2ZM6O

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2zm6O00
3R66A 4LF5O 1N33O 4JI7O 1FYJA 5A2QN 1KUQA 2ZKOA 4DV1O 4DV0O 4JI3O 1IBMO 4LFBO 4DR5O 3O65A 3T1HO 2UXCO 4DV6O 2VQEO 5IWAO 4DR4O 5FLXN 1DK1A 1R6TA 4YHHO 4X64O 4AQYO 2UXDO 4X65O 1I94O 4LF4O 1HNWO 1HNZO 3J80N 3RT3C 1X59A 1XNRO 1N36O 2UU9O 5IT9N 2HHHO 1A32A 3J81N 2UUAO 5BXZA 4B3RO 1XEQA 4DUYO 1G1XB 1AB3A 1XMOO 2UXBO 3T1YO 4OX9O 2UUCO 3F5TA 4X62O 2LW7A 2ZM6O 4LF6O 4JI1O 4LF9O 1HR0O 1HNXO 3JAMN 4DV4O 4GKKO 2DJVA 4OPAA 4JYAO 4B3TO 1D2DA 4OPHA 3SDLA 4JI8O 4LF8O 2Z0AA 2AGAA 2JRIA 4DR7O 2E5LO 4DR6O 1N34O 3M8AA 4JI2O 4NXNO 5BR8O 4JI4O 2VQFO 4DV2O 4DV7O 2FKXA 4NXMO 4KHPO 4JI5O 4DR2O 1IBKO 5LMUO 3J7AU 4JI0O 2DOSA 4B3SO 5LMNO 1R1BA 5H5NA 4DUZO 2UUBO 4GKJO 4A5UB 1J5EO 1IBLO 4DR3O 4YY3O 4K0KO 2N74A 4LF7O 1F7YA 1YZBA 1N32O 4JV5O 5LL6Y 1AILA 4B3MO 1NS1A 4JI6O 1FJGO 5BY1A 4DV5O 4LFAO 2F4VO 1FKAO 1XNQO 4X66O 1XMQO 3OTOO 4LFCO 4DR1O 4DV3O
chains in the Genus database with same CATH superfamily
5GW7A 1YIJV 2WLIB 3CCEV 4X9QA 3G4SV 2QM4A 1SQGA 3P3NA 1NBMG 1R6KA 1XNRB 5KMGA 4BIUA 1KYOF 4DR5O 3CMAV 1Y76A 5J2TA 4FPPA 4DR4O 4DR7B 1VF7A 3EVKA 2UXDO 4X65O 4JZ2A 1KP3A 3W7UA 2EILB 3JALA 4J7JA 4N21A 2HG5C 3B4SA 3BRCA 4I4TA 4RO2A 3ABTA 4PI2A 3FYIB 3CXCU 1BQ0A 2NNUA 4KXRA 3JASB 4K8XA 3HKDB 3THOA 1HNXO 3KG2A 4H33A 5KAFZ 5GTHZ 4OPAA 4F6RA 1EN6A 3IGAC 2EULA 4B3TO 1V55C 1IX9A 1P49A 4DV7B 5IYZA 2JK5C 1DF5A 2P06A 3A0RA 2ZR3A 2QGNA 3C90A 2ADQB 2WAMA 1MSDA 4DV2O 1DGSA 3OR7C 3RYHA 2ATKC 5JWPA 3ZN0A 4DR2O 1PL4A 2XAHA 4O4JB 2XAFA 2RJZA 1JFFA 3JD1A 3JSLA 4I7ZB 1K73W 1H2KA 1YXBA 2F4VO 3RYIB 3WU2Z 4JTCB 1YTFB 1TGOA 1SZTA 5C8YA 3HKBA 2JGUA 1K4DC 1K33A 4IT5A 2XUMA 2CE4A 1P7GA 4JI7O 4LF4B 4IIJB 2OCCB 1O9GA 4F4LA 3K9AA 1IBMO 3L9DA 4U3FH 2CH7A 1ENVA 3JD4A 3JD3A 2UXCO 3LSSA 2HFEC 2BTOA 3TK1A 5B1AC 4ZHQB 1YJNV 1SQVH 1OV9A 1SS3A 4JASA 1RPRA 5BXZA 3N2GB 5GONA 1QLNA 3HKEA 3F5TA 1GM7A 3E8BA 4UCUA 3JAMN 5IJ0B 4N23A 3G71V 1XI1A 2DJVA 5TISZ 3QTCA 1OHHG 4DV5B 2YIBD 1EBOA 4IL6Z 1VF6A 4DYLA 3B77A 1IZ3A 2F66C 1RPOA 1K92A 5CBHA 3M8AA 2QWNB 2WLIA 3ZRWB 3K5NA 4IYHA 4QPJA 4CC6A 4X20B 4GUNA 3T4DA 4HNAB 3ASNC 3K9SA 3ZHVA 3K0DA 3K5OA 3T4ZA 1AJNA 2LGQA 4LCUC 3Q4HB 3BY6A 1QVFU 5F2VO 4ZIBA 2CUGA 1JCHA 5B3SC 2Q8VA 3W7TA 4K35A 1NS1A 1GH6A 1R73A 3FB8C 1S3JA 4WFHA 1NU1H 4Z1MG 4W4KA 2QWPB 3JASA 1S5LZ 3C3TA 4O2BB 1L8DA 3HKDA 3WB2A 1ORQC 2KQXA 4FLWA 4HBNA 1R3IC 3KCXA 1EN5A 3ZHQA 3N2KA 3ABMC 4MVUA 4Q6GA 3WG7C 2OT5A 3ZRXA 4BAYA 1CP9A 3SYCA 2AW9A 1BT8A 3AK2A 4YHHO 2E5LB 2CTPA 4NXNB 3L70H 3C3SA 3HB3B 1BHAA 1Q90D 1BL8A 1TUBB 5ITZA 2CGOA 2HHHO 1A32A 3J81N 4DXWA 1IURA 4B3SB 4O4JA 2Z5UA 3SPHA 2YICA 2R9IA 4JTAB 4CS4A 4FJCC 3RYIA 3BFRA 3K59A 2QM7A 3I55V 4JAUA 2AGAA 4DR7O 1NZ6A 3OEHG 2DW4A 2R9AA 4JI4O 4IIJA 3JAWB 2XOKG 1J95A 1Q5OA 4NXMO 4DV0B 2VRZA 4FFKA 5LMUO 4JI0O 3H01A 2HKOA 5H5NA 2VQEB 4AQYB 4X89A 5LXTB 2FYUH 4UVCA 1CEZA 4U7OA 1AR4A 4W4LA 2YDEA 3ZHTA 2IH3C 3ASNB 3N2GA 3B2EE 3RVYA 1THZA 1N8RW 2C2AA 2RQ6A 4PD4F 3VQXA 4NB5A 5B3SB 5LHHA 5IJ0A 1YJWV 1Q8IA 4OGQB 5A2QN 1VQMV 1PP9H 2V1DA 2QKCA 2QWOB 1FXKB 2LQTA 5LHIA 2EJRA 4R7CA 2UXNA 1PD3A 1M5IA 3L71H 3STZC 1N34B 2Q7EA 1SQPH 2H8PC 3NR7A 5BR8B 2NLJC 4X20A 4ZOLB 3MAQA 1V9PA 4MVZA 1QR9A 2WWWA 3O9OA 3WG7B 3ABMB 3Q4HA 1AB3A 1Q86W 1Z2GA 5DECA 2ZINA 2BTQB 2R70A 3ETEA 3FKSG 3ZHSA 2B9ZA 3L72H 5IE9A 1XILA 2IU3A 1MZFA 3CC7V 1F4NA 2OTJV 4DV2B 4YJ3B 4BWAA 1AR1B 1K9MW 5H6QA 4P9PA 5EYPA 3H1LH 1N33B 3AG1C 1MMMA 1Y6XA 2E75B 4FK5C 5LHGA 3R65A 4MTFA 2DN9A 4QGPA 2Q7GA 3E86A 1QLEC 5LP6C 2QTOA 5JJEB 1L0LH 2UUBO 3W7XA 1F4MA 1NH2B 2F23A 3QO7A 1RP3B 2JEUA 3T2MA 3E8FA 3OGCC 3IC9A 5LL6Y 1MSWD 2FL4A 4JI7B 2WLMA 2X6CA 4DV5O 1OCOC 1OCCC 3RFRA 3D8CA 1IBMB 1HDJA 4X62B 4NTYA 3BEHA 2OIGA 2KG7A 2YXLA 2UXXA 3KCYA 4JYAB 3I5DA 2BSKB 1SZXA 3ZHRA 1NJIW 1XQ8A 2YIAA 2EIMC 4CH3A 3RW0A 3SGIA 3RYFA 4P9OA 1X59A 1I0HA 4MS2A 4X1KA 5DM6V 3U10A 2ZNIA 4KHPB 1U96A 3FAVB 1H2NA 2D3OW 1FXHA 4FFBB 4LH7A 5LXTA 1VEWA 1B3QA 2W6IG 2N05A 2B5UA 1JR9A 1SQBH 2JJ1G 2L35A 1COWG 3MD0A 4HAMA 4JV5B 3VQWA 4PA4A 1P4RA 3T1CA 4CS2A 2A3QA 4ZI7A 2IM9A 4I9QA 3X2QC 4DW0A 1AR5A 2R72A 2E5LO 2HLDG 4NXNO 3FFQA 3BHPA 2ZCEA 1FXKA 2Q7HA 4RQEA 1CPYA 1EZJA 1GAXA 1Z5VA 4B3SO 4H37A 1AP5A 2Q68A 3ML0A 4UB8Z 4LBEC 1GN6A 2IJJA 4GX0A 4ZOLA 1XBLA 3AG1B 4YJ2B 1GM9A 3SR2C 3HR0A 2DYSC 4GX1A 1XMOB 3T1YB 4X1YA 3N27A 5FNVA 4EFEA 1QLEB 5LP6B 1Y74B 4O4LB 1XDCA 1Q81W 4YHHB 1FFXB 4F6EA 4DK0A 1SA0B 4YJ3A 4EB6A 1AI7A 4DV1O 4DV0O 1H2SB 1B06A 3A0BZ 2A79B 4MW8A 2L6LA 5B1BC 4B08A 2JVDA 2HHHB 2VQEO 3RWRD 3UT5B 4AQYO 2HJFC 1MZEA 3CCRV 1FPOA 5JCOA 5C93A 4O4HB 2LFSA 2OCHA 1MA1A 1QBZA 4IHJB 1XHZA 4JGSA 3OGIB 5IT9N 2E3CA 3LDDA 3QF7A 3TGUH 4WBNB 2EIMB 2Q0AA 3E8HA 2LW7A 3APOA 2HR3A 2VWKA 5L3EA 3K58A 4MT8A 4JI4B 1LNQA 2Q0OC 4LFAB 1MOFA 4PA7A 5LGUA 2JJ2G 3FB7C 4NXMB 1NR1A 1DF4A 5LMUB 4JI0B 2P90A 3ZBHA 1N34O 1YVWA 5BR8O 2DQ3A 4BW5A 1IDSA 4MVSA 1BZKA 3ETQA 1SKVA 2BSKA 5LGTA 2XAGA 1FAFA 4FM0A 5KHGA 4I50B 5JH7B 4FM2A 1G8MA 3J7AU 1TAEA 3T1HB 4X64B 4A5UB 1J5EO 4DR3O 3CD6V 2VWJA 1F7YA 1I5XA 5JQGA 3JARB 2QDOA 2IU0A 4TV8B 5CB4B 2E76B 3GB7C 4BIOA 2BOBC 3OM3B 1HP8A 4UXNA 3G6EV 2YSUB 3FB5C 2ZM6B 1UFIA 1NVPD 2WLLA 4BIZA 1N33O 3CRCA 5BZBA 1FS0G 3E22B 2EZPA 4JYCA 3MHHC 1NI8A 1H8EG 4J42A 2P5OA 2DYSB 3CSXA 2EJ7A 1ZTEA 4NYKA 4WFFA 5IJ9B 4LF8B 2ZIOA 1BMFG 2RDCA 2V4DA 3A0HZ 1HNWO 2YEVB 3TJTA 4DK1A 5GTIZ 3IAYA 3SPCA 4B3RO 3OW2U 2QE7G 3UM7A 4X62O 2CGNA 1Q82W 4YY3B 2N04A 1VIBA 4UCRA 4LWSB 4J10A 4U3JB 4YJ2A 4DV4O 1QCEA 2RCVA 5FPRA 3GVMA 4JYAO 1H8HG 4KFMA 5H6RA 5EBLC 2DQ0A 4O2AB 4QJFB 5B5EZ 3KKYA 2M6YA 1R3KC 1VQLV 4FM1A 2ITDC 3DC5A 5LYJB 1WP8A 3RGBA 4D7SA 1FFXA 1US6A 2UUBB 1SA0A 3W7SA 3HKCA 3FD9A 2FB5A 1RM1C 4KHPO 4JI5O 4UCOA 2LO1A 2Q6AA 1ZWIC 3CXHF 1ZL8B 2IBZH 1JA8A 3LDCA 2YXHA 4CH4A 4ZBMA 4O4HA 4PI0A 3RBZA 4JV5O 2YXYA 4IHJA 5L3CA 4LC1A 1ZUQA 1VQNV 1FJGO 4FLXA 3QO5A 2QTSA 1ROPA 1FKAO 3FX7A 2ETNA 3JATB 2Z3YA 3OR6C 1VP7A 1WA8B 5EIBD 1V55B 4OXSA 1FD9A 4Q20A 2F95B 4WCEV 3CEIA 4TUYB 3SJAC 1PKXA 4NVPA 3TXSA 4O4IB 3AG4C 3CCQV 4CBCA 2DWEC 4JI2B 2ZQMA 2QSAA 2WA3A 4GCZA 5IDJA 2ITCC 4PV1B 5KHIA 3J80N 1M90W 1VQ6V 3P3PA 5LA6B 2EIKC 5L3DA 1IBKB 1G1XB 1XEQA 3A8TA 1XMOO 3T1YO 2YC0A 2ZE7A 3CHXA 3F5WC 3WFVA 2QJ1A 3CYOA 1OCZC 4LF6O 1CXZB 4EFBA 1N32B 4TQDA 4PA9A 4PA6A 2EIJC 4TV8A 4AI8A 1SQFA 5EC2C 5CB4A 4ABMA 3OTOB 4K8ZA 3OUFA 2F93B 1Q43A 4IYIA 4PHZA 3B8MA 2IW5A 2P6JA 1QNMA 1N0JA 5FL7G 3K03A 3E22A 3QVNA 2GBOA 2QKAA 4RQFA 1VQ7V 5B1AB 1SQXH 1JJOA 4FLVA 4YIOA 3M99B 1M1KW 1GN3A 2LFRA 4H13B 5LGNA 2CK3G 2CTWA 1NQTA 3S3XA 4I55B 4QPKA 5KUMA 2N74A 1M56C 2RMKB 4NR1A 4I0XB 1RM1B 4DUYB 1Y66A 4LFAO 4TT3G 2UXBB 3IJ4A 2MK3A 4DV1B 3E2EA 3SJBC 3OUSA 3MDSA 3E83A 4B7KA 2HP8A 5CN0A 4LWSA 4JI1B 2WLJA 1QHTA 4U3JA 1JJ2U 3ZMZA 5J2UB 4ZHQA 2P4VA 4E2LA 2EINC 5JVDB 4FLUA 1GK9A 3T1HO 3OE7G 3P32A 4TWKA 4X64O 4JZGA 4CH5A 4IGGA 2XASA 2ZDIC 1R3LC 1K4CC 1GN2A 2E74B 4MSWC 3EXAA 1MG1A 3STLC 2ZT9B 2G38A 3SPJA 1D5AA 3AG4B 2W6JG 2NN4A 4DO2A 4KUMA 2ZM6O 4LF7B 3CJHB 3JCZA 3ZRWA 2LP7A 4UB6Z 3TXQA 2ZE8A 4GZRB 4HNAA 2HVKC 2DYRC 3JAKB 1RSOB 1BE3H 1WA8A 4DR1B 4X8AA 4LF8O 1Y4MA 2JRIA 4TUYA 3B8NA 1OCZB 5CA1B 1J5EB 1TUEB 4DR3B 4NTXA 3RVZA 1H2GA 2EIJB 1BHBA 2ILMA 2Y69C 1WAZA 2CDYA 1D5NA 3LSUA 5IWAB 4LNUB 2V7QG 4UCVA 2DE0X 3L73H 4E4EA 4PDVA 4WFBV 4O2BA 4YY3O 1YZBA 2JGDB 3LNNA 5LA6A 4J7ZA 2GSMB 3WB1A 4JI6O 2YUAA 3SJQC 1K97A 4PDRA 3ICXA 1AVMA 1KBHA 1LUVA 3LUTB 3K5LA 4FZ0A 4UV9A 2PI5A 2MW2B 2PYLA 2W0XA 2LW1A 4CC5A 1GTOA 1YEWA 1S76D 1XOUA 4J9YB 4P2ZA 1GM8A 5KHHA 1HNWB 1FYJA 4FZ1A 3TETA 1DLBA 3SPIA 1Q3EA 4TSFG 2AXTZ 1HWYA 1TUBA 2ZE5A 1JQ0A 2ZNJA 2Y4UA 2AHYA 1P84F 5KA6A 3PN1A 3O65A 4H0LB 4DV6O 4B3RB 2LGWA 4B7EA 2VQFB 1AROP 4WFEA 3BVOA 3AG3C 1EZVH 3BCCH 4DV4B 1ZSPA 5KHJA 4WF9V 1NVPB 1M9NA 1IBLB 1I7FA 3S3WA 4K0KB 2Y48A 1PPJH 3IFXA 3LDEA 4B3MB 4FIPC 1VF6C 3PJSK 3CRQA 3JAWA 1D2DA 4OPHA 2W0FC 3G6BA 2PUSA 4J80A 4JI5B 4JI8O 2XAQA 1PNKA 2Z0AA 2PF4E 3ZRSA 1H2MA 1BQZA 4JI2O 3FYEB 3I56V 5H9CA 2XT9A 4F6RB 3D3QA 2FKXA 3QG5A 2IJKA 3JCUZ 2K9PA 1IVSA 4GX2A 1IBKO 4ASUG 2DOSA 4JAVA 1FJGB 3WB0A 1OCRC 1XL6A 5E79Z 2H3OA 4I9WA 3H1KH 1WB8A 3H9VA 1LUWA 1N32O 1PNMA 1KB9F 2UUAB 2IJHA 2XHBA 4JF3A 4MVQA 4OX9B 1JPXA 4MVRA 3OTOO 2WA4A 3U11A 2DMXA 4RAIA 5JJNB 3K06A 4TV9B 4GLXA 2FMLA 3E89A 4X1IB 1AI4A 3SYAA 3EFFK 4XDKA 1KUQA 3JAKA 2ZR2A 3CRRA 5CA0B 4D7TA 3B40A 1RSOA 1GMGA 4R50A 1WP7A 2YIDA 4PELA 3CCMV 3ZS8C 1SQQH 4DR6B 1VQ4V 2BTQA 3OMNB 1X4TA 4DRXB 3CCVV 2WLHA 4LF6B 2UU9O 1YI2V 2CH7B 2GUZB 2LJ2A 4PA3A 4DUYO 3M7MX 5KX5B 2UXBO 4LNUA 2YI9A 2A9HA 4UCTA 1OCOB 4JI1O 1HR0O 1U97A 2BE3A 1GKFA 1YF2A 1OCCB 4JYBA 4GKKO 1VQ8V 2B1GA 3U0ZA 1F23A 4FLTA 5GONB 4BR6A 3ZJZA 5IY5C 3UKMA 3HKEB 3QO8A 4FLYA 1NTZH 2DWDC 3EHBB 4GX5A 4DV3B 2OCCC 3OTFA 1YITV 2EX3A 4PDLA 4UFZA 3H1HH 2Y0IA 1K5SA 4G2KA 4BW9A 4R8CA 2ARHA 1BSMA 3NXSA 4LFBB 4D6TH 3ZCCA 3CX5F 3ABLC 2JEXA 1S77D 3CCUV 2BCCH 2QR4A 2CAZC 2F43G 4LF7O 2Q9LA 3UCSC 4MVOA 5L3BA 2H94A 1PL0A 1XNQO 3SYOA 1TVKB 4DR1O 1OZ0A 1OCRB 2CTQA 5EZYB 3ETGA 1BGYH 3R66A 2ZDIA 4WFAV 3X2QB 4XDJA 1LR1A 2QKSA 3BA9A 5KAIZ 3AK3A 3FAVA 4LH6A 1VARA 5IWAO 4FFBA 5FLXN 4MW3A 2ZXWC 1NH2D 1DK1A 2PY5A 1S5HC 1QQCA 1QR8A 1HNZO 4UVAA 3N2KB 5B1NA 4J41A 2WPDG 3CMEV 4KP4A 2GV9A 2R9RB 5LBQA 1IXBA 4NTWA 4GKJB 1H2LA 2P4KA 1Q7YW 2GTAA 4AHCA 2OTLV 3D36C 1FFTB 5LOVB 3H1JH 5ITZB 3ZEDA 4RWUA 1JOYA 1AI6A 4X66B 1UPGA 1XMQB 4GT1A 1WJZA 2HEPA 4CZZA 4TV9A 4TOIA 1H38A 3LSQA 4X1IA 1SETA 1URFA 2XAJA 2OYQA 1KKCA 1B6QA 1XL4A 2JS3A 2VQFO 5B1BB 5EBWC 5CA0A 2VS0A 2YIBA 1SERA 3GWOA 3TCUA 4CS3A 4JI3B 5L3FA 3KZIZ 1AJPA 1EFRG 4JI6B 5IY5B 3JYCA 4DRXA 1RFYA 1IBLO 2X7RB 5EBMC 5LP6A 1Y74A 5D5PA 4K0KO 4O4LA 3ASOC 1WB7A 1BS3A 4B3MO 1KECA 1S5JA 5EK0A 3CCJV 2GUZA 4EKWA 1PV0A 5KX5A 3ETDA 1K8AW 2K1EA 4FVMA 3ABLB 2UUCB 4Z2WA 2QEXV 5IYBO 4DV6B 3UT5A 3F7VC 2Q5ZA 2KKWA 3RN4A 4C7UA 2PZSA 1VQKV 5IYDO 4MVMA 3ZN1A 4MTGA 5CMUA 4YXWG 1R6TA 4GYCB 1I94O 4WBNA 3CPWU 2A7WA 2B1IA 4P30A 3RT3C 1Q6HA 1Z5WA 3VOUA 2PTMA 2UUAO 1KMIZ 1M4UA 4ICGA 1KU9A 4JPRA 2WSSG 4OX9O 3JD0A 1B04A 2PI4A 4G28B 2ZXWB 1Q6UA 4JI8B 4WFGA 3CE2A 4MTOA 1TVKA 4I50A 5JH7A 2RNBA 4UCSA 3SDLA 3B09A 1IXMA 1P7BA 2XTAA 3G80A 5EZYA 4AILC 4DR6O 4RUFA 1FXKC 4LF5B 3AG2C 2YI8A 3IC7A 3AEIA 4QNHB 1DTOA 1NTKH 5BMVB 4R6ZA 4U7NA 3SJCC 3JARA 1SF9A 3VBBA 3QNEA 4JYYA 5EYPB 1ZAUA 3OMAB 2AZ2A 4H44B 3SYQA 1VMGA 3VQVA 2A0LA 1W0JG 3ZX6A 4EEQA 3OD4A 3ZIAG 3BABA 1GO3F 4QIWF 1N36B 3CB2A 5H2FZ 5BY1A 1V54C 5K1XA 2P22C 1Y67A 3ZRVA 3DC6A 3LNMB 4MTXA 3DGEA 4HZ3A 4RUEA 1WPXA 3FB6C 4DV3O 5IJ9A 4DW1A 1NKDA 2O57A 3DXRB 4UUJC 4LF9B 3P30A 2Q69A 5LOVA 2GDSA 1OJHA 4XBFA 3ASOB 2RN9A 2YEVA 3K08A 2ZKOA 2X0LA 4X88A 5KA5A 2AHZA 3ZHUA 1MABG 4LFBO 1AI5A 4ZKIA 2UU9B 5JCOC 3DSQA 5DEDA 1XUQA 1YHQV 2KG7B 1W0KG 3F7YC 1XNRO 5E1AC 4JAAA 3L74H 1HR0B 3W7WA 1NT2B 2P67A 3UQ8A 4GKKB 1K34A 5LMNB 3OMIB 4J9ZB 4DUZB 2X6AA 3MHSC 1S0VA 4O2AA 3RYFB 1NR7A 3CS5A 4UV8A 3BPZA 3CCLV 1YJ9V 3E8GA 1WLEA 3JD2A 4X1KB 5LYJA 4FLZA 4KL1A 2M7WA 2A06H 1XREA 1AP6A 1E1QG 1JMKC 4LFCB 4QE9A 2OWOA 2QM8A 1ZL8A 1YCIA 1YTFD 1GN4A 3G67A 3HPLC 1Q6IA 1E79G 5AG2A 4DV7O 4ZI7B 1N4CA 4QE7A 4DR5B 1R1BA 4DR4B 3ZMSA 1BCCH 4GKJO 2EIKB 2UXDB 4X65B 1XNQB 2CTRA 3JATA 4TQFA 1HW7A 2EZOA 3AG2B 2F1MA 2IH1C 1SESA 1KKDA 4X66O 2Q67A 2X6BA 2ZE6A 1XMQO 4L87A 2JS5A 1NTMH 4O4IA 2Y0PA 1HNXB 3ZMTA 3AG7A 3ABKC 5EC1C 1HNZB 2PGGA 3RYCB 4X1YB 4B3TB 5FNVB 4JI3O 3OFNG 1XHXA 5IYCO 2KSDA 1L1FA 1V54B 3K79A 5B1OA 2ZIMA 2YS8A 3K3WA 2EBOA 4NKGB 4LF4O 3D36A 1QVGU 5BMVA 1KC8W 4EB6B 1VF5B 4DR2B 1I5YA 5CA3A 5J9PC 3AK1A 3H1IH 3K57A 1M56B 3CC4V 5EIBC 1WPBA 1YDXA 3CRAA 3CCSV 2UUCO 1SC5B 2QWQB 1O9HA 1K5QA 1N0NA 2GTSA 3ZMUA 2F4VB 2Y4TA 3CC2V 2PYJA 3GWKC 4HYOA 5KMGB 3E35A 2AZ0A 3CRMA 3DXRA 1Y76B 5J2TB 5KUKA 2EINB 4Z1VA 4I55A 2FTKA 1JX9A 4LP8A 3JALB 1AJQA 3SPGA 1M57C 4I4TB 3UO3A 2GHYA 4UVBA 1JVMA 2ODMA 3OEEG 3SYPA 4I0XA 2XNDG 5CBFA 2UXCB 1GRJA 1K3EA 3VQYA 1UJWB 1W59A 2ADPA 5FPOA 2HVJC 1KP2A 2ZD9A 2D2CB 5B66Z 5J2UA 1PM9A 4PJ0Z 3ABUA 4K3AA 3K04A 4LR3A 4XDLA 5IYZB 5JVDA 5A9GA 1E1RG 1SRYA 2DYRB 2EILC 4FMTA 1S72V 3UO2A 5JQGB 4LF5O 3JSNA 3L75H 1I94B 1VQ5V 3DTUB 4I5SA 1W2BU 5KLVH 1VQOV 3RYHB 3D3IA 4G27B 2QWRB 3ZMVA 1VQ9V 2OIEA 1TA8A 1ZLZA 1FXVA 2QA4V 2WLLB 2NR5A 3OAAG 4J11A 2Y69B 2Q4PA 5JJJB 1M93A 1JFFB 4PDMA 4JTDB 3CJHA 3ABKB 1R6NA 1N36O 4J7KA 1YSCA 1T5EA 1QU7A 5CBGA 2JDIG 3APQA 1EN4A 3CWBH 1I08A 1L0NH 2P7TC 1ZX3A 1F51A 5C8YB 4LF9O 3HKBB 1KQSU 4L8JA 2BOCC 5CA1A 4CH6A 5HFLA 1KD1W 5KHKA 3BA8A 2WLKA 3BAAA 1G4YB 1K7DA 5DN6G 3OT7A 3RYCA 2HJDA 2JGDA 2Q73A 1MNGA 1PNLA 3AG3B 5LMNO 2KB1A 4DUZO 1WN7A 2IJIA 5D5QA 1VQPV 5L3GA 1G6UA 3HKCB 1AILA 3K0GA 3K5MA 1R3JC 3A2FA 1M57B 2WLNA 1WNSA 1EM1A 3CP1A 4YIPA 5HFMA 4LFCO 5K1PA 2JIZG
chains in the Genus database with same CATH topology
3R66A 4LF5O 1N33O 4JI7O 1FYJA 5A2QN 1KUQA 2ZKOA 4DV1O 4DV0O 4JI3O 1IBMO 4LFBO 4DR5O 3O65A 3T1HO 2UXCO 4DV6O 2VQEO 5IWAO 4DR4O 5FLXN 1DK1A 1R6TA 4YHHO 4X64O 4AQYO 2UXDO 4X65O 1I94O 4LF4O 1HNWO 1HNZO 3J80N 3RT3C 1X59A 1XNRO 1N36O 2UU9O 5IT9N 2HHHO 1A32A 3J81N 2UUAO 5BXZA 4B3RO 1XEQA 4DUYO 1G1XB 1AB3A 1XMOO 2UXBO 3T1YO 4OX9O 2UUCO 3F5TA 4X62O 2LW7A 2ZM6O 4LF6O 4JI1O 4LF9O 1HR0O 1HNXO 3JAMN 4DV4O 4GKKO 2DJVA 4OPAA 4JYAO 4B3TO 1D2DA 4OPHA 3SDLA 4JI8O 4LF8O 2Z0AA 2AGAA 2JRIA 4DR7O 2E5LO 4DR6O 1N34O 3M8AA 4JI2O 4NXNO 5BR8O 4JI4O 2VQFO 4DV2O 4DV7O 2FKXA 4NXMO 4KHPO 4JI5O 4DR2O 1IBKO 5LMUO 3J7AU 4JI0O 2DOSA 4B3SO 5LMNO 1R1BA 5H5NA 4DUZO 2UUBO 4GKJO 4A5UB 1J5EO 1IBLO 4DR3O 4YY3O 4K0KO 2N74A 4LF7O 1F7YA 1YZBA 1N32O 4JV5O 5LL6Y 1AILA 4B3MO 1NS1A 4JI6O 1FJGO 5BY1A 4DV5O 4LFAO 2F4VO 1FKAO 1XNQO 4X66O 1XMQO 3OTOO 4LFCO 4DR1O 4DV3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R66 A;  4LF5 O;  1N33 O;  4JI7 O;  1FYJ A;  5A2Q N;  1KUQ A;  2ZKO A;  4DV1 O;  4DV0 O;  4JI3 O;  1IBM O;  4LFB O;  4DR5 O;  3O65 A;  3T1H O;  2UXC O;  4DV6 O;  2VQE O;  5IWA O;  4DR4 O;  5FLX N;  1DK1 A;  1R6T A;  4YHH O;  4X64 O;  4AQY O;  2UXD O;  4X65 O;  1I94 O;  4LF4 O;  1HNW O;  1HNZ O;  3J80 N;  3RT3 C;  1X59 A;  1XNR O;  1N36 O;  2UU9 O;  5IT9 N;  2HHH O;  1A32 A;  3J81 N;  2UUA O;  5BXZ A;  4B3R O;  1XEQ A;  4DUY O;  1G1X B;  1AB3 A;  1XMO O;  2UXB O;  3T1Y O;  4OX9 O;  2UUC O;  3F5T A;  4X62 O;  2LW7 A;  2ZM6 O;  4LF6 O;  4JI1 O;  4LF9 O;  1HR0 O;  1HNX O;  3JAM N;  4DV4 O;  4GKK O;  2DJV A;  4OPA A;  4JYA O;  4B3T O;  1D2D A;  4OPH A;  3SDL A;  4JI8 O;  4LF8 O;  2Z0A A;  2AGA A;  2JRI A;  4DR7 O;  2E5L O;  4DR6 O;  1N34 O;  3M8A A;  4JI2 O;  4NXN O;  5BR8 O;  4JI4 O;  2VQF O;  4DV2 O;  4DV7 O;  2FKX A;  4NXM O;  4KHP O;  4JI5 O;  4DR2 O;  1IBK O;  5LMU O;  3J7A U;  4JI0 O;  2DOS A;  4B3S O;  5LMN O;  1R1B A;  5H5N A;  4DUZ O;  2UUB O;  4GKJ O;  4A5U B;  1J5E O;  1IBL O;  4DR3 O;  4YY3 O;  4K0K O;  2N74 A;  4LF7 O;  1F7Y A;  1YZB A;  1N32 O;  4JV5 O;  5LL6 Y;  1AIL A;  4B3M O;  1NS1 A;  4JI6 O;  1FJG O;  5BY1 A;  4DV5 O;  4LFA O;  2F4V O;  1FKA O;  1XNQ O;  4X66 O;  1XMQ O;  3OTO O;  4LFC O;  4DR1 O;  4DV3 O; 
#chains in the Genus database with same CATH topology
 5GW7 A;  1YIJ V;  2WLI B;  3CCE V;  4X9Q A;  3G4S V;  2QM4 A;  1SQG A;  3P3N A;  1NBM G;  1R6K A;  1XNR B;  5KMG A;  4BIU A;  1KYO F;  4DR5 O;  3CMA V;  1Y76 A;  5J2T A;  4FPP A;  4DR4 O;  4DR7 B;  1VF7 A;  3EVK A;  2UXD O;  4X65 O;  4JZ2 A;  1KP3 A;  3W7U A;  2EIL B;  3JAL A;  4J7J A;  4N21 A;  2HG5 C;  3B4S A;  3BRC A;  4I4T A;  4RO2 A;  3ABT A;  4PI2 A;  3FYI B;  3CXC U;  1BQ0 A;  2NNU A;  4KXR A;  3JAS B;  4K8X A;  3HKD B;  3THO A;  1HNX O;  3KG2 A;  4H33 A;  5KAF Z;  5GTH Z;  4OPA A;  4F6R A;  1EN6 A;  3IGA C;  2EUL A;  4B3T O;  1V55 C;  1IX9 A;  1P49 A;  4DV7 B;  5IYZ A;  2JK5 C;  1DF5 A;  2P06 A;  3A0R A;  2ZR3 A;  2QGN A;  3C90 A;  2ADQ B;  2WAM A;  1MSD A;  4DV2 O;  1DGS A;  3OR7 C;  3RYH A;  2ATK C;  5JWP A;  3ZN0 A;  4DR2 O;  1PL4 A;  2XAH A;  4O4J B;  2XAF A;  2RJZ A;  1JFF A;  3JD1 A;  3JSL A;  4I7Z B;  1K73 W;  1H2K A;  1YXB A;  2F4V O;  3RYI B;  3WU2 Z;  4JTC B;  1YTF B;  1TGO A;  1SZT A;  5C8Y A;  3HKB A;  2JGU A;  1K4D C;  1K33 A;  4IT5 A;  2XUM A;  2CE4 A;  1P7G A;  4JI7 O;  4LF4 B;  4IIJ B;  2OCC B;  1O9G A;  4F4L A;  3K9A A;  1IBM O;  3L9D A;  4U3F H;  2CH7 A;  1ENV A;  3JD4 A;  3JD3 A;  2UXC O;  3LSS A;  2HFE C;  2BTO A;  3TK1 A;  5B1A C;  4ZHQ B;  1YJN V;  1SQV H;  1OV9 A;  1SS3 A;  4JAS A;  1RPR A;  5BXZ A;  3N2G B;  5GON A;  1QLN A;  3HKE A;  3F5T A;  1GM7 A;  3E8B A;  4UCU A;  3JAM N;  5IJ0 B;  4N23 A;  3G71 V;  1XI1 A;  2DJV A;  5TIS Z;  3QTC A;  1OHH G;  4DV5 B;  2YIB D;  1EBO A;  4IL6 Z;  1VF6 A;  4DYL A;  3B77 A;  1IZ3 A;  2F66 C;  1RPO A;  1K92 A;  5CBH A;  3M8A A;  2QWN B;  2WLI A;  3ZRW B;  3K5N A;  4IYH A;  4QPJ A;  4CC6 A;  4X20 B;  4GUN A;  3T4D A;  4HNA B;  3ASN C;  3K9S A;  3ZHV A;  3K0D A;  3K5O A;  3T4Z A;  1AJN A;  2LGQ A;  4LCU C;  3Q4H B;  3BY6 A;  1QVF U;  5F2V O;  4ZIB A;  2CUG A;  1JCH A;  5B3S C;  2Q8V A;  3W7T A;  4K35 A;  1NS1 A;  1GH6 A;  1R73 A;  3FB8 C;  1S3J A;  4WFH A;  1NU1 H;  4Z1M G;  4W4K A;  2QWP B;  3JAS A;  1S5L Z;  3C3T A;  4O2B B;  1L8D A;  3HKD A;  3WB2 A;  1ORQ C;  2KQX A;  4FLW A;  4HBN A;  1R3I C;  3KCX A;  1EN5 A;  3ZHQ A;  3N2K A;  3ABM C;  4MVU A;  4Q6G A;  3WG7 C;  2OT5 A;  3ZRX A;  4BAY A;  1CP9 A;  3SYC A;  2AW9 A;  1BT8 A;  3AK2 A;  4YHH O;  2E5L B;  2CTP A;  4NXN B;  3L70 H;  3C3S A;  3HB3 B;  1BHA A;  1Q90 D;  1BL8 A;  1TUB B;  5ITZ A;  2CGO A;  2HHH O;  1A32 A;  3J81 N;  4DXW A;  1IUR A;  4B3S B;  4O4J A;  2Z5U A;  3SPH A;  2YIC A;  2R9I A;  4JTA B;  4CS4 A;  4FJC C;  3RYI A;  3BFR A;  3K59 A;  2QM7 A;  3I55 V;  4JAU A;  2AGA A;  4DR7 O;  1NZ6 A;  3OEH G;  2DW4 A;  2R9A A;  4JI4 O;  4IIJ A;  3JAW B;  2XOK G;  1J95 A;  1Q5O A;  4NXM O;  4DV0 B;  2VRZ A;  4FFK A;  5LMU O;  4JI0 O;  3H01 A;  2HKO A;  5H5N A;  2VQE B;  4AQY B;  4X89 A;  5LXT B;  2FYU H;  4UVC A;  1CEZ A;  4U7O A;  1AR4 A;  4W4L A;  2YDE A;  3ZHT A;  2IH3 C;  3ASN B;  3N2G A;  3B2E E;  3RVY A;  1THZ A;  1N8R W;  2C2A A;  2RQ6 A;  4PD4 F;  3VQX A;  4NB5 A;  5B3S B;  5LHH A;  5IJ0 A;  1YJW V;  1Q8I A;  4OGQ B;  5A2Q N;  1VQM V;  1PP9 H;  2V1D A;  2QKC A;  2QWO B;  1FXK B;  2LQT A;  5LHI A;  2EJR A;  4R7C A;  2UXN A;  1PD3 A;  1M5I A;  3L71 H;  3STZ C;  1N34 B;  2Q7E A;  1SQP H;  2H8P C;  3NR7 A;  5BR8 B;  2NLJ C;  4X20 A;  4ZOL B;  3MAQ A;  1V9P A;  4MVZ A;  1QR9 A;  2WWW A;  3O9O A;  3WG7 B;  3ABM B;  3Q4H A;  1AB3 A;  1Q86 W;  1Z2G A;  5DEC A;  2ZIN A;  2BTQ B;  2R70 A;  3ETE A;  3FKS G;  3ZHS A;  2B9Z A;  3L72 H;  5IE9 A;  1XIL A;  2IU3 A;  1MZF A;  3CC7 V;  1F4N A;  2OTJ V;  4DV2 B;  4YJ3 B;  4BWA A;  1AR1 B;  1K9M W;  5H6Q A;  4P9P A;  5EYP A;  3H1L H;  1N33 B;  3AG1 C;  1MMM A;  1Y6X A;  2E75 B;  4FK5 C;  5LHG A;  3R65 A;  4MTF A;  2DN9 A;  4QGP A;  2Q7G A;  3E86 A;  1QLE C;  5LP6 C;  2QTO A;  5JJE B;  1L0L H;  2UUB O;  3W7X A;  1F4M A;  1NH2 B;  2F23 A;  3QO7 A;  1RP3 B;  2JEU A;  3T2M A;  3E8F A;  3OGC C;  3IC9 A;  5LL6 Y;  1MSW D;  2FL4 A;  4JI7 B;  2WLM A;  2X6C A;  4DV5 O;  1OCO C;  1OCC C;  3RFR A;  3D8C A;  1IBM B;  1HDJ A;  4X62 B;  4NTY A;  3BEH A;  2OIG A;  2KG7 A;  2YXL A;  2UXX A;  3KCY A;  4JYA B;  3I5D A;  2BSK B;  1SZX A;  3ZHR A;  1NJI W;  1XQ8 A;  2YIA A;  2EIM C;  4CH3 A;  3RW0 A;  3SGI A;  3RYF A;  4P9O A;  1X59 A;  1I0H A;  4MS2 A;  4X1K A;  5DM6 V;  3U10 A;  2ZNI A;  4KHP B;  1U96 A;  3FAV B;  1H2N A;  2D3O W;  1FXH A;  4FFB B;  4LH7 A;  5LXT A;  1VEW A;  1B3Q A;  2W6I G;  2N05 A;  2B5U A;  1JR9 A;  1SQB H;  2JJ1 G;  2L35 A;  1COW G;  3MD0 A;  4HAM A;  4JV5 B;  3VQW A;  4PA4 A;  1P4R A;  3T1C A;  4CS2 A;  2A3Q A;  4ZI7 A;  2IM9 A;  4I9Q A;  3X2Q C;  4DW0 A;  1AR5 A;  2R72 A;  2E5L O;  2HLD G;  4NXN O;  3FFQ A;  3BHP A;  2ZCE A;  1FXK A;  2Q7H A;  4RQE A;  1CPY A;  1EZJ A;  1GAX A;  1Z5V A;  4B3S O;  4H37 A;  1AP5 A;  2Q68 A;  3ML0 A;  4UB8 Z;  4LBE C;  1GN6 A;  2IJJ A;  4GX0 A;  4ZOL A;  1XBL A;  3AG1 B;  4YJ2 B;  1GM9 A;  3SR2 C;  3HR0 A;  2DYS C;  4GX1 A;  1XMO B;  3T1Y B;  4X1Y A;  3N27 A;  5FNV A;  4EFE A;  1QLE B;  5LP6 B;  1Y74 B;  4O4L B;  1XDC A;  1Q81 W;  4YHH B;  1FFX B;  4F6E A;  4DK0 A;  1SA0 B;  4YJ3 A;  4EB6 A;  1AI7 A;  4DV1 O;  4DV0 O;  1H2S B;  1B06 A;  3A0B Z;  2A79 B;  4MW8 A;  2L6L A;  5B1B C;  4B08 A;  2JVD A;  2HHH B;  2VQE O;  3RWR D;  3UT5 B;  4AQY O;  2HJF C;  1MZE A;  3CCR V;  1FPO A;  5JCO A;  5C93 A;  4O4H B;  2LFS A;  2OCH A;  1MA1 A;  1QBZ A;  4IHJ B;  1XHZ A;  4JGS A;  3OGI B;  5IT9 N;  2E3C A;  3LDD A;  3QF7 A;  3TGU H;  4WBN B;  2EIM B;  2Q0A A;  3E8H A;  2LW7 A;  3APO A;  2HR3 A;  2VWK A;  5L3E A;  3K58 A;  4MT8 A;  4JI4 B;  1LNQ A;  2Q0O C;  4LFA B;  1MOF A;  4PA7 A;  5LGU A;  2JJ2 G;  3FB7 C;  4NXM B;  1NR1 A;  1DF4 A;  5LMU B;  4JI0 B;  2P90 A;  3ZBH A;  1N34 O;  1YVW A;  5BR8 O;  2DQ3 A;  4BW5 A;  1IDS A;  4MVS A;  1BZK A;  3ETQ A;  1SKV A;  2BSK A;  5LGT A;  2XAG A;  1FAF A;  4FM0 A;  5KHG A;  4I50 B;  5JH7 B;  4FM2 A;  1G8M A;  3J7A U;  1TAE A;  3T1H B;  4X64 B;  4A5U B;  1J5E O;  4DR3 O;  3CD6 V;  2VWJ A;  1F7Y A;  1I5X A;  5JQG A;  3JAR B;  2QDO A;  2IU0 A;  4TV8 B;  5CB4 B;  2E76 B;  3GB7 C;  4BIO A;  2BOB C;  3OM3 B;  1HP8 A;  4UXN A;  3G6E V;  2YSU B;  3FB5 C;  2ZM6 B;  1UFI A;  1NVP D;  2WLL A;  4BIZ A;  1N33 O;  3CRC A;  5BZB A;  1FS0 G;  3E22 B;  2EZP A;  4JYC A;  3MHH C;  1NI8 A;  1H8E G;  4J42 A;  2P5O A;  2DYS B;  3CSX A;  2EJ7 A;  1ZTE A;  4NYK A;  4WFF A;  5IJ9 B;  4LF8 B;  2ZIO A;  1BMF G;  2RDC A;  2V4D A;  3A0H Z;  1HNW O;  2YEV B;  3TJT A;  4DK1 A;  5GTI Z;  3IAY A;  3SPC A;  4B3R O;  3OW2 U;  2QE7 G;  3UM7 A;  4X62 O;  2CGN A;  1Q82 W;  4YY3 B;  2N04 A;  1VIB A;  4UCR A;  4LWS B;  4J10 A;  4U3J B;  4YJ2 A;  4DV4 O;  1QCE A;  2RCV A;  5FPR A;  3GVM A;  4JYA O;  1H8H G;  4KFM A;  5H6R A;  5EBL C;  2DQ0 A;  4O2A B;  4QJF B;  5B5E Z;  3KKY A;  2M6Y A;  1R3K C;  1VQL V;  4FM1 A;  2ITD C;  3DC5 A;  5LYJ B;  1WP8 A;  3RGB A;  4D7S A;  1FFX A;  1US6 A;  2UUB B;  1SA0 A;  3W7S A;  3HKC A;  3FD9 A;  2FB5 A;  1RM1 C;  4KHP O;  4JI5 O;  4UCO A;  2LO1 A;  2Q6A A;  1ZWI C;  3CXH F;  1ZL8 B;  2IBZ H;  1JA8 A;  3LDC A;  2YXH A;  4CH4 A;  4ZBM A;  4O4H A;  4PI0 A;  3RBZ A;  4JV5 O;  2YXY A;  4IHJ A;  5L3C A;  4LC1 A;  1ZUQ A;  1VQN V;  1FJG O;  4FLX A;  3QO5 A;  2QTS A;  1ROP A;  1FKA O;  3FX7 A;  2ETN A;  3JAT B;  2Z3Y A;  3OR6 C;  1VP7 A;  1WA8 B;  5EIB D;  1V55 B;  4OXS A;  1FD9 A;  4Q20 A;  2F95 B;  4WCE V;  3CEI A;  4TUY B;  3SJA C;  1PKX A;  4NVP A;  3TXS A;  4O4I B;  3AG4 C;  3CCQ V;  4CBC A;  2DWE C;  4JI2 B;  2ZQM A;  2QSA A;  2WA3 A;  4GCZ A;  5IDJ A;  2ITC C;  4PV1 B;  5KHI A;  3J80 N;  1M90 W;  1VQ6 V;  3P3P A;  5LA6 B;  2EIK C;  5L3D A;  1IBK B;  1G1X B;  1XEQ A;  3A8T A;  1XMO O;  3T1Y O;  2YC0 A;  2ZE7 A;  3CHX A;  3F5W C;  3WFV A;  2QJ1 A;  3CYO A;  1OCZ C;  4LF6 O;  1CXZ B;  4EFB A;  1N32 B;  4TQD A;  4PA9 A;  4PA6 A;  2EIJ C;  4TV8 A;  4AI8 A;  1SQF A;  5EC2 C;  5CB4 A;  4ABM A;  3OTO B;  4K8Z A;  3OUF A;  2F93 B;  1Q43 A;  4IYI A;  4PHZ A;  3B8M A;  2IW5 A;  2P6J A;  1QNM A;  1N0J A;  5FL7 G;  3K03 A;  3E22 A;  3QVN A;  2GBO A;  2QKA A;  4RQF A;  1VQ7 V;  5B1A B;  1SQX H;  1JJO A;  4FLV A;  4YIO A;  3M99 B;  1M1K W;  1GN3 A;  2LFR A;  4H13 B;  5LGN A;  2CK3 G;  2CTW A;  1NQT A;  3S3X A;  4I55 B;  4QPK A;  5KUM A;  2N74 A;  1M56 C;  2RMK B;  4NR1 A;  4I0X B;  1RM1 B;  4DUY B;  1Y66 A;  4LFA O;  4TT3 G;  2UXB B;  3IJ4 A;  2MK3 A;  4DV1 B;  3E2E A;  3SJB C;  3OUS A;  3MDS A;  3E83 A;  4B7K A;  2HP8 A;  5CN0 A;  4LWS A;  4JI1 B;  2WLJ A;  1QHT A;  4U3J A;  1JJ2 U;  3ZMZ A;  5J2U B;  4ZHQ A;  2P4V A;  4E2L A;  2EIN C;  5JVD B;  4FLU A;  1GK9 A;  3T1H O;  3OE7 G;  3P32 A;  4TWK A;  4X64 O;  4JZG A;  4CH5 A;  4IGG A;  2XAS A;  2ZDI C;  1R3L C;  1K4C C;  1GN2 A;  2E74 B;  4MSW C;  3EXA A;  1MG1 A;  3STL C;  2ZT9 B;  2G38 A;  3SPJ A;  1D5A A;  3AG4 B;  2W6J G;  2NN4 A;  4DO2 A;  4KUM A;  2ZM6 O;  4LF7 B;  3CJH B;  3JCZ A;  3ZRW A;  2LP7 A;  4UB6 Z;  3TXQ A;  2ZE8 A;  4GZR B;  4HNA A;  2HVK C;  2DYR C;  3JAK B;  1RSO B;  1BE3 H;  1WA8 A;  4DR1 B;  4X8A A;  4LF8 O;  1Y4M A;  2JRI A;  4TUY A;  3B8N A;  1OCZ B;  5CA1 B;  1J5E B;  1TUE B;  4DR3 B;  4NTX A;  3RVZ A;  1H2G A;  2EIJ B;  1BHB A;  2ILM A;  2Y69 C;  1WAZ A;  2CDY A;  1D5N A;  3LSU A;  5IWA B;  4LNU B;  2V7Q G;  4UCV A;  2DE0 X;  3L73 H;  4E4E A;  4PDV A;  4WFB V;  4O2B A;  4YY3 O;  1YZB A;  2JGD B;  3LNN A;  5LA6 A;  4J7Z A;  2GSM B;  3WB1 A;  4JI6 O;  2YUA A;  3SJQ C;  1K97 A;  4PDR A;  3ICX A;  1AVM A;  1KBH A;  1LUV A;  3LUT B;  3K5L A;  4FZ0 A;  4UV9 A;  2PI5 A;  2MW2 B;  2PYL A;  2W0X A;  2LW1 A;  4CC5 A;  1GTO A;  1YEW A;  1S76 D;  1XOU A;  4J9Y B;  4P2Z A;  1GM8 A;  5KHH A;  1HNW B;  1FYJ A;  4FZ1 A;  3TET A;  1DLB A;  3SPI A;  1Q3E A;  4TSF G;  2AXT Z;  1HWY A;  1TUB A;  2ZE5 A;  1JQ0 A;  2ZNJ A;  2Y4U A;  2AHY A;  1P84 F;  5KA6 A;  3PN1 A;  3O65 A;  4H0L B;  4DV6 O;  4B3R B;  2LGW A;  4B7E A;  2VQF B;  1ARO P;  4WFE A;  3BVO A;  3AG3 C;  1EZV H;  3BCC H;  4DV4 B;  1ZSP A;  5KHJ A;  4WF9 V;  1NVP B;  1M9N A;  1IBL B;  1I7F A;  3S3W A;  4K0K B;  2Y48 A;  1PPJ H;  3IFX A;  3LDE A;  4B3M B;  4FIP C;  1VF6 C;  3PJS K;  3CRQ A;  3JAW A;  1D2D A;  4OPH A;  2W0F C;  3G6B A;  2PUS A;  4J80 A;  4JI5 B;  4JI8 O;  2XAQ A;  1PNK A;  2Z0A A;  2PF4 E;  3ZRS A;  1H2M A;  1BQZ A;  4JI2 O;  3FYE B;  3I56 V;  5H9C A;  2XT9 A;  4F6R B;  3D3Q A;  2FKX A;  3QG5 A;  2IJK A;  3JCU Z;  2K9P A;  1IVS A;  4GX2 A;  1IBK O;  4ASU G;  2DOS A;  4JAV A;  1FJG B;  3WB0 A;  1OCR C;  1XL6 A;  5E79 Z;  2H3O A;  4I9W A;  3H1K H;  1WB8 A;  3H9V A;  1LUW A;  1N32 O;  1PNM A;  1KB9 F;  2UUA B;  2IJH A;  2XHB A;  4JF3 A;  4MVQ A;  4OX9 B;  1JPX A;  4MVR A;  3OTO O;  2WA4 A;  3U11 A;  2DMX A;  4RAI A;  5JJN B;  3K06 A;  4TV9 B;  4GLX A;  2FML A;  3E89 A;  4X1I B;  1AI4 A;  3SYA A;  3EFF K;  4XDK A;  1KUQ A;  3JAK A;  2ZR2 A;  3CRR A;  5CA0 B;  4D7T A;  3B40 A;  1RSO A;  1GMG A;  4R50 A;  1WP7 A;  2YID A;  4PEL A;  3CCM V;  3ZS8 C;  1SQQ H;  4DR6 B;  1VQ4 V;  2BTQ A;  3OMN B;  1X4T A;  4DRX B;  3CCV V;  2WLH A;  4LF6 B;  2UU9 O;  1YI2 V;  2CH7 B;  2GUZ B;  2LJ2 A;  4PA3 A;  4DUY O;  3M7M X;  5KX5 B;  2UXB O;  4LNU A;  2YI9 A;  2A9H A;  4UCT A;  1OCO B;  4JI1 O;  1HR0 O;  1U97 A;  2BE3 A;  1GKF A;  1YF2 A;  1OCC B;  4JYB A;  4GKK O;  1VQ8 V;  2B1G A;  3U0Z A;  1F23 A;  4FLT A;  5GON B;  4BR6 A;  3ZJZ A;  5IY5 C;  3UKM A;  3HKE B;  3QO8 A;  4FLY A;  1NTZ H;  2DWD C;  3EHB B;  4GX5 A;  4DV3 B;  2OCC C;  3OTF A;  1YIT V;  2EX3 A;  4PDL A;  4UFZ A;  3H1H H;  2Y0I A;  1K5S A;  4G2K A;  4BW9 A;  4R8C A;  2ARH A;  1BSM A;  3NXS A;  4LFB B;  4D6T H;  3ZCC A;  3CX5 F;  3ABL C;  2JEX A;  1S77 D;  3CCU V;  2BCC H;  2QR4 A;  2CAZ C;  2F43 G;  4LF7 O;  2Q9L A;  3UCS C;  4MVO A;  5L3B A;  2H94 A;  1PL0 A;  1XNQ O;  3SYO A;  1TVK B;  4DR1 O;  1OZ0 A;  1OCR B;  2CTQ A;  5EZY B;  3ETG A;  1BGY H;  3R66 A;  2ZDI A;  4WFA V;  3X2Q B;  4XDJ A;  1LR1 A;  2QKS A;  3BA9 A;  5KAI Z;  3AK3 A;  3FAV A;  4LH6 A;  1VAR A;  5IWA O;  4FFB A;  5FLX N;  4MW3 A;  2ZXW C;  1NH2 D;  1DK1 A;  2PY5 A;  1S5H C;  1QQC A;  1QR8 A;  1HNZ O;  4UVA A;  3N2K B;  5B1N A;  4J41 A;  2WPD G;  3CME V;  4KP4 A;  2GV9 A;  2R9R B;  5LBQ A;  1IXB A;  4NTW A;  4GKJ B;  1H2L A;  2P4K A;  1Q7Y W;  2GTA A;  4AHC A;  2OTL V;  3D36 C;  1FFT B;  5LOV B;  3H1J H;  5ITZ B;  3ZED A;  4RWU A;  1JOY A;  1AI6 A;  4X66 B;  1UPG A;  1XMQ B;  4GT1 A;  1WJZ A;  2HEP A;  4CZZ A;  4TV9 A;  4TOI A;  1H38 A;  3LSQ A;  4X1I A;  1SET A;  1URF A;  2XAJ A;  2OYQ A;  1KKC A;  1B6Q A;  1XL4 A;  2JS3 A;  2VQF O;  5B1B B;  5EBW C;  5CA0 A;  2VS0 A;  2YIB A;  1SER A;  3GWO A;  3TCU A;  4CS3 A;  4JI3 B;  5L3F A;  3KZI Z;  1AJP A;  1EFR G;  4JI6 B;  5IY5 B;  3JYC A;  4DRX A;  1RFY A;  1IBL O;  2X7R B;  5EBM C;  5LP6 A;  1Y74 A;  5D5P A;  4K0K O;  4O4L A;  3ASO C;  1WB7 A;  1BS3 A;  4B3M O;  1KEC A;  1S5J A;  5EK0 A;  3CCJ V;  2GUZ A;  4EKW A;  1PV0 A;  5KX5 A;  3ETD A;  1K8A W;  2K1E A;  4FVM A;  3ABL B;  2UUC B;  4Z2W A;  2QEX V;  5IYB O;  4DV6 B;  3UT5 A;  3F7V C;  2Q5Z A;  2KKW A;  3RN4 A;  4C7U A;  2PZS A;  1VQK V;  5IYD O;  4MVM A;  3ZN1 A;  4MTG A;  5CMU A;  4YXW G;  1R6T A;  4GYC B;  1I94 O;  4WBN A;  3CPW U;  2A7W A;  2B1I A;  4P30 A;  3RT3 C;  1Q6H A;  1Z5W A;  3VOU A;  2PTM A;  2UUA O;  1KMI Z;  1M4U A;  4ICG A;  1KU9 A;  4JPR A;  2WSS G;  4OX9 O;  3JD0 A;  1B04 A;  2PI4 A;  4G28 B;  2ZXW B;  1Q6U A;  4JI8 B;  4WFG A;  3CE2 A;  4MTO A;  1TVK A;  4I50 A;  5JH7 A;  2RNB A;  4UCS A;  3SDL A;  3B09 A;  1IXM A;  1P7B A;  2XTA A;  3G80 A;  5EZY A;  4AIL C;  4DR6 O;  4RUF A;  1FXK C;  4LF5 B;  3AG2 C;  2YI8 A;  3IC7 A;  3AEI A;  4QNH B;  1DTO A;  1NTK H;  5BMV B;  4R6Z A;  4U7N A;  3SJC C;  3JAR A;  1SF9 A;  3VBB A;  3QNE A;  4JYY A;  5EYP B;  1ZAU A;  3OMA B;  2AZ2 A;  4H44 B;  3SYQ A;  1VMG A;  3VQV A;  2A0L A;  1W0J G;  3ZX6 A;  4EEQ A;  3OD4 A;  3ZIA G;  3BAB A;  1GO3 F;  4QIW F;  1N36 B;  3CB2 A;  5H2F Z;  5BY1 A;  1V54 C;  5K1X A;  2P22 C;  1Y67 A;  3ZRV A;  3DC6 A;  3LNM B;  4MTX A;  3DGE A;  4HZ3 A;  4RUE A;  1WPX A;  3FB6 C;  4DV3 O;  5IJ9 A;  4DW1 A;  1NKD A;  2O57 A;  3DXR B;  4UUJ C;  4LF9 B;  3P30 A;  2Q69 A;  5LOV A;  2GDS A;  1OJH A;  4XBF A;  3ASO B;  2RN9 A;  2YEV A;  3K08 A;  2ZKO A;  2X0L A;  4X88 A;  5KA5 A;  2AHZ A;  3ZHU A;  1MAB G;  4LFB O;  1AI5 A;  4ZKI A;  2UU9 B;  5JCO C;  3DSQ A;  5DED A;  1XUQ A;  1YHQ V;  2KG7 B;  1W0K G;  3F7Y C;  1XNR O;  5E1A C;  4JAA A;  3L74 H;  1HR0 B;  3W7W A;  1NT2 B;  2P67 A;  3UQ8 A;  4GKK B;  1K34 A;  5LMN B;  3OMI B;  4J9Z B;  4DUZ B;  2X6A A;  3MHS C;  1S0V A;  4O2A A;  3RYF B;  1NR7 A;  3CS5 A;  4UV8 A;  3BPZ A;  3CCL V;  1YJ9 V;  3E8G A;  1WLE A;  3JD2 A;  4X1K B;  5LYJ A;  4FLZ A;  4KL1 A;  2M7W A;  2A06 H;  1XRE A;  1AP6 A;  1E1Q G;  1JMK C;  4LFC B;  4QE9 A;  2OWO A;  2QM8 A;  1ZL8 A;  1YCI A;  1YTF D;  1GN4 A;  3G67 A;  3HPL C;  1Q6I A;  1E79 G;  5AG2 A;  4DV7 O;  4ZI7 B;  1N4C A;  4QE7 A;  4DR5 B;  1R1B A;  4DR4 B;  3ZMS A;  1BCC H;  4GKJ O;  2EIK B;  2UXD B;  4X65 B;  1XNQ B;  2CTR A;  3JAT A;  4TQF A;  1HW7 A;  2EZO A;  3AG2 B;  2F1M A;  2IH1 C;  1SES A;  1KKD A;  4X66 O;  2Q67 A;  2X6B A;  2ZE6 A;  1XMQ O;  4L87 A;  2JS5 A;  1NTM H;  4O4I A;  2Y0P A;  1HNX B;  3ZMT A;  3AG7 A;  3ABK C;  5EC1 C;  1HNZ B;  2PGG A;  3RYC B;  4X1Y B;  4B3T B;  5FNV B;  4JI3 O;  3OFN G;  1XHX A;  5IYC O;  2KSD A;  1L1F A;  1V54 B;  3K79 A;  5B1O A;  2ZIM A;  2YS8 A;  3K3W A;  2EBO A;  4NKG B;  4LF4 O;  3D36 A;  1QVG U;  5BMV A;  1KC8 W;  4EB6 B;  1VF5 B;  4DR2 B;  1I5Y A;  5CA3 A;  5J9P C;  3AK1 A;  3H1I H;  3K57 A;  1M56 B;  3CC4 V;  5EIB C;  1WPB A;  1YDX A;  3CRA A;  3CCS V;  2UUC O;  1SC5 B;  2QWQ B;  1O9H A;  1K5Q A;  1N0N A;  2GTS A;  3ZMU A;  2F4V B;  2Y4T A;  3CC2 V;  2PYJ A;  3GWK C;  4HYO A;  5KMG B;  3E35 A;  2AZ0 A;  3CRM A;  3DXR A;  1Y76 B;  5J2T B;  5KUK A;  2EIN B;  4Z1V A;  4I55 A;  2FTK A;  1JX9 A;  4LP8 A;  3JAL B;  1AJQ A;  3SPG A;  1M57 C;  4I4T B;  3UO3 A;  2GHY A;  4UVB A;  1JVM A;  2ODM A;  3OEE G;  3SYP A;  4I0X A;  2XND G;  5CBF A;  2UXC B;  1GRJ A;  1K3E A;  3VQY A;  1UJW B;  1W59 A;  2ADP A;  5FPO A;  2HVJ C;  1KP2 A;  2ZD9 A;  2D2C B;  5B66 Z;  5J2U A;  1PM9 A;  4PJ0 Z;  3ABU A;  4K3A A;  3K04 A;  4LR3 A;  4XDL A;  5IYZ B;  5JVD A;  5A9G A;  1E1R G;  1SRY A;  2DYR B;  2EIL C;  4FMT A;  1S72 V;  3UO2 A;  5JQG B;  4LF5 O;  3JSN A;  3L75 H;  1I94 B;  1VQ5 V;  3DTU B;  4I5S A;  1W2B U;  5KLV H;  1VQO V;  3RYH B;  3D3I A;  4G27 B;  2QWR B;  3ZMV A;  1VQ9 V;  2OIE A;  1TA8 A;  1ZLZ A;  1FXV A;  2QA4 V;  2WLL B;  2NR5 A;  3OAA G;  4J11 A;  2Y69 B;  2Q4P A;  5JJJ B;  1M93 A;  1JFF B;  4PDM A;  4JTD B;  3CJH A;  3ABK B;  1R6N A;  1N36 O;  4J7K A;  1YSC A;  1T5E A;  1QU7 A;  5CBG A;  2JDI G;  3APQ A;  1EN4 A;  3CWB H;  1I08 A;  1L0N H;  2P7T C;  1ZX3 A;  1F51 A;  5C8Y B;  4LF9 O;  3HKB B;  1KQS U;  4L8J A;  2BOC C;  5CA1 A;  4CH6 A;  5HFL A;  1KD1 W;  5KHK A;  3BA8 A;  2WLK A;  3BAA A;  1G4Y B;  1K7D A;  5DN6 G;  3OT7 A;  3RYC A;  2HJD A;  2JGD A;  2Q73 A;  1MNG A;  1PNL A;  3AG3 B;  5LMN O;  2KB1 A;  4DUZ O;  1WN7 A;  2IJI A;  5D5Q A;  1VQP V;  5L3G A;  1G6U A;  3HKC B;  1AIL A;  3K0G A;  3K5M A;  1R3J C;  3A2F A;  1M57 B;  2WLN A;  1WNS A;  1EM1 A;  3CP1 A;  4YIP A;  5HFM A;  4LFC O;  5K1P A;  2JIZ G; 
#chains in the Genus database with same CATH homology
 3R66 A;  4LF5 O;  1N33 O;  4JI7 O;  1FYJ A;  5A2Q N;  1KUQ A;  2ZKO A;  4DV1 O;  4DV0 O;  4JI3 O;  1IBM O;  4LFB O;  4DR5 O;  3O65 A;  3T1H O;  2UXC O;  4DV6 O;  2VQE O;  5IWA O;  4DR4 O;  5FLX N;  1DK1 A;  1R6T A;  4YHH O;  4X64 O;  4AQY O;  2UXD O;  4X65 O;  1I94 O;  4LF4 O;  1HNW O;  1HNZ O;  3J80 N;  3RT3 C;  1X59 A;  1XNR O;  1N36 O;  2UU9 O;  5IT9 N;  2HHH O;  1A32 A;  3J81 N;  2UUA O;  5BXZ A;  4B3R O;  1XEQ A;  4DUY O;  1G1X B;  1AB3 A;  1XMO O;  2UXB O;  3T1Y O;  4OX9 O;  2UUC O;  3F5T A;  4X62 O;  2LW7 A;  2ZM6 O;  4LF6 O;  4JI1 O;  4LF9 O;  1HR0 O;  1HNX O;  3JAM N;  4DV4 O;  4GKK O;  2DJV A;  4OPA A;  4JYA O;  4B3T O;  1D2D A;  4OPH A;  3SDL A;  4JI8 O;  4LF8 O;  2Z0A A;  2AGA A;  2JRI A;  4DR7 O;  2E5L O;  4DR6 O;  1N34 O;  3M8A A;  4JI2 O;  4NXN O;  5BR8 O;  4JI4 O;  2VQF O;  4DV2 O;  4DV7 O;  2FKX A;  4NXM O;  4KHP O;  4JI5 O;  4DR2 O;  1IBK O;  5LMU O;  3J7A U;  4JI0 O;  2DOS A;  4B3S O;  5LMN O;  1R1B A;  5H5N A;  4DUZ O;  2UUB O;  4GKJ O;  4A5U B;  1J5E O;  1IBL O;  4DR3 O;  4YY3 O;  4K0K O;  2N74 A;  4LF7 O;  1F7Y A;  1YZB A;  1N32 O;  4JV5 O;  5LL6 Y;  1AIL A;  4B3M O;  1NS1 A;  4JI6 O;  1FJG O;  5BY1 A;  4DV5 O;  4LFA O;  2F4V O;  1FKA O;  1XNQ O;  4X66 O;  1XMQ O;  3OTO O;  4LFC O;  4DR1 O;  4DV3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...