2ZM6O

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 27
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2zm6O00
4X64O 4DV5O 4DV3O 4JI2O 1N33O 2UXBO 4GKKO 1I94O 4NXMO 2VQEO 4LF8O 1IBKO 4DR7O 4LF5O 3SDLA 4A5UB 4DR2O 1HNZO 4LF6O 2DOSA 5BR8O 4JI4O 4JI0O 2N74A 4DV7O 1AILA 4DR5O 2AGAA 5A2QN 4AQYO 4B3RO 4JI8O 4DUZO 4X65O 4JV5O 1N34O 4DV0O 3T1HO 2F4VO 2UUBO 3R66A 2VQFO 2HHHO 2DJVA 1DK1A 1FYJA 2FKXA 4JI3O 1XNQO 3RT3C 4DV6O 5BY1A 4JI6O 3M8AA 5LL6Y 1XMQO 4DUYO 4DR1O 2ZKOA 4YHHO 4LF4O 1R6TA 4DV1O 4OPHA 2Z0AA 2E5LO 1XMOO 4NXNO 2UUCO 4LFCO 1FKAO 5IWAO 3J7AU 2UU9O 2UXCO 3J81N 1YZBA 5LMUO 2UXDO 4OPAA 1A32A 1X59A 4JI5O 5FLXN 1J5EO 3J80N 5BXZA 4X62O 4DR6O 4JYAO 4JI1O 5IT9N 1XNRO 1HNWO 1N36O 4JI7O 4B3SO 4YY3O 4DV2O 1AB3A 1IBLO 3T1YO 4LF7O 4GKJO 1G1XB 2ZM6O 1KUQA 2JRIA 4X66O 1NS1A 4B3MO 5H5NA 1IBMO 3F5TA 1N32O 1HR0O 4DV4O 2UUAO 4K0KO 1FJGO 4DR4O 3JAMN 4DR3O 3OTOO 3O65A 1XEQA 5LMNO 1R1BA 4LFBO 4LF9O 2LW7A 1D2DA 4B3TO 4LFAO 4OX9O 1F7YA 4KHPO 1HNXO
chains in the Genus database with same CATH superfamily
3K58A 5KX5B 2VWJA 3QO7A 1FJGB 4MTGA 2WLIA 1SQPH 2BTQA 1W59A 3ABMC 1NR7A 5L3CA 4E4EA 3JD0A 2E76B 4DV7O 2QA4V 2F95B 5EBWC 3WFVA 2CDYA 3ZX6A 3BCCH 1VP7A 4CS3A 4DR7B 4FLTA 3N2GB 3C3TA 1K4CC 2W0FC 5JH7B 4MVOA 3W7UA 2FKXA 2KQXA 2CH7A 3SYAA 3DXRB 4U3JB 3AG1C 2Y4TA 1Y6XA 3OT7A 3K57A 4H44B 2ZDIA 2EIKC 5ITZA 2Z0AA 3HB3B 1FD9A 2HR3A 5CB4A 1XMOO 4IL6Z 2H8PC 4LFCO 1B06A 1UFIA 4UVAA 4DV6B 3J81N 2WA4A 5FNVA 4DR5B 1A32A 1AP5A 4BW5A 4DR1B 3JD3A 2H3OA 3RYHA 1OCOC 2CE4A 1M90W 5LP6B 1KUQA 1RSOA 3NR7A 2Q8VA 4H13B 3RBZA 2BCCH 5J2TA 2BTQB 3CCEV 4PDVA 1FFXA 3K06A 3UT5A 1HWYA 4W4KA 1M93A 5KHJA 2GV9A 4MS2A 1S77D 1SC5B 2G38A 4YHHB 1NH2D 2BSKB 4LF7B 2F1MA 4GUNA 2LW7A 3UO2A 1F7YA 2NN4A 1HNXO 2W6IG 4RUFA 4H37A 3LNMB 3DTUB 2VQEO 2EIMC 3CRMA 2QEXV 1ZL8A 4LH6A 3S3WA 4FM1A 2R9IA 5LYJA 1TA8A 1SZTA 1SQVH 3UO3A 4O2BA 3RYIA 4X20A 2P22C 2CH7B 4X64B 2XTAA 3K03A 3OGCC 4DUZO 5DM6V 4AHCA 2X6BA 2RJZA 2UXXA 5ITZB 4LR3A 5CB4B 1EZJA 1R3KC 2M7WA 2YUAA 4MTOA 1EN5A 1K97A 3JASA 3LSQA 1R6NA 3B09A 4XBFA 1HP8A 1B04A 1D5AA 5FNVB 1F4MA 3T4DA 1YDXA 3OM3B 2IU3A 2OTLV 3RYHB 4DV1O 3ABLC 1K34A 3H1HH 1KU9A 4WFBV 1TVKB 1RSOB 1R3JC 3ABMB 4D6TH 5J2TB 1FFXB 4JI6B 3UT5B 1YEWA 5E79Z 3SPHA 1M56C 4JI1O 4I9QA 4JI7O 2Z3YA 2ITCC 3WB2A 3G4SV 3O9OA 4IGGA 1CP9A 1QR9A 2ZINA 4B3MO 2N04A 4QGPA 1E1QG 3F5TA 1P7BA 2ZT9B 5AG2A 1ZL8B 4ZKIA 4X89A 1BHBA 1LNQA 3LSSA 4I4TA 4LF4B 1GTOA 2X7RB 3ZHUA 4O2BB 2EIKB 2WLHA 4J11A 3RYIB 1N0NA 4X20B 4MVRA 3OFNG 3OMIB 1PM9A 1M1KW 1BGYH 4MW8A 4OX9O 2WSSG 1GM8A 3L75H 1N33O 1M5IA 5L3GA 3KKYA 1P7GA 4MTFA 2YXLA 3KCYA 2K1EA 4DR2O 3JASB 5LMNB 2JGUA 2IH3C 4GKJB 4I9WA 3FAVA 2QWQB 2ZD9A 1XHZA 3E89A 3JAKA 5LOVA 3QVNA 4UCVA 5TISZ 2LO1A 1K8AW 3CCRV 3TXQA 5EYPA 2HHHO 1ZUQA 1BT8A 2LQTA 1Q3EA 1YJNV 4PI2A 1DK1A 1Q7YW 2CAZC 4JV5B 2XT9A 5LL6Y 3E2EA 3FKSG 3W7TA 2CTQA 3SYOA 2ODMA 4W4LA 2FL4A 2IJIA 2DN9A 1K92A 5KUKA 2EIMB 3SPJA 2NNUA 1W2BU 4DV7B 1F4NA 3E8HA 2Q9LA 2ZIMA 3J80N 1KBHA 1K7DA 1MMMA 4I4TB 3ABUA 2HLDG 1YITV 4XDLA 2ARHA 1AJPA 1G1XB 1IDSA 2UU9B 3ZS8C 1WP8A 1T5EA 1JA8A 1HR0O 2YSUB 1FJGO 2BOCC 2DWDC 1Q6UA 1BCCH 4DV2B 3FB6C 2FYUH 2OCHA 3ABLB 1XMOB 1VQ8V 3FAVB 4J80A 2M6YA 2MW2B 4K0KB 2LP7A 4X9QA 4R8CA 4PA9A 3JAKB 1XQ8A 5LOVB 3GB7C 3OTOB 4C7UA 3BFRA 4DR7O 5EYPB 1M56B 2LFSA 1NJIW 3HPLC 4MW3A 4B3TB 4ASUG 2DW4A 4DV3B 1AROP 1NZ6A 3OUSA 4ZOLA 5JVDA 3CC4V 3CRQA 1AI4A 1AR4A 3I56V 1HNZB 3TGUH 2YIBA 1PNLA 3L70H 3R66A 3CD6V 2YI9A 1I5YA 4F6RA 4CC5A 2XAHA 1FYJA 1XNQO 5IY5C 1NH2B 4DV6O 5BY1A 3VQXA 4DR1O 1K33A 2N05A 1GMGA 3RVZA 1ZTEA 1XHXA 5D5PA 5EBLC 4FLUA 3UQ8A 1K3EA 2EILC 1SF9A 4DYLA 2CTWA 4FLVA 2XNDG 1G6UA 1VQPV 4LF7O 1VF7A 5KHKA 2IJHA 4WBNA 5LXTA 2V7QG 1QQCA 5LMUB 3FB5C 2QDOA 4QIWF 1Q81W 1PNMA 4U7OA 4UCUA 5F2VO 3TETA 3MD0A 2F43G 4JAAA 1VQ4V 4DV1B 2QJ1A 2CTRA 4D7TA 5LHIA 3CB2A 4ZOLB 5JVDB 4X64O 3ASNC 3JCZA 4X1KA 1K5QA 1LR1A 4JYCA 4DR3B 3G80A 3ZHQA 1DF5A 4LH7A 2Q68A 4O2AA 4F6RB 4EFEA 5JJNB 4LF9B 2XUMA 4LFAB 3K9SA 4CC6A 2UXNA 4B3MB 3CJHA 2E3CA 4DO2A 4CS2A 5BR8B 5H6RA 5B1AB 2OIEA 3BRCA 3AK1A 1Z5WA 3SJCC 2QGNA 3LDEA 3HKEA 3ZMTA 4JI6O 4FLZA 1XMQO 3G6EV 3QNEA 3VOUA 1GN3A 3BPZA 2GTAA 4ZBMA 1KB9F 5EBMC 4WBNB 5LXTB 5IYCO 5LHHA 2B1GA 1NI8A 5IYBO 1ZAUA 4CZZA 5EC1C 5JJJB 1IX9A 1WPXA 2IU0A 1HNWO 4B3SO 4NVPA 2JEUA 5KHIA 3GWOA 3CCVV 4HYOA 1WNSA 1Z2GA 5H2FZ 4UCSA 1M57C 4X1KB 2UXDB 1BQ0A 4PA3A 3CS5A 1GAXA 4X62B 5IY5B 3ZMUA 3ZEDA 4GX2A 1EZVH 4O2AB 1E79G 2AZ2A 2Q4PA 5LMNO 2LGQA 3HR0A 1N32B 5BMVA 5IYZB 4DV5O 1KECA 3CJHB 4BIOA 5LGUA 5KUMA 1NTMH 2P6JA 1DGSA 1IVSA 3ETEA 2EILB 3TJTA 1BQZA 1OV9A 1WJZA 3CPWU 2AGAA 5C8YA 3B77A 2Z5UA 3HKEB 4JI8O 1NT2B 3K04A 4JV5O 5K1XA 3A0HZ 1NVPD 2A79B 3JSLA 4LF6B 2KG7A 2X6AA 4TQDA 4FLXA 1L0LH 4XDJA 1E1RG 1JFFA 2CGNA 1YTFD 2JVDA 1K4DC 3RT3C 4KP4A 4LNUA 3K5MA 1O9GA 5KAIZ 3ETQA 3JD2A 3ASNB 3CXHF 2P7TC 2B5UA 1EM1A 2ZNJA 2P5OA 4LC1A 5FPOA 5B1BC 2UU9O 1QR8A 1URFA 5FLXN 2K9PA 4TUYA 5DN6G 5E1AC 2Q69A 4RO2A 3CCLV 4CH6A 2Y0PA 1AR1B 4NXNB 4LCUC 4DV2O 1N8RW 1Y66A 3CP1A 2Q5ZA 1EN6A 5BMVB 2XASA 2UXCB 1NBMG 1YJ9V 1Y76A 4NYKA 3ZRWA 2F23A 3QG5A 2UUAO 4K0KO 4DR6B 1XNQB 2AHYA 3IAYA 4DRXA 4Z2WA 3OTOO 4F4LA 2Q6AA 1XI1A 4X1IA 5KA5A 5L3FA 2HJFC 1AI6A 3B40A 4TOIA 5C8YB 1XL4A 1WA8A 1GO3F 4B3TO 1Y67A 5DEDA 4DV3O 4YXWG 1RPOA 1TAEA 4FK5C 4Z1VA 2UXBO 1IXMA 2WLMA 3JARA 4WF9V 2WLIB 2KG7B 3LDCA 4J41A 4G27B 1DTOA 1HNZO 5J2UA 4HBNA 2DOSA 4QPJA 1VF6C 1JFFB 4CH5A 4JAUA 3L72H 2R9RB 4WFGA 2PZSA 3LUTB 4N21A 1QNMA 4LNUB 1VQMV 4MT8A 1L1FA 4X65O 3N2KA 2WAMA 2UUBO 4JI4B 1R3IC 2W0XA 2Q7EA 2JS5A 3IGAC 4YIOA 2DJVA 2IM9A 2QWNB 4PA4A 2ZNIA 1NKDA 2JDIG 1MG1A 2IH1C 2B9ZA 1OJHA 4IYIA 1TUBA 2JJ1G 4TUYB 3THOA 4NTXA 1TUEB 4UFZA 4AI8A 1OCRC 3EHBB 2F4VB 4Q6GA 2GSMB 3CCJV 3JSNA 1VQOV 1Y76B 1OHHG 3ZRWB 3ZHSA 5LMUO 1B3QA 2XAFA 3PJSK 4DRXB 4CS4A 1VQLV 4X1IB 1WN7A 4QNHB 1SQFA 2D2CB 1WA8B 3G6BA 3H01A 1PNKA 3ZBHA 1ZSPA 5LA6A 1VF6A 4X1YA 5IDJA 3M99B 1D5NA 3JARB 4FLYA 2Y69C 4AILC 5J2UB 1N36B 3CCUV 4DR3O 1XMQB 1OCCC 3FD9A 1IBLB 4R6ZA 2DMXA 2CK3G 4NB5A 4LF9O 4LFAO 3JYCA 4MVZA 1SA0A 2QWOB 3N2KB 1SESA 2V1DA 2RMKB 4FLWA 3D36C 5B1BB 4I0XA 1I94O 4ICGA 1H2LA 4LF8O 2QTSA 3AG2C 3SDLA 2PI5A 2HP8A 1VQ7V 4HAMA 5BR8O 3LDDA 3RVYA 3AG1B 4YIPA 1HNWB 1NR1A 4B3SB 5LYJB 1AILA 2YIDA 1WLEA 4J42A 1VF5B 1IBKB 5IJ0A 4L87A 1U97A 2RQ6A 2F93B 5CBHA 4LWSA 2PYLA 1OCOB 3CEIA 3OGIB 2BOBC 3M8AA 3ZRVA 1N34B 4DV5B 3CRRA 1BZKA 2GTSA 3SR2C 2Y4UA 4K35A 1SQXH 3WG7C 1FKAO 2EX3A 5LA6B 4X1YB 2UXDO 4TT3G 3K9AA 3ABKC 4PI0A 4TQFA 4JI8B 2A06H 4X62O 4PDRA 1MSWD 4CBCA 4FVMA 2A3QA 3D36A 1SQQH 4Z1MG 1L0NH 1NVPB 3A8TA 3ZRSA 1SA0B 4JPRA 4K3AA 1N32O 3F7YC 3ETDA 4I0XB 3SPGA 4BIZA 4ZI7A 1H8HG 3W7SA 1YTFB 2RN9A 5KAFZ 1XOUA 3O65A 1GN2A 3F7VC 4O4JA 1OCRB 1JQ0A 3CXCU 4O4LA 4PD4F 1DLBA 2KB1A 2V4DA 1QBZA 4I5SA 4TSFG 5K1PA 5B5EZ 5L3BA 4EKWA 4X88A 1VQNV 5IJ0B 5C93A 1RM1C 4DR4B 1V55C 3D3IA 4O4IA 3ML0A 3ZJZA 4LF6O 4LWSB 1CXZB 2HKOA 2QKCA 3W7WA 3OR6C 4PA6A 2N74A 1JX9A 2LGWA 4JTDB 3U10A 3G71V 4JI2B 4PDLA 2WPDG 2GUZA 3IC7A 3MAQA 4GKKB 2JJ2G 1AP6A 2Q7GA 5EC2C 3RFRA 4LF5B 2UUAB 1FXVA 2W6JG 1ZX3A 5FL7G 3AEIA 1I5XA 2Y69B 2ADPA 1GN6A 1I7FA 4B08A 1OCCB 1O9HA 4P9PA 3OMNB 4GX0A 1XILA 2QKSA 2UXBB 4GYCB 1VMGA 2ZE8A 3ZMZA 2Q0OC 1THZA 4NXNO 3AG2B 1S0VA 2DQ0A 1PL0A 2UXCO 2YC0A 4ZI7B 4KL1A 4DUYB 2ADQB 2LJ2A 4DR6O 4UB6Z 4X65B 4K8ZA 2DYSC 3MHSC 5IYDO 2AW9A 2UUBB 5D5QA 2UUCB 4H0LB 2P4VA 1GH6A 1KP3A 3QO5A 4PHZA 3UCSC 4YJ2A 2OIGA 1ZLZA 4JAVA 2LW1A 5EK0A 1J5EB 4O4IB 4BR6A 1XNRB 3E8GA 1OZ0A 2OTJV 3U0ZA 4G2KA 3AG3C 1AVMA 3CMAV 4KUMA 1JJ2U 4X66B 4J7KA 4UCOA 2GUZB 1WB8A 3B2EE 3WG7B 1HW7A 2Q0AA 3HKDA 3A0RA 1YXBA 4RQFA 1WB7A 3ABKB 2MK3A 2HVJC 4LFBB 4JI4O 5FPRA 3ZHRA 4UVBA 2Y0IA 3AG7A 5B3SC 4WFFA 1H38A 2WLLA 1X4TA 3EXAA 3FB7C 3RGBA 2QM8A 2GDSA 3S3XA 4GX1A 2F4VO 1MSDA 1Q43A 2H94A 2ZE7A 3CRAA 3DSQA 3C90A 4PA7A 1I94B 1Y4MA 1SZXA 2RDCA 4LF8B 3CYOA 1V55B 5IE9A 2WWWA 1L8DA 2ZR2A 2QWRB 4YJ2B 4JI3B 3K79A 2LFRA 3PN1A 1GM7A 2R72A 4OPAA 1PP9H 1X59A 1GN4A 1W0JG 2XAJA 4FIPC 1Q86W 3W7XA 4MSWC 1H2GA 4NKGB 4TV8A 3LSUA 2YIAA 1N36O 2O57A 3N27A 1IBLO 1P84F 1H2NA 1ENVA 1JJOA 2ZXWC 3AK3A 3HKDB 4JI5B 3VQVA 5KHGA 1JR9A 3K59A 2BTOA 2YICA 2EJ7A 1WPBA 1PV0A 2P4KA 1AR5A 4EFBA 4WFHA 4LBEC 1LUVA 4WFEA 3KCXA 3AG4C 4RUEA 2AZ0A 5JQGA 3CX5F 4HZ3A 4E2LA 2WLLB 1XREA 1Z5VA 5LP6C 1PD3A 4ZIBA 4FM2A 1IBKO 3BA9A 3JATA 4X8AA 4MVSA 3OW2U 3H1KH 2ZCEA 2YI8A 2GBOA 4YJ3A 2DYSB 1S3JA 1Y74A 4MVUA 1Q6IA 4KFMA 1LUWA 4ABMA 2XHBA 4B3RO 2FMLA 4I55A 2EZPA 4FZ0A 4NXMB 1N34O 4J9ZB 4JZ2A 4LP8A 4PDMA 1CPYA 3K0DA 2JS3A 4BIUA 1W0KG 4JI0B 3EFFK 4QE7A 4FZ1A 3NXSA 3ZN1A 2P90A 3AG3B 3UM7A 4BWAA 2PGGA 3ZHVA 2IJJA 3SPCA 4TV8B 4FFKA 1R6TA 3FB8C 2PI4A 4OPHA 1FS0G 1WP7A 5CBGA 1Q90D 3T4ZA 1AJQA 3VQWA 3J7AU 3ZRXA 4TV9A 3T1CA 2QM4A 3JCUZ 4J9YB 5B3SB 3E22A 2L6LA 1Q8IA 5LP6A 1AB3A 5B66Z 1GRJA 5JCOC 3WU2Z 1BHAA 2JRIA 5JQGB 1V54C 1I08A 1F23A 1VEWA 1VIBA 3CCSV 3JATB 1S5HC 4DR4O 3TCUA 2BSKA 5LHGA 1GKFA 4YY3B 5DECA 1YI2V 3CRCA 3T1YB 2EBOA 4YJ3B 5H6QA 5KMGA 2RNBA 1Y74B 1Q5OA 2DQ3A 1JOYA 4R50A 4KHPO 4JI2O 3BHPA 5CBFA 4I55B 4GKKO 2HG5C 3L9DA 4QJFB 4WCEV 4D7SA 1YIJV 4LF5O 4A5UB 2EJRA 4U3FH 4P9OA 3TK1A 2KSDA 5GONA 1YVWA 1RFYA 3B8NA 1YSCA 1XL6A 1BS3A 2ZXWB 2HVKC 4J7ZA 2WA3A 5KA6A 1H2KA 1R73A 1RP3B 1VARA 3QO8A 2VQFO 2PYJA 4TWKA 3ICXA 4TV9B 4KXRA 3ZCCA 3H1LH 4JYYA 4GT1A 2OT5A 2ZE5A 1OCZC 3CWBH 5JCOA 2YDEA 3E22B 1R3LC 1VQ9V 3AG4B 4DUYO 2A7WA 2OCCC 2Q7HA 3Q4HA 3HKCA 1N0JA 1TVKA 1M57B 3K0GA 3APOA 4P30A 4NTWA 4PV1B 2UUCO 5CA1A 2DE0X 3OD4A 3K5LA 2ETNA 3C3SA 1UPGA 2YEVA 2ILMA 2IJKA 4GLXA 1J5EO 3H1IH 1JVMA 3BEHA 3G67A 5JJEB 1XNRO 3AK2A 2VRZA 1K9MW 2E5LB 4IIJA 4UXNA 3H1JH 5KMGB 2EULA 5HFMA 5IWAB 4X66O 1ORQC 3QTCA 2QSAA 1QHTA 3P30A 1JPXA 4RWUA 1H2SB 1VQ6V 2CTPA 4H33A 3IFXA 3JAMN 2AXTZ 3JD1A 4QE9A 4UV9A 3EVKA 1R1BA 4LFBO 3APQA 2R70A 3RW0A 5GONB 3VBBA 4DXWA 1IBMB 1EBOA 1NQTA 3OUFA 3GVMA 4DV4B 3ETGA 3KG2A 3SYPA 1XUQA 3OEEG 5KLVH 3SGIA 1MZFA 3OTFA 3E83A 3H9VA 3M7MX 2VWKA 5A2QN 2A0LA 2PF4E 3DC5A 4FFBA 1V54B 5HFLA 3Q4HB 1EN4A 3HKCB 3MDSA 1K73W 3LNNA 1KP2A 3ZMSA 5B1NA 5LBQA 3FYIB 2WLKA 2YIBD 4JZGA 2ATKC 5CA1B 1AI7A 4AQYB 5BZBA 2YEVB 4JI3O 1PKXA 4OXSA 2JEXA 2JGDA 3P3PA 1KD1W 2ZE6A 4DV0B 5L3DA 3T1HB 2L35A 4XDKA 1TUBB 3L73H 2R9AA 4IIJB 4UV8A 4DK0A 3HKBA 5EIBD 2X6CA 4IHJA 5CA3A 3ASOC 1F51A 4J10A 4FMTA 4JI5O 3RN4A 4B3RB 1QCEA 5BXZA 1XBLA 1JCHA 5CMUA 5IT9N 1JMKC 3RYFA 5EZYA 2ZIOA 4B7KA 3K5NA 1S72V 2ZQMA 2A9HA 1NU1H 4JYAB 2F66C 1OCZB 1XEQA 4GZRB 2OCCB 2ZM6B 4FJCC 1D2DA 1P49A 4I7ZB 4EB6A 3ZIAG 4FFBB 1QU7A 3UKMA 2KKWA 2QKAA 2QTOA 3K3WA 3BY6A 2JK5C 3ZN0A 4NXMO 1MABG 1KKCA 3CCQV 5GTHZ 3DC6A 2ITDC 1YHQV 4JI0O 5GTIZ 1SQBH 1FFTB 2EINC 3L71H 1U96A 2JGDB 1FAFA 3HKBB 4RAIA 3IJ4A 2CUGA 3IC9A 1QLNA 3E86A 3P3NA 4IHJB 2XAQA 2P06A 3MHHC 3E35A 1QVGU 4K8XA 3JALA 2YXHA 1FXKC 1NTZH 2NR5A 1G8MA 1PPJH 1QLEC 1KMIZ 4KHPB 1UJWB 1K5SA 2IW5A 3RYFB 1KC8W 5EZYB 1US6A 2QM7A 1CEZA 2RCVA 2DYRC 2WLNA 3B4SA 1G4YB 1SS3A 5EIBC 3ABTA 2DWEC 3SYQA 2B1IA 3TXSA 4JF3A 2QE7G 1V9PA 4JYBA 5B1AC 3FYEB 1FXHA 3D8CA 4N23A 1SETA 1MNGA 3SJQC 3R65A 4UCRA 3U11A 5IJ9A 2EIJC 2IBZH 1BE3H 4YY3O 4UVCA 2D3OW 4JTCB 2QR4A 3T1YO 4LFCB 1IURA 4EB6B 4IT5A 2VQFB 1SRYA 3K5OA 4JGSA 1BSMA 1NS1A 2JIZG 4QPKA 4O4HA 3T2MA 1N4CA 1FPOA 1RPRA 1IZ3A 4GX5A 1COWG 2XOKG 5JWPA 1GM9A 1YF2A 4BW9A 3CC2V 4BAYA 2P67A 3E8FA 5J9PC 4O4JB 3L74H 1P4RA 4O4LB 2PTMA 4DW1A 3ASOB 3BABA 3CMEV 3RYCA 1FXKA 4FPPA 4MTXA 2GHYA 4DR5O 1H8EG 1SQGA 3JALB 3QF7A 1HNXB 3RWRD 4ZHQA 3BVOA 2PUSA 2HFEC 1NTKH 2VQEB 4OGQB 2FTKA 3SJAC 4DK1A 1VQ5V 1KYOF 1B6QA 1ZWIC 2NLJC 3CSXA 5L3EA 4DUZB 4I50A 2FB5A 3OAAG 4U7NA 4YHHO 5IJ9B 4EEQA 1IXBA 3ZMVA 5CA0A 5CN0A 3STZC 2E5LO 3X2QC 2VS0A 5H9CA 2Q67A 2EZOA 2YXYA 5IWAO 1AJNA 4O4HB 4UCTA 3WB0A 1YZBA 3GWKC 2EINB 2X0LA 3A2FA 1BL8A 4HNAA 1XDCA 2QWPB 4NR1A 3CHXA 1S76D 3JAWA 1VQKV 1RM1B 1MA1A 1IBMO 3CE2A 1M9NA 2Q73A 1BMFG 4DV4O 2OWOA 3D3QA 1H2MA 3RYCB 3A0BZ 3B8MA 3OE7G 4JI1B 5GW7A 4PELA 1FXKB 1QLEB 4JI7B 1EFRG 1MZEA 2YS8A 4UB8Z 1AI5A 5IYZA 1J95A 2DYRB 3DGEA 4ZHQB 4DW0A 4UUJC 2CGOA 5KHHA 1SERA 1DF4A 3I55V 1YJWV 1KKDA 2EIJB 5LGTA 4I50B 4OX9B 4JTAB 3VQYA 4AQYO 2ZR3A 2E75B 3FX7A 2C2AA 1N33B 5KX5A 1R6KA 3FFQA 4Q20A 4DV0O 3T1HO 5CA0B 4F6EA 4DR2B 3OEHG 4GCZA 4P2ZA 5A9GA 4R7CA 1M4UA 1GK9A 2BE3A 3JD4A 1Q82W 2HJDA 3F5WC 3OR7C 3WB1A 5B1OA 4L8JA 1I0HA 1SKVA 2WLJA 4HNAB 2ZKOA 2XAGA 4LF4O 1S5JA 4MVQA 3BA8A 1S5LZ 3P32A 2HHHB 3N2GA 4NTYA 2AHZA 3JAWB 4WFAV 3SYCA 5JH7A 3SJBC 3SPIA 4J7JA 4RQEA 3DXRA 4U3JA 4PJ0Z 2Y48A 1HDJA 4JYAO 3OMAB 1QVFU 1PL4A 3STLC 4B7EA 1TGOA 1WAZA 1YCIA 4FM0A 2PY5A 4GKJO 2ZM6O 3I5DA 4JASA 3ZHTA 2ZDIC 4G28B 5H5NA 4MVMA 3CCMV 3KZIZ 5LGNA 1MOFA 1ROPA 3BAAA 4CH3A 3K08A 2E74B 4CH4A 3CC7V 2HEPA 4IYHA 2OYQA 1Q6HA 3E8BA 3X2QB 1KQSU 1HR0B
chains in the Genus database with same CATH topology
4X64O 4DV5O 4DV3O 4JI2O 1N33O 2UXBO 4GKKO 1I94O 4NXMO 2VQEO 4LF8O 1IBKO 4DR7O 4LF5O 3SDLA 4A5UB 4DR2O 1HNZO 4LF6O 2DOSA 5BR8O 4JI4O 4JI0O 2N74A 4DV7O 1AILA 4DR5O 2AGAA 5A2QN 4AQYO 4B3RO 4JI8O 4DUZO 4X65O 4JV5O 1N34O 4DV0O 3T1HO 2F4VO 2UUBO 3R66A 2VQFO 2HHHO 2DJVA 1DK1A 1FYJA 2FKXA 4JI3O 1XNQO 3RT3C 4DV6O 5BY1A 4JI6O 3M8AA 5LL6Y 1XMQO 4DUYO 4DR1O 2ZKOA 4YHHO 4LF4O 1R6TA 4DV1O 4OPHA 2Z0AA 2E5LO 1XMOO 4NXNO 2UUCO 4LFCO 1FKAO 5IWAO 3J7AU 2UU9O 2UXCO 3J81N 1YZBA 5LMUO 2UXDO 4OPAA 1A32A 1X59A 4JI5O 5FLXN 1J5EO 3J80N 5BXZA 4X62O 4DR6O 4JYAO 4JI1O 5IT9N 1XNRO 1HNWO 1N36O 4JI7O 4B3SO 4YY3O 4DV2O 1AB3A 1IBLO 3T1YO 4LF7O 4GKJO 1G1XB 2ZM6O 1KUQA 2JRIA 4X66O 1NS1A 4B3MO 5H5NA 1IBMO 3F5TA 1N32O 1HR0O 4DV4O 2UUAO 4K0KO 1FJGO 4DR4O 3JAMN 4DR3O 3OTOO 3O65A 1XEQA 5LMNO 1R1BA 4LFBO 4LF9O 2LW7A 1D2DA 4B3TO 4LFAO 4OX9O 1F7YA 4KHPO 1HNXO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 O;  4DV5 O;  4DV3 O;  4JI2 O;  1N33 O;  2UXB O;  4GKK O;  1I94 O;  4NXM O;  2VQE O;  4LF8 O;  1IBK O;  4DR7 O;  4LF5 O;  3SDL A;  4A5U B;  4DR2 O;  1HNZ O;  4LF6 O;  2DOS A;  5BR8 O;  4JI4 O;  4JI0 O;  2N74 A;  4DV7 O;  1AIL A;  4DR5 O;  2AGA A;  5A2Q N;  4AQY O;  4B3R O;  4JI8 O;  4DUZ O;  4X65 O;  4JV5 O;  1N34 O;  4DV0 O;  3T1H O;  2F4V O;  2UUB O;  3R66 A;  2VQF O;  2HHH O;  2DJV A;  1DK1 A;  1FYJ A;  2FKX A;  4JI3 O;  1XNQ O;  3RT3 C;  4DV6 O;  5BY1 A;  4JI6 O;  3M8A A;  5LL6 Y;  1XMQ O;  4DUY O;  4DR1 O;  2ZKO A;  4YHH O;  4LF4 O;  1R6T A;  4DV1 O;  4OPH A;  2Z0A A;  2E5L O;  1XMO O;  4NXN O;  2UUC O;  4LFC O;  1FKA O;  5IWA O;  3J7A U;  2UU9 O;  2UXC O;  3J81 N;  1YZB A;  5LMU O;  2UXD O;  4OPA A;  1A32 A;  1X59 A;  4JI5 O;  5FLX N;  1J5E O;  3J80 N;  5BXZ A;  4X62 O;  4DR6 O;  4JYA O;  4JI1 O;  5IT9 N;  1XNR O;  1HNW O;  1N36 O;  4JI7 O;  4B3S O;  4YY3 O;  4DV2 O;  1AB3 A;  1IBL O;  3T1Y O;  4LF7 O;  4GKJ O;  1G1X B;  2ZM6 O;  1KUQ A;  2JRI A;  4X66 O;  1NS1 A;  4B3M O;  5H5N A;  1IBM O;  3F5T A;  1N32 O;  1HR0 O;  4DV4 O;  2UUA O;  4K0K O;  1FJG O;  4DR4 O;  3JAM N;  4DR3 O;  3OTO O;  3O65 A;  1XEQ A;  5LMN O;  1R1B A;  4LFB O;  4LF9 O;  2LW7 A;  1D2D A;  4B3T O;  4LFA O;  4OX9 O;  1F7Y A;  4KHP O;  1HNX O; 
#chains in the Genus database with same CATH topology
 3K58 A;  5KX5 B;  2VWJ A;  3QO7 A;  1FJG B;  4MTG A;  2WLI A;  1SQP H;  2BTQ A;  1W59 A;  3ABM C;  1NR7 A;  5L3C A;  4E4E A;  3JD0 A;  2E76 B;  4DV7 O;  2QA4 V;  2F95 B;  5EBW C;  3WFV A;  2CDY A;  3ZX6 A;  3BCC H;  1VP7 A;  4CS3 A;  4DR7 B;  4FLT A;  3N2G B;  3C3T A;  1K4C C;  2W0F C;  5JH7 B;  4MVO A;  3W7U A;  2FKX A;  2KQX A;  2CH7 A;  3SYA A;  3DXR B;  4U3J B;  3AG1 C;  2Y4T A;  1Y6X A;  3OT7 A;  3K57 A;  4H44 B;  2ZDI A;  2EIK C;  5ITZ A;  2Z0A A;  3HB3 B;  1FD9 A;  2HR3 A;  5CB4 A;  1XMO O;  4IL6 Z;  2H8P C;  4LFC O;  1B06 A;  1UFI A;  4UVA A;  4DV6 B;  3J81 N;  2WA4 A;  5FNV A;  4DR5 B;  1A32 A;  1AP5 A;  4BW5 A;  4DR1 B;  3JD3 A;  2H3O A;  3RYH A;  1OCO C;  2CE4 A;  1M90 W;  5LP6 B;  1KUQ A;  1RSO A;  3NR7 A;  2Q8V A;  4H13 B;  3RBZ A;  2BCC H;  5J2T A;  2BTQ B;  3CCE V;  4PDV A;  1FFX A;  3K06 A;  3UT5 A;  1HWY A;  4W4K A;  1M93 A;  5KHJ A;  2GV9 A;  4MS2 A;  1S77 D;  1SC5 B;  2G38 A;  4YHH B;  1NH2 D;  2BSK B;  4LF7 B;  2F1M A;  4GUN A;  2LW7 A;  3UO2 A;  1F7Y A;  2NN4 A;  1HNX O;  2W6I G;  4RUF A;  4H37 A;  3LNM B;  3DTU B;  2VQE O;  2EIM C;  3CRM A;  2QEX V;  1ZL8 A;  4LH6 A;  3S3W A;  4FM1 A;  2R9I A;  5LYJ A;  1TA8 A;  1SZT A;  1SQV H;  3UO3 A;  4O2B A;  3RYI A;  4X20 A;  2P22 C;  2CH7 B;  4X64 B;  2XTA A;  3K03 A;  3OGC C;  4DUZ O;  5DM6 V;  4AHC A;  2X6B A;  2RJZ A;  2UXX A;  5ITZ B;  4LR3 A;  5CB4 B;  1EZJ A;  1R3K C;  2M7W A;  2YUA A;  4MTO A;  1EN5 A;  1K97 A;  3JAS A;  3LSQ A;  1R6N A;  3B09 A;  4XBF A;  1HP8 A;  1B04 A;  1D5A A;  5FNV B;  1F4M A;  3T4D A;  1YDX A;  3OM3 B;  2IU3 A;  2OTL V;  3RYH B;  4DV1 O;  3ABL C;  1K34 A;  3H1H H;  1KU9 A;  4WFB V;  1TVK B;  1RSO B;  1R3J C;  3ABM B;  4D6T H;  5J2T B;  1FFX B;  4JI6 B;  3UT5 B;  1YEW A;  5E79 Z;  3SPH A;  1M56 C;  4JI1 O;  4I9Q A;  4JI7 O;  2Z3Y A;  2ITC C;  3WB2 A;  3G4S V;  3O9O A;  4IGG A;  1CP9 A;  1QR9 A;  2ZIN A;  4B3M O;  2N04 A;  4QGP A;  1E1Q G;  3F5T A;  1P7B A;  2ZT9 B;  5AG2 A;  1ZL8 B;  4ZKI A;  4X89 A;  1BHB A;  1LNQ A;  3LSS A;  4I4T A;  4LF4 B;  1GTO A;  2X7R B;  3ZHU A;  4O2B B;  2EIK B;  2WLH A;  4J11 A;  3RYI B;  1N0N A;  4X20 B;  4MVR A;  3OFN G;  3OMI B;  1PM9 A;  1M1K W;  1BGY H;  4MW8 A;  4OX9 O;  2WSS G;  1GM8 A;  3L75 H;  1N33 O;  1M5I A;  5L3G A;  3KKY A;  1P7G A;  4MTF A;  2YXL A;  3KCY A;  2K1E A;  4DR2 O;  3JAS B;  5LMN B;  2JGU A;  2IH3 C;  4GKJ B;  4I9W A;  3FAV A;  2QWQ B;  2ZD9 A;  1XHZ A;  3E89 A;  3JAK A;  5LOV A;  3QVN A;  4UCV A;  5TIS Z;  2LO1 A;  1K8A W;  3CCR V;  3TXQ A;  5EYP A;  2HHH O;  1ZUQ A;  1BT8 A;  2LQT A;  1Q3E A;  1YJN V;  4PI2 A;  1DK1 A;  1Q7Y W;  2CAZ C;  4JV5 B;  2XT9 A;  5LL6 Y;  3E2E A;  3FKS G;  3W7T A;  2CTQ A;  3SYO A;  2ODM A;  4W4L A;  2FL4 A;  2IJI A;  2DN9 A;  1K92 A;  5KUK A;  2EIM B;  3SPJ A;  2NNU A;  1W2B U;  4DV7 B;  1F4N A;  3E8H A;  2Q9L A;  2ZIM A;  3J80 N;  1KBH A;  1K7D A;  1MMM A;  4I4T B;  3ABU A;  2HLD G;  1YIT V;  4XDL A;  2ARH A;  1AJP A;  1G1X B;  1IDS A;  2UU9 B;  3ZS8 C;  1WP8 A;  1T5E A;  1JA8 A;  1HR0 O;  2YSU B;  1FJG O;  2BOC C;  2DWD C;  1Q6U A;  1BCC H;  4DV2 B;  3FB6 C;  2FYU H;  2OCH A;  3ABL B;  1XMO B;  1VQ8 V;  3FAV B;  4J80 A;  2M6Y A;  2MW2 B;  4K0K B;  2LP7 A;  4X9Q A;  4R8C A;  4PA9 A;  3JAK B;  1XQ8 A;  5LOV B;  3GB7 C;  3OTO B;  4C7U A;  3BFR A;  4DR7 O;  5EYP B;  1M56 B;  2LFS A;  1NJI W;  3HPL C;  4MW3 A;  4B3T B;  4ASU G;  2DW4 A;  4DV3 B;  1ARO P;  1NZ6 A;  3OUS A;  4ZOL A;  5JVD A;  3CC4 V;  3CRQ A;  1AI4 A;  1AR4 A;  3I56 V;  1HNZ B;  3TGU H;  2YIB A;  1PNL A;  3L70 H;  3R66 A;  3CD6 V;  2YI9 A;  1I5Y A;  4F6R A;  4CC5 A;  2XAH A;  1FYJ A;  1XNQ O;  5IY5 C;  1NH2 B;  4DV6 O;  5BY1 A;  3VQX A;  4DR1 O;  1K33 A;  2N05 A;  1GMG A;  3RVZ A;  1ZTE A;  1XHX A;  5D5P A;  5EBL C;  4FLU A;  3UQ8 A;  1K3E A;  2EIL C;  1SF9 A;  4DYL A;  2CTW A;  4FLV A;  2XND G;  1G6U A;  1VQP V;  4LF7 O;  1VF7 A;  5KHK A;  2IJH A;  4WBN A;  5LXT A;  2V7Q G;  1QQC A;  5LMU B;  3FB5 C;  2QDO A;  4QIW F;  1Q81 W;  1PNM A;  4U7O A;  4UCU A;  5F2V O;  3TET A;  3MD0 A;  2F43 G;  4JAA A;  1VQ4 V;  4DV1 B;  2QJ1 A;  2CTR A;  4D7T A;  5LHI A;  3CB2 A;  4ZOL B;  5JVD B;  4X64 O;  3ASN C;  3JCZ A;  4X1K A;  1K5Q A;  1LR1 A;  4JYC A;  4DR3 B;  3G80 A;  3ZHQ A;  1DF5 A;  4LH7 A;  2Q68 A;  4O2A A;  4F6R B;  4EFE A;  5JJN B;  4LF9 B;  2XUM A;  4LFA B;  3K9S A;  4CC6 A;  2UXN A;  4B3M B;  3CJH A;  2E3C A;  4DO2 A;  4CS2 A;  5BR8 B;  5H6R A;  5B1A B;  2OIE A;  3BRC A;  3AK1 A;  1Z5W A;  3SJC C;  2QGN A;  3LDE A;  3HKE A;  3ZMT A;  4JI6 O;  4FLZ A;  1XMQ O;  3G6E V;  3QNE A;  3VOU A;  1GN3 A;  3BPZ A;  2GTA A;  4ZBM A;  1KB9 F;  5EBM C;  4WBN B;  5LXT B;  5IYC O;  5LHH A;  2B1G A;  1NI8 A;  5IYB O;  1ZAU A;  4CZZ A;  5EC1 C;  5JJJ B;  1IX9 A;  1WPX A;  2IU0 A;  1HNW O;  4B3S O;  4NVP A;  2JEU A;  5KHI A;  3GWO A;  3CCV V;  4HYO A;  1WNS A;  1Z2G A;  5H2F Z;  4UCS A;  1M57 C;  4X1K B;  2UXD B;  1BQ0 A;  4PA3 A;  3CS5 A;  1GAX A;  4X62 B;  5IY5 B;  3ZMU A;  3ZED A;  4GX2 A;  1EZV H;  4O2A B;  1E79 G;  2AZ2 A;  2Q4P A;  5LMN O;  2LGQ A;  3HR0 A;  1N32 B;  5BMV A;  5IYZ B;  4DV5 O;  1KEC A;  3CJH B;  4BIO A;  5LGU A;  5KUM A;  1NTM H;  2P6J A;  1DGS A;  1IVS A;  3ETE A;  2EIL B;  3TJT A;  1BQZ A;  1OV9 A;  1WJZ A;  3CPW U;  2AGA A;  5C8Y A;  3B77 A;  2Z5U A;  3HKE B;  4JI8 O;  1NT2 B;  3K04 A;  4JV5 O;  5K1X A;  3A0H Z;  1NVP D;  2A79 B;  3JSL A;  4LF6 B;  2KG7 A;  2X6A A;  4TQD A;  4FLX A;  1L0L H;  4XDJ A;  1E1R G;  1JFF A;  2CGN A;  1YTF D;  2JVD A;  1K4D C;  3RT3 C;  4KP4 A;  4LNU A;  3K5M A;  1O9G A;  5KAI Z;  3ETQ A;  3JD2 A;  3ASN B;  3CXH F;  2P7T C;  2B5U A;  1EM1 A;  2ZNJ A;  2P5O A;  4LC1 A;  5FPO A;  5B1B C;  2UU9 O;  1QR8 A;  1URF A;  5FLX N;  2K9P A;  4TUY A;  5DN6 G;  5E1A C;  2Q69 A;  4RO2 A;  3CCL V;  4CH6 A;  2Y0P A;  1AR1 B;  4NXN B;  4LCU C;  4DV2 O;  1N8R W;  1Y66 A;  3CP1 A;  2Q5Z A;  1EN6 A;  5BMV B;  2XAS A;  2UXC B;  1NBM G;  1YJ9 V;  1Y76 A;  4NYK A;  3ZRW A;  2F23 A;  3QG5 A;  2UUA O;  4K0K O;  4DR6 B;  1XNQ B;  2AHY A;  3IAY A;  4DRX A;  4Z2W A;  3OTO O;  4F4L A;  2Q6A A;  1XI1 A;  4X1I A;  5KA5 A;  5L3F A;  2HJF C;  1AI6 A;  3B40 A;  4TOI A;  5C8Y B;  1XL4 A;  1WA8 A;  1GO3 F;  4B3T O;  1Y67 A;  5DED A;  4DV3 O;  4YXW G;  1RPO A;  1TAE A;  4FK5 C;  4Z1V A;  2UXB O;  1IXM A;  2WLM A;  3JAR A;  4WF9 V;  2WLI B;  2KG7 B;  3LDC A;  4J41 A;  4G27 B;  1DTO A;  1HNZ O;  5J2U A;  4HBN A;  2DOS A;  4QPJ A;  1VF6 C;  1JFF B;  4CH5 A;  4JAU A;  3L72 H;  2R9R B;  4WFG A;  2PZS A;  3LUT B;  4N21 A;  1QNM A;  4LNU B;  1VQM V;  4MT8 A;  1L1F A;  4X65 O;  3N2K A;  2WAM A;  2UUB O;  4JI4 B;  1R3I C;  2W0X A;  2Q7E A;  2JS5 A;  3IGA C;  4YIO A;  2DJV A;  2IM9 A;  2QWN B;  4PA4 A;  2ZNI A;  1NKD A;  2JDI G;  1MG1 A;  2IH1 C;  2B9Z A;  1OJH A;  4IYI A;  1TUB A;  2JJ1 G;  4TUY B;  3THO A;  4NTX A;  1TUE B;  4UFZ A;  4AI8 A;  1OCR C;  3EHB B;  2F4V B;  4Q6G A;  2GSM B;  3CCJ V;  3JSN A;  1VQO V;  1Y76 B;  1OHH G;  3ZRW B;  3ZHS A;  5LMU O;  1B3Q A;  2XAF A;  3PJS K;  4DRX B;  4CS4 A;  1VQL V;  4X1I B;  1WN7 A;  4QNH B;  1SQF A;  2D2C B;  1WA8 B;  3G6B A;  3H01 A;  1PNK A;  3ZBH A;  1ZSP A;  5LA6 A;  1VF6 A;  4X1Y A;  5IDJ A;  3M99 B;  1D5N A;  3JAR B;  4FLY A;  2Y69 C;  4AIL C;  5J2U B;  1N36 B;  3CCU V;  4DR3 O;  1XMQ B;  1OCC C;  3FD9 A;  1IBL B;  4R6Z A;  2DMX A;  2CK3 G;  4NB5 A;  4LF9 O;  4LFA O;  3JYC A;  4MVZ A;  1SA0 A;  2QWO B;  3N2K B;  1SES A;  2V1D A;  2RMK B;  4FLW A;  3D36 C;  5B1B B;  4I0X A;  1I94 O;  4ICG A;  1H2L A;  4LF8 O;  2QTS A;  3AG2 C;  3SDL A;  2PI5 A;  2HP8 A;  1VQ7 V;  4HAM A;  5BR8 O;  3LDD A;  3RVY A;  3AG1 B;  4YIP A;  1HNW B;  1NR1 A;  4B3S B;  5LYJ B;  1AIL A;  2YID A;  1WLE A;  4J42 A;  1VF5 B;  1IBK B;  5IJ0 A;  4L87 A;  1U97 A;  2RQ6 A;  2F93 B;  5CBH A;  4LWS A;  2PYL A;  1OCO B;  3CEI A;  3OGI B;  2BOB C;  3M8A A;  3ZRV A;  1N34 B;  4DV5 B;  3CRR A;  1BZK A;  2GTS A;  3SR2 C;  2Y4U A;  4K35 A;  1SQX H;  3WG7 C;  1FKA O;  2EX3 A;  5LA6 B;  4X1Y B;  2UXD O;  4TT3 G;  3K9A A;  3ABK C;  4PI0 A;  4TQF A;  4JI8 B;  2A06 H;  4X62 O;  4PDR A;  1MSW D;  4CBC A;  4FVM A;  2A3Q A;  3D36 A;  1SQQ H;  4Z1M G;  1L0N H;  1NVP B;  3A8T A;  3ZRS A;  1SA0 B;  4JPR A;  4K3A A;  1N32 O;  3F7Y C;  3ETD A;  4I0X B;  3SPG A;  4BIZ A;  4ZI7 A;  1H8H G;  3W7S A;  1YTF B;  2RN9 A;  5KAF Z;  1XOU A;  3O65 A;  1GN2 A;  3F7V C;  4O4J A;  1OCR B;  1JQ0 A;  3CXC U;  4O4L A;  4PD4 F;  1DLB A;  2KB1 A;  2V4D A;  1QBZ A;  4I5S A;  4TSF G;  5K1P A;  5B5E Z;  5L3B A;  4EKW A;  4X88 A;  1VQN V;  5IJ0 B;  5C93 A;  1RM1 C;  4DR4 B;  1V55 C;  3D3I A;  4O4I A;  3ML0 A;  3ZJZ A;  4LF6 O;  4LWS B;  1CXZ B;  2HKO A;  2QKC A;  3W7W A;  3OR6 C;  4PA6 A;  2N74 A;  1JX9 A;  2LGW A;  4JTD B;  3U10 A;  3G71 V;  4JI2 B;  4PDL A;  2WPD G;  2GUZ A;  3IC7 A;  3MAQ A;  4GKK B;  2JJ2 G;  1AP6 A;  2Q7G A;  5EC2 C;  3RFR A;  4LF5 B;  2UUA B;  1FXV A;  2W6J G;  1ZX3 A;  5FL7 G;  3AEI A;  1I5X A;  2Y69 B;  2ADP A;  1GN6 A;  1I7F A;  4B08 A;  1OCC B;  1O9H A;  4P9P A;  3OMN B;  4GX0 A;  1XIL A;  2QKS A;  2UXB B;  4GYC B;  1VMG A;  2ZE8 A;  3ZMZ A;  2Q0O C;  1THZ A;  4NXN O;  3AG2 B;  1S0V A;  2DQ0 A;  1PL0 A;  2UXC O;  2YC0 A;  4ZI7 B;  4KL1 A;  4DUY B;  2ADQ B;  2LJ2 A;  4DR6 O;  4UB6 Z;  4X65 B;  4K8Z A;  2DYS C;  3MHS C;  5IYD O;  2AW9 A;  2UUB B;  5D5Q A;  2UUC B;  4H0L B;  2P4V A;  1GH6 A;  1KP3 A;  3QO5 A;  4PHZ A;  3UCS C;  4YJ2 A;  2OIG A;  1ZLZ A;  4JAV A;  2LW1 A;  5EK0 A;  1J5E B;  4O4I B;  4BR6 A;  1XNR B;  3E8G A;  1OZ0 A;  2OTJ V;  3U0Z A;  4G2K A;  3AG3 C;  1AVM A;  3CMA V;  4KUM A;  1JJ2 U;  4X66 B;  4J7K A;  4UCO A;  2GUZ B;  1WB8 A;  3B2E E;  3WG7 B;  1HW7 A;  2Q0A A;  3HKD A;  3A0R A;  1YXB A;  4RQF A;  1WB7 A;  3ABK B;  2MK3 A;  2HVJ C;  4LFB B;  4JI4 O;  5FPR A;  3ZHR A;  4UVB A;  2Y0I A;  3AG7 A;  5B3S C;  4WFF A;  1H38 A;  2WLL A;  1X4T A;  3EXA A;  3FB7 C;  3RGB A;  2QM8 A;  2GDS A;  3S3X A;  4GX1 A;  2F4V O;  1MSD A;  1Q43 A;  2H94 A;  2ZE7 A;  3CRA A;  3DSQ A;  3C90 A;  4PA7 A;  1I94 B;  1Y4M A;  1SZX A;  2RDC A;  4LF8 B;  3CYO A;  1V55 B;  5IE9 A;  2WWW A;  1L8D A;  2ZR2 A;  2QWR B;  4YJ2 B;  4JI3 B;  3K79 A;  2LFR A;  3PN1 A;  1GM7 A;  2R72 A;  4OPA A;  1PP9 H;  1X59 A;  1GN4 A;  1W0J G;  2XAJ A;  4FIP C;  1Q86 W;  3W7X A;  4MSW C;  1H2G A;  4NKG B;  4TV8 A;  3LSU A;  2YIA A;  1N36 O;  2O57 A;  3N27 A;  1IBL O;  1P84 F;  1H2N A;  1ENV A;  1JJO A;  2ZXW C;  3AK3 A;  3HKD B;  4JI5 B;  3VQV A;  5KHG A;  1JR9 A;  3K59 A;  2BTO A;  2YIC A;  2EJ7 A;  1WPB A;  1PV0 A;  2P4K A;  1AR5 A;  4EFB A;  4WFH A;  4LBE C;  1LUV A;  4WFE A;  3KCX A;  3AG4 C;  4RUE A;  2AZ0 A;  5JQG A;  3CX5 F;  4HZ3 A;  4E2L A;  2WLL B;  1XRE A;  1Z5V A;  5LP6 C;  1PD3 A;  4ZIB A;  4FM2 A;  1IBK O;  3BA9 A;  3JAT A;  4X8A A;  4MVS A;  3OW2 U;  3H1K H;  2ZCE A;  2YI8 A;  2GBO A;  4YJ3 A;  2DYS B;  1S3J A;  1Y74 A;  4MVU A;  1Q6I A;  4KFM A;  1LUW A;  4ABM A;  2XHB A;  4B3R O;  2FML A;  4I55 A;  2EZP A;  4FZ0 A;  4NXM B;  1N34 O;  4J9Z B;  4JZ2 A;  4LP8 A;  4PDM A;  1CPY A;  3K0D A;  2JS3 A;  4BIU A;  1W0K G;  4JI0 B;  3EFF K;  4QE7 A;  4FZ1 A;  3NXS A;  3ZN1 A;  2P90 A;  3AG3 B;  3UM7 A;  4BWA A;  2PGG A;  3ZHV A;  2IJJ A;  3SPC A;  4TV8 B;  4FFK A;  1R6T A;  3FB8 C;  2PI4 A;  4OPH A;  1FS0 G;  1WP7 A;  5CBG A;  1Q90 D;  3T4Z A;  1AJQ A;  3VQW A;  3J7A U;  3ZRX A;  4TV9 A;  3T1C A;  2QM4 A;  3JCU Z;  4J9Y B;  5B3S B;  3E22 A;  2L6L A;  1Q8I A;  5LP6 A;  1AB3 A;  5B66 Z;  1GRJ A;  5JCO C;  3WU2 Z;  1BHA A;  2JRI A;  5JQG B;  1V54 C;  1I08 A;  1F23 A;  1VEW A;  1VIB A;  3CCS V;  3JAT B;  1S5H C;  4DR4 O;  3TCU A;  2BSK A;  5LHG A;  1GKF A;  4YY3 B;  5DEC A;  1YI2 V;  3CRC A;  3T1Y B;  2EBO A;  4YJ3 B;  5H6Q A;  5KMG A;  2RNB A;  1Y74 B;  1Q5O A;  2DQ3 A;  1JOY A;  4R50 A;  4KHP O;  4JI2 O;  3BHP A;  5CBF A;  4I55 B;  4GKK O;  2HG5 C;  3L9D A;  4QJF B;  4WCE V;  4D7S A;  1YIJ V;  4LF5 O;  4A5U B;  2EJR A;  4U3F H;  4P9O A;  3TK1 A;  2KSD A;  5GON A;  1YVW A;  1RFY A;  3B8N A;  1YSC A;  1XL6 A;  1BS3 A;  2ZXW B;  2HVK C;  4J7Z A;  2WA3 A;  5KA6 A;  1H2K A;  1R73 A;  1RP3 B;  1VAR A;  3QO8 A;  2VQF O;  2PYJ A;  4TWK A;  3ICX A;  4TV9 B;  4KXR A;  3ZCC A;  3H1L H;  4JYY A;  4GT1 A;  2OT5 A;  2ZE5 A;  1OCZ C;  3CWB H;  5JCO A;  2YDE A;  3E22 B;  1R3L C;  1VQ9 V;  3AG4 B;  4DUY O;  2A7W A;  2OCC C;  2Q7H A;  3Q4H A;  3HKC A;  1N0J A;  1TVK A;  1M57 B;  3K0G A;  3APO A;  4P30 A;  4NTW A;  4PV1 B;  2UUC O;  5CA1 A;  2DE0 X;  3OD4 A;  3K5L A;  2ETN A;  3C3S A;  1UPG A;  2YEV A;  2ILM A;  2IJK A;  4GLX A;  1J5E O;  3H1I H;  1JVM A;  3BEH A;  3G67 A;  5JJE B;  1XNR O;  3AK2 A;  2VRZ A;  1K9M W;  2E5L B;  4IIJ A;  4UXN A;  3H1J H;  5KMG B;  2EUL A;  5HFM A;  5IWA B;  4X66 O;  1ORQ C;  3QTC A;  2QSA A;  1QHT A;  3P30 A;  1JPX A;  4RWU A;  1H2S B;  1VQ6 V;  2CTP A;  4H33 A;  3IFX A;  3JAM N;  2AXT Z;  3JD1 A;  4QE9 A;  4UV9 A;  3EVK A;  1R1B A;  4LFB O;  3APQ A;  2R70 A;  3RW0 A;  5GON B;  3VBB A;  4DXW A;  1IBM B;  1EBO A;  1NQT A;  3OUF A;  3GVM A;  4DV4 B;  3ETG A;  3KG2 A;  3SYP A;  1XUQ A;  3OEE G;  5KLV H;  3SGI A;  1MZF A;  3OTF A;  3E83 A;  3H9V A;  3M7M X;  2VWK A;  5A2Q N;  2A0L A;  2PF4 E;  3DC5 A;  4FFB A;  1V54 B;  5HFL A;  3Q4H B;  1EN4 A;  3HKC B;  3MDS A;  1K73 W;  3LNN A;  1KP2 A;  3ZMS A;  5B1N A;  5LBQ A;  3FYI B;  2WLK A;  2YIB D;  4JZG A;  2ATK C;  5CA1 B;  1AI7 A;  4AQY B;  5BZB A;  2YEV B;  4JI3 O;  1PKX A;  4OXS A;  2JEX A;  2JGD A;  3P3P A;  1KD1 W;  2ZE6 A;  4DV0 B;  5L3D A;  3T1H B;  2L35 A;  4XDK A;  1TUB B;  3L73 H;  2R9A A;  4IIJ B;  4UV8 A;  4DK0 A;  3HKB A;  5EIB D;  2X6C A;  4IHJ A;  5CA3 A;  3ASO C;  1F51 A;  4J10 A;  4FMT A;  4JI5 O;  3RN4 A;  4B3R B;  1QCE A;  5BXZ A;  1XBL A;  1JCH A;  5CMU A;  5IT9 N;  1JMK C;  3RYF A;  5EZY A;  2ZIO A;  4B7K A;  3K5N A;  1S72 V;  2ZQM A;  2A9H A;  1NU1 H;  4JYA B;  2F66 C;  1OCZ B;  1XEQ A;  4GZR B;  2OCC B;  2ZM6 B;  4FJC C;  1D2D A;  1P49 A;  4I7Z B;  4EB6 A;  3ZIA G;  4FFB B;  1QU7 A;  3UKM A;  2KKW A;  2QKA A;  2QTO A;  3K3W A;  3BY6 A;  2JK5 C;  3ZN0 A;  4NXM O;  1MAB G;  1KKC A;  3CCQ V;  5GTH Z;  3DC6 A;  2ITD C;  1YHQ V;  4JI0 O;  5GTI Z;  1SQB H;  1FFT B;  2EIN C;  3L71 H;  1U96 A;  2JGD B;  1FAF A;  3HKB B;  4RAI A;  3IJ4 A;  2CUG A;  3IC9 A;  1QLN A;  3E86 A;  3P3N A;  4IHJ B;  2XAQ A;  2P06 A;  3MHH C;  3E35 A;  1QVG U;  4K8X A;  3JAL A;  2YXH A;  1FXK C;  1NTZ H;  2NR5 A;  1G8M A;  1PPJ H;  1QLE C;  1KMI Z;  4KHP B;  1UJW B;  1K5S A;  2IW5 A;  3RYF B;  1KC8 W;  5EZY B;  1US6 A;  2QM7 A;  1CEZ A;  2RCV A;  2DYR C;  2WLN A;  3B4S A;  1G4Y B;  1SS3 A;  5EIB C;  3ABT A;  2DWE C;  3SYQ A;  2B1I A;  3TXS A;  4JF3 A;  2QE7 G;  1V9P A;  4JYB A;  5B1A C;  3FYE B;  1FXH A;  3D8C A;  4N23 A;  1SET A;  1MNG A;  3SJQ C;  3R65 A;  4UCR A;  3U11 A;  5IJ9 A;  2EIJ C;  2IBZ H;  1BE3 H;  4YY3 O;  4UVC A;  2D3O W;  4JTC B;  2QR4 A;  3T1Y O;  4LFC B;  1IUR A;  4EB6 B;  4IT5 A;  2VQF B;  1SRY A;  3K5O A;  4JGS A;  1BSM A;  1NS1 A;  2JIZ G;  4QPK A;  4O4H A;  3T2M A;  1N4C A;  1FPO A;  1RPR A;  1IZ3 A;  4GX5 A;  1COW G;  2XOK G;  5JWP A;  1GM9 A;  1YF2 A;  4BW9 A;  3CC2 V;  4BAY A;  2P67 A;  3E8F A;  5J9P C;  4O4J B;  3L74 H;  1P4R A;  4O4L B;  2PTM A;  4DW1 A;  3ASO B;  3BAB A;  3CME V;  3RYC A;  1FXK A;  4FPP A;  4MTX A;  2GHY A;  4DR5 O;  1H8E G;  1SQG A;  3JAL B;  3QF7 A;  1HNX B;  3RWR D;  4ZHQ A;  3BVO A;  2PUS A;  2HFE C;  1NTK H;  2VQE B;  4OGQ B;  2FTK A;  3SJA C;  4DK1 A;  1VQ5 V;  1KYO F;  1B6Q A;  1ZWI C;  2NLJ C;  3CSX A;  5L3E A;  4DUZ B;  4I50 A;  2FB5 A;  3OAA G;  4U7N A;  4YHH O;  5IJ9 B;  4EEQ A;  1IXB A;  3ZMV A;  5CA0 A;  5CN0 A;  3STZ C;  2E5L O;  3X2Q C;  2VS0 A;  5H9C A;  2Q67 A;  2EZO A;  2YXY A;  5IWA O;  1AJN A;  4O4H B;  4UCT A;  3WB0 A;  1YZB A;  3GWK C;  2EIN B;  2X0L A;  3A2F A;  1BL8 A;  4HNA A;  1XDC A;  2QWP B;  4NR1 A;  3CHX A;  1S76 D;  3JAW A;  1VQK V;  1RM1 B;  1MA1 A;  1IBM O;  3CE2 A;  1M9N A;  2Q73 A;  1BMF G;  4DV4 O;  2OWO A;  3D3Q A;  1H2M A;  3RYC B;  3A0B Z;  3B8M A;  3OE7 G;  4JI1 B;  5GW7 A;  4PEL A;  1FXK B;  1QLE B;  4JI7 B;  1EFR G;  1MZE A;  2YS8 A;  4UB8 Z;  1AI5 A;  5IYZ A;  1J95 A;  2DYR B;  3DGE A;  4ZHQ B;  4DW0 A;  4UUJ C;  2CGO A;  5KHH A;  1SER A;  1DF4 A;  3I55 V;  1YJW V;  1KKD A;  2EIJ B;  5LGT A;  4I50 B;  4OX9 B;  4JTA B;  3VQY A;  4AQY O;  2ZR3 A;  2E75 B;  3FX7 A;  2C2A A;  1N33 B;  5KX5 A;  1R6K A;  3FFQ A;  4Q20 A;  4DV0 O;  3T1H O;  5CA0 B;  4F6E A;  4DR2 B;  3OEH G;  4GCZ A;  4P2Z A;  5A9G A;  4R7C A;  1M4U A;  1GK9 A;  2BE3 A;  3JD4 A;  1Q82 W;  2HJD A;  3F5W C;  3OR7 C;  3WB1 A;  5B1O A;  4L8J A;  1I0H A;  1SKV A;  2WLJ A;  4HNA B;  2ZKO A;  2XAG A;  4LF4 O;  1S5J A;  4MVQ A;  3BA8 A;  1S5L Z;  3P32 A;  2HHH B;  3N2G A;  4NTY A;  2AHZ A;  3JAW B;  4WFA V;  3SYC A;  5JH7 A;  3SJB C;  3SPI A;  4J7J A;  4RQE A;  3DXR A;  4U3J A;  4PJ0 Z;  2Y48 A;  1HDJ A;  4JYA O;  3OMA B;  1QVF U;  1PL4 A;  3STL C;  4B7E A;  1TGO A;  1WAZ A;  1YCI A;  4FM0 A;  2PY5 A;  4GKJ O;  2ZM6 O;  3I5D A;  4JAS A;  3ZHT A;  2ZDI C;  4G28 B;  5H5N A;  4MVM A;  3CCM V;  3KZI Z;  5LGN A;  1MOF A;  1ROP A;  3BAA A;  4CH3 A;  3K08 A;  2E74 B;  4CH4 A;  3CC7 V;  2HEP A;  4IYH A;  2OYQ A;  1Q6H A;  3E8B A;  3X2Q B;  1KQS U;  1HR0 B; 
#chains in the Genus database with same CATH homology
 4X64 O;  4DV5 O;  4DV3 O;  4JI2 O;  1N33 O;  2UXB O;  4GKK O;  1I94 O;  4NXM O;  2VQE O;  4LF8 O;  1IBK O;  4DR7 O;  4LF5 O;  3SDL A;  4A5U B;  4DR2 O;  1HNZ O;  4LF6 O;  2DOS A;  5BR8 O;  4JI4 O;  4JI0 O;  2N74 A;  4DV7 O;  1AIL A;  4DR5 O;  2AGA A;  5A2Q N;  4AQY O;  4B3R O;  4JI8 O;  4DUZ O;  4X65 O;  4JV5 O;  1N34 O;  4DV0 O;  3T1H O;  2F4V O;  2UUB O;  3R66 A;  2VQF O;  2HHH O;  2DJV A;  1DK1 A;  1FYJ A;  2FKX A;  4JI3 O;  1XNQ O;  3RT3 C;  4DV6 O;  5BY1 A;  4JI6 O;  3M8A A;  5LL6 Y;  1XMQ O;  4DUY O;  4DR1 O;  2ZKO A;  4YHH O;  4LF4 O;  1R6T A;  4DV1 O;  4OPH A;  2Z0A A;  2E5L O;  1XMO O;  4NXN O;  2UUC O;  4LFC O;  1FKA O;  5IWA O;  3J7A U;  2UU9 O;  2UXC O;  3J81 N;  1YZB A;  5LMU O;  2UXD O;  4OPA A;  1A32 A;  1X59 A;  4JI5 O;  5FLX N;  1J5E O;  3J80 N;  5BXZ A;  4X62 O;  4DR6 O;  4JYA O;  4JI1 O;  5IT9 N;  1XNR O;  1HNW O;  1N36 O;  4JI7 O;  4B3S O;  4YY3 O;  4DV2 O;  1AB3 A;  1IBL O;  3T1Y O;  4LF7 O;  4GKJ O;  1G1X B;  2ZM6 O;  1KUQ A;  2JRI A;  4X66 O;  1NS1 A;  4B3M O;  5H5N A;  1IBM O;  3F5T A;  1N32 O;  1HR0 O;  4DV4 O;  2UUA O;  4K0K O;  1FJG O;  4DR4 O;  3JAM N;  4DR3 O;  3OTO O;  3O65 A;  1XEQ A;  5LMN O;  1R1B A;  4LFB O;  4LF9 O;  2LW7 A;  1D2D A;  4B3T O;  4LFA O;  4OX9 O;  1F7Y A;  4KHP O;  1HNX O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...