2ZM6T

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
94
structure length
94
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 29
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2zm6T00
2ZM6T 4DV0T 4DV1T 4DV5T 2UUAT 1HNXT 4JI4T 4JI7T 4X62T 4DR3T 4DR2T 1FJGT 2UUCT 1N36T 1J5ET 4DV3T 4LF4T 4DV7T 4LFCT 2UXBT 1N33T 4LF7T 4X66T 4X65T 1HNZT 4B3TT 4LFAT 4JV5T 2VQET 2UXCT 4JI6T 4JI2T 3T1HT 1XMQT 4NXMT 2UUBT 2UXDT 4DUYT 4YY3T 1IBKT 4DR1T 4JI1T 1HNWT 4GKJT 5LMNT 4LF8T 4YHHT 4JI3T 1XNRT 4K0KT 4NXNT 4DR4T 1XNQT 4LF5T 1IBLT 4LFBT 4AQYT 4LF9T 1IBMT 4JI5T 5LMUT 4DV4T 4JI0T 4DUZT 4DR5T 4KHPT 4B3ST 3OTOT 2E5LT 1I94T 4X64T 1N32T 5BR8T 4B3RT 1HR0T 2VQFT 4GKKT 2HHHT 4JI8T 4OX9T 1XMOT 2UU9T 3T1YT 4B3MT 4DV6T 4DR7T 2F4VT 4DR6T 4JYAT 4LF6T 5IWAT 1N34T 4DV2T
chains in the Genus database with same CATH superfamily
2LSYA 1E1HB 2CHOA 4GK5E 4O2AE 3ZMUB 2A2FX 5DJQC 4MBQA 3P8CD 4AQFC 4HFDA 2HH7A 3RH3A 4EAHA 4PNIA 5L4EA 4IGUA 2LJLA 4ISSA 2Q9QA 3RPUA 3RYIE 2BBJA 2J1DG 3LBXA 3UU8A 3AA7B 4HFVA 3KBUA 1VRBA 4DIDB 2FBWA 2FJEA 3LBXB 2BVLA 2JMHA 2ZM0A 3P4SA 4HFEA 4YHJA 5HWXA 4E7ZA 4HGAA 1HX8A 5AQQB 3CMLA 3E08A 5AQPB 4X62T 5FY1A 1WCRA 4CI1B 4YLHA 4DR2T 3AE6A 1KEYA 3RYHE 2WWUA 1XDOA 1N36T 1J5ET 1JNZA 2FUPA 2W63A 4CQIA 4LF4T 4QH4A 2WY2A 3EVYA 1ZHCA 2JIWA 4DV7T 2XJ7A 2LKGA 4UV9B 2Y8DA 4XBFB 3X1DA 4KBMB 4NUUA 3CX6B 1EZ3A 3HKCE 3ONXA 4PK5A 5JDFA 4ZI2D 4V1Av 2FJBA 1D0XA 3MKDA 5AQFB 1B7TA 2WP9A 4UV8B 5FY0A 4TUYE 2CBIA 4OYJA 3AE7A 4P09A 4A56A 4A5XA 2CM0A 3PUVF 5LHHB 1HNZT 2MOZA 3HI2A 3C98B 5ABEA 2ACXA 4PJNA 5FVLA 5JVDE 3D0TA 1YW0A 3I0OA 3KVAA 3FZKB 4ILCA 3TLUA 4JV5T 2DWGA 3AE2A 2YU2A 4IDPA 4Z91A 3H3AA 4HFBA 3TLVA 3R84B 3AAAB 3VR8A 4P0BA 5L47A 2KWHA 1CHUA 1MMAA 3RIAA 4JUYA 4AKRB 3LSVA 2JPFA 4DMVA 2XAHB 2XTLA 5ABFA 3UTKA 3T1HT 4EYUA 4O2BE 3VRAA 1YQ4A 4WNKA 2H89A 5F5WA 3RRCA 4JBWF 1ZP0A 5LGUB 1XMQT 2BDEA 1NENA 2GK9A 4ILUA 3DJBA 3AE4A 3AA0B 3JC6D 4YJ3E 3UU4A 1VCSA 5LCYA 2XAQB 2M6IA 3I9YA 1I6ZA 1IJ5A 5KXJA 4YY3T 2X67A 3QK6A 4UVCB 4QXCB 3ZYLA 2CPTA 3Q5XA 5AQRB 1IBKT 1HNWT 2N1GA 5HEOA 1D0YA 3ABVA 2VK9A 4IE4A 2A9UA 3ZLIA 4GKJT 3Q5EA 5LMNT 4JI3T 4AIUA 4K0KT 4EZ4A 3KV4A 2NW7A 2W61A 3UQ7A 2VKHA 4NXNT 3HKBE 1XNQT 1IBLT 1SHZC 2QGSA 2XAFB 3C51A 2E9XA 3CK6A 4Q25A 3UFGA 2KSRA 2YDRA 4UVAB 3F2EA 3UUMA 2MPKA 3ZYKA 1T7SA 3GN5A 4KMCA 3CWZB 1J1JA 4HWFA 1DU2A 5EK4A 3AVRA 4X5TA 3UU5A 4HEAA 5H6QB 3ZN0B 4JI0T 3ZT6A 3IEEA 3KBTA 4L9IA 3B5MA 2V26A 1OWAA 2ZLYA 2J4GA 1AJ3A 3KV6A 3RIUC 2JJ9A 2QA7A 5ABGA 3FZLB 3NWIA 2WU5A 3PV0F 2XM2A 4X1KE 3BK9A 5HEUA 2W66A 5JR9C 3ZC1A 4ASKA 2XZEA 4KUMB 4HWHA 5BR8T 1KNPA 4YTNA 1UX5A 2ZMAA 2HN1A 5C3JA 5FL1A 4ANJA 2VQFT 1HR0T 1IJ6A 1W9RA 2LLYA 2WQYA 1XMOT 1KNRA 4JEHB 5L3GB 3JADA 4B3MT 1E7PA 1SA0E 2LT3A 2IHR1 2PBIA 2BG9B 3HKDE 4DV6T 1LVKA 5IHYA 1XWMA 2PG8A 5IWAT 4J2CA 1Y01A 1ZV4X 2DI4A 3FB2A 4IIJE 3AA6B 3PTRB 3VR9A 5AFUL 3AEEA 4TX5A 3L3PA 1MNEA 3AAIA 1HX1B 3EAMA 3Q5DA 2ODUA 4DVDA 4DBQA 2E5VA 2XQ5A 2UXXB 2P9BA 3P4WA 5E0OA 2UXNB 5J2TE 2ZM6T 4O4JE 1N34T 4TZ4C 3CX7B 2Q9QB 2V6XA 5LBQB 3AVSA 2UUAT 5HAXA 5KX5E 4H9RC 1HNXT 4AKHA 3N9NA 2EHOD 1D1CA 2LSJA 3MXZA 3L39A 5FVKA 2DNXA 2IIUA 2WAUA 3A5XA 3ETUA 4IE5A 4ILBA 4JEUB 4B6XA 4EYYR 1QUUA 3FZFB 2I6HA 2WDVA 5LXTE 1CUNA 2CEAA 2LRKA 3A8YC 3IA3A 4X20E 4TV9E 5FP3A 2HN2A 5LHGB 4Z90A 4FJOA 2G0UA 5CFBA 5LGNB 4JI7T 2XHEB 3JCFA 3N2OA 3NKZA 3ONLC 2KT9A 4ZI3C 3RLFF 3PUSA 4X1IE 1FJGT 4TNWA 3N9LA 5L2LA 5CJ5A 5JREA 1G8XA 4TN7B 2RA1A 3AE1A 4PAGA 4F8HA 1HFAA 1N33T 3AEGA 4LF7T 1M62A 3O1IA 2XM1A 3CKDA 2K24A 4H9NC 3S4UA 4ZHQE 3ZEFB 2E9XC 3RX6A 2H7OA 2LE8A 2V7IA 4M1PA 5AQMB 5HEGA 3L8RA 2V7MA 4DBRA 5ADXL 1U5PA 4O4LE 3E0ZA 5AQJB 4COFA 1HF8A 3Q9DA 3RC3A 2CRBA 3EDUA 3ZYMA 1D1BA 2XQ6A 2H3RA 4I4TE 1U4QA 3ZJ2A 5CGMA 3ZT5A 2VQET 2YK0A 4QHOA 3AEFA 3B13A 2UXCT 4XAXB 2NWBA 2V1DB 5EZYE 1BR2A 3RIUA 1NWMX 3AE3A 1MIVA 4BJMA 1W0BA 5F8PA 4P0AA 2DWKA 4JI6T 2WBLA 3PUXF 3GA8A 2XQ4A 3QOFA 4UXNB 1S35A 3V5SA 3UFEA 1W0AA 4IE6A 1QSDA 2D0UA 2LSKA 3I9WA 3QNUA 4HFCA 5LOVE 1BR1A 3MK7C 5M4YA 1US7B 2M67A 2YDQA 3VKHA 1T98A 4IL4A 5LB7B 4Z8XA 2KMFA 3HL6A 3K3QC 3N9OA 5LYJE 2K3WA 3OJAA 3ZN1B 1HG2A 3ANWA 4CI2B 2XQ8A 5JDGA 5JDHA 2UXDT 5LBMA 4G63A 4PFPA 2LSIA 3M3ZB 3N2KE 2MYSA 2YU1A 1IZNB 2ODVA 3ANWB 3ESLA 4LMKA 3SRZA 2JQKA 4PFOA 2LM2A 4IE0A 4WZXA 3F31A 4C90A 4KP3C 1FIOA 2CA5A 3TLTA 4YHHT 3OPCA 3M65A 4BAYB 4DR4T 3P50A 1FMVA 1X79A 2EHOA 5AQNB 1OEDE 4L0RA 2BS4A 3RKOA 3I0QA 4PK6A 4AQYT 4LFBT 3ONJA 4F6RC 4CN1A 3VHLA 5BMVE 2D0TA 2MBGA 5L3BB 1OEDC 2KWIB 4U33A 1XZYA 2X0YA 3PU8A 3UUXB 4DR5T 4C91A 3MA9A 4AKGA 4GYRA 4H9PC 4MHCA 2CXDA 2VWAA 3F57A 4GYSA 4U2YA 4YSYA 3RQUA 2AE9A 4KI0F 4QX8B 4HKAA 4EIWA 2WWVA 2IMLA 2C0SA 5LHIB 2KZ7B 1I94T 2X0LB 2XY8B 4YTMA 2BKPA 2WDQA 3NRXA 4YJ2E 2KNDA 4MLKA 4B3RT 3PE0A 1MMNA 2B1EA 2X9YA 2V8SV 1BR4A 1HCIA 3AA1B 3CQGB 3FZHB 2X51A 2CLYB 4OYKA 4U3CA 4OX9T 1LKXA 4I50E 2IUBA 3R6NA 3JAFA 4IDNA 4AQFA 2N9DA 2B76A 4EEBA 4ZI7E 2XSBA 3KDSE 4PJJA 5J0ZA 2YOEA 4XZCA 3UT5E 2F4VT 4JYAT 2Q9QC 1T72A 2FJAA 4O4IE 3JC6C 2XQ9A 2I59A 3PUAA 4IHJE 4ERRA 3J9X1 2LOPA 4LF6T 1L0VA 5L4HA 3AEBA 1X9BA 2C5JA 1VCTA 2KXPB 3AE9A 4DV0T 3CPZA 3U78A 1UGOA 4DV1T 4DV5T 5L3CB 3FHNA 3ZMTB 3FXDB 2X0HA 2E9XB 3NZQA 4H63H 1XDPA 2WZHA 3LJCA 2WCAA 3PUZF 4LMJA 4EOZB 4IT4A 5FY7A 2DHRA 2JQ9A 4YSZA 3CVRA 3K3OA 1GQEA 5CB4E 5FXVA 2XQAA 5JH7E 5JR9B 2CE7A 3FBZA 5FYMA 4JI4T 4AI6A 3A7MA 2W62A 3UUBA 5LNKA 2VB6A 1NEKA 1IAPA 2UUCT 2WMNA 5AQKB 3B57A 3O4XE 4LFCT 3L09A 3OKQA 2UXBT 4ZI2C 1YKEB 3LFMA 4QXHB 3EDVA 1NAFA 5J1GA 4MFRA 2VVNA 2CWYA 2DL1A 4EXTA 2X68A 2ES0A 5HWYA 5HYAA 3P4QA 4OK0A 5FXZA 5HCJA 4CXXA 3RHWA 5JRCA 3UULA 4O8SA 3UUNA 1OEDA 2MAWA 2CXLA 4H9QC 2E8IA 4PJMA 4WBNE 4B3TT 2WM9A 4LFAT 5JRCB 1WYBA 2V5CA 3KV9A 2IDOB 3G06A 2AXDS 3ZT7A 2W2UA 2ZM2A 2CCQA 1MIYA 2BVMA 2V7LA 4U7IA 2VURA 4ILAA 4UF0B 1UX4A 2Y6XA 4N78D 1KK7A 1T8BA 1BR0A 5HXRA 1SUMB 4QH1A 2YKSA 5AQVB 4AISA 2SPCA 4O4HE 1FMWA 3AXJA 3KINB 3LDQB 3OYZA 3PJAJ 4CN4A 2KLQA 3SWHA 2FJDA 3NRYA 1WR6A 4NXMT 2LHRA 2LSGA 4I0UA 3K1SA 4HWCA 5KMGP 4DUYT 2WZIA 4EV6A 4UELA 3PU3A 2IAKA 2PFVA 2RP4A 2K48A 2XAGB 4HFHA 5LJMA 4DR1T 3O1HA 5H6RB 4H63V 4CXWA 2BS2A 3PURA 4CN6A 1Z8UA 2BG9C 2BKOA 3KFWX 5AQLB 5A1LA 1WLXA 3C50A 5FMNA 3UQ4A 3MJXA 3E22E 3N9QA 4H9SE 4LF5T 3ZSSA 4CI3B 3SOLA 4DO0A 3AEDA 4QWNB 2H7VC 3VKGA 2WS3A 4ZZCA 4U31A 1HS7A 4KHZF 2NW8A 4JLEA 4LF9T 2EHOB 1UUSA 1IBMT 3BQIA 3GMIA 2PTFA 2JQHA 1HG5A 3K8PC 3LK3B 2BG9A 4HFIA 4WBOA 2XQ3A 4NUVA 5AQHB 4EB6E 4TNVA 5LMUT 2IC6A 2L3LA 4IREA 4UEMA 1WR0A 4IDZA 4DUZT 3CQXC 3EUHA 4FI5A 3H37A 4GK0E 3OTOT 4G2AA 2K5BB 5FKYA 2V6YB 4A98A 4PJLA 5C8YE 2HHHT 2HPLA 4UIGA 1JNRA 4YT0A 2E5LT 3GWHA 2R6GF 3KVBA 4U7YA 4KX6A 3ZKRA 4TWFA 1MMGA 4X64T 1N32T 2A72A 5FXXA 4EEDA 1FEWA 2JRKA 2NR4A 2PJQA 2XUEA 2WU2A 4YSXA 3QUJA 1VOMA 4IDQA 3QC9A 2X9WA 5TAOA 2CXFA 2ZM8A 3ZCJA 3NBXX 3ZPOA 4ADZA 2XPKA 1E2AA 2W0GA 3C64A 3PUGA 3WAJA 2UU9T 2NOXA 2J47A 4QXBB 3LK2B 4DR7T 5JDMA 2LOSA 5IYZE 2L9QA 5F3JA 1HTJF 4H9OC 2IC9A 4UVBB 5JR9A 1H7CA 2BZBA 2LHNA 2VL0A 3IHRA 2A3DA 4DV4T 3EHZA 4MALA 5L3DB 2NTXA 2LKHA 1M7KA 2DLRA 2JMKA 3WI3A 3RGLA 4DMWA 2EHOC 4DV2T 3PJAA 2YINA 5JDQA 2D2SA 2QYWA 3I1AA 4IE7A 1Z0PA 4UR9A 2HPJA 4ZOLE 3RI5A 3P4RA 5JDNA 3PDYA 3RRWA 2MTQA 1OXZA 3DTOA 2V5DA 1WYCA 3PUQA 3GN5B 4I55E 3N9MA 1YD8G 2ACZA 2WMOA 2LEHA 5FXWA 5CA0E 1O3XA 2BS3A 3AE8A 1KNZA 3AXJB 5HEJA 4NPPA 3ZCIA 2K9AA 4IL9A 2VKJA 2E2AA 3BQLA 4HN9A 1YQ3A 2H88A 3P7IA 3HA4A 3T8OA 2YDSA 3O9XA 2CMRA 4A97A 4DR3T 4AKIA 2VKOA 2L8KA 4GIWA 2RPAA 3LK42 1UCUA 2N2NA 3FZMB 5EK3A 4DV3T 5AQSB 3C4WA 2C5KT 2NTYA 2E9XD 1MMDA 4HE8A 1W09A 4QH5A 3RQWA 3TLSA 3W15B 2CWOA 4AXPA 5KDMC 3ZMVB 2BG9E 4JI5T 5C2TA 4TWHA 4WYVA 3VU7H 2KINB 3N9PA 3EABA 5AQOB 3RIFA 3UU6A 4X65T 4X66T 3NVOA 2DCFA 1MNDA 1ZEEA 3JAEA 4OFZA 2OV9A 5JQGE 1WFDA 2I0MA 5HXCA 1S94A 4U72A 4WW0A 1YKHB 2BKNA 2JQQA 2D5UA 3V5UA 2OA5A 3HKEE 2W67A 1UK5A 1V9DA 2V7KA 3ZMZB 4HTEA 4L5GA 1YXRA 4UF0A 3TLWA 1ZKEA 2VKDA 4NIQA 4YXDA 5FL0A 5EK2A 3FBLA 1UURA 1MIWA 3N5LA 4K0UA 4ZEYA 2OLTA 4JI2T 4ZZBA 3IBPA 3ETVA 4QX7B 4E7SA 1KF6A 3N2GE 4AQGA 4HWDA 5FNVE 3RYFE 3TKLB 4I43B 4YTPA 2IW5B 3OVUA 3Q2MA 4U74A 4ISTA 2VL8A 4P1NA 3CQCB 2QRXA 3QB5K 4ZS2A 5HXEA 2UUBT 2YEVC 4GOUA 3K3NA 4JI8T 2Y48B 5AQGB 2XQYA 2NW9A 1LVFA 3UU3A 2V6YA 3LG7A 4BJNA 5AQUB 5LP6E 3ZJ1A 4JI1T 4X1YE 4U2ZA 1J5WA 5DABA 2VASA 5CA1E 3C4XA 1D0ZA 4LF8T 3ZSTA 3AECA 1ZOYA 2W4XA 3FXEB 3PUYF 3EI0A 3BQKA 5AQIB 1XNRT 1R8IA 4CZZB 1SE7A 2X9HA 4YFSA 4PK4A 5GONE 2WB5A 3PUWF 4IDOA 3ZMSB 4OHFA 4BA9A 2X66A 5JDLA 2W00A 2XAJB 2CBJA 2WDRA 3MACA 3P4PA 2NP9A 5AQTB 4ZI3D 2Z6EA 2XASB 3QB5A 5ETWA 3IF8B 4HWIB 4KHPT 3AAEB 2BBHA 3HR0A 5HCMA 1G73A 1KFYA 3H3MA 5HXSA 5LG4A 4B3ST 3ZC0A 2YN6A 5LJNA 3J7Yq 3SFDA 5HEHA 2J62A 2WSSV 5DQVA 2X9XA 4LMLA 4TWDA 3KV5A 2CLYC 5LA6E 2D9DA 3RF1A 3SFEA 1WRDA 4QKNA 3VRBA 2CHNA 3CX8B 5L3FB 5LGTB 2XSAA 4GKKT 3AEAA 3O1JA 2QVAA 1D1AA 3CIRA 3DP7A 3RYCE 3SS1A 4AKLA 2LM9A 5ABFB 1Y64B 2Q9QD 3WAKA 3AE5A 4ZS3A 2LRLA 2VVSA 5J2UE 3AB3B 3T1YT 2C5IT 4TV8E 5DQWA 4ZXLA 3OYXA 4DR6T 3NZPA 3U3IA 4EZHA 2V7JA 3C4ZA 3MZKB 3RC8A 1LRZA 5IUXA 5JTGA 1QLBA 3RKGA 5L3EB 4CXYA 3OBVE 4DNDA 4EGWA 2XQ7A 1OEDB 5ABHA 3Q5WA 5HXHA 5LG3A 2M6BA 4PW8A
chains in the Genus database with same CATH topology
2ZM6T 4DV0T 4DV1T 4DV5T 2UUAT 1HNXT 4JI4T 4JI7T 4X62T 4DR3T 4DR2T 1FJGT 2UUCT 1N36T 1J5ET 4DV3T 4LF4T 4DV7T 4LFCT 2UXBT 1N33T 4LF7T 4X66T 4X65T 1HNZT 4B3TT 4LFAT 4JV5T 2VQET 2UXCT 4JI6T 4JI2T 3T1HT 1XMQT 4NXMT 2UUBT 2UXDT 4DUYT 4YY3T 1IBKT 4DR1T 4JI1T 1HNWT 4GKJT 5LMNT 4LF8T 4YHHT 4JI3T 1XNRT 4K0KT 4NXNT 4DR4T 1XNQT 4LF5T 1IBLT 4LFBT 4AQYT 4LF9T 1IBMT 4JI5T 5LMUT 4DV4T 4JI0T 4DUZT 4DR5T 4KHPT 4B3ST 3OTOT 2E5LT 1I94T 4X64T 1N32T 5BR8T 4B3RT 1HR0T 2VQFT 4GKKT 2HHHT 4JI8T 4OX9T 1XMOT 2UU9T 3T1YT 4B3MT 4DV6T 4DR7T 2F4VT 4DR6T 4JYAT 4LF6T 5IWAT 1N34T 4DV2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 T;  4DV0 T;  4DV1 T;  4DV5 T;  2UUA T;  1HNX T;  4JI4 T;  4JI7 T;  4X62 T;  4DR3 T;  4DR2 T;  1FJG T;  2UUC T;  1N36 T;  1J5E T;  4DV3 T;  4LF4 T;  4DV7 T;  4LFC T;  2UXB T;  1N33 T;  4LF7 T;  4X66 T;  4X65 T;  1HNZ T;  4B3T T;  4LFA T;  4JV5 T;  2VQE T;  2UXC T;  4JI6 T;  4JI2 T;  3T1H T;  1XMQ T;  4NXM T;  2UUB T;  2UXD T;  4DUY T;  4YY3 T;  1IBK T;  4DR1 T;  4JI1 T;  1HNW T;  4GKJ T;  5LMN T;  4LF8 T;  4YHH T;  4JI3 T;  1XNR T;  4K0K T;  4NXN T;  4DR4 T;  1XNQ T;  4LF5 T;  1IBL T;  4LFB T;  4AQY T;  4LF9 T;  1IBM T;  4JI5 T;  5LMU T;  4DV4 T;  4JI0 T;  4DUZ T;  4DR5 T;  4KHP T;  4B3S T;  3OTO T;  2E5L T;  1I94 T;  4X64 T;  1N32 T;  5BR8 T;  4B3R T;  1HR0 T;  2VQF T;  4GKK T;  2HHH T;  4JI8 T;  4OX9 T;  1XMO T;  2UU9 T;  3T1Y T;  4B3M T;  4DV6 T;  4DR7 T;  2F4V T;  4DR6 T;  4JYA T;  4LF6 T;  5IWA T;  1N34 T;  4DV2 T; 
#chains in the Genus database with same CATH topology
 2LSY A;  1E1H B;  2CHO A;  4GK5 E;  4O2A E;  3ZMU B;  2A2F X;  5DJQ C;  4MBQ A;  3P8C D;  4AQF C;  4HFD A;  2HH7 A;  3RH3 A;  4EAH A;  4PNI A;  5L4E A;  4IGU A;  2LJL A;  4ISS A;  2Q9Q A;  3RPU A;  3RYI E;  2BBJ A;  2J1D G;  3LBX A;  3UU8 A;  3AA7 B;  4HFV A;  3KBU A;  1VRB A;  4DID B;  2FBW A;  2FJE A;  3LBX B;  2BVL A;  2JMH A;  2ZM0 A;  3P4S A;  4HFE A;  4YHJ A;  5HWX A;  4E7Z A;  4HGA A;  1HX8 A;  5AQQ B;  3CML A;  3E08 A;  5AQP B;  4X62 T;  5FY1 A;  1WCR A;  4CI1 B;  4YLH A;  4DR2 T;  3AE6 A;  1KEY A;  3RYH E;  2WWU A;  1XDO A;  1N36 T;  1J5E T;  1JNZ A;  2FUP A;  2W63 A;  4CQI A;  4LF4 T;  4QH4 A;  2WY2 A;  3EVY A;  1ZHC A;  2JIW A;  4DV7 T;  2XJ7 A;  2LKG A;  4UV9 B;  2Y8D A;  4XBF B;  3X1D A;  4KBM B;  4NUU A;  3CX6 B;  1EZ3 A;  3HKC E;  3ONX A;  4PK5 A;  5JDF A;  4ZI2 D;  4V1A v;  2FJB A;  1D0X A;  3MKD A;  5AQF B;  1B7T A;  2WP9 A;  4UV8 B;  5FY0 A;  4TUY E;  2CBI A;  4OYJ A;  3AE7 A;  4P09 A;  4A56 A;  4A5X A;  2CM0 A;  3PUV F;  5LHH B;  1HNZ T;  2MOZ A;  3HI2 A;  3C98 B;  5ABE A;  2ACX A;  4PJN A;  5FVL A;  5JVD E;  3D0T A;  1YW0 A;  3I0O A;  3KVA A;  3FZK B;  4ILC A;  3TLU A;  4JV5 T;  2DWG A;  3AE2 A;  2YU2 A;  4IDP A;  4Z91 A;  3H3A A;  4HFB A;  3TLV A;  3R84 B;  3AAA B;  3VR8 A;  4P0B A;  5L47 A;  2KWH A;  1CHU A;  1MMA A;  3RIA A;  4JUY A;  4AKR B;  3LSV A;  2JPF A;  4DMV A;  2XAH B;  2XTL A;  5ABF A;  3UTK A;  3T1H T;  4EYU A;  4O2B E;  3VRA A;  1YQ4 A;  4WNK A;  2H89 A;  5F5W A;  3RRC A;  4JBW F;  1ZP0 A;  5LGU B;  1XMQ T;  2BDE A;  1NEN A;  2GK9 A;  4ILU A;  3DJB A;  3AE4 A;  3AA0 B;  3JC6 D;  4YJ3 E;  3UU4 A;  1VCS A;  5LCY A;  2XAQ B;  2M6I A;  3I9Y A;  1I6Z A;  1IJ5 A;  5KXJ A;  4YY3 T;  2X67 A;  3QK6 A;  4UVC B;  4QXC B;  3ZYL A;  2CPT A;  3Q5X A;  5AQR B;  1IBK T;  1HNW T;  2N1G A;  5HEO A;  1D0Y A;  3ABV A;  2VK9 A;  4IE4 A;  2A9U A;  3ZLI A;  4GKJ T;  3Q5E A;  5LMN T;  4JI3 T;  4AIU A;  4K0K T;  4EZ4 A;  3KV4 A;  2NW7 A;  2W61 A;  3UQ7 A;  2VKH A;  4NXN T;  3HKB E;  1XNQ T;  1IBL T;  1SHZ C;  2QGS A;  2XAF B;  3C51 A;  2E9X A;  3CK6 A;  4Q25 A;  3UFG A;  2KSR A;  2YDR A;  4UVA B;  3F2E A;  3UUM A;  2MPK A;  3ZYK A;  1T7S A;  3GN5 A;  4KMC A;  3CWZ B;  1J1J A;  4HWF A;  1DU2 A;  5EK4 A;  3AVR A;  4X5T A;  3UU5 A;  4HEA A;  5H6Q B;  3ZN0 B;  4JI0 T;  3ZT6 A;  3IEE A;  3KBT A;  4L9I A;  3B5M A;  2V26 A;  1OWA A;  2ZLY A;  2J4G A;  1AJ3 A;  3KV6 A;  3RIU C;  2JJ9 A;  2QA7 A;  5ABG A;  3FZL B;  3NWI A;  2WU5 A;  3PV0 F;  2XM2 A;  4X1K E;  3BK9 A;  5HEU A;  2W66 A;  5JR9 C;  3ZC1 A;  4ASK A;  2XZE A;  4KUM B;  4HWH A;  5BR8 T;  1KNP A;  4YTN A;  1UX5 A;  2ZMA A;  2HN1 A;  5C3J A;  5FL1 A;  4ANJ A;  2VQF T;  1HR0 T;  1IJ6 A;  1W9R A;  2LLY A;  2WQY A;  1XMO T;  1KNR A;  4JEH B;  5L3G B;  3JAD A;  4B3M T;  1E7P A;  1SA0 E;  2LT3 A;  2IHR 1;  2PBI A;  2BG9 B;  3HKD E;  4DV6 T;  1LVK A;  5IHY A;  1XWM A;  2PG8 A;  5IWA T;  4J2C A;  1Y01 A;  1ZV4 X;  2DI4 A;  3FB2 A;  4IIJ E;  3AA6 B;  3PTR B;  3VR9 A;  5AFU L;  3AEE A;  4TX5 A;  3L3P A;  1MNE A;  3AAI A;  1HX1 B;  3EAM A;  3Q5D A;  2ODU A;  4DVD A;  4DBQ A;  2E5V A;  2XQ5 A;  2UXX B;  2P9B A;  3P4W A;  5E0O A;  2UXN B;  5J2T E;  2ZM6 T;  4O4J E;  1N34 T;  4TZ4 C;  3CX7 B;  2Q9Q B;  2V6X A;  5LBQ B;  3AVS A;  2UUA T;  5HAX A;  5KX5 E;  4H9R C;  1HNX T;  4AKH A;  3N9N A;  2EHO D;  1D1C A;  2LSJ A;  3MXZ A;  3L39 A;  5FVK A;  2DNX A;  2IIU A;  2WAU A;  3A5X A;  3ETU A;  4IE5 A;  4ILB A;  4JEU B;  4B6X A;  4EYY R;  1QUU A;  3FZF B;  2I6H A;  2WDV A;  5LXT E;  1CUN A;  2CEA A;  2LRK A;  3A8Y C;  3IA3 A;  4X20 E;  4TV9 E;  5FP3 A;  2HN2 A;  5LHG B;  4Z90 A;  4FJO A;  2G0U A;  5CFB A;  5LGN B;  4JI7 T;  2XHE B;  3JCF A;  3N2O A;  3NKZ A;  3ONL C;  2KT9 A;  4ZI3 C;  3RLF F;  3PUS A;  4X1I E;  1FJG T;  4TNW A;  3N9L A;  5L2L A;  5CJ5 A;  5JRE A;  1G8X A;  4TN7 B;  2RA1 A;  3AE1 A;  4PAG A;  4F8H A;  1HFA A;  1N33 T;  3AEG A;  4LF7 T;  1M62 A;  3O1I A;  2XM1 A;  3CKD A;  2K24 A;  4H9N C;  3S4U A;  4ZHQ E;  3ZEF B;  2E9X C;  3RX6 A;  2H7O A;  2LE8 A;  2V7I A;  4M1P A;  5AQM B;  5HEG A;  3L8R A;  2V7M A;  4DBR A;  5ADX L;  1U5P A;  4O4L E;  3E0Z A;  5AQJ B;  4COF A;  1HF8 A;  3Q9D A;  3RC3 A;  2CRB A;  3EDU A;  3ZYM A;  1D1B A;  2XQ6 A;  2H3R A;  4I4T E;  1U4Q A;  3ZJ2 A;  5CGM A;  3ZT5 A;  2VQE T;  2YK0 A;  4QHO A;  3AEF A;  3B13 A;  2UXC T;  4XAX B;  2NWB A;  2V1D B;  5EZY E;  1BR2 A;  3RIU A;  1NWM X;  3AE3 A;  1MIV A;  4BJM A;  1W0B A;  5F8P A;  4P0A A;  2DWK A;  4JI6 T;  2WBL A;  3PUX F;  3GA8 A;  2XQ4 A;  3QOF A;  4UXN B;  1S35 A;  3V5S A;  3UFE A;  1W0A A;  4IE6 A;  1QSD A;  2D0U A;  2LSK A;  3I9W A;  3QNU A;  4HFC A;  5LOV E;  1BR1 A;  3MK7 C;  5M4Y A;  1US7 B;  2M67 A;  2YDQ A;  3VKH A;  1T98 A;  4IL4 A;  5LB7 B;  4Z8X A;  2KMF A;  3HL6 A;  3K3Q C;  3N9O A;  5LYJ E;  2K3W A;  3OJA A;  3ZN1 B;  1HG2 A;  3ANW A;  4CI2 B;  2XQ8 A;  5JDG A;  5JDH A;  2UXD T;  5LBM A;  4G63 A;  4PFP A;  2LSI A;  3M3Z B;  3N2K E;  2MYS A;  2YU1 A;  1IZN B;  2ODV A;  3ANW B;  3ESL A;  4LMK A;  3SRZ A;  2JQK A;  4PFO A;  2LM2 A;  4IE0 A;  4WZX A;  3F31 A;  4C90 A;  4KP3 C;  1FIO A;  2CA5 A;  3TLT A;  4YHH T;  3OPC A;  3M65 A;  4BAY B;  4DR4 T;  3P50 A;  1FMV A;  1X79 A;  2EHO A;  5AQN B;  1OED E;  4L0R A;  2BS4 A;  3RKO A;  3I0Q A;  4PK6 A;  4AQY T;  4LFB T;  3ONJ A;  4F6R C;  4CN1 A;  3VHL A;  5BMV E;  2D0T A;  2MBG A;  5L3B B;  1OED C;  2KWI B;  4U33 A;  1XZY A;  2X0Y A;  3PU8 A;  3UUX B;  4DR5 T;  4C91 A;  3MA9 A;  4AKG A;  4GYR A;  4H9P C;  4MHC A;  2CXD A;  2VWA A;  3F57 A;  4GYS A;  4U2Y A;  4YSY A;  3RQU A;  2AE9 A;  4KI0 F;  4QX8 B;  4HKA A;  4EIW A;  2WWV A;  2IML A;  2C0S A;  5LHI B;  2KZ7 B;  1I94 T;  2X0L B;  2XY8 B;  4YTM A;  2BKP A;  2WDQ A;  3NRX A;  4YJ2 E;  2KND A;  4MLK A;  4B3R T;  3PE0 A;  1MMN A;  2B1E A;  2X9Y A;  2V8S V;  1BR4 A;  1HCI A;  3AA1 B;  3CQG B;  3FZH B;  2X51 A;  2CLY B;  4OYK A;  4U3C A;  4OX9 T;  1LKX A;  4I50 E;  2IUB A;  3R6N A;  3JAF A;  4IDN A;  4AQF A;  2N9D A;  2B76 A;  4EEB A;  4ZI7 E;  2XSB A;  3KDS E;  4PJJ A;  5J0Z A;  2YOE A;  4XZC A;  3UT5 E;  2F4V T;  4JYA T;  2Q9Q C;  1T72 A;  2FJA A;  4O4I E;  3JC6 C;  2XQ9 A;  2I59 A;  3PUA A;  4IHJ E;  4ERR A;  3J9X 1;  2LOP A;  4LF6 T;  1L0V A;  5L4H A;  3AEB A;  1X9B A;  2C5J A;  1VCT A;  2KXP B;  3AE9 A;  4DV0 T;  3CPZ A;  3U78 A;  1UGO A;  4DV1 T;  4DV5 T;  5L3C B;  3FHN A;  3ZMT B;  3FXD B;  2X0H A;  2E9X B;  3NZQ A;  4H63 H;  1XDP A;  2WZH A;  3LJC A;  2WCA A;  3PUZ F;  4LMJ A;  4EOZ B;  4IT4 A;  5FY7 A;  2DHR A;  2JQ9 A;  4YSZ A;  3CVR A;  3K3O A;  1GQE A;  5CB4 E;  5FXV A;  2XQA A;  5JH7 E;  5JR9 B;  2CE7 A;  3FBZ A;  5FYM A;  4JI4 T;  4AI6 A;  3A7M A;  2W62 A;  3UUB A;  5LNK A;  2VB6 A;  1NEK A;  1IAP A;  2UUC T;  2WMN A;  5AQK B;  3B57 A;  3O4X E;  4LFC T;  3L09 A;  3OKQ A;  2UXB T;  4ZI2 C;  1YKE B;  3LFM A;  4QXH B;  3EDV A;  1NAF A;  5J1G A;  4MFR A;  2VVN A;  2CWY A;  2DL1 A;  4EXT A;  2X68 A;  2ES0 A;  5HWY A;  5HYA A;  3P4Q A;  4OK0 A;  5FXZ A;  5HCJ A;  4CXX A;  3RHW A;  5JRC A;  3UUL A;  4O8S A;  3UUN A;  1OED A;  2MAW A;  2CXL A;  4H9Q C;  2E8I A;  4PJM A;  4WBN E;  4B3T T;  2WM9 A;  4LFA T;  5JRC B;  1WYB A;  2V5C A;  3KV9 A;  2IDO B;  3G06 A;  2AXD S;  3ZT7 A;  2W2U A;  2ZM2 A;  2CCQ A;  1MIY A;  2BVM A;  2V7L A;  4U7I A;  2VUR A;  4ILA A;  4UF0 B;  1UX4 A;  2Y6X A;  4N78 D;  1KK7 A;  1T8B A;  1BR0 A;  5HXR A;  1SUM B;  4QH1 A;  2YKS A;  5AQV B;  4AIS A;  2SPC A;  4O4H E;  1FMW A;  3AXJ A;  3KIN B;  3LDQ B;  3OYZ A;  3PJA J;  4CN4 A;  2KLQ A;  3SWH A;  2FJD A;  3NRY A;  1WR6 A;  4NXM T;  2LHR A;  2LSG A;  4I0U A;  3K1S A;  4HWC A;  5KMG P;  4DUY T;  2WZI A;  4EV6 A;  4UEL A;  3PU3 A;  2IAK A;  2PFV A;  2RP4 A;  2K48 A;  2XAG B;  4HFH A;  5LJM A;  4DR1 T;  3O1H A;  5H6R B;  4H63 V;  4CXW A;  2BS2 A;  3PUR A;  4CN6 A;  1Z8U A;  2BG9 C;  2BKO A;  3KFW X;  5AQL B;  5A1L A;  1WLX A;  3C50 A;  5FMN A;  3UQ4 A;  3MJX A;  3E22 E;  3N9Q A;  4H9S E;  4LF5 T;  3ZSS A;  4CI3 B;  3SOL A;  4DO0 A;  3AED A;  4QWN B;  2H7V C;  3VKG A;  2WS3 A;  4ZZC A;  4U31 A;  1HS7 A;  4KHZ F;  2NW8 A;  4JLE A;  4LF9 T;  2EHO B;  1UUS A;  1IBM T;  3BQI A;  3GMI A;  2PTF A;  2JQH A;  1HG5 A;  3K8P C;  3LK3 B;  2BG9 A;  4HFI A;  4WBO A;  2XQ3 A;  4NUV A;  5AQH B;  4EB6 E;  4TNV A;  5LMU T;  2IC6 A;  2L3L A;  4IRE A;  4UEM A;  1WR0 A;  4IDZ A;  4DUZ T;  3CQX C;  3EUH A;  4FI5 A;  3H37 A;  4GK0 E;  3OTO T;  4G2A A;  2K5B B;  5FKY A;  2V6Y B;  4A98 A;  4PJL A;  5C8Y E;  2HHH T;  2HPL A;  4UIG A;  1JNR A;  4YT0 A;  2E5L T;  3GWH A;  2R6G F;  3KVB A;  4U7Y A;  4KX6 A;  3ZKR A;  4TWF A;  1MMG A;  4X64 T;  1N32 T;  2A72 A;  5FXX A;  4EED A;  1FEW A;  2JRK A;  2NR4 A;  2PJQ A;  2XUE A;  2WU2 A;  4YSX A;  3QUJ A;  1VOM A;  4IDQ A;  3QC9 A;  2X9W A;  5TAO A;  2CXF A;  2ZM8 A;  3ZCJ A;  3NBX X;  3ZPO A;  4ADZ A;  2XPK A;  1E2A A;  2W0G A;  3C64 A;  3PUG A;  3WAJ A;  2UU9 T;  2NOX A;  2J47 A;  4QXB B;  3LK2 B;  4DR7 T;  5JDM A;  2LOS A;  5IYZ E;  2L9Q A;  5F3J A;  1HTJ F;  4H9O C;  2IC9 A;  4UVB B;  5JR9 A;  1H7C A;  2BZB A;  2LHN A;  2VL0 A;  3IHR A;  2A3D A;  4DV4 T;  3EHZ A;  4MAL A;  5L3D B;  2NTX A;  2LKH A;  1M7K A;  2DLR A;  2JMK A;  3WI3 A;  3RGL A;  4DMW A;  2EHO C;  4DV2 T;  3PJA A;  2YIN A;  5JDQ A;  2D2S A;  2QYW A;  3I1A A;  4IE7 A;  1Z0P A;  4UR9 A;  2HPJ A;  4ZOL E;  3RI5 A;  3P4R A;  5JDN A;  3PDY A;  3RRW A;  2MTQ A;  1OXZ A;  3DTO A;  2V5D A;  1WYC A;  3PUQ A;  3GN5 B;  4I55 E;  3N9M A;  1YD8 G;  2ACZ A;  2WMO A;  2LEH A;  5FXW A;  5CA0 E;  1O3X A;  2BS3 A;  3AE8 A;  1KNZ A;  3AXJ B;  5HEJ A;  4NPP A;  3ZCI A;  2K9A A;  4IL9 A;  2VKJ A;  2E2A A;  3BQL A;  4HN9 A;  1YQ3 A;  2H88 A;  3P7I A;  3HA4 A;  3T8O A;  2YDS A;  3O9X A;  2CMR A;  4A97 A;  4DR3 T;  4AKI A;  2VKO A;  2L8K A;  4GIW A;  2RPA A;  3LK4 2;  1UCU A;  2N2N A;  3FZM B;  5EK3 A;  4DV3 T;  5AQS B;  3C4W A;  2C5K T;  2NTY A;  2E9X D;  1MMD A;  4HE8 A;  1W09 A;  4QH5 A;  3RQW A;  3TLS A;  3W15 B;  2CWO A;  4AXP A;  5KDM C;  3ZMV B;  2BG9 E;  4JI5 T;  5C2T A;  4TWH A;  4WYV A;  3VU7 H;  2KIN B;  3N9P A;  3EAB A;  5AQO B;  3RIF A;  3UU6 A;  4X65 T;  4X66 T;  3NVO A;  2DCF A;  1MND A;  1ZEE A;  3JAE A;  4OFZ A;  2OV9 A;  5JQG E;  1WFD A;  2I0M A;  5HXC A;  1S94 A;  4U72 A;  4WW0 A;  1YKH B;  2BKN A;  2JQQ A;  2D5U A;  3V5U A;  2OA5 A;  3HKE E;  2W67 A;  1UK5 A;  1V9D A;  2V7K A;  3ZMZ B;  4HTE A;  4L5G A;  1YXR A;  4UF0 A;  3TLW A;  1ZKE A;  2VKD A;  4NIQ A;  4YXD A;  5FL0 A;  5EK2 A;  3FBL A;  1UUR A;  1MIW A;  3N5L A;  4K0U A;  4ZEY A;  2OLT A;  4JI2 T;  4ZZB A;  3IBP A;  3ETV A;  4QX7 B;  4E7S A;  1KF6 A;  3N2G E;  4AQG A;  4HWD A;  5FNV E;  3RYF E;  3TKL B;  4I43 B;  4YTP A;  2IW5 B;  3OVU A;  3Q2M A;  4U74 A;  4IST A;  2VL8 A;  4P1N A;  3CQC B;  2QRX A;  3QB5 K;  4ZS2 A;  5HXE A;  2UUB T;  2YEV C;  4GOU A;  3K3N A;  4JI8 T;  2Y48 B;  5AQG B;  2XQY A;  2NW9 A;  1LVF A;  3UU3 A;  2V6Y A;  3LG7 A;  4BJN A;  5AQU B;  5LP6 E;  3ZJ1 A;  4JI1 T;  4X1Y E;  4U2Z A;  1J5W A;  5DAB A;  2VAS A;  5CA1 E;  3C4X A;  1D0Z A;  4LF8 T;  3ZST A;  3AEC A;  1ZOY A;  2W4X A;  3FXE B;  3PUY F;  3EI0 A;  3BQK A;  5AQI B;  1XNR T;  1R8I A;  4CZZ B;  1SE7 A;  2X9H A;  4YFS A;  4PK4 A;  5GON E;  2WB5 A;  3PUW F;  4IDO A;  3ZMS B;  4OHF A;  4BA9 A;  2X66 A;  5JDL A;  2W00 A;  2XAJ B;  2CBJ A;  2WDR A;  3MAC A;  3P4P A;  2NP9 A;  5AQT B;  4ZI3 D;  2Z6E A;  2XAS B;  3QB5 A;  5ETW A;  3IF8 B;  4HWI B;  4KHP T;  3AAE B;  2BBH A;  3HR0 A;  5HCM A;  1G73 A;  1KFY A;  3H3M A;  5HXS A;  5LG4 A;  4B3S T;  3ZC0 A;  2YN6 A;  5LJN A;  3J7Y q;  3SFD A;  5HEH A;  2J62 A;  2WSS V;  5DQV A;  2X9X A;  4LML A;  4TWD A;  3KV5 A;  2CLY C;  5LA6 E;  2D9D A;  3RF1 A;  3SFE A;  1WRD A;  4QKN A;  3VRB A;  2CHN A;  3CX8 B;  5L3F B;  5LGT B;  2XSA A;  4GKK T;  3AEA A;  3O1J A;  2QVA A;  1D1A A;  3CIR A;  3DP7 A;  3RYC E;  3SS1 A;  4AKL A;  2LM9 A;  5ABF B;  1Y64 B;  2Q9Q D;  3WAK A;  3AE5 A;  4ZS3 A;  2LRL A;  2VVS A;  5J2U E;  3AB3 B;  3T1Y T;  2C5I T;  4TV8 E;  5DQW A;  4ZXL A;  3OYX A;  4DR6 T;  3NZP A;  3U3I A;  4EZH A;  2V7J A;  3C4Z A;  3MZK B;  3RC8 A;  1LRZ A;  5IUX A;  5JTG A;  1QLB A;  3RKG A;  5L3E B;  4CXY A;  3OBV E;  4DND A;  4EGW A;  2XQ7 A;  1OED B;  5ABH A;  3Q5W A;  5HXH A;  5LG3 A;  2M6B A;  4PW8 A; 
#chains in the Genus database with same CATH homology
 2ZM6 T;  4DV0 T;  4DV1 T;  4DV5 T;  2UUA T;  1HNX T;  4JI4 T;  4JI7 T;  4X62 T;  4DR3 T;  4DR2 T;  1FJG T;  2UUC T;  1N36 T;  1J5E T;  4DV3 T;  4LF4 T;  4DV7 T;  4LFC T;  2UXB T;  1N33 T;  4LF7 T;  4X66 T;  4X65 T;  1HNZ T;  4B3T T;  4LFA T;  4JV5 T;  2VQE T;  2UXC T;  4JI6 T;  4JI2 T;  3T1H T;  1XMQ T;  4NXM T;  2UUB T;  2UXD T;  4DUY T;  4YY3 T;  1IBK T;  4DR1 T;  4JI1 T;  1HNW T;  4GKJ T;  5LMN T;  4LF8 T;  4YHH T;  4JI3 T;  1XNR T;  4K0K T;  4NXN T;  4DR4 T;  1XNQ T;  4LF5 T;  1IBL T;  4LFB T;  4AQY T;  4LF9 T;  1IBM T;  4JI5 T;  5LMU T;  4DV4 T;  4JI0 T;  4DUZ T;  4DR5 T;  4KHP T;  4B3S T;  3OTO T;  2E5L T;  1I94 T;  4X64 T;  1N32 T;  5BR8 T;  4B3R T;  1HR0 T;  2VQF T;  4GKK T;  2HHH T;  4JI8 T;  4OX9 T;  1XMO T;  2UU9 T;  3T1Y T;  4B3M T;  4DV6 T;  4DR7 T;  2F4V T;  4DR6 T;  4JYA T;  4LF6 T;  5IWA T;  1N34 T;  4DV2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...