2ZM6T

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
94
structure length
94
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 29
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2zm6T00
1I94T 4JYAT 3T1HT 1N34T 4LFCT 1N33T 4LF4T 4DV1T 2E5LT 4LFBT 1HR0T 4LF9T 4DR2T 4DV2T 1XNRT 5BR8T 4JI2T 2F4VT 1N32T 4DUZT 4LFAT 4X65T 4YY3T 3OTOT 4KHPT 5LMNT 2UUAT 4JI5T 2VQET 4JI3T 2UU9T 2VQFT 1HNZT 4JV5T 4GKJT 4DV5T 4NXNT 4DR3T 4YHHT 2UUBT 4K0KT 4X66T 5IWAT 4DV6T 4LF7T 4JI4T 4GKKT 4DR5T 2UXDT 4B3RT 4JI0T 2ZM6T 4JI1T 2UUCT 1HNXT 4DV7T 4B3MT 2HHHT 1XNQT 4DR6T 4JI6T 1N36T 4LF6T 4JI8T 4DR4T 4X62T 4AQYT 1IBLT 2UXBT 4LF5T 4DV0T 1IBMT 4B3TT 4X64T 1HNWT 3T1YT 4DV4T 4B3ST 4JI7T 2UXCT 1IBKT 4DR7T 5LMUT 1XMOT 1XMQT 4LF8T 4DUYT 4OX9T 1FJGT 1J5ET 4NXMT 4DR1T 4DV3T
chains in the Genus database with same CATH superfamily
2VKOA 2XQ4A 2A72A 2WMOA 2Y6XA 3T1HT 4E7SA 4N78D 1I6ZA 3J7Yq 3I1AA 2IC9A 1XNRT 3L09A 1WRDA 2BS4A 3O1JA 2MOZA 2X66A 4ZHQE 2E9XB 2XQAA 3CQGB 3NZPA 3NBXX 3IF8B 3QUJA 3UU4A 4GK5E 2ZM8A 2XSBA 5FVKA 5J1GA 2Y8DA 4CI3B 5ABGA 3ZLIA 2M6BA 1UCUA 4ILAA 4IE7A 2WMNA 2Y48B 4GIWA 2RP4A 4NIQA 2W66A 3PJAA 5AQTB 2X9HA 4DV7T 1D1AA 2ES0A 3GN5A 1U4QA 1KK7A 2YEVC 2LHRA 3P8CD 3JCFA 1EZ3A 2XAJB 4GYSA 1JNZA 2D5UA 5IHYA 3ZJ2A 4AIUA 2PG8A 2V7MA 4EAHA 4DV4T 3ZMTB 5FL1A 4YSXA 4L0RA 2P9BA 2CCQA 4MHCA 1HG2A 1XMQT 1ZV4X 2XM2A 3VRAA 2X9WA 2Q9QA 3E22E 1YW0A 2ZM2A 2H88A 3HR0A 3UFGA 4TV8E 2F4VT 5CB4E 1KFYA 3RC8A 5AQPB 3N9OA 4HFHA 5ADXL 5JRCA 5FY0A 2CBJA 4IE5A 2W67A 3RQWA 1OEDE 2D0UA 5H6RB 4HFIA 3PUVF 2H7VC 2AE9A 1OXZA 5FVLA 3L3PA 2OLTA 4JI4T 4TX5A 3KDSE 2WS3A 4I0UA 3AXJB 4UIGA 2W4XA 3ZPOA 3ZT5A 4EEDA 2W63A 5DQWA 3HKDE 1HFAA 3EI0A 2BG9A 3N2OA 3SS1A 2IIUA 2UXXB 3ANWB 4QX7B 4JUYA 3UT5E 4CI2B 2PFVA 3PUXF 5LHHB 4QH5A 4COFA 1BR4A 5LB7B 3L8RA 2KNDA 2UXNB 5AFUL 2E2AA 2FJBA 4L9IA 2YN6A 4CXYA 3EDVA 4AI6A 3UULA 3AE3A 5C2TA 5AQQB 3KVBA 4HWIB 2X51A 1L0VA 4MFRA 1W0AA 3OYZA 4PFPA 5CFBA 3LBXA 2Z6EA 3UQ7A 4KHPT 2JQ9A 2PJQA 3O4XE 5LMNT 1FEWA 2E9XC 1YXRA 1WR6A 2V8SV 2QRXA 2LJLA 2WB5A 2CXFA 2GK9A 4JI3T 3SOLA 2KLQA 2FUPA 1AJ3A 4JEHB 3Q9DA 3FXEB 2ACXA 3UTKA 4PJNA 2I59A 5IWAT 1UK5A 5AQHB 5JQGE 1XNQT 4EYUA 4KP3C 3UUNA 3ZMVB 4CXWA 2WBLA 4QWNB 2XSAA 4C90A 3M3ZB 5BMVE 4J2CA 3JAEA 4EXTA 5HAXA 4TWFA 3ETVA 5TAOA 5LG3A 4X64T 3W15B 3I0QA 2XAQB 1WCRA 1MNEA 3K3NA 4TNWA 1WYCA 3ZEFB 2NTXA 4HFDA 3V5UA 2D2SA 3J9X1 3UQ4A 3RKGA 3I0OA 3JC6C 1HF8A 4HWDA 5F3JA 2IC6A 3IA3A 5JTGA 1WFDA 4OFZA 3IBPA 3N9PA 1Z0PA 2K3WA 2QGSA 4P09A 3M65A 2XZEA 3TLVA 1MIVA 3KFWX 5L47A 4O8SA 5HEUA 4IE4A 1LVKA 2BS2A 3P4RA 4H63H 5HWXA 4DV5T 4ANJA 4YSZA 2I0MA 2ODVA 3FBZA 2IDOB 3LJCA 3AA6B 3Q5DA 2BS3A 3BQKA 4BJNA 4LF7T 3RYCE 4WBOA 3LK42 2PBIA 1WLXA 2LEHA 5HCJA 1N36T 3AXJA 4JEUB 4AQFC 5JDLA 5FY7A 3T8OA 4YHJA 3JC6D 1LRZA 4YXDA 3UU3A 2J1DG 4OK0A 3T1YT 4AKLA 2XQ9A 3NKZA 5JR9A 3C4XA 3AE6A 4DBRA 5AQFB 4EV6A 1XMOT 1D0ZA 3PDYA 3UFEA 2XQ6A 2CXDA 4QXHB 1HCIA 1I94T 4NPPA 2CHNA 2KT9A 4A98A 4HN9A 1N33T 5JDNA 4JBWF 2BKPA 3C50A 3ZYLA 2XASB 3PUZF 3LFMA 2V6YB 3RYIE 4I50E 1SA0E 2H3RA 3O1HA 2LOPA 4WYVA 4CN1A 2DCFA 3AA0B 4AISA 2V1DB 5FXWA 5JREA 4IHJE 2KWHA 2W62A 5ABFB 4EB6E 3WAKA 1HNZT 4PK6A 3CX8B 1MMAA 4NUUA 4PK5A 3SFDA 2UXDT 4ZXLA 2EHOC 1HNXT 2V7IA 3ABVA 5DQVA 2YINA 4DR4T 2NWBA 3NZQA 3C98B 2LM2A 2LOSA 4ADZA 3NRYA 3S4UA 2D9DA 1UX4A 4A97A 3F31A 4BAYB 2UXCT 4YLHA 3BQIA 4UVCB 3RIUA 2H7OA 4UV8B 3ZYKA 3VU7H 5H6QB 2V26A 3HA4A 2BKNA 1D1CA 2X9YA 3DTOA 2HN1A 4UVAB 4DV1T 3B13A 3N9QA 4DR2T 5DJQC 4ISSA 2YOEA 4CXXA 1N32T 3QB5K 1VCTA 5LGUB 5KX5E 4YY3T 3AE2A 3LK2B 2BZBA 2VVSA 2IUBA 3PJAJ 3KV5A 4HFEA 4X5TA 4QH1A 1WR0A 3P50A 2UUAT 2VQET 5AQRB 3GWHA 2BBJA 3QK6A 1Y01A 2IW5B 5AQMB 2M6IA 4K0KT 4UF0B 4GKKT 5L3GB 2X0HA 5GONE 4JI0T 4H9NC 5FXXA 5JDHA 5LNKA 5JDMA 2WP9A 1KEYA 3NVOA 3VKHA 3SFEA 5E0OA 2VKJA 1IJ5A 4Z8XA 1XZYA 2WSSV 4V1Av 3F57A 1YQ3A 2E8IA 1OEDB 3NRXA 4LMLA 4MLKA 2VKDA 3BQLA 3ZC1A 5LJMA 4PW8A 2BG9E 4EZ4A 5HXRA 3RHWA 2NW9A 2HH7A 4WZXA 4LF4T 2ZLYA 1HR0T 3HKBE 3K3QC 5LYJE 4KHZF 2IMLA 2V6YA 5EK4A 2MAWA 4WNKA 4P1NA 3ZJ1A 1UURA 4OHFA 4B6XA 4AKIA 5L3FB 3KVAA 4JI5T 4AKGA 2A9UA 5ETWA 4DNDA 2XQ3A 4JV5T 4GKJT 5HEHA 3EVYA 3OPCA 5LHIB 4IE0A 2J47A 3PU8A 1O3XA 1HS7A 4CI1B 4QXCB 5EZYE 2XAFB 4CZZB 4DR6T 1MMGA 3E0ZA 4YJ3E 3AAIA 3AAEB 4ZI3D 4AQYT 4TV9E 4YTPA 4KMCA 2H89A 3I9WA 1YD8G 1Y64B 1SE7A 5KMGP 3VRBA 4YTMA 4C91A 2BVMA 2LE8A 3RKOA 2A2FX 5L4HA 2KINB 3AEGA 2WZHA 4DV3T 3SWHA 4ERRA 3CK6A 4TWDA 1MMNA 2MYSA 4UEMA 1WYBA 4ASKA 1NEKA 4JI2T 5HXSA 5C8YE 4X65T 3C64A 2NW8A 4ZI2C 4L5GA 1KNZA 3AEEA 2Q9QD 2CPTA 2L9QA 3RLFF 1UGOA 2WDVA 3N5LA 1V9DA 2C0SA 4KUMB 2QYWA 3HKCE 1HG5A 4LMKA 2C5KT 4BJMA 2KWIB 1YQ4A 3H3MA 4HWCA 2NW7A 5LBMA 3TKLB 4YSYA 3WAJA 3MJXA 2E9XA 4DR5T 1FMWA 2UUCT 3ZYMA 1H7CA 2WM9A 4GK0E 3RYHE 4ZS3A 4JI8T 4U74A 1ZOYA 4X1YE 4WW0A 3E08A 4HFBA 2YDRA 2KSRA 1IBLT 2DLRA 2UXBT 3AE4A 1T7SA 3FZFB 1VRBA 2EHOB 5IYZE 4X1KE 2JJ9A 2JPFA 3V5SA 5HEGA 3RH3A 3MZKB 2CMRA 3X1DA 3AEFA 4ZI2D 2SPCA 1US7B 4YTNA 3ZN0B 2CWYA 1KNPA 1NENA 2I6HA 1U5PA 4QHOA 1OEDC 3ZMZB 3FXDB 3PUWF 3ZT7A 3FZLB 1R8IA 2VB6A 1MMDA 4DO0A 3ZCJA 5FXVA 3N2GE 1NAFA 5L4EA 3VHLA 2W00A 3A7MA 1HX1B 4FI5A 3CMLA 4PFOA 5FY1A 5BR8T 1BR2A 4FJOA 3CIRA 2OA5A 2V5DA 2CHOA 2MTQA 4HWHA 5CGMA 2JIWA 4IL4A 2XHEB 5FNVE 4EZHA 5EK2A 4ZOLE 1ZP0A 1M62A 2CBIA 4O4JE 5M4YA 5HEJA 5AQOB 3CWZB 2LLYA 4EEBA 2LSIA 4CQIA 4DR3T 3H3AA 2CRBA 1E7PA 2NTYA 4X66T 2DHRA 5L3BB 3UU6A 3HI2A 1QUUA 2CA5A 4MALA 5LGNB 3TLTA 2XUEA 2JQHA 2XM1A 1IBMT 4QH4A 4HTEA 4IT4A 4UVBB 3B5MA 3KBTA 4EOZB 2NP9A 1T72A 4AQFA 1T98A 3EABA 4DUYT 1FJGT 4TN7B 1J5ET 2JMKA 4NXMT 3FBLA 2PTFA 1BR1A 4K0UA 3P4SA 4JYAT 2W0GA 2R6GF 3LSVA 4LFCT 4BA9A 2VKHA 3ANWA 2ODUA 5JVDE 5IUXA 2W2UA 2WU5A 1G8XA 5AQLB 4DV2T 3TLWA 5L2LA 4UXNB 1VCSA 3Q5WA 5FP3A 4AQGA 4U2ZA 4Z91A 4P0AA 4H9PC 2XQYA 4I43B 4QX8B 4HWFA 3I9YA 2WQYA 4IDOA 2WU2A 3PTRB 3GN5B 2VWAA 3KV4A 4A5XA 5LA6E 2XAHB 2A3DA 3R6NA 2RA1A 5LP6E 2JQQA 2LKGA 4X20E 5AQIB 3RRWA 4DBQA 4AKRB 1DU2A 3AE1A 1ZEEA 4KI0F 2LRKA 5JH7E 2FJDA 2Q9QB 1HX8A 2K48A 2EHOA 1HNWT 4G63A 1IBKT 3G06A 2KMFA 4IDNA 3GA8A 3C51A 3L39A 5JRCB 5FYMA 2DL1A 3O9XA 1MNDA 3UUBA 2X0LB 3ZSTA 4DUZT 1KF6A 2RPAA 3KV9A 2V6XA 3AA7B 2AXDS 3VR8A 3OBVE 3ZMUB 4IDQA 1ZKEA 2VVNA 4ZZCA 4CN4A 3RPUA 3A8YC 3Q5XA 5HXHA 4ILBA 4O4IE 2B1EA 4U33A 3RX6A 4F8HA 3UU5A 4H9OC 4EGWA 5FKYA 3CQCB 4HFCA 2LKHA 5CA1E 2DI4A 1T8BA 3OKQA 1IAPA 4IGUA 4HEAA 4U7IA 2FJAA 3K1SA 2KZ7B 3HKEE 4A56A 5L3CB 3F2EA 3IEEA 3PV0F 1XDPA 2CEAA 3AEDA 4B3ST 2VK9A 2CE7A 3FZMB 5J2UE 2XAGB 4OX9T 3LBXB 3Q5EA 3IHRA 4PJJA 4ILUA 2WY2A 5AQJB 2HPJA 3ZMSB 4H63V 1YKHB 1LVFA 1XDOA 3FZKB 2WWUA 3U3IA 3OYXA 2XQ7A 3MACA 4LFAT 1VOMA 4DMVA 5KXJA 2CLYB 2MBGA 3OTOT 3RC3A 3Q2MA 2WZIA 2YK0A 3GMIA 4ZI3C 3AE7A 2VURA 2LT3A 5ABEA 5J0ZA 2NOXA 2WDRA 3QB5A 1J5WA 1D1BA 3MK7C 3PUSA 4IREA 2XPKA 2DNXA 2ZMAA 2WDQA 4HFVA 3P4WA 4HE8A 3LK3B 3N9MA 5HXEA 5LCYA 1B7TA 2YU2A 4B3RT 3O1IA 4EIWA 1NWMX 1J1JA 4B3MT 4JLEA 4ILCA 3ZT6A 2X68A 3ETUA 2NR4A 4X62T 4TWHA 5ABFA 3C4WA 2BDEA 4PAGA 5CA0E 5LXTE 3A5XA 3PUYF 2Q9QC 4PJLA 5KDMC 5AQVB 2QA7A 4IIJE 1IZNB 2XQ5A 3N2KE 2DWKA 3PE0A 3KBUA 5LG4A 4IE6A 5AQNB 1MIWA 2G0UA 3B57A 3ZN1B 5HYAA 1N34T 4E7ZA 3RI5A 3DJBA 3FHNA 3BK9A 1E2AA 1ZHCA 2LRLA 4IDZA 5HXCA 2V7KA 1G73A 3AECA 2V7LA 3P7IA 4WBNE 2BKOA 3HL6A 4Q25A 3ESLA 1UUSA 2LM9A 3RIAA 1CHUA 3AEAA 4O2AE 2HN2A 1W9RA 2WWVA 1CUNA 2VQFT 4NXNT 2X9XA 2JRKA 2W61A 4YHHT 4TZ4C 1XWMA 2VL0A 2BG9C 5JR9B 4M1PA 3CX7B 3JAFA 3RF1A 3QNUA 4JI6T 4LF6T 4UV9B 4XBFB 4EYYR 2K5BB 4DMWA 4DV0T 5AQGB 4B3TT 4UF0A 4YFSA 3U78A 2JMHA 3ONXA 3JADA 3AVSA 4JI7T 2WCAA 4ZZBA 3CVRA 1FMVA 5L3DB 4AKHA 5EK3A 4LF8T 4I4TE 3RIFA 5J2TE 4ZI7E 4OYKA 2YDSA 4DIDB 1Z8UA 3EDUA 4HGAA 5JDGA 4GOUA 5ABHA 4I55E 3VKGA 4OYJA 2E5LT 5FL0A 3SRZA 3UUMA 1OEDA 3K8PC 3FB2A 2C5JA 3PUAA 2LSYA 1W0BA 5HWYA 1UX5A 3EHZA 2BVLA 2N2NA 3EAMA 4LMJA 2CLYC 2FBWA 1IJ6A 4AXPA 2X0YA 3CPZA 5CJ5A 4PNIA 2XTLA 3LG7A 1D0YA 3PU3A 2JQKA 3KINB 4CN6A 3ZKRA 4JI1T 3ONLC 2HHHT 4U7YA 5JDQA 3N9NA 2L3LA 1FIOA 5FXZA 4ZEYA 4O2BE 3N9LA 1BR0A 2E9XD 4PK4A 3VR9A 5C3JA 5L3EB 3MKDA 1E1HB 4IL9A 3D0TA 2XJ7A 3P4QA 4KX6A 4MBQA 1JNRA 2XQ8A 3DP7A 3AVRA 4UR9A 4NUVA 4DVDA 2XY8B 2VASA 2X67A 3AEBA 3AE8A 4H9RC 3ZSSA 3OJAA 2DWGA 3OVUA 4LF9T 2CM0A 3PUGA 2MPKA 5LOVE 2D0TA 2HPLA 3FZHB 2OV9A 1SUMB 1KNRA 4KBMB 2YKSA 5A1LA 5LGTB 1W09A 2N1GA 4PJMA 3KV6A 2YDQA 2K9AA 3LDQB 2N9DA 1QLBA 1X9BA 4DV6T 3TLSA 4QXBB 1LKXA 4TNVA 2LSKA 4TUYE 5JR9C 2WAUA 3RGLA 3TLUA 4LF5T 2IAKA 5JDFA 3MA9A 1S94A 4F6RC 3QOFA 3PURA 5LJNA 3H37A 3RRCA 4IDPA 1SHZC 1S35A 4DR7T 5LMUT 3CKDA 2J62A 2V5CA 1M7KA 3PUQA 2FJEA 5AQUB 4HKAA 4P0BA 5F5WA 4O4HE 3AE9A 3AAAB 4LFBT 3WI3A 2LSGA 2M67A 2QVAA 3K3OA 3P4PA 2YU1A 2V7JA 4ISTA 4YJ2E 4YT0A 1HTJF 5DABA 2C5IT 3ZC0A 2KXPB 4H9QC 3AB3B 2CXLA 5AQSB 4G2AA 3CQXC 4UELA 2IHR1 4U31A 3QC9A 3UUXB 2BBHA 2K24A 5HEOA 1OWAA 4U3CA 2ACZA 2UU9T 4GYRA 1MIYA 1D0XA 3C4ZA 3RYFE 4X1IE 3UU8A 1GQEA 3R84B 3AA1B 2VL8A 3ONJA 2UUBT 5AQKB 4Z90A 3CX6B 2CWOA 4O4LE 2ZM6T 1YKEB 3ZCIA 4U72A 1QSDA 4ZS2A 5F8PA 3RIUC 3EUHA 4H9SE 2BG9B 3RQUA 1X79A 2LHNA 5LHGB 4QKNA 4XAXB 2B76A 3NWIA 2E5VA 4U2YA 2ZM0A 5HCMA 3MXZA 2J4GA 2L8KA 3AE5A 4XZCA 2LSJA 5FMNA 4DR1T 5LBQB 2EHOD
chains in the Genus database with same CATH topology
1I94T 4JYAT 3T1HT 1N34T 4LFCT 1N33T 4LF4T 4DV1T 2E5LT 4LFBT 1HR0T 4LF9T 4DR2T 4DV2T 1XNRT 5BR8T 4JI2T 2F4VT 1N32T 4DUZT 4LFAT 4X65T 4YY3T 3OTOT 4KHPT 5LMNT 2UUAT 4JI5T 2VQET 4JI3T 2UU9T 2VQFT 1HNZT 4JV5T 4GKJT 4DV5T 4NXNT 4DR3T 4YHHT 2UUBT 4K0KT 4X66T 5IWAT 4DV6T 4LF7T 4JI4T 4GKKT 4DR5T 2UXDT 4B3RT 4JI0T 2ZM6T 4JI1T 2UUCT 1HNXT 4DV7T 4B3MT 2HHHT 1XNQT 4DR6T 4JI6T 1N36T 4LF6T 4JI8T 4DR4T 4X62T 4AQYT 1IBLT 2UXBT 4LF5T 4DV0T 1IBMT 4B3TT 4X64T 1HNWT 3T1YT 4DV4T 4B3ST 4JI7T 2UXCT 1IBKT 4DR7T 5LMUT 1XMOT 1XMQT 4LF8T 4DUYT 4OX9T 1FJGT 1J5ET 4NXMT 4DR1T 4DV3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 T;  4JYA T;  3T1H T;  1N34 T;  4LFC T;  1N33 T;  4LF4 T;  4DV1 T;  2E5L T;  4LFB T;  1HR0 T;  4LF9 T;  4DR2 T;  4DV2 T;  1XNR T;  5BR8 T;  4JI2 T;  2F4V T;  1N32 T;  4DUZ T;  4LFA T;  4X65 T;  4YY3 T;  3OTO T;  4KHP T;  5LMN T;  2UUA T;  4JI5 T;  2VQE T;  4JI3 T;  2UU9 T;  2VQF T;  1HNZ T;  4JV5 T;  4GKJ T;  4DV5 T;  4NXN T;  4DR3 T;  4YHH T;  2UUB T;  4K0K T;  4X66 T;  5IWA T;  4DV6 T;  4LF7 T;  4JI4 T;  4GKK T;  4DR5 T;  2UXD T;  4B3R T;  4JI0 T;  2ZM6 T;  4JI1 T;  2UUC T;  1HNX T;  4DV7 T;  4B3M T;  2HHH T;  1XNQ T;  4DR6 T;  4JI6 T;  1N36 T;  4LF6 T;  4JI8 T;  4DR4 T;  4X62 T;  4AQY T;  1IBL T;  2UXB T;  4LF5 T;  4DV0 T;  1IBM T;  4B3T T;  4X64 T;  1HNW T;  3T1Y T;  4DV4 T;  4B3S T;  4JI7 T;  2UXC T;  1IBK T;  4DR7 T;  5LMU T;  1XMO T;  1XMQ T;  4LF8 T;  4DUY T;  4OX9 T;  1FJG T;  1J5E T;  4NXM T;  4DR1 T;  4DV3 T; 
#chains in the Genus database with same CATH topology
 2VKO A;  2XQ4 A;  2A72 A;  2WMO A;  2Y6X A;  3T1H T;  4E7S A;  4N78 D;  1I6Z A;  3J7Y q;  3I1A A;  2IC9 A;  1XNR T;  3L09 A;  1WRD A;  2BS4 A;  3O1J A;  2MOZ A;  2X66 A;  4ZHQ E;  2E9X B;  2XQA A;  3CQG B;  3NZP A;  3NBX X;  3IF8 B;  3QUJ A;  3UU4 A;  4GK5 E;  2ZM8 A;  2XSB A;  5FVK A;  5J1G A;  2Y8D A;  4CI3 B;  5ABG A;  3ZLI A;  2M6B A;  1UCU A;  4ILA A;  4IE7 A;  2WMN A;  2Y48 B;  4GIW A;  2RP4 A;  4NIQ A;  2W66 A;  3PJA A;  5AQT B;  2X9H A;  4DV7 T;  1D1A A;  2ES0 A;  3GN5 A;  1U4Q A;  1KK7 A;  2YEV C;  2LHR A;  3P8C D;  3JCF A;  1EZ3 A;  2XAJ B;  4GYS A;  1JNZ A;  2D5U A;  5IHY A;  3ZJ2 A;  4AIU A;  2PG8 A;  2V7M A;  4EAH A;  4DV4 T;  3ZMT B;  5FL1 A;  4YSX A;  4L0R A;  2P9B A;  2CCQ A;  4MHC A;  1HG2 A;  1XMQ T;  1ZV4 X;  2XM2 A;  3VRA A;  2X9W A;  2Q9Q A;  3E22 E;  1YW0 A;  2ZM2 A;  2H88 A;  3HR0 A;  3UFG A;  4TV8 E;  2F4V T;  5CB4 E;  1KFY A;  3RC8 A;  5AQP B;  3N9O A;  4HFH A;  5ADX L;  5JRC A;  5FY0 A;  2CBJ A;  4IE5 A;  2W67 A;  3RQW A;  1OED E;  2D0U A;  5H6R B;  4HFI A;  3PUV F;  2H7V C;  2AE9 A;  1OXZ A;  5FVL A;  3L3P A;  2OLT A;  4JI4 T;  4TX5 A;  3KDS E;  2WS3 A;  4I0U A;  3AXJ B;  4UIG A;  2W4X A;  3ZPO A;  3ZT5 A;  4EED A;  2W63 A;  5DQW A;  3HKD E;  1HFA A;  3EI0 A;  2BG9 A;  3N2O A;  3SS1 A;  2IIU A;  2UXX B;  3ANW B;  4QX7 B;  4JUY A;  3UT5 E;  4CI2 B;  2PFV A;  3PUX F;  5LHH B;  4QH5 A;  4COF A;  1BR4 A;  5LB7 B;  3L8R A;  2KND A;  2UXN B;  5AFU L;  2E2A A;  2FJB A;  4L9I A;  2YN6 A;  4CXY A;  3EDV A;  4AI6 A;  3UUL A;  3AE3 A;  5C2T A;  5AQQ B;  3KVB A;  4HWI B;  2X51 A;  1L0V A;  4MFR A;  1W0A A;  3OYZ A;  4PFP A;  5CFB A;  3LBX A;  2Z6E A;  3UQ7 A;  4KHP T;  2JQ9 A;  2PJQ A;  3O4X E;  5LMN T;  1FEW A;  2E9X C;  1YXR A;  1WR6 A;  2V8S V;  2QRX A;  2LJL A;  2WB5 A;  2CXF A;  2GK9 A;  4JI3 T;  3SOL A;  2KLQ A;  2FUP A;  1AJ3 A;  4JEH B;  3Q9D A;  3FXE B;  2ACX A;  3UTK A;  4PJN A;  2I59 A;  5IWA T;  1UK5 A;  5AQH B;  5JQG E;  1XNQ T;  4EYU A;  4KP3 C;  3UUN A;  3ZMV B;  4CXW A;  2WBL A;  4QWN B;  2XSA A;  4C90 A;  3M3Z B;  5BMV E;  4J2C A;  3JAE A;  4EXT A;  5HAX A;  4TWF A;  3ETV A;  5TAO A;  5LG3 A;  4X64 T;  3W15 B;  3I0Q A;  2XAQ B;  1WCR A;  1MNE A;  3K3N A;  4TNW A;  1WYC A;  3ZEF B;  2NTX A;  4HFD A;  3V5U A;  2D2S A;  3J9X 1;  3UQ4 A;  3RKG A;  3I0O A;  3JC6 C;  1HF8 A;  4HWD A;  5F3J A;  2IC6 A;  3IA3 A;  5JTG A;  1WFD A;  4OFZ A;  3IBP A;  3N9P A;  1Z0P A;  2K3W A;  2QGS A;  4P09 A;  3M65 A;  2XZE A;  3TLV A;  1MIV A;  3KFW X;  5L47 A;  4O8S A;  5HEU A;  4IE4 A;  1LVK A;  2BS2 A;  3P4R A;  4H63 H;  5HWX A;  4DV5 T;  4ANJ A;  4YSZ A;  2I0M A;  2ODV A;  3FBZ A;  2IDO B;  3LJC A;  3AA6 B;  3Q5D A;  2BS3 A;  3BQK A;  4BJN A;  4LF7 T;  3RYC E;  4WBO A;  3LK4 2;  2PBI A;  1WLX A;  2LEH A;  5HCJ A;  1N36 T;  3AXJ A;  4JEU B;  4AQF C;  5JDL A;  5FY7 A;  3T8O A;  4YHJ A;  3JC6 D;  1LRZ A;  4YXD A;  3UU3 A;  2J1D G;  4OK0 A;  3T1Y T;  4AKL A;  2XQ9 A;  3NKZ A;  5JR9 A;  3C4X A;  3AE6 A;  4DBR A;  5AQF B;  4EV6 A;  1XMO T;  1D0Z A;  3PDY A;  3UFE A;  2XQ6 A;  2CXD A;  4QXH B;  1HCI A;  1I94 T;  4NPP A;  2CHN A;  2KT9 A;  4A98 A;  4HN9 A;  1N33 T;  5JDN A;  4JBW F;  2BKP A;  3C50 A;  3ZYL A;  2XAS B;  3PUZ F;  3LFM A;  2V6Y B;  3RYI E;  4I50 E;  1SA0 E;  2H3R A;  3O1H A;  2LOP A;  4WYV A;  4CN1 A;  2DCF A;  3AA0 B;  4AIS A;  2V1D B;  5FXW A;  5JRE A;  4IHJ E;  2KWH A;  2W62 A;  5ABF B;  4EB6 E;  3WAK A;  1HNZ T;  4PK6 A;  3CX8 B;  1MMA A;  4NUU A;  4PK5 A;  3SFD A;  2UXD T;  4ZXL A;  2EHO C;  1HNX T;  2V7I A;  3ABV A;  5DQV A;  2YIN A;  4DR4 T;  2NWB A;  3NZQ A;  3C98 B;  2LM2 A;  2LOS A;  4ADZ A;  3NRY A;  3S4U A;  2D9D A;  1UX4 A;  4A97 A;  3F31 A;  4BAY B;  2UXC T;  4YLH A;  3BQI A;  4UVC B;  3RIU A;  2H7O A;  4UV8 B;  3ZYK A;  3VU7 H;  5H6Q B;  2V26 A;  3HA4 A;  2BKN A;  1D1C A;  2X9Y A;  3DTO A;  2HN1 A;  4UVA B;  4DV1 T;  3B13 A;  3N9Q A;  4DR2 T;  5DJQ C;  4ISS A;  2YOE A;  4CXX A;  1N32 T;  3QB5 K;  1VCT A;  5LGU B;  5KX5 E;  4YY3 T;  3AE2 A;  3LK2 B;  2BZB A;  2VVS A;  2IUB A;  3PJA J;  3KV5 A;  4HFE A;  4X5T A;  4QH1 A;  1WR0 A;  3P50 A;  2UUA T;  2VQE T;  5AQR B;  3GWH A;  2BBJ A;  3QK6 A;  1Y01 A;  2IW5 B;  5AQM B;  2M6I A;  4K0K T;  4UF0 B;  4GKK T;  5L3G B;  2X0H A;  5GON E;  4JI0 T;  4H9N C;  5FXX A;  5JDH A;  5LNK A;  5JDM A;  2WP9 A;  1KEY A;  3NVO A;  3VKH A;  3SFE A;  5E0O A;  2VKJ A;  1IJ5 A;  4Z8X A;  1XZY A;  2WSS V;  4V1A v;  3F57 A;  1YQ3 A;  2E8I A;  1OED B;  3NRX A;  4LML A;  4MLK A;  2VKD A;  3BQL A;  3ZC1 A;  5LJM A;  4PW8 A;  2BG9 E;  4EZ4 A;  5HXR A;  3RHW A;  2NW9 A;  2HH7 A;  4WZX A;  4LF4 T;  2ZLY A;  1HR0 T;  3HKB E;  3K3Q C;  5LYJ E;  4KHZ F;  2IML A;  2V6Y A;  5EK4 A;  2MAW A;  4WNK A;  4P1N A;  3ZJ1 A;  1UUR A;  4OHF A;  4B6X A;  4AKI A;  5L3F B;  3KVA A;  4JI5 T;  4AKG A;  2A9U A;  5ETW A;  4DND A;  2XQ3 A;  4JV5 T;  4GKJ T;  5HEH A;  3EVY A;  3OPC A;  5LHI B;  4IE0 A;  2J47 A;  3PU8 A;  1O3X A;  1HS7 A;  4CI1 B;  4QXC B;  5EZY E;  2XAF B;  4CZZ B;  4DR6 T;  1MMG A;  3E0Z A;  4YJ3 E;  3AAI A;  3AAE B;  4ZI3 D;  4AQY T;  4TV9 E;  4YTP A;  4KMC A;  2H89 A;  3I9W A;  1YD8 G;  1Y64 B;  1SE7 A;  5KMG P;  3VRB A;  4YTM A;  4C91 A;  2BVM A;  2LE8 A;  3RKO A;  2A2F X;  5L4H A;  2KIN B;  3AEG A;  2WZH A;  4DV3 T;  3SWH A;  4ERR A;  3CK6 A;  4TWD A;  1MMN A;  2MYS A;  4UEM A;  1WYB A;  4ASK A;  1NEK A;  4JI2 T;  5HXS A;  5C8Y E;  4X65 T;  3C64 A;  2NW8 A;  4ZI2 C;  4L5G A;  1KNZ A;  3AEE A;  2Q9Q D;  2CPT A;  2L9Q A;  3RLF F;  1UGO A;  2WDV A;  3N5L A;  1V9D A;  2C0S A;  4KUM B;  2QYW A;  3HKC E;  1HG5 A;  4LMK A;  2C5K T;  4BJM A;  2KWI B;  1YQ4 A;  3H3M A;  4HWC A;  2NW7 A;  5LBM A;  3TKL B;  4YSY A;  3WAJ A;  3MJX A;  2E9X A;  4DR5 T;  1FMW A;  2UUC T;  3ZYM A;  1H7C A;  2WM9 A;  4GK0 E;  3RYH E;  4ZS3 A;  4JI8 T;  4U74 A;  1ZOY A;  4X1Y E;  4WW0 A;  3E08 A;  4HFB A;  2YDR A;  2KSR A;  1IBL T;  2DLR A;  2UXB T;  3AE4 A;  1T7S A;  3FZF B;  1VRB A;  2EHO B;  5IYZ E;  4X1K E;  2JJ9 A;  2JPF A;  3V5S A;  5HEG A;  3RH3 A;  3MZK B;  2CMR A;  3X1D A;  3AEF A;  4ZI2 D;  2SPC A;  1US7 B;  4YTN A;  3ZN0 B;  2CWY A;  1KNP A;  1NEN A;  2I6H A;  1U5P A;  4QHO A;  1OED C;  3ZMZ B;  3FXD B;  3PUW F;  3ZT7 A;  3FZL B;  1R8I A;  2VB6 A;  1MMD A;  4DO0 A;  3ZCJ A;  5FXV A;  3N2G E;  1NAF A;  5L4E A;  3VHL A;  2W00 A;  3A7M A;  1HX1 B;  4FI5 A;  3CML A;  4PFO A;  5FY1 A;  5BR8 T;  1BR2 A;  4FJO A;  3CIR A;  2OA5 A;  2V5D A;  2CHO A;  2MTQ A;  4HWH A;  5CGM A;  2JIW A;  4IL4 A;  2XHE B;  5FNV E;  4EZH A;  5EK2 A;  4ZOL E;  1ZP0 A;  1M62 A;  2CBI A;  4O4J E;  5M4Y A;  5HEJ A;  5AQO B;  3CWZ B;  2LLY A;  4EEB A;  2LSI A;  4CQI A;  4DR3 T;  3H3A A;  2CRB A;  1E7P A;  2NTY A;  4X66 T;  2DHR A;  5L3B B;  3UU6 A;  3HI2 A;  1QUU A;  2CA5 A;  4MAL A;  5LGN B;  3TLT A;  2XUE A;  2JQH A;  2XM1 A;  1IBM T;  4QH4 A;  4HTE A;  4IT4 A;  4UVB B;  3B5M A;  3KBT A;  4EOZ B;  2NP9 A;  1T72 A;  4AQF A;  1T98 A;  3EAB A;  4DUY T;  1FJG T;  4TN7 B;  1J5E T;  2JMK A;  4NXM T;  3FBL A;  2PTF A;  1BR1 A;  4K0U A;  3P4S A;  4JYA T;  2W0G A;  2R6G F;  3LSV A;  4LFC T;  4BA9 A;  2VKH A;  3ANW A;  2ODU A;  5JVD E;  5IUX A;  2W2U A;  2WU5 A;  1G8X A;  5AQL B;  4DV2 T;  3TLW A;  5L2L A;  4UXN B;  1VCS A;  3Q5W A;  5FP3 A;  4AQG A;  4U2Z A;  4Z91 A;  4P0A A;  4H9P C;  2XQY A;  4I43 B;  4QX8 B;  4HWF A;  3I9Y A;  2WQY A;  4IDO A;  2WU2 A;  3PTR B;  3GN5 B;  2VWA A;  3KV4 A;  4A5X A;  5LA6 E;  2XAH B;  2A3D A;  3R6N A;  2RA1 A;  5LP6 E;  2JQQ A;  2LKG A;  4X20 E;  5AQI B;  3RRW A;  4DBQ A;  4AKR B;  1DU2 A;  3AE1 A;  1ZEE A;  4KI0 F;  2LRK A;  5JH7 E;  2FJD A;  2Q9Q B;  1HX8 A;  2K48 A;  2EHO A;  1HNW T;  4G63 A;  1IBK T;  3G06 A;  2KMF A;  4IDN A;  3GA8 A;  3C51 A;  3L39 A;  5JRC B;  5FYM A;  2DL1 A;  3O9X A;  1MND A;  3UUB A;  2X0L B;  3ZST A;  4DUZ T;  1KF6 A;  2RPA A;  3KV9 A;  2V6X A;  3AA7 B;  2AXD S;  3VR8 A;  3OBV E;  3ZMU B;  4IDQ A;  1ZKE A;  2VVN A;  4ZZC A;  4CN4 A;  3RPU A;  3A8Y C;  3Q5X A;  5HXH A;  4ILB A;  4O4I E;  2B1E A;  4U33 A;  3RX6 A;  4F8H A;  3UU5 A;  4H9O C;  4EGW A;  5FKY A;  3CQC B;  4HFC A;  2LKH A;  5CA1 E;  2DI4 A;  1T8B A;  3OKQ A;  1IAP A;  4IGU A;  4HEA A;  4U7I A;  2FJA A;  3K1S A;  2KZ7 B;  3HKE E;  4A56 A;  5L3C B;  3F2E A;  3IEE A;  3PV0 F;  1XDP A;  2CEA A;  3AED A;  4B3S T;  2VK9 A;  2CE7 A;  3FZM B;  5J2U E;  2XAG B;  4OX9 T;  3LBX B;  3Q5E A;  3IHR A;  4PJJ A;  4ILU A;  2WY2 A;  5AQJ B;  2HPJ A;  3ZMS B;  4H63 V;  1YKH B;  1LVF A;  1XDO A;  3FZK B;  2WWU A;  3U3I A;  3OYX A;  2XQ7 A;  3MAC A;  4LFA T;  1VOM A;  4DMV A;  5KXJ A;  2CLY B;  2MBG A;  3OTO T;  3RC3 A;  3Q2M A;  2WZI A;  2YK0 A;  3GMI A;  4ZI3 C;  3AE7 A;  2VUR A;  2LT3 A;  5ABE A;  5J0Z A;  2NOX A;  2WDR A;  3QB5 A;  1J5W A;  1D1B A;  3MK7 C;  3PUS A;  4IRE A;  2XPK A;  2DNX A;  2ZMA A;  2WDQ A;  4HFV A;  3P4W A;  4HE8 A;  3LK3 B;  3N9M A;  5HXE A;  5LCY A;  1B7T A;  2YU2 A;  4B3R T;  3O1I A;  4EIW A;  1NWM X;  1J1J A;  4B3M T;  4JLE A;  4ILC A;  3ZT6 A;  2X68 A;  3ETU A;  2NR4 A;  4X62 T;  4TWH A;  5ABF A;  3C4W A;  2BDE A;  4PAG A;  5CA0 E;  5LXT E;  3A5X A;  3PUY F;  2Q9Q C;  4PJL A;  5KDM C;  5AQV B;  2QA7 A;  4IIJ E;  1IZN B;  2XQ5 A;  3N2K E;  2DWK A;  3PE0 A;  3KBU A;  5LG4 A;  4IE6 A;  5AQN B;  1MIW A;  2G0U A;  3B57 A;  3ZN1 B;  5HYA A;  1N34 T;  4E7Z A;  3RI5 A;  3DJB A;  3FHN A;  3BK9 A;  1E2A A;  1ZHC A;  2LRL A;  4IDZ A;  5HXC A;  2V7K A;  1G73 A;  3AEC A;  2V7L A;  3P7I A;  4WBN E;  2BKO A;  3HL6 A;  4Q25 A;  3ESL A;  1UUS A;  2LM9 A;  3RIA A;  1CHU A;  3AEA A;  4O2A E;  2HN2 A;  1W9R A;  2WWV A;  1CUN A;  2VQF T;  4NXN T;  2X9X A;  2JRK A;  2W61 A;  4YHH T;  4TZ4 C;  1XWM A;  2VL0 A;  2BG9 C;  5JR9 B;  4M1P A;  3CX7 B;  3JAF A;  3RF1 A;  3QNU A;  4JI6 T;  4LF6 T;  4UV9 B;  4XBF B;  4EYY R;  2K5B B;  4DMW A;  4DV0 T;  5AQG B;  4B3T T;  4UF0 A;  4YFS A;  3U78 A;  2JMH A;  3ONX A;  3JAD A;  3AVS A;  4JI7 T;  2WCA A;  4ZZB A;  3CVR A;  1FMV A;  5L3D B;  4AKH A;  5EK3 A;  4LF8 T;  4I4T E;  3RIF A;  5J2T E;  4ZI7 E;  4OYK A;  2YDS A;  4DID B;  1Z8U A;  3EDU A;  4HGA A;  5JDG A;  4GOU A;  5ABH A;  4I55 E;  3VKG A;  4OYJ A;  2E5L T;  5FL0 A;  3SRZ A;  3UUM A;  1OED A;  3K8P C;  3FB2 A;  2C5J A;  3PUA A;  2LSY A;  1W0B A;  5HWY A;  1UX5 A;  3EHZ A;  2BVL A;  2N2N A;  3EAM A;  4LMJ A;  2CLY C;  2FBW A;  1IJ6 A;  4AXP A;  2X0Y A;  3CPZ A;  5CJ5 A;  4PNI A;  2XTL A;  3LG7 A;  1D0Y A;  3PU3 A;  2JQK A;  3KIN B;  4CN6 A;  3ZKR A;  4JI1 T;  3ONL C;  2HHH T;  4U7Y A;  5JDQ A;  3N9N A;  2L3L A;  1FIO A;  5FXZ A;  4ZEY A;  4O2B E;  3N9L A;  1BR0 A;  2E9X D;  4PK4 A;  3VR9 A;  5C3J A;  5L3E B;  3MKD A;  1E1H B;  4IL9 A;  3D0T A;  2XJ7 A;  3P4Q A;  4KX6 A;  4MBQ A;  1JNR A;  2XQ8 A;  3DP7 A;  3AVR A;  4UR9 A;  4NUV A;  4DVD A;  2XY8 B;  2VAS A;  2X67 A;  3AEB A;  3AE8 A;  4H9R C;  3ZSS A;  3OJA A;  2DWG A;  3OVU A;  4LF9 T;  2CM0 A;  3PUG A;  2MPK A;  5LOV E;  2D0T A;  2HPL A;  3FZH B;  2OV9 A;  1SUM B;  1KNR A;  4KBM B;  2YKS A;  5A1L A;  5LGT B;  1W09 A;  2N1G A;  4PJM A;  3KV6 A;  2YDQ A;  2K9A A;  3LDQ B;  2N9D A;  1QLB A;  1X9B A;  4DV6 T;  3TLS A;  4QXB B;  1LKX A;  4TNV A;  2LSK A;  4TUY E;  5JR9 C;  2WAU A;  3RGL A;  3TLU A;  4LF5 T;  2IAK A;  5JDF A;  3MA9 A;  1S94 A;  4F6R C;  3QOF A;  3PUR A;  5LJN A;  3H37 A;  3RRC A;  4IDP A;  1SHZ C;  1S35 A;  4DR7 T;  5LMU T;  3CKD A;  2J62 A;  2V5C A;  1M7K A;  3PUQ A;  2FJE A;  5AQU B;  4HKA A;  4P0B A;  5F5W A;  4O4H E;  3AE9 A;  3AAA B;  4LFB T;  3WI3 A;  2LSG A;  2M67 A;  2QVA A;  3K3O A;  3P4P A;  2YU1 A;  2V7J A;  4IST A;  4YJ2 E;  4YT0 A;  1HTJ F;  5DAB A;  2C5I T;  3ZC0 A;  2KXP B;  4H9Q C;  3AB3 B;  2CXL A;  5AQS B;  4G2A A;  3CQX C;  4UEL A;  2IHR 1;  4U31 A;  3QC9 A;  3UUX B;  2BBH A;  2K24 A;  5HEO A;  1OWA A;  4U3C A;  2ACZ A;  2UU9 T;  4GYR A;  1MIY A;  1D0X A;  3C4Z A;  3RYF E;  4X1I E;  3UU8 A;  1GQE A;  3R84 B;  3AA1 B;  2VL8 A;  3ONJ A;  2UUB T;  5AQK B;  4Z90 A;  3CX6 B;  2CWO A;  4O4L E;  2ZM6 T;  1YKE B;  3ZCI A;  4U72 A;  1QSD A;  4ZS2 A;  5F8P A;  3RIU C;  3EUH A;  4H9S E;  2BG9 B;  3RQU A;  1X79 A;  2LHN A;  5LHG B;  4QKN A;  4XAX B;  2B76 A;  3NWI A;  2E5V A;  4U2Y A;  2ZM0 A;  5HCM A;  3MXZ A;  2J4G A;  2L8K A;  3AE5 A;  4XZC A;  2LSJ A;  5FMN A;  4DR1 T;  5LBQ B;  2EHO D; 
#chains in the Genus database with same CATH homology
 1I94 T;  4JYA T;  3T1H T;  1N34 T;  4LFC T;  1N33 T;  4LF4 T;  4DV1 T;  2E5L T;  4LFB T;  1HR0 T;  4LF9 T;  4DR2 T;  4DV2 T;  1XNR T;  5BR8 T;  4JI2 T;  2F4V T;  1N32 T;  4DUZ T;  4LFA T;  4X65 T;  4YY3 T;  3OTO T;  4KHP T;  5LMN T;  2UUA T;  4JI5 T;  2VQE T;  4JI3 T;  2UU9 T;  2VQF T;  1HNZ T;  4JV5 T;  4GKJ T;  4DV5 T;  4NXN T;  4DR3 T;  4YHH T;  2UUB T;  4K0K T;  4X66 T;  5IWA T;  4DV6 T;  4LF7 T;  4JI4 T;  4GKK T;  4DR5 T;  2UXD T;  4B3R T;  4JI0 T;  2ZM6 T;  4JI1 T;  2UUC T;  1HNX T;  4DV7 T;  4B3M T;  2HHH T;  1XNQ T;  4DR6 T;  4JI6 T;  1N36 T;  4LF6 T;  4JI8 T;  4DR4 T;  4X62 T;  4AQY T;  1IBL T;  2UXB T;  4LF5 T;  4DV0 T;  1IBM T;  4B3T T;  4X64 T;  1HNW T;  3T1Y T;  4DV4 T;  4B3S T;  4JI7 T;  2UXC T;  1IBK T;  4DR7 T;  5LMU T;  1XMO T;  1XMQ T;  4LF8 T;  4DUY T;  4OX9 T;  1FJG T;  1J5E T;  4NXM T;  4DR1 T;  4DV3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...