2ZM6T

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
94
structure length
94
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
total genus 29
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2zm6T00
4DR3T 4JI4T 2HHHT 2UU9T 4DV6T 4YY3T 4B3RT 1N34T 4YHHT 4B3TT 4DR1T 4LF5T 4LF7T 4LFBT 2E5LT 1XNRT 4JI5T 5BR8T 4DR6T 1XNQT 4AQYT 4LF9T 4DR2T 4DR4T 4X64T 4DR5T 5IWAT 2UUBT 4LFCT 4X62T 4DV0T 4DR7T 5LMNT 2F4VT 4DUZT 4GKKT 3OTOT 1N36T 4JI7T 4JYAT 4JI2T 4X66T 4DUYT 2UXDT 4B3ST 2VQET 2UXBT 1HNWT 3T1HT 1HNXT 4X65T 1IBKT 4DV3T 4JI1T 4KHPT 1IBLT 1XMOT 4LF8T 4B3MT 4NXMT 4JI3T 4LF6T 4JV5T 2ZM6T 1IBMT 1FJGT 1XMQT 1HNZT 3T1YT 4OX9T 4DV7T 2UUAT 1N33T 4LF4T 4DV2T 4NXNT 1N32T 4DV4T 5LMUT 1I94T 4JI0T 4DV1T 4DV5T 1HR0T 4JI6T 2UUCT 4LFAT 2UXCT 1J5ET 4JI8T 2VQFT 4GKJT 4K0KT
chains in the Genus database with same CATH superfamily
3M3ZB 1MIVA 3N9MA 3RLFF 3NVOA 2FJDA 1VCTA 2RP4A 4MHCA 2I6HA 4COFA 3ZSSA 4ILUA 4YLHA 2C0SA 3ZMTB 2W2UA 4CXWA 3WAJA 5FY7A 2CHOA 3C4XA 3FZHB 2V6YB 3PU3A 5HYAA 3PUWF 2KXPB 3E0ZA 2LT3A 2YDRA 2W0GA 2IW5B 1G73A 4LFCT 4Z8XA 4DUZT 4PJNA 3AE1A 3ZMZB 2BZBA 4DIDB 1KF6A 2VWAA 2E2AA 3ZT5A 4P0AA 3J7Yq 2BKPA 2LSYA 3C50A 3KVAA 5CA0E 4Q25A 4B3MT 2DWGA 2W66A 5J2TE 4HFVA 2YU1A 3B5MA 3U3IA 2Q9QA 1QSDA 3TLUA 4PJJA 3T8OA 3C4ZA 4LFAT 4PFPA 2VQFT 3O1JA 3WI3A 3GN5A 3UU6A 3UQ7A 4EZHA 5HEHA 3RPUA 2PBIA 3ETUA 2V7MA 4TZ4C 5TAOA 4EYUA 4YJ3E 4FI5A 3FXEB 5EK3A 4GK0E 2LSIA 3I9WA 2CE7A 3FB2A 4LF9T 4AQFA 3ZYMA 4ERRA 5C3JA 5LJNA 2NW9A 2XM1A 5ABEA 1ZEEA 4QXCB 1YW0A 1WRDA 3TLTA 3O9XA 4IE4A 5L3DB 3JC6D 1L0VA 1NENA 3RYIE 3RYHE 2OLTA 2XASB 3OJAA 3PUYF 1R8IA 2VQET 3O1HA 1HNXT 2WU5A 3P4RA 3IA3A 5DABA 2XHEB 3FZLB 3WAKA 3I0OA 1XMQT 2D0TA 2FJAA 3Q5EA 5CA1E 3LK2B 5JH7E 2CM0A 5LMUT 4O2AE 1I94T 2E8IA 3VR9A 1MIWA 2KNDA 3GA8A 2WZIA 4GKJT 2WCAA 2ES0A 1D0ZA 3AEFA 1V9DA 1U5PA 5AQKB 4UF0B 3NRYA 4ZI2C 5C8YE 2LOPA 4KI0F 3ZPOA 2VL8A 4KMCA 2EHOD 3V5SA 2CXFA 2A72A 4AKIA 2LHRA 2EHOB 1Z8UA 3IEEA 3LFMA 3PDYA 1SUMB 5FP3A 3ETVA 4UIGA 3UULA 5LGTB 2LOSA 2LM2A 4QH4A 2AE9A 2D2SA 3N9NA 2SPCA 4OYJA 4DV0T 4NPPA 3Q5DA 4HE8A 2HN1A 4ANJA 4YT0A 2DHRA 4A98A 4CQIA 3E22E 2CMRA 2YK0A 4HFBA 2XQ9A 2XZEA 4F6RC 1T72A 1MMNA 5JDFA 3AVSA 5J0ZA 3ZSTA 2IMLA 3EAMA 3VU7H 1Y01A 1HTJF 5AQGB 2M6BA 5JR9C 1N32T 3AECA 1MIYA 5FY0A 4YHJA 1OWAA 4U31A 1NEKA 4ZZCA 1UUSA 2BBJA 4KUMB 3S4UA 4GYSA 1OEDA 3E08A 4HGAA 3CQGB 4PJMA 4AI6A 2K5BB 5LG3A 4ISSA 4U3CA 3SWHA 4O8SA 2LRLA 3AA0B 4B3TT 4HWDA 1HG2A 2GK9A 5HXRA 1YKEB 3MZKB 4QH1A 4X1KE 2WM9A 3P7IA 1D1CA 2MPKA 1UURA 4WZXA 2W63A 4O2BE 2D5UA 4QWNB 4ADZA 3UTKA 4DO0A 4DR5T 4DVDA 2C5JA 3AEAA 4ZI3C 1CUNA 2LSJA 4CI2B 4YFSA 3RH3A 2QGSA 4HFCA 4AXPA 3OPCA 1FIOA 3OTOT 4JI2T 2A9UA 4IE5A 4ZI3D 2WP9A 2WY2A 4H9PC 2XQ6A 3AE5A 4NUUA 1D0XA 2CRBA 3RC3A 2X0YA 4QX8B 2VB6A 4IE0A 3RF1A 2HH7A 1HX1B 3Q2MA 1ZV4X 5L3GB 3RIUA 3AE8A 2W67A 2CCQA 3HR0A 3KBTA 4LMKA 3L09A 5HAXA 2DNXA 2KWHA 4O4HE 4DV1T 4ILBA 5KMGP 2CEAA 1KNRA 4BA9A 2Y6XA 1HF8A 2JPFA 3FZKB 3QNUA 4MLKA 3GMIA 4TNWA 1VOMA 2C5IT 3JAFA 3CWZB 4KX6A 1IJ6A 4GOUA 3KVBA 3ZT7A 3AA6B 2X68A 2A3DA 3AXJA 2BKOA 4KP3C 2IIUA 3PTRB 1YXRA 5AQTB 5LYJE 4OYKA 2KMFA 2W62A 1MNDA 5KDMC 4E7SA 1YKHB 4JUYA 3K3NA 3LBXA 2WDQA 5AFUL 5FVLA 4IL9A 2CLYB 4X62T 4U7IA 5LMNT 2KWIB 2F4VT 4EAHA 3IF8B 5FVKA 1VRBA 2FUPA 2XAFB 4IE7A 3EUHA 2YU2A 3ZN0B 3NZPA 3ABVA 4H9SE 3PUSA 3MXZA 4ZEYA 3MK7C 3ONXA 1QLBA 4C90A 1XDOA 1SHZC 5JTGA 3AE2A 3EVYA 5CGMA 1IBMT 1UX4A 4L5GA 1OEDE 4MBQA 3HI2A 1YQ3A 1XZYA 4AQGA 4LF4T 1KEYA 3JCFA 3EI0A 1HCIA 4IE6A 4YXDA 3RKGA 4UVCB 5HEUA 3AAAB 4JI0T 4IDQA 1KK7A 4EXTA 3UFEA 1LKXA 3CQCB 2UUCT 2XQAA 3L3PA 5LNKA 3ANWA 2J1DG 3SS1A 2LSKA 1Z0PA 5L3CB 2YOEA 2JJ9A 4B3RT 4YHHT 2XJ7A 4Z90A 4L0RA 5JVDE 5JDGA 2WAUA 5BR8T 4CN4A 3OBVE 2PFVA 3ZYLA 5LHHB 3KBUA 5JDNA 5AQIB 5DQVA 1HX8A 1WLXA 2D9DA 2QVAA 5AQPB 4BJMA 2Q9QC 2CWYA 2BG9B 2CA5A 2J62A 2E9XA 3P4WA 2X51A 3AAEB 3FBZA 1WYBA 1B7TA 5FXWA 3CVRA 2WWUA 2X9HA 2DL1A 2WDVA 4H63V 2XM2A 3TLWA 2XY8B 3VKGA 3T1YT 2W00A 4M1PA 4AQFC 2JMHA 5AQOB 2DWKA 4EEBA 2L8KA 4OK0A 5JRCA 4YSXA 4JI6T 3H3MA 3AA1B 1E7PA 1J5ET 4JI8T 4XZCA 3PUQA 1G8XA 3I9YA 4U33A 5GONE 4AKLA 4H9NC 4AKRB 4CXYA 2V7KA 3PUAA 2FJBA 4LFBT 2ACZA 2H88A 4X1YE 3AVRA 4I4TE 4P0BA 1XNRT 3PU8A 1W9RA 2XQ8A 5C2TA 2IC9A 2K3WA 3X1DA 4MFRA 2ZM8A 4K0UA 4IT4A 5L2LA 2ZM2A 2B1EA 2V6YA 4ILCA 1BR4A 4NUVA 2V6XA 3F57A 2XQ7A 3KFWX 2X67A 3EDVA 2LM9A 5LCYA 3LK3B 4ASKA 2XAQB 5ABGA 1BR0A 5EZYE 4JI7T 3PUGA 5JDQA 3A7MA 5HXCA 2CXLA 3FZMB 1SE7A 5BMVE 4U72A 1HNWT 3ONLC 2JRKA 3KDSE 5DQWA 1T98A 4JEHB 1W0BA 2L3LA 2XQ5A 2G0UA 4CZZB 2KSRA 4EYYR 2IC6A 3P8CD 4H9OC 1IZNB 3V5UA 5ABHA 4EV6A 3AEGA 2N9DA 2BBHA 2KLQA 2NOXA 1D1BA 2VASA 3ZN1B 4DBRA 5HEGA 3RRWA 2ZLYA 5ABFB 4GIWA 3LSVA 2DI4A 2B76A 3L39A 4O4IE 3SFDA 3A5XA 5LHGB 2QA7A 4LMJA 3PUZF 4PNIA 5LXTE 2DCFA 3LK42 3OVUA 5H6QB 2R6GF 3FZFB 2H89A 3MJXA 4XBFB 3H3AA 5LBMA 3MKDA 4U74A 4ZI2D 3N5LA 2WS3A 4FJOA 3PV0F 3HL6A 1OEDC 3TLSA 3HKBE 3UQ4A 2MOZA 2N1GA 4OFZA 4A56A 4I55E 4YSYA 2UXDT 4EGWA 4HFIA 5LJMA 2VVNA 5CB4E 1ZKEA 2LJLA 3KV4A 4DV3T 4JI1T 4U2ZA 1O3XA 4NXMT 5JDHA 3P4SA 4IGUA 4DBQA 3K3QC 4QXHB 3L8RA 4DV2T 2HPJA 2X9XA 4DV4T 3VHLA 3N9LA 4DMVA 4WBNE 2Y8DA 4ISTA 4PW8A 5LOVE 4ZHQE 4HN9A 2JQKA 3OYZA 2XQ3A 3IHRA 2VKHA 4JLEA 1ZP0A 4DV6T 4UF0A 5AQSB 4YY3T 1SA0E 4ZI7E 3UU4A 2XUEA 3R84B 2QRXA 3VR8A 2XTLA 4N78D 4LF7T 3A8YC 2EHOA 4JEUB 4JI5T 4ZS3A 1H7CA 4I43B 1M7KA 5JR9B 3N2OA 4TX5A 3RIUC 5FMNA 4TWHA 2VKOA 5CJ5A 3I1AA 3BQIA 4HFHA 1JNRA 2N2NA 2V26A 2W4XA 4ZOLE 3TLVA 5LBQB 1ZOYA 1LVFA 3H37A 3MACA 5HWYA 4JYAT 2X66A 4X66T 4DUYT 5M4YA 4IDZA 3AE9A 2HPLA 3AE3A 5L3EB 4QH5A 4LF6T 4JV5T 4G2AA 2IHR1 2NW7A 4OX9T 3NRXA 1N33T 2A2FX 2LRKA 2JMKA 1S35A 5IUXA 4DV5T 3OYXA 1LRZA 2ODVA 3Q5WA 1US7B 3RIAA 3QOFA 2VK9A 2WZHA 5HWXA 4PK5A 3R6NA 3RKOA 5ADXL 3JAEA 2WMNA 4DR1T 4PJLA 3K1SA 2BS4A 1EZ3A 4QHOA 2NR4A 3SOLA 3F2EA 2X0LB 1T8BA 2WDRA 2M6IA 5J1GA 4DR6T 2XAHB 1MMDA 4EB6E 4X1IE 1VCSA 2V7LA 5H6RB 4UVBB 3UUNA 3CK6A 3D0TA 3SRZA 5IWAT 2E5VA 2KINB 2YKSA 3ZMVB 5LB7B 4DR7T 4UV9B 2LKHA 4TWFA 1N36T 3KINB 4CXXA 2MTQA 2UXBT 4X65T 5IHYA 3KV5A 3CX7B 2ACXA 3ANWB 4G63A 3RYCE 3Q5XA 5LGNB 2I59A 3ZCJA 1HNZT 3CX8B 2BS3A 4TWDA 4LMLA 4J2CA 2XSAA 3K3OA 1E1HB 5FL0A 2J47A 5JDLA 5HCJA 2FBWA 3ZYKA 1HG5A 1LVKA 4C91A 3AB3B 2XQ4A 5F5WA 5EK2A 2E9XC 3CQXC 4YJ2E 3HA4A 3HKCE 2FJEA 4HWFA 5AQUB 1J5WA 5EK4A 4JBWF 3RRCA 2C5KT 2D0UA 2CBJA 4LF5T 1UGOA 2E5LT 3AEEA 4DMWA 4YSZA 3B57A 1KFYA 4DR2T 3UUMA 2WMOA 1KNZA 4TNVA 2KT9A 1MNEA 1IAPA 3JADA 3N9OA 1Y64B 2YEVC 3RC8A 4X20E 2Y48B 2K24A 4HFEA 4IIJE 2KZ7B 3NBXX 5LHIB 4UELA 1FMWA 2BG9C 1YD8G 1IBLT 2XSBA 4EEDA 3AE6A 2MAWA 3VRAA 2Q9QD 3ZJ2A 2Q9QB 1UCUA 1I6ZA 2L9QA 2LEHA 3N2GE 5IYZE 3N9QA 2RPAA 4H63H 2UXCT 2MBGA 5L3BB 3GN5B 4IDPA 2WB5A 3ZKRA 3GWHA 3QB5K 4BJNA 3RQUA 4HKAA 3OKQA 3ESLA 1ZHCA 4YTNA 1NAFA 2K9AA 1OXZA 3BQKA 2LKGA 5LA6E 4KHZF 1MMGA 3VKHA 2H3RA 2VL0A 2YINA 2CPTA 4AQYT 1DU2A 1UX5A 4GYRA 3KV6A 2AXDS 2J4GA 4P1NA 2X9WA 3DJBA 1IJ5A 4PK6A 3P4QA 3AAIA 3QK6A 4YTPA 3MA9A 2BG9A 2NWBA 3F31A 2BS2A 2VURA 2NTYA 2X0HA 5A1LA 2WWVA 3PJAJ 3BK9A 2UXXB 3EABA 3RYFE 1WR6A 2CBIA 4HFDA 5DJQC 1XWMA 4PFOA 1IBKT 4TV9E 3P4PA 4CI3B 2JQQA 3LG7A 3K8PC 4ZXLA 4JI3T 3C64A 3AEBA 3KV9A 2V1DB 4CN1A 4DV7T 2UUAT 3HKEE 5HCMA 3NKZA 4ZS2A 5AQRB 2XAJB 1HR0T 1D0YA 4U7YA 1U4QA 3ZT6A 5LP6E 5AQFB 4UEMA 4BAYB 4DR3T 4JI4T 4I50E 3AE4A 2JQHA 3DP7A 3JC6C 1FMVA 5ETWA 4QXBB 3RI5A 1X79A 1UK5A 2WQYA 1WYCA 2QYWA 3UU3A 3U78A 2XAGB 2LSGA 5FNVE 2V5DA 5FYMA 4DR4T 2OA5A 4UVAB 2I0MA 3IBPA 3ZMUB 4Z91A 2YDQA 2IAKA 1HS7A 2V8SV 3AA7B 3O1IA 4WW0A 3EHZA 4A97A 3LDQB 3W15B 1QUUA 3UT5E 4ILAA 4X5TA 4QX7B 3QB5A 2IUBA 4IL4A 2LHNA 2OV9A 4HTEA 3PUVF 4OHFA 2Z6EA 1WR0A 4U2YA 2WSSV 2EHOC 2V7IA 1FEWA 3M65A 5E0OA 3P50A 3VRBA 1AJ3A 2K48A 4AKHA 5FKYA 3ZJ1A 4NXNT 4CI1B 1XDPA 2WBLA 4E7ZA 2WU2A 3NZQA 2YDSA 1MMAA 1BR1A 4AKGA 4DNDA 1OEDB 4CN6A 4HWIB 1GQEA 1N34T 5HXHA 3CKDA 5ABFA 4WBOA 2BG9E 4ZZBA 5L4EA 4H9QC 1KNPA 4P09A 5HEOA 5HXEA 2VKJA 2YN6A 4UR9A 2X9YA 1D1AA 2BVLA 3J9X1 5AQHB 2ODUA 4TV8E 1WCRA 5JDMA 5LGUB 3B13A 3C4WA 4PAGA 2UUBT 5LG4A 5AQLB 4HEAA 2VKDA 4GKKT 4IDNA 1E2AA 4H9RC 2NW8A 5AQNB 2IDOB 4PK4A 3ZLIA 1JNZA 2H7OA 3EDUA 3TKLB 1CHUA 1FJGT 1W0AA 4HWCA 3FHNA 5FXZA 5F8PA 3DTOA 2MYSA 3N2KE 2W61A 2H7VC 3SFEA 1YQ4A 2V5CA 4WNKA 4NIQA 2UXNB 5JREA 1W09A 3N9PA 4KBMB 5HEJA 2HHHT 5FY1A 2UU9T 3NWIA 3PURA 1S94A 3ZEFB 2ZMAA 3CX6B 2XQYA 3AXJB 3QC9A 1HFAA 5L47A 3RX6A 2BDEA 4GK5E 5L3FB 2V7JA 2XPKA 5FXVA 3PE0A 5JR9A 2CWOA 4X64T 3RQWA 1X9BA 3QUJA 3LBXB 3ZCIA 5KX5E 4AIUA 3LJCA 5CFBA 5JQGE 3I0QA 2CHNA 2PTFA 3RIFA 5L4HA 1NWMX 2VVSA 2PJQA 3RGLA 4V1Av 2CXDA 1XMOT 2DLRA 3PJAA 4MALA 3C98B 4EOZB 1BR2A 3UFGA 2NP9A 2BVMA 2P9BA 4IREA 3CIRA 5FL1A 4O4LE 3ONJA 3C51A 1M62A 1J1JA 3HKDE 5HXSA 5J2UE 4EZ4A 2CLYC 3AEDA 4K0KT 4UV8B 5AQMB 4QKNA 3ZC0A 2JQ9A 2PG8A 2NTXA 2LLYA 3UU5A 4UXNB 3PUXF 4IHJE 2RA1A 1XNQT 3AE7A 4B6XA 3FBLA 2BKNA 4HWHA 3UUBA 3ZC1A 5AQJB 2E9XD 3UUXB 4WYVA 3ZMSB 4TN7B 4XAXB 4IDOA 4TUYE 4O4JE 2E9XB 4A5XA 4EIWA 2LE8A 3G06A 3RHWA 3BQLA 4YTMA 4B3ST 1WFDA 3T1HT 5FXXA 4KHPT 3UU8A 4LF8T 2ZM6T 3CPZA 3O4XE 5AQQB 5F3JA 2ZM0A 4I0UA 1T7SA 2HN2A 3Q9DA 5KXJA 3FXDB 5JRCB 5AQVB 2JIWA 4AISA 3CMLA 4F8HA 4L9IA 2M67A
chains in the Genus database with same CATH topology
4DR3T 4JI4T 2HHHT 2UU9T 4DV6T 4YY3T 4B3RT 1N34T 4YHHT 4B3TT 4DR1T 4LF5T 4LF7T 4LFBT 2E5LT 1XNRT 4JI5T 5BR8T 4DR6T 1XNQT 4AQYT 4LF9T 4DR2T 4DR4T 4X64T 4DR5T 5IWAT 2UUBT 4LFCT 4X62T 4DV0T 4DR7T 5LMNT 2F4VT 4DUZT 4GKKT 3OTOT 1N36T 4JI7T 4JYAT 4JI2T 4X66T 4DUYT 2UXDT 4B3ST 2VQET 2UXBT 1HNWT 3T1HT 1HNXT 4X65T 1IBKT 4DV3T 4JI1T 4KHPT 1IBLT 1XMOT 4LF8T 4B3MT 4NXMT 4JI3T 4LF6T 4JV5T 2ZM6T 1IBMT 1FJGT 1XMQT 1HNZT 3T1YT 4OX9T 4DV7T 2UUAT 1N33T 4LF4T 4DV2T 4NXNT 1N32T 4DV4T 5LMUT 1I94T 4JI0T 4DV1T 4DV5T 1HR0T 4JI6T 2UUCT 4LFAT 2UXCT 1J5ET 4JI8T 2VQFT 4GKJT 4K0KT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 T;  4JI4 T;  2HHH T;  2UU9 T;  4DV6 T;  4YY3 T;  4B3R T;  1N34 T;  4YHH T;  4B3T T;  4DR1 T;  4LF5 T;  4LF7 T;  4LFB T;  2E5L T;  1XNR T;  4JI5 T;  5BR8 T;  4DR6 T;  1XNQ T;  4AQY T;  4LF9 T;  4DR2 T;  4DR4 T;  4X64 T;  4DR5 T;  5IWA T;  2UUB T;  4LFC T;  4X62 T;  4DV0 T;  4DR7 T;  5LMN T;  2F4V T;  4DUZ T;  4GKK T;  3OTO T;  1N36 T;  4JI7 T;  4JYA T;  4JI2 T;  4X66 T;  4DUY T;  2UXD T;  4B3S T;  2VQE T;  2UXB T;  1HNW T;  3T1H T;  1HNX T;  4X65 T;  1IBK T;  4DV3 T;  4JI1 T;  4KHP T;  1IBL T;  1XMO T;  4LF8 T;  4B3M T;  4NXM T;  4JI3 T;  4LF6 T;  4JV5 T;  2ZM6 T;  1IBM T;  1FJG T;  1XMQ T;  1HNZ T;  3T1Y T;  4OX9 T;  4DV7 T;  2UUA T;  1N33 T;  4LF4 T;  4DV2 T;  4NXN T;  1N32 T;  4DV4 T;  5LMU T;  1I94 T;  4JI0 T;  4DV1 T;  4DV5 T;  1HR0 T;  4JI6 T;  2UUC T;  4LFA T;  2UXC T;  1J5E T;  4JI8 T;  2VQF T;  4GKJ T;  4K0K T; 
#chains in the Genus database with same CATH topology
 3M3Z B;  1MIV A;  3N9M A;  3RLF F;  3NVO A;  2FJD A;  1VCT A;  2RP4 A;  4MHC A;  2I6H A;  4COF A;  3ZSS A;  4ILU A;  4YLH A;  2C0S A;  3ZMT B;  2W2U A;  4CXW A;  3WAJ A;  5FY7 A;  2CHO A;  3C4X A;  3FZH B;  2V6Y B;  3PU3 A;  5HYA A;  3PUW F;  2KXP B;  3E0Z A;  2LT3 A;  2YDR A;  2W0G A;  2IW5 B;  1G73 A;  4LFC T;  4Z8X A;  4DUZ T;  4PJN A;  3AE1 A;  3ZMZ B;  2BZB A;  4DID B;  1KF6 A;  2VWA A;  2E2A A;  3ZT5 A;  4P0A A;  3J7Y q;  2BKP A;  2LSY A;  3C50 A;  3KVA A;  5CA0 E;  4Q25 A;  4B3M T;  2DWG A;  2W66 A;  5J2T E;  4HFV A;  2YU1 A;  3B5M A;  3U3I A;  2Q9Q A;  1QSD A;  3TLU A;  4PJJ A;  3T8O A;  3C4Z A;  4LFA T;  4PFP A;  2VQF T;  3O1J A;  3WI3 A;  3GN5 A;  3UU6 A;  3UQ7 A;  4EZH A;  5HEH A;  3RPU A;  2PBI A;  3ETU A;  2V7M A;  4TZ4 C;  5TAO A;  4EYU A;  4YJ3 E;  4FI5 A;  3FXE B;  5EK3 A;  4GK0 E;  2LSI A;  3I9W A;  2CE7 A;  3FB2 A;  4LF9 T;  4AQF A;  3ZYM A;  4ERR A;  5C3J A;  5LJN A;  2NW9 A;  2XM1 A;  5ABE A;  1ZEE A;  4QXC B;  1YW0 A;  1WRD A;  3TLT A;  3O9X A;  4IE4 A;  5L3D B;  3JC6 D;  1L0V A;  1NEN A;  3RYI E;  3RYH E;  2OLT A;  2XAS B;  3OJA A;  3PUY F;  1R8I A;  2VQE T;  3O1H A;  1HNX T;  2WU5 A;  3P4R A;  3IA3 A;  5DAB A;  2XHE B;  3FZL B;  3WAK A;  3I0O A;  1XMQ T;  2D0T A;  2FJA A;  3Q5E A;  5CA1 E;  3LK2 B;  5JH7 E;  2CM0 A;  5LMU T;  4O2A E;  1I94 T;  2E8I A;  3VR9 A;  1MIW A;  2KND A;  3GA8 A;  2WZI A;  4GKJ T;  2WCA A;  2ES0 A;  1D0Z A;  3AEF A;  1V9D A;  1U5P A;  5AQK B;  4UF0 B;  3NRY A;  4ZI2 C;  5C8Y E;  2LOP A;  4KI0 F;  3ZPO A;  2VL8 A;  4KMC A;  2EHO D;  3V5S A;  2CXF A;  2A72 A;  4AKI A;  2LHR A;  2EHO B;  1Z8U A;  3IEE A;  3LFM A;  3PDY A;  1SUM B;  5FP3 A;  3ETV A;  4UIG A;  3UUL A;  5LGT B;  2LOS A;  2LM2 A;  4QH4 A;  2AE9 A;  2D2S A;  3N9N A;  2SPC A;  4OYJ A;  4DV0 T;  4NPP A;  3Q5D A;  4HE8 A;  2HN1 A;  4ANJ A;  4YT0 A;  2DHR A;  4A98 A;  4CQI A;  3E22 E;  2CMR A;  2YK0 A;  4HFB A;  2XQ9 A;  2XZE A;  4F6R C;  1T72 A;  1MMN A;  5JDF A;  3AVS A;  5J0Z A;  3ZST A;  2IML A;  3EAM A;  3VU7 H;  1Y01 A;  1HTJ F;  5AQG B;  2M6B A;  5JR9 C;  1N32 T;  3AEC A;  1MIY A;  5FY0 A;  4YHJ A;  1OWA A;  4U31 A;  1NEK A;  4ZZC A;  1UUS A;  2BBJ A;  4KUM B;  3S4U A;  4GYS A;  1OED A;  3E08 A;  4HGA A;  3CQG B;  4PJM A;  4AI6 A;  2K5B B;  5LG3 A;  4ISS A;  4U3C A;  3SWH A;  4O8S A;  2LRL A;  3AA0 B;  4B3T T;  4HWD A;  1HG2 A;  2GK9 A;  5HXR A;  1YKE B;  3MZK B;  4QH1 A;  4X1K E;  2WM9 A;  3P7I A;  1D1C A;  2MPK A;  1UUR A;  4WZX A;  2W63 A;  4O2B E;  2D5U A;  4QWN B;  4ADZ A;  3UTK A;  4DO0 A;  4DR5 T;  4DVD A;  2C5J A;  3AEA A;  4ZI3 C;  1CUN A;  2LSJ A;  4CI2 B;  4YFS A;  3RH3 A;  2QGS A;  4HFC A;  4AXP A;  3OPC A;  1FIO A;  3OTO T;  4JI2 T;  2A9U A;  4IE5 A;  4ZI3 D;  2WP9 A;  2WY2 A;  4H9P C;  2XQ6 A;  3AE5 A;  4NUU A;  1D0X A;  2CRB A;  3RC3 A;  2X0Y A;  4QX8 B;  2VB6 A;  4IE0 A;  3RF1 A;  2HH7 A;  1HX1 B;  3Q2M A;  1ZV4 X;  5L3G B;  3RIU A;  3AE8 A;  2W67 A;  2CCQ A;  3HR0 A;  3KBT A;  4LMK A;  3L09 A;  5HAX A;  2DNX A;  2KWH A;  4O4H E;  4DV1 T;  4ILB A;  5KMG P;  2CEA A;  1KNR A;  4BA9 A;  2Y6X A;  1HF8 A;  2JPF A;  3FZK B;  3QNU A;  4MLK A;  3GMI A;  4TNW A;  1VOM A;  2C5I T;  3JAF A;  3CWZ B;  4KX6 A;  1IJ6 A;  4GOU A;  3KVB A;  3ZT7 A;  3AA6 B;  2X68 A;  2A3D A;  3AXJ A;  2BKO A;  4KP3 C;  2IIU A;  3PTR B;  1YXR A;  5AQT B;  5LYJ E;  4OYK A;  2KMF A;  2W62 A;  1MND A;  5KDM C;  4E7S A;  1YKH B;  4JUY A;  3K3N A;  3LBX A;  2WDQ A;  5AFU L;  5FVL A;  4IL9 A;  2CLY B;  4X62 T;  4U7I A;  5LMN T;  2KWI B;  2F4V T;  4EAH A;  3IF8 B;  5FVK A;  1VRB A;  2FUP A;  2XAF B;  4IE7 A;  3EUH A;  2YU2 A;  3ZN0 B;  3NZP A;  3ABV A;  4H9S E;  3PUS A;  3MXZ A;  4ZEY A;  3MK7 C;  3ONX A;  1QLB A;  4C90 A;  1XDO A;  1SHZ C;  5JTG A;  3AE2 A;  3EVY A;  5CGM A;  1IBM T;  1UX4 A;  4L5G A;  1OED E;  4MBQ A;  3HI2 A;  1YQ3 A;  1XZY A;  4AQG A;  4LF4 T;  1KEY A;  3JCF A;  3EI0 A;  1HCI A;  4IE6 A;  4YXD A;  3RKG A;  4UVC B;  5HEU A;  3AAA B;  4JI0 T;  4IDQ A;  1KK7 A;  4EXT A;  3UFE A;  1LKX A;  3CQC B;  2UUC T;  2XQA A;  3L3P A;  5LNK A;  3ANW A;  2J1D G;  3SS1 A;  2LSK A;  1Z0P A;  5L3C B;  2YOE A;  2JJ9 A;  4B3R T;  4YHH T;  2XJ7 A;  4Z90 A;  4L0R A;  5JVD E;  5JDG A;  2WAU A;  5BR8 T;  4CN4 A;  3OBV E;  2PFV A;  3ZYL A;  5LHH B;  3KBU A;  5JDN A;  5AQI B;  5DQV A;  1HX8 A;  1WLX A;  2D9D A;  2QVA A;  5AQP B;  4BJM A;  2Q9Q C;  2CWY A;  2BG9 B;  2CA5 A;  2J62 A;  2E9X A;  3P4W A;  2X51 A;  3AAE B;  3FBZ A;  1WYB A;  1B7T A;  5FXW A;  3CVR A;  2WWU A;  2X9H A;  2DL1 A;  2WDV A;  4H63 V;  2XM2 A;  3TLW A;  2XY8 B;  3VKG A;  3T1Y T;  2W00 A;  4M1P A;  4AQF C;  2JMH A;  5AQO B;  2DWK A;  4EEB A;  2L8K A;  4OK0 A;  5JRC A;  4YSX A;  4JI6 T;  3H3M A;  3AA1 B;  1E7P A;  1J5E T;  4JI8 T;  4XZC A;  3PUQ A;  1G8X A;  3I9Y A;  4U33 A;  5GON E;  4AKL A;  4H9N C;  4AKR B;  4CXY A;  2V7K A;  3PUA A;  2FJB A;  4LFB T;  2ACZ A;  2H88 A;  4X1Y E;  3AVR A;  4I4T E;  4P0B A;  1XNR T;  3PU8 A;  1W9R A;  2XQ8 A;  5C2T A;  2IC9 A;  2K3W A;  3X1D A;  4MFR A;  2ZM8 A;  4K0U A;  4IT4 A;  5L2L A;  2ZM2 A;  2B1E A;  2V6Y A;  4ILC A;  1BR4 A;  4NUV A;  2V6X A;  3F57 A;  2XQ7 A;  3KFW X;  2X67 A;  3EDV A;  2LM9 A;  5LCY A;  3LK3 B;  4ASK A;  2XAQ B;  5ABG A;  1BR0 A;  5EZY E;  4JI7 T;  3PUG A;  5JDQ A;  3A7M A;  5HXC A;  2CXL A;  3FZM B;  1SE7 A;  5BMV E;  4U72 A;  1HNW T;  3ONL C;  2JRK A;  3KDS E;  5DQW A;  1T98 A;  4JEH B;  1W0B A;  2L3L A;  2XQ5 A;  2G0U A;  4CZZ B;  2KSR A;  4EYY R;  2IC6 A;  3P8C D;  4H9O C;  1IZN B;  3V5U A;  5ABH A;  4EV6 A;  3AEG A;  2N9D A;  2BBH A;  2KLQ A;  2NOX A;  1D1B A;  2VAS A;  3ZN1 B;  4DBR A;  5HEG A;  3RRW A;  2ZLY A;  5ABF B;  4GIW A;  3LSV A;  2DI4 A;  2B76 A;  3L39 A;  4O4I E;  3SFD A;  3A5X A;  5LHG B;  2QA7 A;  4LMJ A;  3PUZ F;  4PNI A;  5LXT E;  2DCF A;  3LK4 2;  3OVU A;  5H6Q B;  2R6G F;  3FZF B;  2H89 A;  3MJX A;  4XBF B;  3H3A A;  5LBM A;  3MKD A;  4U74 A;  4ZI2 D;  3N5L A;  2WS3 A;  4FJO A;  3PV0 F;  3HL6 A;  1OED C;  3TLS A;  3HKB E;  3UQ4 A;  2MOZ A;  2N1G A;  4OFZ A;  4A56 A;  4I55 E;  4YSY A;  2UXD T;  4EGW A;  4HFI A;  5LJM A;  2VVN A;  5CB4 E;  1ZKE A;  2LJL A;  3KV4 A;  4DV3 T;  4JI1 T;  4U2Z A;  1O3X A;  4NXM T;  5JDH A;  3P4S A;  4IGU A;  4DBQ A;  3K3Q C;  4QXH B;  3L8R A;  4DV2 T;  2HPJ A;  2X9X A;  4DV4 T;  3VHL A;  3N9L A;  4DMV A;  4WBN E;  2Y8D A;  4IST A;  4PW8 A;  5LOV E;  4ZHQ E;  4HN9 A;  2JQK A;  3OYZ A;  2XQ3 A;  3IHR A;  2VKH A;  4JLE A;  1ZP0 A;  4DV6 T;  4UF0 A;  5AQS B;  4YY3 T;  1SA0 E;  4ZI7 E;  3UU4 A;  2XUE A;  3R84 B;  2QRX A;  3VR8 A;  2XTL A;  4N78 D;  4LF7 T;  3A8Y C;  2EHO A;  4JEU B;  4JI5 T;  4ZS3 A;  1H7C A;  4I43 B;  1M7K A;  5JR9 B;  3N2O A;  4TX5 A;  3RIU C;  5FMN A;  4TWH A;  2VKO A;  5CJ5 A;  3I1A A;  3BQI A;  4HFH A;  1JNR A;  2N2N A;  2V26 A;  2W4X A;  4ZOL E;  3TLV A;  5LBQ B;  1ZOY A;  1LVF A;  3H37 A;  3MAC A;  5HWY A;  4JYA T;  2X66 A;  4X66 T;  4DUY T;  5M4Y A;  4IDZ A;  3AE9 A;  2HPL A;  3AE3 A;  5L3E B;  4QH5 A;  4LF6 T;  4JV5 T;  4G2A A;  2IHR 1;  2NW7 A;  4OX9 T;  3NRX A;  1N33 T;  2A2F X;  2LRK A;  2JMK A;  1S35 A;  5IUX A;  4DV5 T;  3OYX A;  1LRZ A;  2ODV A;  3Q5W A;  1US7 B;  3RIA A;  3QOF A;  2VK9 A;  2WZH A;  5HWX A;  4PK5 A;  3R6N A;  3RKO A;  5ADX L;  3JAE A;  2WMN A;  4DR1 T;  4PJL A;  3K1S A;  2BS4 A;  1EZ3 A;  4QHO A;  2NR4 A;  3SOL A;  3F2E A;  2X0L B;  1T8B A;  2WDR A;  2M6I A;  5J1G A;  4DR6 T;  2XAH B;  1MMD A;  4EB6 E;  4X1I E;  1VCS A;  2V7L A;  5H6R B;  4UVB B;  3UUN A;  3CK6 A;  3D0T A;  3SRZ A;  5IWA T;  2E5V A;  2KIN B;  2YKS A;  3ZMV B;  5LB7 B;  4DR7 T;  4UV9 B;  2LKH A;  4TWF A;  1N36 T;  3KIN B;  4CXX A;  2MTQ A;  2UXB T;  4X65 T;  5IHY A;  3KV5 A;  3CX7 B;  2ACX A;  3ANW B;  4G63 A;  3RYC E;  3Q5X A;  5LGN B;  2I59 A;  3ZCJ A;  1HNZ T;  3CX8 B;  2BS3 A;  4TWD A;  4LML A;  4J2C A;  2XSA A;  3K3O A;  1E1H B;  5FL0 A;  2J47 A;  5JDL A;  5HCJ A;  2FBW A;  3ZYK A;  1HG5 A;  1LVK A;  4C91 A;  3AB3 B;  2XQ4 A;  5F5W A;  5EK2 A;  2E9X C;  3CQX C;  4YJ2 E;  3HA4 A;  3HKC E;  2FJE A;  4HWF A;  5AQU B;  1J5W A;  5EK4 A;  4JBW F;  3RRC A;  2C5K T;  2D0U A;  2CBJ A;  4LF5 T;  1UGO A;  2E5L T;  3AEE A;  4DMW A;  4YSZ A;  3B57 A;  1KFY A;  4DR2 T;  3UUM A;  2WMO A;  1KNZ A;  4TNV A;  2KT9 A;  1MNE A;  1IAP A;  3JAD A;  3N9O A;  1Y64 B;  2YEV C;  3RC8 A;  4X20 E;  2Y48 B;  2K24 A;  4HFE A;  4IIJ E;  2KZ7 B;  3NBX X;  5LHI B;  4UEL A;  1FMW A;  2BG9 C;  1YD8 G;  1IBL T;  2XSB A;  4EED A;  3AE6 A;  2MAW A;  3VRA A;  2Q9Q D;  3ZJ2 A;  2Q9Q B;  1UCU A;  1I6Z A;  2L9Q A;  2LEH A;  3N2G E;  5IYZ E;  3N9Q A;  2RPA A;  4H63 H;  2UXC T;  2MBG A;  5L3B B;  3GN5 B;  4IDP A;  2WB5 A;  3ZKR A;  3GWH A;  3QB5 K;  4BJN A;  3RQU A;  4HKA A;  3OKQ A;  3ESL A;  1ZHC A;  4YTN A;  1NAF A;  2K9A A;  1OXZ A;  3BQK A;  2LKG A;  5LA6 E;  4KHZ F;  1MMG A;  3VKH A;  2H3R A;  2VL0 A;  2YIN A;  2CPT A;  4AQY T;  1DU2 A;  1UX5 A;  4GYR A;  3KV6 A;  2AXD S;  2J4G A;  4P1N A;  2X9W A;  3DJB A;  1IJ5 A;  4PK6 A;  3P4Q A;  3AAI A;  3QK6 A;  4YTP A;  3MA9 A;  2BG9 A;  2NWB A;  3F31 A;  2BS2 A;  2VUR A;  2NTY A;  2X0H A;  5A1L A;  2WWV A;  3PJA J;  3BK9 A;  2UXX B;  3EAB A;  3RYF E;  1WR6 A;  2CBI A;  4HFD A;  5DJQ C;  1XWM A;  4PFO A;  1IBK T;  4TV9 E;  3P4P A;  4CI3 B;  2JQQ A;  3LG7 A;  3K8P C;  4ZXL A;  4JI3 T;  3C64 A;  3AEB A;  3KV9 A;  2V1D B;  4CN1 A;  4DV7 T;  2UUA T;  3HKE E;  5HCM A;  3NKZ A;  4ZS2 A;  5AQR B;  2XAJ B;  1HR0 T;  1D0Y A;  4U7Y A;  1U4Q A;  3ZT6 A;  5LP6 E;  5AQF B;  4UEM A;  4BAY B;  4DR3 T;  4JI4 T;  4I50 E;  3AE4 A;  2JQH A;  3DP7 A;  3JC6 C;  1FMV A;  5ETW A;  4QXB B;  3RI5 A;  1X79 A;  1UK5 A;  2WQY A;  1WYC A;  2QYW A;  3UU3 A;  3U78 A;  2XAG B;  2LSG A;  5FNV E;  2V5D A;  5FYM A;  4DR4 T;  2OA5 A;  4UVA B;  2I0M A;  3IBP A;  3ZMU B;  4Z91 A;  2YDQ A;  2IAK A;  1HS7 A;  2V8S V;  3AA7 B;  3O1I A;  4WW0 A;  3EHZ A;  4A97 A;  3LDQ B;  3W15 B;  1QUU A;  3UT5 E;  4ILA A;  4X5T A;  4QX7 B;  3QB5 A;  2IUB A;  4IL4 A;  2LHN A;  2OV9 A;  4HTE A;  3PUV F;  4OHF A;  2Z6E A;  1WR0 A;  4U2Y A;  2WSS V;  2EHO C;  2V7I A;  1FEW A;  3M65 A;  5E0O A;  3P50 A;  3VRB A;  1AJ3 A;  2K48 A;  4AKH A;  5FKY A;  3ZJ1 A;  4NXN T;  4CI1 B;  1XDP A;  2WBL A;  4E7Z A;  2WU2 A;  3NZQ A;  2YDS A;  1MMA A;  1BR1 A;  4AKG A;  4DND A;  1OED B;  4CN6 A;  4HWI B;  1GQE A;  1N34 T;  5HXH A;  3CKD A;  5ABF A;  4WBO A;  2BG9 E;  4ZZB A;  5L4E A;  4H9Q C;  1KNP A;  4P09 A;  5HEO A;  5HXE A;  2VKJ A;  2YN6 A;  4UR9 A;  2X9Y A;  1D1A A;  2BVL A;  3J9X 1;  5AQH B;  2ODU A;  4TV8 E;  1WCR A;  5JDM A;  5LGU B;  3B13 A;  3C4W A;  4PAG A;  2UUB T;  5LG4 A;  5AQL B;  4HEA A;  2VKD A;  4GKK T;  4IDN A;  1E2A A;  4H9R C;  2NW8 A;  5AQN B;  2IDO B;  4PK4 A;  3ZLI A;  1JNZ A;  2H7O A;  3EDU A;  3TKL B;  1CHU A;  1FJG T;  1W0A A;  4HWC A;  3FHN A;  5FXZ A;  5F8P A;  3DTO A;  2MYS A;  3N2K E;  2W61 A;  2H7V C;  3SFE A;  1YQ4 A;  2V5C A;  4WNK A;  4NIQ A;  2UXN B;  5JRE A;  1W09 A;  3N9P A;  4KBM B;  5HEJ A;  2HHH T;  5FY1 A;  2UU9 T;  3NWI A;  3PUR A;  1S94 A;  3ZEF B;  2ZMA A;  3CX6 B;  2XQY A;  3AXJ B;  3QC9 A;  1HFA A;  5L47 A;  3RX6 A;  2BDE A;  4GK5 E;  5L3F B;  2V7J A;  2XPK A;  5FXV A;  3PE0 A;  5JR9 A;  2CWO A;  4X64 T;  3RQW A;  1X9B A;  3QUJ A;  3LBX B;  3ZCI A;  5KX5 E;  4AIU A;  3LJC A;  5CFB A;  5JQG E;  3I0Q A;  2CHN A;  2PTF A;  3RIF A;  5L4H A;  1NWM X;  2VVS A;  2PJQ A;  3RGL A;  4V1A v;  2CXD A;  1XMO T;  2DLR A;  3PJA A;  4MAL A;  3C98 B;  4EOZ B;  1BR2 A;  3UFG A;  2NP9 A;  2BVM A;  2P9B A;  4IRE A;  3CIR A;  5FL1 A;  4O4L E;  3ONJ A;  3C51 A;  1M62 A;  1J1J A;  3HKD E;  5HXS A;  5J2U E;  4EZ4 A;  2CLY C;  3AED A;  4K0K T;  4UV8 B;  5AQM B;  4QKN A;  3ZC0 A;  2JQ9 A;  2PG8 A;  2NTX A;  2LLY A;  3UU5 A;  4UXN B;  3PUX F;  4IHJ E;  2RA1 A;  1XNQ T;  3AE7 A;  4B6X A;  3FBL A;  2BKN A;  4HWH A;  3UUB A;  3ZC1 A;  5AQJ B;  2E9X D;  3UUX B;  4WYV A;  3ZMS B;  4TN7 B;  4XAX B;  4IDO A;  4TUY E;  4O4J E;  2E9X B;  4A5X A;  4EIW A;  2LE8 A;  3G06 A;  3RHW A;  3BQL A;  4YTM A;  4B3S T;  1WFD A;  3T1H T;  5FXX A;  4KHP T;  3UU8 A;  4LF8 T;  2ZM6 T;  3CPZ A;  3O4X E;  5AQQ B;  5F3J A;  2ZM0 A;  4I0U A;  1T7S A;  2HN2 A;  3Q9D A;  5KXJ A;  3FXD B;  5JRC B;  5AQV B;  2JIW A;  4AIS A;  3CML A;  4F8H A;  4L9I A;  2M67 A; 
#chains in the Genus database with same CATH homology
 4DR3 T;  4JI4 T;  2HHH T;  2UU9 T;  4DV6 T;  4YY3 T;  4B3R T;  1N34 T;  4YHH T;  4B3T T;  4DR1 T;  4LF5 T;  4LF7 T;  4LFB T;  2E5L T;  1XNR T;  4JI5 T;  5BR8 T;  4DR6 T;  1XNQ T;  4AQY T;  4LF9 T;  4DR2 T;  4DR4 T;  4X64 T;  4DR5 T;  5IWA T;  2UUB T;  4LFC T;  4X62 T;  4DV0 T;  4DR7 T;  5LMN T;  2F4V T;  4DUZ T;  4GKK T;  3OTO T;  1N36 T;  4JI7 T;  4JYA T;  4JI2 T;  4X66 T;  4DUY T;  2UXD T;  4B3S T;  2VQE T;  2UXB T;  1HNW T;  3T1H T;  1HNX T;  4X65 T;  1IBK T;  4DV3 T;  4JI1 T;  4KHP T;  1IBL T;  1XMO T;  4LF8 T;  4B3M T;  4NXM T;  4JI3 T;  4LF6 T;  4JV5 T;  2ZM6 T;  1IBM T;  1FJG T;  1XMQ T;  1HNZ T;  3T1Y T;  4OX9 T;  4DV7 T;  2UUA T;  1N33 T;  4LF4 T;  4DV2 T;  4NXN T;  1N32 T;  4DV4 T;  5LMU T;  1I94 T;  4JI0 T;  4DV1 T;  4DV5 T;  1HR0 T;  4JI6 T;  2UUC T;  4LFA T;  2UXC T;  1J5E T;  4JI8 T;  2VQF T;  4GKJ T;  4K0K T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...