMU A;  4TMT A;  1NRK A;  3AVT A;  3CCU B;  3CMM A;  4RD1 A;  3AGQ A;  4UAJ A;  3A1P A;  1G7S A;  3ZBT A;  2V31 A;  2JDI A;  2X3U A;  4TMX A;  4QVJ A;  1B23 P;  4M2L A;  2F1M A;  4HE5 A;  1OGI A;  4PAA A;  4RD2 A;  3H9N A;  1YIT B;  2CW5 A;  2R6H A;  2ZZE A;  3BCD A;  3U2Q A;  4AF7 A;  1K8A D;  3AVU A;  4G5G A;  4XON A;  2F4N A;  1PJ6 A;  3PVD A;  1WTH D;  3MMP A;  3ZIA A;  3PA1 A;  3CCQ B;  4RDL A;  3CCE B;  3GIR A;  4P9S A;  2CC2 A;  3A3G A;  3CTA A;  1K73 D;  2GJP A;  3BQJ A;  3OP1 A;  3A8K A;  4DQL A;  3ZPN A;  2XEX A;  4JMQ A;  2BM0 A;  1W9X A;  3BH4 A;  2CF4 A;  5LMZ A;  4Z4Z A;  5HKK A;  4M0L A;  5IYN A;  4OPS A;  2C5B A;  1NBM A;  3A8J A;  4ROX A;  4DNT B;  5HZB A;  3FJO A;  1VQO B;  4Z4Y A;  2XOK A;  4KKT A;  1E3Z A;  1EFU A;  4TSF A;  1W2B B;  1XFO A;  5BSY A;  4U9U A;  4YAO A;  5IYQ A;  1VQK B;  2HDN B;  2D74 A;  3CCR B;  4P25 A;  5DS0 A;  4AC9 A;  5FL7 A;  3WQZ A;  1IJF A;  4ZCL A;  1MRZ A;  1KD1 D;  1GR1 A;  1WP6 A;  1H85 A;  2VBT A;  2BN4 A;  3U6K A;  1T5E A;  4X7F A;  3Q38 A;  1V0E A;  3QFS A;  4RCZ A;  3I1F A;  5HXB A;  3SKB A;  2E1B A;  2X85 A;  2Q6O A;  2HCJ B;  3ONY A;  2QTL A;  1QVF B;  2WSS A;  5TR9 A;  1QGZ A;  2JJ1 A;  2ZIT A;  4XLE A;  2WYR A;  1A8P A;  2Q6L A;  1W35 A;  1WPC A;  1YI2 B;  5KNL A;  1RQR A;  3G6E B;  2GRE A;  1EXM A;  1V0F A;  2AHO A;  1Q7Y D;  4FWT A;  1R5N A;  4UZU A;  4RD0 A;  4XOR A;  4B47 A;  1VQ6 B;  3KEW A;  4FK8 A;  2VBS A;  3CMA B;  1R5B A;  1FND A;  2ZZG A;  4LBV A;  4OOV A;  4G1V A;  1KK3 A;  3A8I A;  4RPD A;  1FRQ A;  1I8D A;  1SM4 A;  4MYT A;  4YAL A;  1CQX A;  2C4T A;  4X7C A;  4YAU A;  1YJN B;  1T6Z A;  4DK1 A;  3MHP A;  1WSR A;  2PLF A;  3LVB A;  3OFN A;  5TY0 A;  2OBT A;  3W2F A;  1OB0 A;  3WY9 A;  3OEH A;  1TTT A;  4PC3 A;  3G05 A;  5FA6 A;  2Q6I A;  3PA2 A;  3LO8 A;  3GVL A;  1KC8 D;  2CRV A;  1G7R A; 
#chains in the Genus database with same CATH homology
 2OBS A;  3BY1 A;  3ASP A;  3SLN A;  3RY8 A;  3AST A;  4QVJ A;  4P3I A;  4RM0 A;  3ASS A;  5F4O A;  3ASQ A;  3Q6R A;  4WZT A;  4P26 A;  4QUZ A;  4X06 A;  3PVD A;  5IYW A;  3PA1 A;  4RDL A;  4OP7 A;  4Z4R A;  3LQE A;  4OOX A;  3SEJ A;  3BQJ A;  3R6J A;  4Z4T A;  4P2N A;  4X05 A;  3Q39 A;  4Z4Z A;  5IYN A;  4OPS A;  4ROX A;  5J3O A;  4Z4S A;  3D26 A;  3BY2 A;  4RLZ A;  5HZB A;  3PUN A;  2OBR A;  4Z4Y A;  3R6K A;  3V7A A;  4P12 A;  4WZL A;  5BSY A;  2ZL6 A;  4X7D A;  3ONU A;  5IYQ A;  3Q6Q A;  4WZE A;  4P25 A;  4Z4U A;  4QVA A;  3ASR A;  4X7F A;  3Q38 A;  4RDJ A;  2ZL5 A;  3SKB A;  5BSX A;  5E6T A;  3ONY A;  3PUM A;  2ZL7 A;  4OOS A;  3SLD A;  4Z4V A;  5F4J A;  5KW9 A;  4OPV A;  4QV2 A;  4RDK A;  5F4M A;  1IHM A;  4X0C A;  4X07 A;  3Q3A A;  5J35 A;  4OOV A;  4P1V A;  4RPD A;  4Z4W A;  5HZA A;  4X7C A;  4OPO A;  2OBT A;  4X7E A;  4RPB A;  5IYR A;  3SJP A;  3LQ6 A;  3PA2 A;  4WZK A;  5IYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...