2ZM6T

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
94
structure length
94
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 29
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2zm6T00
2HHHT 4DR3T 1XNRT 1XMOT 4DV3T 2VQFT 1XNQT 4LFCT 4DR7T 2UXBT 2VQET 5LMNT 4DUYT 2E5LT 4JI7T 2UUAT 4LF4T 3T1HT 4JI2T 4JI5T 4DV6T 4JV5T 1HNXT 4LFAT 1I94T 4JYAT 2UXDT 4OX9T 2ZM6T 5IWAT 1N33T 3T1YT 4LF6T 4LF7T 4K0KT 1HNZT 4DR6T 1N32T 4X66T 4JI0T 2UUCT 4JI3T 4DV7T 4YHHT 4DV5T 4DR5T 1N36T 1HNWT 4DV1T 5LMUT 1N34T 4NXNT 4DV4T 4GKJT 4DUZT 4X64T 3OTOT 4JI8T 4DR4T 4LF9T 4KHPT 1IBLT 4JI1T 4JI6T 4GKKT 1HR0T 2UU9T 1IBMT 4B3RT 4LFBT 4X65T 1FJGT 2F4VT 4DR1T 4B3MT 4LF5T 4NXMT 4YY3T 4DV0T 4DV2T 4X62T 2UXCT 4AQYT 2UUBT 1IBKT 4B3ST 4B3TT 1J5ET 5BR8T 4LF8T 1XMQT 4JI4T 4DR2T
chains in the Genus database with same CATH superfamily
3F2EA 1XNQT 4FJOA 2IUBA 3KFWX 4K0UA 2KWIB 5JDMA 5BMVE 3AA1B 2UUAT 4ISSA 2PJQA 2BDEA 4I55E 4UR9A 3QUJA 2M6BA 3PJAA 2BG9B 3N9LA 3AVSA 2MBGA 3C51A 3AAEB 1US7B 4QKNA 2QVAA 3I0QA 3HL6A 3ZN1B 2IAKA 3B13A 4QHOA 5L4EA 3AA6B 4P1NA 5DJQC 2W62A 3BQKA 4HTEA 5FXVA 4I4TE 4NUUA 3I9WA 5DQVA 4G2AA 4DIDB 4WNKA 5JRCA 2V6YB 3CIRA 5HYAA 2JMHA 5LYJE 1WYBA 2D0TA 2WU2A 1KK7A 4KUMB 3FXDB 4TV8E 4HWFA 5C3JA 3JAEA 4PNIA 1HG5A 2CA5A 4B6XA 4PFOA 2VVNA 1YQ3A 3WAJA 2BG9C 5ETWA 5HEUA 4WZXA 3K1SA 2BS2A 2C5IT 2X9HA 3M65A 1X9BA 2WP9A 4AKLA 3PTRB 4JI5T 2WSSV 4YJ2E 3MA9A 4IE4A 2E9XB 3Q5XA 2CCQA 3J9X1 4AQGA 2JQHA 4L0RA 3JAFA 2BG9E 4LF6T 4KX6A 2WAUA 4K0KT 1IAPA 4ILAA 3H37A 5CA1E 2MPKA 3MKDA 1VCSA 1OXZA 2HPJA 5JR9C 2C0SA 1NWMX 2DLRA 4GYRA 3ONLC 4DR4T 1BR2A 2ACZA 4HEAA 3RF1A 5JRCB 4JI1T 1XWMA 2J62A 3I9YA 2E9XD 2EHOA 1IZNB 3CKDA 3VR9A 3AXJB 2NP9A 4LFBT 1H7CA 5FMNA 3JADA 4Z90A 5C8YE 3ETVA 2A3DA 1MIWA 4TWHA 4PJNA 3RYFE 4QX8B 1HX1B 4KP3C 2WDQA 4L9IA 2UXBT 4OFZA 2KWHA 1E7PA 1SUMB 5AQQB 4EXTA 4Z8XA 4MALA 2X51A 5HEOA 1FMVA 2IDOB 3RIUA 4CN4A 4YSYA 2NW9A 4U7YA 5F3JA 4ASKA 2XQAA 3UU4A 1MMNA 4DBQA 5JTGA 3SFEA 3K8PC 2D9DA 2I6HA 4F8HA 1UX5A 5ABHA 4ISTA 2CXDA 3PU8A 4AQFA 3OTOT 1YKHB 3QB5A 4TNVA 2IC6A 4PK5A 3N9NA 2EHOB 4KHPT 3G06A 2UXNB 1KNRA 2XAJB 3VKGA 3I1AA 2HPLA 1JNRA 4I0UA 4Z91A 4QXCB 4U72A 3VU7H 3ZKRA 2YU1A 2CEAA 3WI3A 5FXZA 3MJXA 3C4XA 2WZHA 3KDSE 2X0HA 1T72A 1ZHCA 3OYXA 1FEWA 3ZEFB 4LMJA 1UX4A 2V6XA 4H63V 4DV2T 3AE8A 3HKDE 3PUWF 2WZIA 3ZT6A 3LBXA 3RIFA 4JI4T 4DR2T 2V5DA 2E5VA 2VVSA 2VURA 4U2YA 2K48A 2EHOD 5LXTE 5CA0E 4JI7T 3LK42 5HXSA 4ZI3C 2LSYA 4HWHA 4DV6T 5L3EB 3IA3A 4IE6A 3E0ZA 1HNXT 3KBUA 3DJBA 3CWZB 2NWBA 5AQGB 1N33T 3W15B 3T1YT 2N1GA 4DR6T 3P4QA 3Q5WA 2XY8B 4JI3T 1QUUA 3LFMA 2Q9QA 4DV7T 3AA0B 3QB5K 3LJCA 2CLYC 2CWYA 3LK2B 1E2AA 3HKCE 4PJMA 5C2TA 2OA5A 1M7KA 1G73A 3SS1A 2IW5B 5HXHA 4QX7B 5IYZE 4LF9T 1X79A 3JC6C 4TZ4C 1CUNA 5HEGA 3RYCE 2UXXB 2LSJA 3N9OA 4HFEA 3DTOA 3B57A 4I43B 5HAXA 2Y8DA 2D0UA 3L09A 1KEYA 4M1PA 4CXXA 1Z0PA 5F5WA 2NTXA 3DP7A 4DR3T 2CM0A 1XMOT 4DV3T 3BK9A 3Q5DA 2H89A 4UVCB 2XAQB 1T98A 4EGWA 3CVRA 5CB4E 4HWDA 3AE3A 4EZHA 2ZM2A 2RP4A 1HFAA 2XAFB 2UXDT 4HN9A 5JDNA 2DL1A 1S94A 3AE5A 4TWDA 3EUHA 1HTJF 2Q9QB 4P0BA 4YXDA 2LEHA 3ZCJA 4EEBA 4U2ZA 3GA8A 5LNKA 1HNWT 2QA7A 4IL4A 2V7MA 4GKJT 4DUZT 3ZMSB 2BBHA 4ILUA 4XBFB 3P50A 1QLBA 2KSRA 2BG9A 4WYVA 1GQEA 2HN2A 3SOLA 3C98B 2LKGA 5H6QB 2Q9QD 4HFDA 3EDVA 1YXRA 4IDZA 4DO0A 2OLTA 3VRBA 3OVUA 1UCUA 2HHHT 4EIWA 5J1GA 5AQHB 3K3OA 4UVAB 3VHLA 2J4GA 5JR9A 3PU3A 4BAYB 5M4YA 5LG4A 3N5LA 3SFDA 2XSBA 2V6YA 2CE7A 3K3QC 2BBJA 4PK6A 4E7ZA 3P4WA 1VCTA 4X1IE 4DVDA 3RC3A 4JYAT 2WMOA 2QRXA 2V1DB 4ZI2C 5A1LA 4EAHA 2XJ7A 3ZMTB 2LJLA 3PUXF 5J2UE 3K3NA 2FJAA 3UTKA 3FHNA 4UIGA 2JIWA 4YHHT 1Z8UA 2VWAA 3KV6A 1CHUA 4DV1T 4NXNT 4DV4T 3HKBE 3GWHA 4HWCA 2E9XA 1R8IA 2M6IA 4H63H 3H3MA 4ZHQE 3ZCIA 5HEJA 4MLKA 1FIOA 3KV5A 1UGOA 4DNDA 2X67A 2X9YA 4GKKT 2UU9T 2DNXA 1MIYA 3P7IA 3KBTA 3BQLA 5AQRB 2JRKA 4TWFA 3J7Yq 2ODVA 4HE8A 5L47A 3RQWA 5IUXA 2W4XA 3HKEE 2ZLYA 3VR8A 4PFPA 2X0YA 3AEFA 1SA0E 3N2GE 5ADXL 5JR9B 4PJLA 4H9PC 2WCAA 2RA1A 3CK6A 2N2NA 4OK0A 3EAMA 3S4UA 4LFCT 4CI2B 5CFBA 4UV8B 3U3IA 1ZKEA 3RQUA 3RH3A 4BJMA 1WYCA 2XUEA 3AXJA 4ZS2A 5TAOA 5J0ZA 4IIJE 3WAKA 4LFAT 1I94T 2CRBA 4X5TA 1OEDC 2MTQA 3FBZA 3ZSSA 1EZ3A 3PUZF 3V5SA 4WBNE 1KNPA 1HNZT 2DCFA 2UUCT 2LOPA 5ABEA 5L3FB 3RHWA 4PW8A 3EABA 4UELA 2MYSA 2W2UA 1OEDE 2WDRA 1W09A 2X9XA 2XPKA 1MIVA 4AISA 4X20E 3NRYA 4ZI7E 3FBLA 2ODUA 1HG2A 2ACXA 4LMLA 3RKGA 1D1BA 4XAXB 1Y64B 4U33A 3VKHA 5LP6E 1HR0T 4H9SE 4KMCA 2K5BB 1IBMT 3RYIE 1MNEA 2LRKA 3A5XA 4I50E 4AKGA 2L3LA 2XQ9A 3N2KE 1SE7A 4N78D 2J47A 4B3MT 3PUQA 4CI1B 2CHOA 5FL1A 3ZC0A 4H9RC 4DBRA 4C91A 3E08A 3FZHB 4NUVA 2BKNA 5AQOB 3UQ4A 1XNRT 1W9RA 4HFHA 2BKPA 4JEUB 3RC8A 3FZMB 2DWGA 2N9DA 5L2LA 5AQTB 4TV9E 2X66A 2H7OA 2LOSA 2ZM6T 4O2AE 4GK0E 4X1KE 5CGMA 4CQIA 4IT4A 3ONJA 1WR0A 1SHZC 3QC9A 4IGUA 5AQSB 5JDFA 4DV5T 3AA7B 4DR5T 2KMFA 3RLFF 4HFCA 2H3RA 1LKXA 2MOZA 3RGLA 3P8CD 3C4WA 3V5UA 5FVLA 5JDGA 2D5UA 3RI5A 4EB6E 2LM2A 4JEHB 1YD8G 5HCMA 2Z6EA 3L39A 3A7MA 2ZMAA 3RX6A 2YK0A 1YQ4A 2JPFA 3IEEA 4COFA 5FY1A 2YDRA 3UFEA 3OBVE 2XQ4A 4NXMT 2YDQA 3CX8B 4B3ST 1OWAA 5BR8T 2CLYB 3AE2A 5LGTB 2XQ7A 3Q9DA 2XM2A 2VQFT 5AQKB 1KNZA 5LG3A 5L3CB 4ZS3A 3OKQA 2A2FX 4ZI3D 3CQGB 1BR0A 1ZP0A 2KINB 4YT0A 3ZJ2A 5AQJB 3ZYLA 4LMKA 5AFUL 3N2OA 3CX6B 5AQVB 4GIWA 5IHYA 1IJ5A 2XSAA 1MMGA 4P09A 5JDQA 3MK7C 4OHFA 3O4XE 1B7TA 4EEDA 5LMUT 2YU2A 4PAGA 2XTLA 3UULA 4F6RC 3JC6D 4O4LE 5AQFB 3F57A 4JI8T 3PUYF 1IJ6A 2NR4A 4JI6T 2CHNA 3L3PA 2VK9A 3TLVA 4ADZA 4UF0A 3QK6A 3AEBA 2CBJA 4UEMA 3UFGA 5FP3A 4YTMA 2GK9A 2LM9A 2XQYA 3F31A 3FZKB 2UXCT 2UUBT 3LG7A 1J5ET 4ZXLA 2WS3A 2A72A 5KDMC 4OYJA 3FZFB 4JUYA 4GYSA 3GN5A 1BR1A 3O9XA 5HXCA 1Y01A 3M3ZB 1BR4A 5FVKA 4C90A 4MBQA 3UU3A 3PURA 3PUAA 4AIUA 3PUGA 2XM1A 5J2TE 4U3CA 4QWNB 4IDPA 4GOUA 2W67A 4IE5A 2VKJA 5JQGE 4EV6A 3MACA 3OYZA 3ZN0B 3RIUC 4EYYR 1ZV4X 2XQ8A 1WR6A 4H9OC 4HFVA 5AQIB 2CXFA 4HWIB 2NTYA 4A56A 5ABFA 2J1DG 3ZLIA 5DQWA 3P4SA 3GMIA 4X64T 3ZT7A 5FXXA 3ZT5A 2MAWA 4UF0B 2WU5A 4AQFC 1DU2A 4AKIA 1G8XA 3C50A 3N9MA 3OPCA 2V5CA 4EZ4A 2WY2A 1FJGT 2XQ6A 4DR1T 4LF5T 3ZC1A 4H9QC 3ZYMA 2WMNA 1OEDA 5DABA 2HH7A 3GN5B 4ZZCA 4YTPA 4TN7B 3X1DA 2C5KT 4HKAA 3AEEA 3HR0A 4YSZA 2NW7A 5H6RB 4LF4T 2Y48B 4L5GA 5JVDE 4O4HE 2WDVA 2VKDA 4ZI2D 5HWYA 4CI3B 3ZMVB 4A5XA 2YDSA 4CN6A 1N32T 2K3WA 3JCFA 1M62A 5AQLB 1VRBA 5ABFB 3CPZA 5KXJA 2Y6XA 4KBMB 4Q25A 4TNWA 2AXDS 4QH5A 4UVBB 5LB7B 1N34T 3ABVA 5FKYA 4TUYE 4J2CA 3UUBA 2NW8A 1LVFA 5FNVE 4DMVA 3AVRA 1JNZA 2PFVA 2D2SA 3AEAA 1I6ZA 5LOVE 1J1JA 3NRXA 3ZMZB 4GK5E 4H9NC 3EVYA 5GONE 4YLHA 2YEVC 1OEDB 3RRCA 4B3RT 1NAFA 3QOFA 4V1Av 2AE9A 3UT5E 4YY3T 2X68A 4IREA 5KMGP 4AI6A 3O1IA 1S35A 2VL0A 4AQYT 3EDUA 1IBKT 2YINA 4QXBB 2R6GF 3LDQB 4IE0A 3NWIA 2LKHA 2JQ9A 3FZLB 3RIAA 2HN1A 2WBLA 3AECA 3PUSA 4DR7T 2VQET 1UURA 1WRDA 3KVAA 3NZPA 2E5LT 2IC9A 2V7KA 5F8PA 3T1HT 2CMRA 3EI0A 3SWHA 2KLQA 2XQ3A 3EHZA 3KINB 5LHIB 2XAHB 3T8OA 3ZJ1A 4X66T 3CMLA 4IE7A 2BVLA 3PDYA 3QNUA 3UUMA 2B1EA 5L3GB 4ERRA 2YOEA 3VRAA 3FXEB 4JLEA 4JBWF 3Q2MA 2B76A 3AAAB 5LHGB 4MFRA 2QGSA 4U7IA 5HEHA 1L0VA 5FY7A 2E2AA 4ZEYA 3TLUA 4IHJE 1HX8A 2X0LB 2XAGB 1T7SA 1HF8A 1YKEB 2KNDA 2CBIA 4A98A 2WWUA 3ANWA 4NPPA 3R84B 1XDPA 4KI0F 2WWVA 5LMNT 3UUNA 2LT3A 4XZCA 1WCRA 1E1HB 3UU6A 4BA9A 2JJ9A 4PK4A 2RPAA 3SRZA 4QH1A 3KV4A 3L8RA 4ZZBA 3ESLA 2ZM0A 4LF7T 4CXWA 4A97A 3FB2A 2CXLA 5AQPB 2LHRA 4ILCA 3UU5A 3ZMUB 5LJMA 2KT9A 4PJJA 2XZEA 4P0AA 3LSVA 1W0AA 1O3XA 1D0ZA 1HCIA 3P4RA 3E22E 3ZPOA 4G63A 2CPTA 2V7JA 2V8SV 3PV0F 2VKHA 3D0TA 4FI5A 2E9XC 5HXEA 4O8SA 2JQKA 2A9UA 3HA4A 3H3AA 4MHCA 1NENA 3NKZA 3TLTA 4AKRB 2IIUA 2F4VT 4HGAA 5FL0A 5HWXA 3BQIA 1NEKA 3ANWB 2IHR1 2WQYA 2SPCA 2W61A 4CXYA 1XMQT 2FBWA 4KHZF 3RKOA 2ZM8A 1W0BA 2LRLA 5JREA 3CQCB 5LHHB 3Q5EA 3IF8B 1VOMA 2JQQA 3AB3B 2YN6A 2LE8A 2H7VC 2I0MA 4O2BE 1KFYA 1D1CA 5AQMB 2VL8A 5LA6E 2V7LA 2M67A 2XHEB 1MNDA 5AQNB 1MMDA 4JI0T 3I0OA 4ANJA 4UV9B 4IDNA 4YHJA 3C4ZA 2CWOA 3UU8A 1AJ3A 2LSIA 5LGNB 3ZYKA 5E0OA 5ABGA 1UK5A 3O1HA 2P9BA 3LK3B 4EYUA 1UUSA 1MMAA 2FJEA 5AQUB 4O4IE 3N9QA 4CZZB 2V7IA 1V9DA 2FJDA 4O4JE 4AKHA 3UQ7A 4DMWA 1ZOYA 3PUVF 3C64A 3P4PA 4HFBA 2QYWA 1FMWA 4NIQA 2DHRA 4DV0T 4X1YE 2L9QA 4HFIA 3IHRA 4WW0A 2VB6A 1WLXA 2DI4A 3B5MA 2VKOA 4IDQA 3TLSA 2XQ5A 2EHOC 2I59A 1T8BA 4JI2T 1LRZA 2JMKA 5EZYE 3ETUA 3MXZA 3TLWA 1WFDA 2YKSA 2PBIA 3IBPA 3AE6A 3PE0A 3CX7B 5FYMA 4QH4A 5L3DB 5LJNA 2XASB 3AEDA 4ILBA 3UUXB 5JH7E 3AE9A 3AEGA 2BZBA 2PG8A 1XZYA 2W00A 2BKOA 2VASA 1LVKA 3LBXB 4BJNA 5KX5E 2NOXA 3NBXX 1IBLT 3KV9A 3ONXA 3KVBA 2FUPA 4TX5A 1XDOA 3R6NA 1U5PA 2X9WA 5EK4A 2WM9A 2ES0A 3CQXC 5LBQB 4X65T 1YW0A 3AE1A 2IMLA 4AXPA 3NZQA 3RPUA 2K24A 2KXPB 2LHNA 1KF6A 2H88A 4YJ3E 3TKLB 2DWKA 4WBOA 2E8IA 4ZOLE 5FXWA 3RYHE 2OV9A 4DUYT 2FJBA 1D0XA 4IDOA 4OYKA 2W0GA 5LBMA 5JDHA 4JV5T 4OX9T 4E7SA 4U31A 3U78A 5IWAT 2V26A 5JDLA 2LLYA 3NVOA 3O1JA 3N9PA 4IL9A 5CJ5A 3HI2A 2KZ7B 1J5WA 2BS4A 4QXHB 4EOZB 1U4QA 1ZEEA 3ZSTA 3MZKB 1N36T 3AAIA 1D1AA 4YTNA 3AE7A 4YSXA 4U74A 1HS7A 4CN1A 2WB5A 2LSGA 4YFSA 2BVMA 5L3BB 5LGUB 2LSKA 2W63A 5LCYA 3A8YC 2W66A 4UXNB 2BS3A 3PJAJ 5HCJA 2Q9QC 1QSDA 5HXRA 3OJAA 3AE4A 2K9AA 2PTFA 4X62T 5EK3A 5FY0A 5EK2A 2G0UA 4B3TT 2C5JA 5L4HA 1D0YA 4LF8T 3RRWA 2L8KA
chains in the Genus database with same CATH topology
2HHHT 4DR3T 1XNRT 1XMOT 4DV3T 2VQFT 1XNQT 4LFCT 4DR7T 2UXBT 2VQET 5LMNT 4DUYT 2E5LT 4JI7T 2UUAT 4LF4T 3T1HT 4JI2T 4JI5T 4DV6T 4JV5T 1HNXT 4LFAT 1I94T 4JYAT 2UXDT 4OX9T 2ZM6T 5IWAT 1N33T 3T1YT 4LF6T 4LF7T 4K0KT 1HNZT 4DR6T 1N32T 4X66T 4JI0T 2UUCT 4JI3T 4DV7T 4YHHT 4DV5T 4DR5T 1N36T 1HNWT 4DV1T 5LMUT 1N34T 4NXNT 4DV4T 4GKJT 4DUZT 4X64T 3OTOT 4JI8T 4DR4T 4LF9T 4KHPT 1IBLT 4JI1T 4JI6T 4GKKT 1HR0T 2UU9T 1IBMT 4B3RT 4LFBT 4X65T 1FJGT 2F4VT 4DR1T 4B3MT 4LF5T 4NXMT 4YY3T 4DV0T 4DV2T 4X62T 2UXCT 4AQYT 2UUBT 1IBKT 4B3ST 4B3TT 1J5ET 5BR8T 4LF8T 1XMQT 4JI4T 4DR2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH T;  4DR3 T;  1XNR T;  1XMO T;  4DV3 T;  2VQF T;  1XNQ T;  4LFC T;  4DR7 T;  2UXB T;  2VQE T;  5LMN T;  4DUY T;  2E5L T;  4JI7 T;  2UUA T;  4LF4 T;  3T1H T;  4JI2 T;  4JI5 T;  4DV6 T;  4JV5 T;  1HNX T;  4LFA T;  1I94 T;  4JYA T;  2UXD T;  4OX9 T;  2ZM6 T;  5IWA T;  1N33 T;  3T1Y T;  4LF6 T;  4LF7 T;  4K0K T;  1HNZ T;  4DR6 T;  1N32 T;  4X66 T;  4JI0 T;  2UUC T;  4JI3 T;  4DV7 T;  4YHH T;  4DV5 T;  4DR5 T;  1N36 T;  1HNW T;  4DV1 T;  5LMU T;  1N34 T;  4NXN T;  4DV4 T;  4GKJ T;  4DUZ T;  4X64 T;  3OTO T;  4JI8 T;  4DR4 T;  4LF9 T;  4KHP T;  1IBL T;  4JI1 T;  4JI6 T;  4GKK T;  1HR0 T;  2UU9 T;  1IBM T;  4B3R T;  4LFB T;  4X65 T;  1FJG T;  2F4V T;  4DR1 T;  4B3M T;  4LF5 T;  4NXM T;  4YY3 T;  4DV0 T;  4DV2 T;  4X62 T;  2UXC T;  4AQY T;  2UUB T;  1IBK T;  4B3S T;  4B3T T;  1J5E T;  5BR8 T;  4LF8 T;  1XMQ T;  4JI4 T;  4DR2 T; 
#chains in the Genus database with same CATH topology
 3F2E A;  1XNQ T;  4FJO A;  2IUB A;  3KFW X;  4K0U A;  2KWI B;  5JDM A;  5BMV E;  3AA1 B;  2UUA T;  4ISS A;  2PJQ A;  2BDE A;  4I55 E;  4UR9 A;  3QUJ A;  2M6B A;  3PJA A;  2BG9 B;  3N9L A;  3AVS A;  2MBG A;  3C51 A;  3AAE B;  1US7 B;  4QKN A;  2QVA A;  3I0Q A;  3HL6 A;  3ZN1 B;  2IAK A;  3B13 A;  4QHO A;  5L4E A;  3AA6 B;  4P1N A;  5DJQ C;  2W62 A;  3BQK A;  4HTE A;  5FXV A;  4I4T E;  4NUU A;  3I9W A;  5DQV A;  4G2A A;  4DID B;  4WNK A;  5JRC A;  2V6Y B;  3CIR A;  5HYA A;  2JMH A;  5LYJ E;  1WYB A;  2D0T A;  2WU2 A;  1KK7 A;  4KUM B;  3FXD B;  4TV8 E;  4HWF A;  5C3J A;  3JAE A;  4PNI A;  1HG5 A;  2CA5 A;  4B6X A;  4PFO A;  2VVN A;  1YQ3 A;  3WAJ A;  2BG9 C;  5ETW A;  5HEU A;  4WZX A;  3K1S A;  2BS2 A;  2C5I T;  2X9H A;  3M65 A;  1X9B A;  2WP9 A;  4AKL A;  3PTR B;  4JI5 T;  2WSS V;  4YJ2 E;  3MA9 A;  4IE4 A;  2E9X B;  3Q5X A;  2CCQ A;  3J9X 1;  4AQG A;  2JQH A;  4L0R A;  3JAF A;  2BG9 E;  4LF6 T;  4KX6 A;  2WAU A;  4K0K T;  1IAP A;  4ILA A;  3H37 A;  5CA1 E;  2MPK A;  3MKD A;  1VCS A;  1OXZ A;  2HPJ A;  5JR9 C;  2C0S A;  1NWM X;  2DLR A;  4GYR A;  3ONL C;  4DR4 T;  1BR2 A;  2ACZ A;  4HEA A;  3RF1 A;  5JRC B;  4JI1 T;  1XWM A;  2J62 A;  3I9Y A;  2E9X D;  2EHO A;  1IZN B;  3CKD A;  3VR9 A;  3AXJ B;  2NP9 A;  4LFB T;  1H7C A;  5FMN A;  3JAD A;  4Z90 A;  5C8Y E;  3ETV A;  2A3D A;  1MIW A;  4TWH A;  4PJN A;  3RYF E;  4QX8 B;  1HX1 B;  4KP3 C;  2WDQ A;  4L9I A;  2UXB T;  4OFZ A;  2KWH A;  1E7P A;  1SUM B;  5AQQ B;  4EXT A;  4Z8X A;  4MAL A;  2X51 A;  5HEO A;  1FMV A;  2IDO B;  3RIU A;  4CN4 A;  4YSY A;  2NW9 A;  4U7Y A;  5F3J A;  4ASK A;  2XQA A;  3UU4 A;  1MMN A;  4DBQ A;  5JTG A;  3SFE A;  3K8P C;  2D9D A;  2I6H A;  4F8H A;  1UX5 A;  5ABH A;  4IST A;  2CXD A;  3PU8 A;  4AQF A;  3OTO T;  1YKH B;  3QB5 A;  4TNV A;  2IC6 A;  4PK5 A;  3N9N A;  2EHO B;  4KHP T;  3G06 A;  2UXN B;  1KNR A;  2XAJ B;  3VKG A;  3I1A A;  2HPL A;  1JNR A;  4I0U A;  4Z91 A;  4QXC B;  4U72 A;  3VU7 H;  3ZKR A;  2YU1 A;  2CEA A;  3WI3 A;  5FXZ A;  3MJX A;  3C4X A;  2WZH A;  3KDS E;  2X0H A;  1T72 A;  1ZHC A;  3OYX A;  1FEW A;  3ZEF B;  4LMJ A;  1UX4 A;  2V6X A;  4H63 V;  4DV2 T;  3AE8 A;  3HKD E;  3PUW F;  2WZI A;  3ZT6 A;  3LBX A;  3RIF A;  4JI4 T;  4DR2 T;  2V5D A;  2E5V A;  2VVS A;  2VUR A;  4U2Y A;  2K48 A;  2EHO D;  5LXT E;  5CA0 E;  4JI7 T;  3LK4 2;  5HXS A;  4ZI3 C;  2LSY A;  4HWH A;  4DV6 T;  5L3E B;  3IA3 A;  4IE6 A;  3E0Z A;  1HNX T;  3KBU A;  3DJB A;  3CWZ B;  2NWB A;  5AQG B;  1N33 T;  3W15 B;  3T1Y T;  2N1G A;  4DR6 T;  3P4Q A;  3Q5W A;  2XY8 B;  4JI3 T;  1QUU A;  3LFM A;  2Q9Q A;  4DV7 T;  3AA0 B;  3QB5 K;  3LJC A;  2CLY C;  2CWY A;  3LK2 B;  1E2A A;  3HKC E;  4PJM A;  5C2T A;  2OA5 A;  1M7K A;  1G73 A;  3SS1 A;  2IW5 B;  5HXH A;  4QX7 B;  5IYZ E;  4LF9 T;  1X79 A;  3JC6 C;  4TZ4 C;  1CUN A;  5HEG A;  3RYC E;  2UXX B;  2LSJ A;  3N9O A;  4HFE A;  3DTO A;  3B57 A;  4I43 B;  5HAX A;  2Y8D A;  2D0U A;  3L09 A;  1KEY A;  4M1P A;  4CXX A;  1Z0P A;  5F5W A;  2NTX A;  3DP7 A;  4DR3 T;  2CM0 A;  1XMO T;  4DV3 T;  3BK9 A;  3Q5D A;  2H89 A;  4UVC B;  2XAQ B;  1T98 A;  4EGW A;  3CVR A;  5CB4 E;  4HWD A;  3AE3 A;  4EZH A;  2ZM2 A;  2RP4 A;  1HFA A;  2XAF B;  2UXD T;  4HN9 A;  5JDN A;  2DL1 A;  1S94 A;  3AE5 A;  4TWD A;  3EUH A;  1HTJ F;  2Q9Q B;  4P0B A;  4YXD A;  2LEH A;  3ZCJ A;  4EEB A;  4U2Z A;  3GA8 A;  5LNK A;  1HNW T;  2QA7 A;  4IL4 A;  2V7M A;  4GKJ T;  4DUZ T;  3ZMS B;  2BBH A;  4ILU A;  4XBF B;  3P50 A;  1QLB A;  2KSR A;  2BG9 A;  4WYV A;  1GQE A;  2HN2 A;  3SOL A;  3C98 B;  2LKG A;  5H6Q B;  2Q9Q D;  4HFD A;  3EDV A;  1YXR A;  4IDZ A;  4DO0 A;  2OLT A;  3VRB A;  3OVU A;  1UCU A;  2HHH T;  4EIW A;  5J1G A;  5AQH B;  3K3O A;  4UVA B;  3VHL A;  2J4G A;  5JR9 A;  3PU3 A;  4BAY B;  5M4Y A;  5LG4 A;  3N5L A;  3SFD A;  2XSB A;  2V6Y A;  2CE7 A;  3K3Q C;  2BBJ A;  4PK6 A;  4E7Z A;  3P4W A;  1VCT A;  4X1I E;  4DVD A;  3RC3 A;  4JYA T;  2WMO A;  2QRX A;  2V1D B;  4ZI2 C;  5A1L A;  4EAH A;  2XJ7 A;  3ZMT B;  2LJL A;  3PUX F;  5J2U E;  3K3N A;  2FJA A;  3UTK A;  3FHN A;  4UIG A;  2JIW A;  4YHH T;  1Z8U A;  2VWA A;  3KV6 A;  1CHU A;  4DV1 T;  4NXN T;  4DV4 T;  3HKB E;  3GWH A;  4HWC A;  2E9X A;  1R8I A;  2M6I A;  4H63 H;  3H3M A;  4ZHQ E;  3ZCI A;  5HEJ A;  4MLK A;  1FIO A;  3KV5 A;  1UGO A;  4DND A;  2X67 A;  2X9Y A;  4GKK T;  2UU9 T;  2DNX A;  1MIY A;  3P7I A;  3KBT A;  3BQL A;  5AQR B;  2JRK A;  4TWF A;  3J7Y q;  2ODV A;  4HE8 A;  5L47 A;  3RQW A;  5IUX A;  2W4X A;  3HKE E;  2ZLY A;  3VR8 A;  4PFP A;  2X0Y A;  3AEF A;  1SA0 E;  3N2G E;  5ADX L;  5JR9 B;  4PJL A;  4H9P C;  2WCA A;  2RA1 A;  3CK6 A;  2N2N A;  4OK0 A;  3EAM A;  3S4U A;  4LFC T;  4CI2 B;  5CFB A;  4UV8 B;  3U3I A;  1ZKE A;  3RQU A;  3RH3 A;  4BJM A;  1WYC A;  2XUE A;  3AXJ A;  4ZS2 A;  5TAO A;  5J0Z A;  4IIJ E;  3WAK A;  4LFA T;  1I94 T;  2CRB A;  4X5T A;  1OED C;  2MTQ A;  3FBZ A;  3ZSS A;  1EZ3 A;  3PUZ F;  3V5S A;  4WBN E;  1KNP A;  1HNZ T;  2DCF A;  2UUC T;  2LOP A;  5ABE A;  5L3F B;  3RHW A;  4PW8 A;  3EAB A;  4UEL A;  2MYS A;  2W2U A;  1OED E;  2WDR A;  1W09 A;  2X9X A;  2XPK A;  1MIV A;  4AIS A;  4X20 E;  3NRY A;  4ZI7 E;  3FBL A;  2ODU A;  1HG2 A;  2ACX A;  4LML A;  3RKG A;  1D1B A;  4XAX B;  1Y64 B;  4U33 A;  3VKH A;  5LP6 E;  1HR0 T;  4H9S E;  4KMC A;  2K5B B;  1IBM T;  3RYI E;  1MNE A;  2LRK A;  3A5X A;  4I50 E;  4AKG A;  2L3L A;  2XQ9 A;  3N2K E;  1SE7 A;  4N78 D;  2J47 A;  4B3M T;  3PUQ A;  4CI1 B;  2CHO A;  5FL1 A;  3ZC0 A;  4H9R C;  4DBR A;  4C91 A;  3E08 A;  3FZH B;  4NUV A;  2BKN A;  5AQO B;  3UQ4 A;  1XNR T;  1W9R A;  4HFH A;  2BKP A;  4JEU B;  3RC8 A;  3FZM B;  2DWG A;  2N9D A;  5L2L A;  5AQT B;  4TV9 E;  2X66 A;  2H7O A;  2LOS A;  2ZM6 T;  4O2A E;  4GK0 E;  4X1K E;  5CGM A;  4CQI A;  4IT4 A;  3ONJ A;  1WR0 A;  1SHZ C;  3QC9 A;  4IGU A;  5AQS B;  5JDF A;  4DV5 T;  3AA7 B;  4DR5 T;  2KMF A;  3RLF F;  4HFC A;  2H3R A;  1LKX A;  2MOZ A;  3RGL A;  3P8C D;  3C4W A;  3V5U A;  5FVL A;  5JDG A;  2D5U A;  3RI5 A;  4EB6 E;  2LM2 A;  4JEH B;  1YD8 G;  5HCM A;  2Z6E A;  3L39 A;  3A7M A;  2ZMA A;  3RX6 A;  2YK0 A;  1YQ4 A;  2JPF A;  3IEE A;  4COF A;  5FY1 A;  2YDR A;  3UFE A;  3OBV E;  2XQ4 A;  4NXM T;  2YDQ A;  3CX8 B;  4B3S T;  1OWA A;  5BR8 T;  2CLY B;  3AE2 A;  5LGT B;  2XQ7 A;  3Q9D A;  2XM2 A;  2VQF T;  5AQK B;  1KNZ A;  5LG3 A;  5L3C B;  4ZS3 A;  3OKQ A;  2A2F X;  4ZI3 D;  3CQG B;  1BR0 A;  1ZP0 A;  2KIN B;  4YT0 A;  3ZJ2 A;  5AQJ B;  3ZYL A;  4LMK A;  5AFU L;  3N2O A;  3CX6 B;  5AQV B;  4GIW A;  5IHY A;  1IJ5 A;  2XSA A;  1MMG A;  4P09 A;  5JDQ A;  3MK7 C;  4OHF A;  3O4X E;  1B7T A;  4EED A;  5LMU T;  2YU2 A;  4PAG A;  2XTL A;  3UUL A;  4F6R C;  3JC6 D;  4O4L E;  5AQF B;  3F57 A;  4JI8 T;  3PUY F;  1IJ6 A;  2NR4 A;  4JI6 T;  2CHN A;  3L3P A;  2VK9 A;  3TLV A;  4ADZ A;  4UF0 A;  3QK6 A;  3AEB A;  2CBJ A;  4UEM A;  3UFG A;  5FP3 A;  4YTM A;  2GK9 A;  2LM9 A;  2XQY A;  3F31 A;  3FZK B;  2UXC T;  2UUB T;  3LG7 A;  1J5E T;  4ZXL A;  2WS3 A;  2A72 A;  5KDM C;  4OYJ A;  3FZF B;  4JUY A;  4GYS A;  3GN5 A;  1BR1 A;  3O9X A;  5HXC A;  1Y01 A;  3M3Z B;  1BR4 A;  5FVK A;  4C90 A;  4MBQ A;  3UU3 A;  3PUR A;  3PUA A;  4AIU A;  3PUG A;  2XM1 A;  5J2T E;  4U3C A;  4QWN B;  4IDP A;  4GOU A;  2W67 A;  4IE5 A;  2VKJ A;  5JQG E;  4EV6 A;  3MAC A;  3OYZ A;  3ZN0 B;  3RIU C;  4EYY R;  1ZV4 X;  2XQ8 A;  1WR6 A;  4H9O C;  4HFV A;  5AQI B;  2CXF A;  4HWI B;  2NTY A;  4A56 A;  5ABF A;  2J1D G;  3ZLI A;  5DQW A;  3P4S A;  3GMI A;  4X64 T;  3ZT7 A;  5FXX A;  3ZT5 A;  2MAW A;  4UF0 B;  2WU5 A;  4AQF C;  1DU2 A;  4AKI A;  1G8X A;  3C50 A;  3N9M A;  3OPC A;  2V5C A;  4EZ4 A;  2WY2 A;  1FJG T;  2XQ6 A;  4DR1 T;  4LF5 T;  3ZC1 A;  4H9Q C;  3ZYM A;  2WMN A;  1OED A;  5DAB A;  2HH7 A;  3GN5 B;  4ZZC A;  4YTP A;  4TN7 B;  3X1D A;  2C5K T;  4HKA A;  3AEE A;  3HR0 A;  4YSZ A;  2NW7 A;  5H6R B;  4LF4 T;  2Y48 B;  4L5G A;  5JVD E;  4O4H E;  2WDV A;  2VKD A;  4ZI2 D;  5HWY A;  4CI3 B;  3ZMV B;  4A5X A;  2YDS A;  4CN6 A;  1N32 T;  2K3W A;  3JCF A;  1M62 A;  5AQL B;  1VRB A;  5ABF B;  3CPZ A;  5KXJ A;  2Y6X A;  4KBM B;  4Q25 A;  4TNW A;  2AXD S;  4QH5 A;  4UVB B;  5LB7 B;  1N34 T;  3ABV A;  5FKY A;  4TUY E;  4J2C A;  3UUB A;  2NW8 A;  1LVF A;  5FNV E;  4DMV A;  3AVR A;  1JNZ A;  2PFV A;  2D2S A;  3AEA A;  1I6Z A;  5LOV E;  1J1J A;  3NRX A;  3ZMZ B;  4GK5 E;  4H9N C;  3EVY A;  5GON E;  4YLH A;  2YEV C;  1OED B;  3RRC A;  4B3R T;  1NAF A;  3QOF A;  4V1A v;  2AE9 A;  3UT5 E;  4YY3 T;  2X68 A;  4IRE A;  5KMG P;  4AI6 A;  3O1I A;  1S35 A;  2VL0 A;  4AQY T;  3EDU A;  1IBK T;  2YIN A;  4QXB B;  2R6G F;  3LDQ B;  4IE0 A;  3NWI A;  2LKH A;  2JQ9 A;  3FZL B;  3RIA A;  2HN1 A;  2WBL A;  3AEC A;  3PUS A;  4DR7 T;  2VQE T;  1UUR A;  1WRD A;  3KVA A;  3NZP A;  2E5L T;  2IC9 A;  2V7K A;  5F8P A;  3T1H T;  2CMR A;  3EI0 A;  3SWH A;  2KLQ A;  2XQ3 A;  3EHZ A;  3KIN B;  5LHI B;  2XAH B;  3T8O A;  3ZJ1 A;  4X66 T;  3CML A;  4IE7 A;  2BVL A;  3PDY A;  3QNU A;  3UUM A;  2B1E A;  5L3G B;  4ERR A;  2YOE A;  3VRA A;  3FXE B;  4JLE A;  4JBW F;  3Q2M A;  2B76 A;  3AAA B;  5LHG B;  4MFR A;  2QGS A;  4U7I A;  5HEH A;  1L0V A;  5FY7 A;  2E2A A;  4ZEY A;  3TLU A;  4IHJ E;  1HX8 A;  2X0L B;  2XAG B;  1T7S A;  1HF8 A;  1YKE B;  2KND A;  2CBI A;  4A98 A;  2WWU A;  3ANW A;  4NPP A;  3R84 B;  1XDP A;  4KI0 F;  2WWV A;  5LMN T;  3UUN A;  2LT3 A;  4XZC A;  1WCR A;  1E1H B;  3UU6 A;  4BA9 A;  2JJ9 A;  4PK4 A;  2RPA A;  3SRZ A;  4QH1 A;  3KV4 A;  3L8R A;  4ZZB A;  3ESL A;  2ZM0 A;  4LF7 T;  4CXW A;  4A97 A;  3FB2 A;  2CXL A;  5AQP B;  2LHR A;  4ILC A;  3UU5 A;  3ZMU B;  5LJM A;  2KT9 A;  4PJJ A;  2XZE A;  4P0A A;  3LSV A;  1W0A A;  1O3X A;  1D0Z A;  1HCI A;  3P4R A;  3E22 E;  3ZPO A;  4G63 A;  2CPT A;  2V7J A;  2V8S V;  3PV0 F;  2VKH A;  3D0T A;  4FI5 A;  2E9X C;  5HXE A;  4O8S A;  2JQK A;  2A9U A;  3HA4 A;  3H3A A;  4MHC A;  1NEN A;  3NKZ A;  3TLT A;  4AKR B;  2IIU A;  2F4V T;  4HGA A;  5FL0 A;  5HWX A;  3BQI A;  1NEK A;  3ANW B;  2IHR 1;  2WQY A;  2SPC A;  2W61 A;  4CXY A;  1XMQ T;  2FBW A;  4KHZ F;  3RKO A;  2ZM8 A;  1W0B A;  2LRL A;  5JRE A;  3CQC B;  5LHH B;  3Q5E A;  3IF8 B;  1VOM A;  2JQQ A;  3AB3 B;  2YN6 A;  2LE8 A;  2H7V C;  2I0M A;  4O2B E;  1KFY A;  1D1C A;  5AQM B;  2VL8 A;  5LA6 E;  2V7L A;  2M67 A;  2XHE B;  1MND A;  5AQN B;  1MMD A;  4JI0 T;  3I0O A;  4ANJ A;  4UV9 B;  4IDN A;  4YHJ A;  3C4Z A;  2CWO A;  3UU8 A;  1AJ3 A;  2LSI A;  5LGN B;  3ZYK A;  5E0O A;  5ABG A;  1UK5 A;  3O1H A;  2P9B A;  3LK3 B;  4EYU A;  1UUS A;  1MMA A;  2FJE A;  5AQU B;  4O4I E;  3N9Q A;  4CZZ B;  2V7I A;  1V9D A;  2FJD A;  4O4J E;  4AKH A;  3UQ7 A;  4DMW A;  1ZOY A;  3PUV F;  3C64 A;  3P4P A;  4HFB A;  2QYW A;  1FMW A;  4NIQ A;  2DHR A;  4DV0 T;  4X1Y E;  2L9Q A;  4HFI A;  3IHR A;  4WW0 A;  2VB6 A;  1WLX A;  2DI4 A;  3B5M A;  2VKO A;  4IDQ A;  3TLS A;  2XQ5 A;  2EHO C;  2I59 A;  1T8B A;  4JI2 T;  1LRZ A;  2JMK A;  5EZY E;  3ETU A;  3MXZ A;  3TLW A;  1WFD A;  2YKS A;  2PBI A;  3IBP A;  3AE6 A;  3PE0 A;  3CX7 B;  5FYM A;  4QH4 A;  5L3D B;  5LJN A;  2XAS B;  3AED A;  4ILB A;  3UUX B;  5JH7 E;  3AE9 A;  3AEG A;  2BZB A;  2PG8 A;  1XZY A;  2W00 A;  2BKO A;  2VAS A;  1LVK A;  3LBX B;  4BJN A;  5KX5 E;  2NOX A;  3NBX X;  1IBL T;  3KV9 A;  3ONX A;  3KVB A;  2FUP A;  4TX5 A;  1XDO A;  3R6N A;  1U5P A;  2X9W A;  5EK4 A;  2WM9 A;  2ES0 A;  3CQX C;  5LBQ B;  4X65 T;  1YW0 A;  3AE1 A;  2IML A;  4AXP A;  3NZQ A;  3RPU A;  2K24 A;  2KXP B;  2LHN A;  1KF6 A;  2H88 A;  4YJ3 E;  3TKL B;  2DWK A;  4WBO A;  2E8I A;  4ZOL E;  5FXW A;  3RYH E;  2OV9 A;  4DUY T;  2FJB A;  1D0X A;  4IDO A;  4OYK A;  2W0G A;  5LBM A;  5JDH A;  4JV5 T;  4OX9 T;  4E7S A;  4U31 A;  3U78 A;  5IWA T;  2V26 A;  5JDL A;  2LLY A;  3NVO A;  3O1J A;  3N9P A;  4IL9 A;  5CJ5 A;  3HI2 A;  2KZ7 B;  1J5W A;  2BS4 A;  4QXH B;  4EOZ B;  1U4Q A;  1ZEE A;  3ZST A;  3MZK B;  1N36 T;  3AAI A;  1D1A A;  4YTN A;  3AE7 A;  4YSX A;  4U74 A;  1HS7 A;  4CN1 A;  2WB5 A;  2LSG A;  4YFS A;  2BVM A;  5L3B B;  5LGU B;  2LSK A;  2W63 A;  5LCY A;  3A8Y C;  2W66 A;  4UXN B;  2BS3 A;  3PJA J;  5HCJ A;  2Q9Q C;  1QSD A;  5HXR A;  3OJA A;  3AE4 A;  2K9A A;  2PTF A;  4X62 T;  5EK3 A;  5FY0 A;  5EK2 A;  2G0U A;  4B3T T;  2C5J A;  5L4H A;  1D0Y A;  4LF8 T;  3RRW A;  2L8K A; 
#chains in the Genus database with same CATH homology
 2HHH T;  4DR3 T;  1XNR T;  1XMO T;  4DV3 T;  2VQF T;  1XNQ T;  4LFC T;  4DR7 T;  2UXB T;  2VQE T;  5LMN T;  4DUY T;  2E5L T;  4JI7 T;  2UUA T;  4LF4 T;  3T1H T;  4JI2 T;  4JI5 T;  4DV6 T;  4JV5 T;  1HNX T;  4LFA T;  1I94 T;  4JYA T;  2UXD T;  4OX9 T;  2ZM6 T;  5IWA T;  1N33 T;  3T1Y T;  4LF6 T;  4LF7 T;  4K0K T;  1HNZ T;  4DR6 T;  1N32 T;  4X66 T;  4JI0 T;  2UUC T;  4JI3 T;  4DV7 T;  4YHH T;  4DV5 T;  4DR5 T;  1N36 T;  1HNW T;  4DV1 T;  5LMU T;  1N34 T;  4NXN T;  4DV4 T;  4GKJ T;  4DUZ T;  4X64 T;  3OTO T;  4JI8 T;  4DR4 T;  4LF9 T;  4KHP T;  1IBL T;  4JI1 T;  4JI6 T;  4GKK T;  1HR0 T;  2UU9 T;  1IBM T;  4B3R T;  4LFB T;  4X65 T;  1FJG T;  2F4V T;  4DR1 T;  4B3M T;  4LF5 T;  4NXM T;  4YY3 T;  4DV0 T;  4DV2 T;  4X62 T;  2UXC T;  4AQY T;  2UUB T;  1IBK T;  4B3S T;  4B3T T;  1J5E T;  5BR8 T;  4LF8 T;  1XMQ T;  4JI4 T;  4DR2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...