2ZMFA

Crystal structure of the c-terminal gaf domain of human phosphodiesterase 10a
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
177
structure length
177
Chain Sequence
QTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase
publication title Crystal Structure of the GAF-B Domain from Human Phosphodiesterase 10A Complexed with Its Ligand, cAMP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.1.4.17: 3',5'-cyclic-nucleotide phosphodiesterase.
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2zmfA00
2O9BA 4Q0JA 5K5BA 4QPRA 4ZRRA 5HL6A 3MMHA 3NHQA 3S7NA 4ME4A 2GX5A 3NOPC 4DMZA 3KSIA 2B18A 4MMNA 4YOFA 4LRZE 2O99A 2W1RA 3E98A 2LB5A 2O9CA 2OOLA 2W3GA 2XRNA 3HCYA 2Y8HA 1ZTUA 4Q0IA 2W3FA 4G3VA 2IA2A 4Y5FA 4MCWA 4R70A 4G3KA 2K2NA 5L8MA 2LB9A 3OBFA 1F5MA 3DBAA 3G6OA 3IBJA 3RFBA 5HPIA 3NOTC 5DFYA 2XROA 2VZWA 3S7QA 3CITA 5AJGA 3MF0A 2W1TB 3W2ZA 3ZQ5A 4YNRA 3S7OA 2VJWA 1TD5A 4IUKA 3KSFA 2ZMFA 3OOVA 4EUVA 4O8GA 4GW9A 3VV4A 2VEAA 3CI6A 4LRXC 1MKMA 1YKDA 4Y2FA 3R4KA 4IUHA 5LBRA 2W3EA 2W1TA 3C2WA 1YSQA 3LFVA 4FOFA 5DFXA 5TJJA 4BWIA 2VKSA 4MDZA 4Y3IA 3E0YA 4RQ9A 3KO6A 4MN7A 1YSPA 4EU0A 3EEAA 4LRYC 2KLIA 4DN0A 2QYBA 5HSQA 3BJNA 3KSHA 1TF1A 2KOIA 2Y79A 4G3WA 5HPFA 3MQ0A 3NOUC 2XSSA 4PAUA 1MC0A 2K31A 3S7PA 3K2NA 1STZA 2M7VA 4Z1WA 2G7UA 2HGVA 4Q0HA 2M7UA 4R6LA 3TRCA 4ETXA 5I5LA 2W3DA 2O9AA 4IJGA 3KSGA 4CQHA 3IBRA 2W3HA 5C5KA 3D3OA 4O0PA 1VHMA 4E04A 2O0YA 4O01A 4GLQA 3O5YA 4ETZA
chains in the Genus database with same CATH superfamily
2O9BA 5EE8A 4CLCC 4KQDA 4D2OA 2PYPA 5FAOA 3T4JA 1W63M 1JTGA 4B93A 1W79A 4OOLA 3D72A 1PWGA 2V8FA 2W3GA 2IWBA 3UDXA 1IKIA 3DWZA 3C38A 2B95A 4R70A 2BG1A 3RTYA 3WWXA 5F5YA 2ZL1B 5BOHA 5HAPA 4B4XA 1PZOA 3BFFA 3N7WA 4YNRA 1ALQA 4X69A 3OCNA 3IX4A 3Q7VB 2FZ0A 4L0LA 4S2MA 5DTKA 1K54C 3UO9A 3WRZA 1I2SA 2ZM0A 5JYPA 4KQOA 4Y3IA 3PBRA 3TSGA 3E0YA 5F1FA 2HDQA 3GMWA 1AWIA 3MFDA 4MN7A 3AGDA 1P97A 4XUZA 3G31A 3SZTA 1G5UA 1TF1A 4WEKA 5HX9A 2XSSA 3F1OB 1E3UA 3ZCZA 1FQGA 5FI6A 4HESA 1XJ2A 1BZAA 5FSRA 3PXPA 1S0WA 2ZM8A 5FQIA 2Q9MA 4Y15A 1EROA 3RXWA 1RP5A 5DF7A 5EOEA 1LI9A 2V2FF 5KIZA 5IT5A 4UQIS 3UB9A 1IKGA 4GD8A 2HP6A 3C4OA 3VP1A 4EV4A 2PR6A 3CPTB 2WK0A 1DRMA 3NOPC 3OCLA 3BFDA 4WN5A 1YLYA 1OTIA 3OLOA 2Y8HA 1LHYA 5J7EA 4Y0TA 3G30A 3KYQA 4HY8A 4WYYA 4EBPA 1IYSA 4LV3A 2VZWA 3CG5A 5CGSA 2Y2MA 5FI7A 5FQKA 2VJWA 4RVAA 3MXSA 4S2PA 5HAQA 1AXBA 3IX3A 4JBFA 2IWCA 1FILA 4BBUA 1MKMA 2BLSA 2X01A 3O88A 2QZ6A 2ZMAA 2JCHA 2VGKA 3ULFA 4QU3A 3ZHHA 4OQHA 1L0GA 1FR1A 2HF6A 3EOIA 5CRFA 4CLCE 2ZQ8A 3LR3A 2VGLM 3HLFA 2ZL1A 1QMFA 2JBFA 3VOYA 2JC7A 4OOMA 3A3DA 5FDSA 4ETXA 2WKRA 2OAQ1 3B42A 3SS5A 2H0TA 3KSGA 1K0KA 3V3RA 2WKHA 3LYXA 2PT7A 3LUQA 4MBKA 3E2LA 1IYPA 4Y7PA 1PIOA 4ETZA 1ZKJA 1ES5A 3UPOA 3HVFA 3QHYA 3IT9A 4KG2A 1BUEA 1BLHA 3TOIA 4YOFA 4BMWA 3ITBA 2J9PA 3LIFA 4ESPA 2OOLA 3F1OA 3UE0A 4IBXA 3ZG0A 4BD1A 3JYIA 4UEYA 4JF4A 3IS2A 3W4OA 1WE4A 4WEJA 1TS6A 1F5MA 3MR0A 1MXOA 1ACFA 1NYYA 4P85A 2HV1A 3BFEA 3M2KA 1W8QA 2J9OA 4WZ5A 3LEQA 4CJNA 3T1XA 2WAEA 1CEFA 4JGOA 4X1MA 3UMDA 4Y0OA 3HLWA 4MEZA 5HDCA 3FKWA 3OC2A 2IWDA 5EV0A 3IF6B 4DRTA 2E8JA 1ZG6A 2HDSA 4MLLA 5GLCA 4RQ9A 2DRWA 2ZQCA 3WS2A 3H9WA 4UA9A 2HP5A 2KLIA 5AVFA 3O87A 2P74A 1NLYA 2INWA 5GLDA 2A2LA 3CMZA 3LR0A 3M6BA 1OPXA 4PAUA 1ES3A 1K55A 4X55A 5KSHA 4Q0HA 1Y4OA 3C8CA 1W7FA 2W3DA 4RA7A 2WGWB 3DTMA 1KE0A 1BYWA 3BFCA 4H6JA 1KGFA 4OQIA 2GNXA 4JXVA 3EEHA 4DF6A 1L0DA 3FPVA 4R4SA 2ZBBA 2GZAA 4Q0JA 2Y2IA 4WM9A 5CEBA 1P9RA 5F82A 4WL9A 1FSYA 3KYZA 1XA7A 4GCZA 4F3LB 2EX6A 3GECA 4S2JA 3PBTA 1NXYA 3HCYA 4Y13A 2Y2HA 2OLVA 3O3VA 2PD8A 3F1NB 1NZOA 2Y2KA 4L9EA 5I94A 3H82B 4DJ3A 1N9OA 2HDUA 4N9LA 1TDLA 3S7OA 2L4RA 1YLWA 2ZC3B 1CI8A 1ZG4A 3TW8A 1XP4A 4X6TA 2CC1A 3LIDA 1XGIA 3QP4A 2G2UA 5F68A 4HP9A 3JVUA 5AQAA 1Y54A 4KZ6A 4WMCD 5CGXA 4RX2A 3JVVA 1OMEA 2EX8A 2JE5A 1CEGA 3IWQA 2ZC4B 4P6BA 3P98A 4DE2A 4OKPA 1DP8A 5EPHA 5HPFA 3V39A 3MSHA 4I5SA 1LL8A 2PBYA 3BEBA 4DKIA 4S2NC 1DJCA 2DCFA 1LL5A 4PMAA 1NJ4A 1SZVA 3HLBA 1FIKA 1V9YA 5F69A 2XF3A 1JWZA 3LEZA 3GSGA 3MXRA 3LY3A 3GQZA 1BLCA 1FSWA 4R1GA 4OP8A 1E25A 1KE3A 4C3QA 4B88A 1S4RA 3MMHA 3NHQA 3IH9A 4PM6A 4PKYA 4E6WA 2GX5A 4Y17A 5EECA 3D9YA 2NUTC 4JXSA 3VFFA 5HAIA 3NECA 2PRFA 5HWVA 3UNWA 1Z09A 5A92A 4U3TA 2ZOIA 5TBMA 2RL3A 3VSKA 5HL1A 2XA7S 4HH2A 1M40A 4BENA 4OP5A 2PDRA 3IF5A 5G18A 3AGEA 1N4OA 1S4SA 5FQJA 3NIAA 2H10A 3WS5A 2L1MA 3CUEC 2W1TA 5EVEA 4CPKA 4F3LA 3WRTA 3BFGA 3ICYA 4QY5A 2GJ3A 4X53A 3LIEA 4PM8A 1T1AA 2EXBA 1K56D 2EWWA 4DJ2A 4E3MA 2PD7A 1XJ6A 2WGVA 5M1AA 2Z2LB 3DTIA 4P6ZS 4XXRA 4KQQA 5L09A 3BECA 4NXGA 1D7EA 3ZNYA 3ZVWA 5DKLA 5K5BA 1K57C 3MQOA 4WF0A 2D02A 4PM9A 5IU1A 2W1RA 3A3EA 3T50A 2O9CA 1MPLA 3NY4A 4EXOA 2WUQA 3OPPA 2ZOHA 3HLEA 1CK3A 2FH5A 3VE4A 3PBSA 5IHVA 4E3LA 5A8BA 1U60A 1SDNA 1S1YA 4WMCA 3EGDC 1O7EA 1K6SA 3RH8B 1GHIA 5FEGA 3OOVA 4BBTA 2E8IA 1PRQA 2M1CA 4II7A 3MBZA 4WUJA 5MC7A 1IFQA 4YFMA 4Y2FA 1T1BA 2EXAA 1UGUA 5DFXA 3V67A 4KZ7A 4A5RA 2ZLYA 2J8YA 4GHIA 2DMWA 3Q81A 1C3BA 4R3AA 1IEMA 3KO6A 4CLCB 1DJBA 2JN7A 4JGPA 1VB6A 4LRYC 2I9VA 2QYBA 5L10A 4OLGA 3VP0A 3SS3A 4DDYA 3S7PA 2M7VA 2JKTM 1EWZA 4GNUA 3QP2A 3C7VA 2G2WA 5KZHA 1PI4A 2B5RA 5CHMA 3UY6A 4EERA 2QHKA 4E3IA 5J4EA 1OTDA 3IX8A 1T19A 4CQHA 2VX8A 1NZUA 3E4QA 4QD4A 1GCEA 3LO7A 5FATA 4O0PA 2PHYA 4LCMA 2MJ6A 2C5WB 3QP1A 1ONGA 3BLMA 5HL6A 5M19A 1XXMA 4ME4A 3IS2B 1F9IA 3L9KA 3V3SA 4MCWA 2YKHA 3QP5A 3M2JA 3G6OA 4NK3A 5GHYA 1BTLA 4JF6A 3VSLA 3HUNA 4KENB 1YQSA 1XJ3A 3LGOA 1UWNX 4R23A 4NKPA 1GHMA 4K08A 2VEAA 4XT2A 3K3DA 4E6XA 4S2IA 5HDDA 3R4KA 1BLPA 1ONHA 1YPRA 4RX3A 3ZG5A 3U4LP 1W5DA 2Z6CA 3IXHA 2ACGA 1OJGA 1XKZA 3QP8A 1KVMA 4HJ4A 3WS1A 4IVKA 3HBRA 3MZEA 3T1RA 4H6JB 2V1BA 5FA7A 1SKOB 5FQ9A 4Z1WA 1BULA 2XH9A 1K25A 4R6LA 3TRCA 4JKTA 5E43A 3A3JA 4KUKA 3NDGA 4I38A 5FDHA 1FCMA 1SCWA 3PAGA 4HBUA 4S2KA 1J9MA 4WBGA 4GLQA 3U2AA 5DF8A 4FCFA 4BD0A 4QPRA 3EQVA 2YKFA 4CLCA 4PHTA 1D1JA 4DMZA 3AGFA 5CERA 4MMNA 1CQAA 2QMIA 1BT5A 1FCOA 4OPZA 3IXGA 4EUZA 1YLZA 3C5AA 1MWTA 2R78A 1G6OA 2V9AA 1TDGA 4G3VA 3MZFA 1L3LA 2PYRA 4KZ4A 3IBJA 1MY8A 3LCEA 3NOTC 2XROA 4JGQA 4Q8IA 2FFYA 2JHEA 3K3CA 3SH9A 3BLSA 4O8GA 5GL9A 5FAQA 2UV0E 1K54A 1XFQA 1IELA 4ZJ1A 1YKDA 5AQBA 5EVIC 5LBRA 3VFHA 4FH2A 4FOFA 5EM1A 2VKSA 2XFTA 3GR2A 2Z2MB 4FH4A 4QHCA 3IF6C 3ZNTA 4IHQA 1WA9A 3BJNA 4PM5A 5HWTA 5HW3A 4BBVA 3NOUC 3HJKA 1O07A 5L2FA 2OAP1 1MWRA 2CMNA 2OSUA 2G7UA 3NI9A 4MN6A 4MBFA 2Y2LA 3HLCA 3B33A 3O86A 4HQAA 2HJ9C 2P04A 3CZDA 1RGZA 2W3HA 3GV9A 3T4QA 1HD8A 2V0UA 4OPRA 3WS4A 3PBQA 4E04A 2KX6A 3I7JA 3FKVA 4X56A 4IBRA 1G28A 4NXEA 3LIBA 1Y28A 5TBMB 3QNCA 1FCNA 4LRZE 4NEED 4FSFA 1LSWA 1SKOA 4HJ6A 3P01A 1ERMA 3A0RA 2W3FA 4OQGA 1PFLA 4JF5A 3A3FA 5HPIA 2W1TB 1L2SA 4QJGA 1NLZA 2JKRI 2WKEA 1G68A 2EFUA 2ZMFA 3E2KA 1T18A 4GB7A 3VV4A 4H8RA 2I72A 5GLBA 5AQ7A 3N4IA 5DJUA 3EGXC 2VGLS 2EX9A 1KE4A 1L0FA 4ARZA 1NRFA 4MDZA 3LR5A 5D3OA 2XD1A 3BRMA 4K0WA 1YSPA 2BTFP 3T4OA 4DN0A 4KZBA 3Q07A 5HSQA 3KSHA 5CHJA 1MC0A 1XGJA 3K2NA 4R3JA 4HHDA 2JKGA 2VLGA 1YMSA 2M7UA 4GOGA 5FL3A 1JVJA 3TJZC 1HZOA 2J3TD 3N6IA 3BQ8A 4GN2A 1H8YA 4KZ9A 2ZQDA 4EQ1A 4Z9QA 2J3TC 1VHMA 4O01A 4I3AA 3B47A 1W63Q 2ZC5B 2OV5A 1PW8A 2C6WB 2UWXA 3UDIA 2L0WA 4C6YA 3SW1A 1V9ZA 4N1HA 3PHYA 3FPWA 3UB5P 2J3WA 2QJ7A 2ZJ9A 3QNBA 3E98A 1X0OA 4OLDA 3S1YA 4I3IA 2P9VA 3RJUA 4U0XA 2OWHA 4EBNA 1VETB 1SDEA 4R0QA 1HLUP 2VGJA 1LT0A 1NYMA 4KZ3A 2XD5A 3CITA 2Y4AA 3DTEA 3V5MA 3ZQ5A 1OT6A 3F1PB 1TD5A 4GHIB 2EX2A 3VMAA 3UN7A 4F94A 3T1SA 4MN5A 1UWPX 2Y2NA 4BJPA 3LR4A 5J3WA 3C2WA 3SH7A 3C7UA 3MZDA 1LSVA 4BLMA 4GKUA 3QP6A 1Z6FA 1KGGA 5CGWA 2OWJA 4EU0A 2WGIA 5GHZA 4QWOA 2VA0A 4OQ0A 1VEUA 5A90A 2EWVA 5HZHA 5DJTA 4BL2A 3NC8A 4JXWA 3N8RA 1I2WA 5HD5A 3TE8A 4K0XA 3T4LA 2O0YA 2VV6A 5EOOA 1FOFA 4GZBA 3H7WB 4HI4A 2ZQ9A 1MZUA 4I39A 1YT4A 4UQIM 4BQMA 1TS0A 1RGYA 3ZG8B 1ZTUA 3BYDA 4NG2A 4G3KA 3P09A 4JGRA 2ZQ7A 3PR6A 4KZ5A 4XT2B 2LB9A 3D4FA 4R3BA 3MXQA 1XA1A 1NWZA 3G35A 4WLAA 3RXXA 3T4SA 2XGNA 4N9KA 2GDNA 2VV7A 1WYCA 5HFOA 1XJ4A 4PPRA 1IYQA 4IUKA 3DTKA 2PU2A 3DAVA 2A49A 3G2YA 3CWFA 4LRXC 2WKIA 2H28A 4HH3A 2Y59A 5TFQA 3Q7ZA 1GA0A 4FUWA 5E2GA 1CF0A 1HVBA 3KX0X 5FI2A 3E4OA 1ES2A 3N8SA 3ZG9B 1G6AA 1KDWA 4G3WA 3G2ZA 4PKYG 2P7JA 4XUXA 2EA9A 3VOLA 1VETA 3A0SA 2XK1A 4JLFA 3IWOA 3BW6A 1PZPA 3SOIA 4S2NA 3F1PA 2XDMA 4IJGA 1YAXA 4EQIA 4N1XA 3S4XA 5G4YA 1EW0A 1D06A 1OTAA 1XFNA 3O5YA 5FQQA 4OONA 5EVLA 4LV2A 2PAVP 3S7NA 2WADA 1P9WA 3V50A 5GLAA 5G4ZA 2B18A 4LCLA 2V1ZA 4WELA 2NUPC 2A24A 1NY0A 1ODVA 4KUOA 4Y5FA 1OJ5A 1BLSA 4GD6A 3NBLA 2Q0OA 4D60A 5U47A 3ITAA 5DTTA 5E2EA 3G34A 3MF0A 3LICA 2H5SA 4WZ5C 2AVXA 5EUAA 2Y2PA 4DXBA 3VP2A 2FFFB 5F83A 2ZMVA 5HDSA 4KG6A 3CUEA 3H7WA 1YMXA 5TJJA 5IS1A 1EI5A 3UPPA 1JWPA 2VK3A 2VV8A 1H8ZA 2W27A 3JPUA 1JWVA 4DE1A 5E2FA 3PAEA 4NXBA 5HD3A 2Y2OA 1KOUA 2Y2QA 1PW1A 4IVIA 3CLOA 1MKIA 1K55C 1HTZA 4C75A 1OTEA 4X25A 4EWFA 4YWZA 1VQQA 1GSVA 3MQQA 1K56A 5I5LA 1H8MA 3HL9A 2HPBA 2O9AA 3NCKA 2XLNA 4L9GA 3IBRA 3MFXA 2D01A 2V1AA 5A91A 2ZC6B 5C5KA 4ZBEA 2KDKA 2PR5A 3UB8A 1F2KA 1PYYA 4ZDXA 4OPYA 3W8KA 1PWCA 2JKFA 1YM1A 1S6RA 1K57A 2QKPA 2Q9NA 4MBHA 3CAXA 4LGWA 2Y2JA 4L9FA 2O99A 1SKFA 3KYEA 1GHPA 5EM0A 4KG5A 4QY6A 3ZYTA 3UB6A 3NDEA 4HIAA 1I5QA 1M6KA 4S2OA 3HJIA 3EQUA 2B02A 3DBAA 3N8LA 4U0TA 2EFXA 3RFBA 4ARZB 5DFYA 2ZC7A 1DY6A 5AQ9A 4ZJ3A 2J80A 5KSCA 5A93A 4FTXA 4RYEA 1JNUA 4NETA 5FEFA 1OT9A 5HWWA 4P0MA 4LPZA 3HLGA 3FWLA 1XPBA 1KGEA 1MWSA 4LV0A 4OOYA 3CI6A 3M6HA 2J7VA 1YLJA 4ZAMA 2QJ5A 2WZZA 4IUHA 4HNBA 1YSQA 1DP6A 2Z6DA 3GTCA 1ES4A 3FG8A 2R9XA 3Q7VA 4LLOB 4N92A 3EEAA 1S1ZA 3MKFA 3NULA 5HARA 2XQZA 1Q2QA 2Y55A 5CEDA 3FZCA 5EVID 2Y79A 2K31A 4DE3A 3ZDJA 1TVFA 1PI5A 2HDRA 4EW7A 4EBLA 4K91A 5F1GA 2V8CA 5CX7A 4HP4A 1P0ZA 3VP4A 1K38A 3ZG7B 4E3KA 5KMWA 3ZVTA 2P9VB 4LENA 5CECA 2XFSA 3GRJA 3IXBA 3C30A 2WKQA 3KSIA 5EVIB 1S67L 2WKPA 2Y2GA 2LB5A 4Y0UA 3T4TA 2P08A 1PNEA 4GJ4A 4FD8A 3FV7A 2Y91A 3IXDA 2IA2A 3CPTA 3PBOA 1NRJA 1ZHHB 3CHWP 3BY9A 3IQAA 5E2HA 5FAPA 4O7DA 3ZFZA 1H0MA 5CXWA 3MKEA 4ZTKA 5DTSA 3B3XA 4GW9A 1GSWA 3IWIA 1ESIA 3GVBA 1K4FA 4I3JA 3PBNA 5AVEA 2PU4A 1VEUB 1N9BA 5J8XA 2XA7M 4BWIA 4GS9B 2DNSA 4YINA 4GDNA 3VE3A 3LI9A 4AFIA 3FC7A 1DJAA 4BL3A 1TS8A 2HGVA 1PWDA 2W0NA 2HJEA 2K7SA 4R38A 3UE1A 4P87A 1KVLA 4UAAA 4M4XA 1F98A 3CJMA 1L0EA 2A3UA 1QMEA 4X68A 4OPQA 4DDSA 1IOUA 4P6ZM 1GSXA 3T4KA 3T1QB 1WYBA 3R7WB 2X71A 4X1LA 5GHXA 4B4ZA 3OPHA 1A0KA 4UA7A 5JYOA 3S22A 3G4PA 2XEPA 3Q82A 4B9OA 3IHBA 2V20A 3BY8A 2ZM2A 3L7HA 2K2NA 3ZGAB 5L8MA 4DE0A 1CJFA 4GDBA 4EEUA 5CTNA 3BQAA 1K6RA 3OBFA 4KQRA 4ZJ2A 3E4PA 1IYOA 3OZHA 4E3OA 1TS7A 1ESUA 5F6AA 3W2ZA 3NJAA 5CHUA 4UHUA 2ZQAA 1YLPA 3G32A 3KSFA 1LSXA 3Q1FA 2JKRM 5TR7A 4QB8A 3W4QA 3EWKA 4LFUA 3LY4A 2WAFA 3VOZA 3OPLA 4KZAA 2BASA 2W3EA 3WS0A 5EVIA 1T1CA 2ZD8A 2WYXA 1TEMA 1FR6A 1K4EA 3IH8A 4DXCA 3PYPA 3IF6A 4IEDA 4EETB 1H3QA 4JXGA 2RCXA 5DF9A 3MQ0A 1ERQA 4NXFA 1N9NA 3FYZA 3DW0A 2QWSA 3MJQA 1LL9A 4OH0A 4E3NA 1Q2PA 3LI8A 4HOIA 1E3UD 3D3OA 1OTBA 4MNRA 5DVAA 3P7NA 3PTEA 3MS6A 2A24B 2X02A 2WGWA 4GS9A 4ZRRA 3C4PA 4OVDA 3GDIA 5L07A 3SS4A 4KZ8A 5CTMA 1JTDA 3LIAA 3BWLA 3UE6A 1GA9A 4E3JA 5FASA 4HBTA 2XRNA 3UPNA 3DWKA 4EEPA 1BSGA 1XX2A 4Q0IA 2HP9A 1J3WA 1LI0A 1LLBA 3A3IA 5M18A 2PBDP 1W8YA 2QPNA 3IHAA 1KDSA 3OPRA 4PM7A 1MBLA 3S7QA 3HUMA 5AJGA 3UDFA 4EUVA 4R4RA 3F1NA 3UB7A 3W4PA 5FQMA 3T12B 4M3KA 2XR0A 3A0VA 3H82A 3R7WA 2OLUA 3VP3A 4ID4A 3LFVA 4S2LA 1CI9A 1N9LA 4EESA 1DP9A 3ISGA 1S66L 2WZXA 1H5XA 2R9WA 3SH8A 4JPMA 1MWUA 3UE3A 2JKTI 2KOIA 2H0YA 1STZA 5EFWA 3HREA 1ZC2A 1VM1A 4HEFA 1SHVA 5TGFA 1E4DA 2V0WA 4UA6A 4WZ4A 1RCJA 4LV1A 3UMEA 4HJ3A 3TG9A 4CLCD 1YLTA 5DKKA 3HUOA 2HZ5A 3BM6A 3HLDA
chains in the Genus database with same CATH topology
2O9BA 1S4RA 3MMHA 3NHQA 4CLCC 2QKPA 1G28A 4NXEA 4PKYA 4KQDA 2GX5A 3LIBA 3CAXA 1Y28A 2PYPA 5TBMB 3T4JA 2NUTC 4L9FA 1W63M 2O99A 4LRZE 4NEED 4B93A 4OOLA 3D72A 4FSFA 1LSWA 2W3GA 4HJ6A 3P01A 5HWVA 3A0RA 2W3FA 3ZYTA 3UB6A 3C38A 4HIAA 4R70A 3HJIA 3RTYA 2ZOIA 3EQUA 2B02A 5TBMA 3DBAA 5F5YA 3RFBA 5HPIA 4ARZB 5DFYA 2XA7S 2J80A 4HH2A 2W1TB 1NLZA 1JNUA 2JKRI 4YNRA 1OT9A 3OCNA 2PDRA 5HWWA 2ZMFA 1T18A 1S4SA 2FZ0A 3VV4A 4L0LA 4LPZA 5DJUA 3CI6A 3EGXC 2L1MA 2VGLS 3CUEC 2QJ5A 4ARZA 4IUHA 2W1TA 4HNBA 1YSQA 4KQOA 1DP6A 2Z6DA 3LR5A 4MDZA 3PBRA 4Y3IA 4F3LA 3ICYA 3E0YA 2GJ3A 3FG8A 4MN7A 4LLOB 1P97A 1YSPA 3LIEA 3EEAA 3T4OA 1S1ZA 4DN0A 5HSQA 1T1AA 1TF1A 3KSHA 2EWWA 2Y79A 4DJ2A 4WEKA 2PD7A 2XSSA 3F1OB 1MC0A 2K31A 1XJ6A 3K2NA 4HHDA 2VLGA 2M7UA 5FL3A 4P6ZS 4EW7A 3TJZC 1XJ2A 2J3TD 3PXPA 5CX7A 4HP4A 3BQ8A 1P0ZA 4NXGA 4EQ1A 2J3TC 1VHMA 1D7EA 5KIZA 5IT5A 4UQIS 3UB9A 4O01A 4I3AA 3B47A 5DKLA 1W63Q 5K5BA 3SW1A 2L0WA 2PR6A 1V9ZA 3MQOA 4WF0A 3PHYA 3FPWA 1DRMA 3C30A 3NOPC 2WKQA 2D02A 3KSIA 1S67L 2J3WA 5IU1A 2WKPA 3OCLA 2QJ7A 2W1RA 3E98A 3T50A 4WN5A 2LB5A 1X0OA 2O9CA 3T4TA 1OTIA 3OLOA 2P08A 2Y8HA 4I3IA 4GJ4A 4EXOA 2IA2A 5J7EA 3PBOA 1NRJA 2ZOHA 2FH5A 3VE4A 3PBSA 2OWHA 1ZHHB 3KYQA 3BY9A 4HY8A 5A8BA 1LT0A 1S1YA 2VZWA 3EGDC 3CITA 3ZQ5A 1OT6A 3F1PB 2VJWA 3RH8B 1TD5A 4GHIB 3OOVA 4BBTA 4GW9A 2M1CA 4MN5A 1GSWA 1UWPX 4II7A 4WUJA 4I3JA 4BJPA 4BBUA 5MC7A 1MKMA 1IFQA 3PBNA 5AVEA 3LR4A 4Y2FA 1T1BA 5J3WA 1UGUA 3C2WA 5DFXA 2XA7M 3V67A 4BWIA 1LSVA 4GHIA 2DMWA 4GS9B 3ULFA 4R3AA 3KO6A 4CLCB 2JN7A 2OWJA 4JGPA 4EU0A 1VB6A 4LRYC 2I9VA 2QYBA 2HF6A 3VE3A 3EOIA 4CLCE 3LI9A 4AFIA 3FC7A 3LR3A 2VA0A 2VGLM 3S7PA 2M7VA 2JKTM 4OOMA 1TS8A 2HGVA 2EWVA 5HZHA 2W0NA 4ETXA 5DJTA 2WKRA 2HJEA 2OAQ1 3B42A 2K7SA 4R38A 4EERA 2QHKA 5J4EA 1OTDA 1T19A 3KSGA 4CQHA 2VX8A 4M4XA 1F98A 3E4QA 3LYXA 5HD5A 3TE8A 2PT7A 3LUQA 4O0PA 3T4LA 2PHYA 2MJ6A 2O0YA 2VV6A 4ETZA 1IOUA 4P6ZM 1GSXA 3T4KA 5HL6A 3R7WB 4ME4A 3H7WB 3IS2B 1F9IA 4HI4A 4YOFA 4BMWA 3LIFA 1MZUA 4I39A 2OOLA 3F1OA 4UQIM 1TS0A 4B9OA 1ZTUA 3BY8A 4MCWA 4UEYA 4G3KA 2K2NA 4JGRA 5L8MA 2YKHA 3IS2A 3PR6A 1TS6A 4WEJA 4EEUA 2LB9A 3BQAA 4XT2B 3OBFA 1F5MA 3E4PA 3MXQA 3G6OA 3MR0A 1NWZA 4WLAA 3T4SA 1TS7A 2HV1A 5F6AA 3W2ZA 3NJAA 2VV7A 1XJ4A 4IUKA 3KSFA 1XJ3A 1LSXA 1UWNX 4NKPA 4JGOA 2JKRM 4K08A 3UMDA 3CWFA 2VEAA 5HDCA 4XT2A 3OC2A 3EWKA 3K3DA 4LRXC 2H28A 2BASA 5HDDA 3R4KA 4HH3A 2W3EA 1T1CA 4RQ9A 2Z6CA 3H9WA 3KX0X 3E4OA 2KLIA 1OJGA 5AVFA 3PYPA 4HJ4A 1NLYA 4EETB 2INWA 1H3QA 2A2LA 3LR0A 4G3WA 2V1BA 4H6JB 3MQ0A 5DF9A 4PKYG 1OPXA 4NXFA 4PAUA 1N9NA 2P7JA 2EA9A 3VOLA 3A0SA 5KSHA 4Z1WA 4Q0HA 3BW6A 4R6LA 3TRCA 2QWSA 3C8CA 3F1PA 2W3DA 3MJQA 4IJGA 1YAXA 4KUKA 1BYWA 4I38A 4H6JA 3LI8A 4HOIA 2GNXA 3D3OA 1OTBA 3EEHA 3FPVA 5G4YA 1EW0A 1D06A 1OTAA 1XFNA 3O5YA 3P7NA 2ZBBA 4GLQA 2GZAA 2A24B 4Q0JA 3U2AA 4QPRA 1P9RA 4GS9A 4ZRRA 3EQVA 3GDIA 2YKFA 4WL9A 3S7NA 4CLCA 1P9WA 4PHTA 4DMZA 3LIAA 3KYZA 2B18A 5G4ZA 4GCZA 3BWLA 4MMNA 4WELA 3UE6A 4F3LB 3GECA 2NUPC 3PBTA 2R78A 2A24A 2XRNA 3HCYA 4EEPA 1ODVA 1G6OA 4KUOA 2V9AA 4Q0IA 1OJ5A 4G3VA 4Y5FA 2PD8A 3F1NB 4L9EA 2PYRA 3H82B 3IBJA 4DJ3A 1N9OA 3NOTC 2XROA 3S7QA 4JGQA 5AJGA 3MF0A 3LICA 3S7OA 2L4RA 2JHEA 3TW8A 3K3CA 4EUVA 4O8GA 3LIDA 3F1NA 3UB7A 5F68A 2ZMVA 3JVUA 1XFQA 4HP9A 3H82A 5HDSA 3R7WA 3CUEA 1YKDA 3H7WA 5TJJA 5LBRA 3LFVA 5IS1A 4FOFA 1N9LA 2VKSA 4EESA 1DP9A 3JVVA 1S66L 2VV8A 2W27A 4IHQA 3UE3A 4NXBA 1WA9A 3BJNA 5HD3A 1DP8A 1KOUA 5HWTA 2JKTI 2KOIA 3CLOA 4BBVA 5HPFA 3NOUC 3HJKA 1STZA 5EFWA 2OAP1 2CMNA 1OTEA 2G7UA 4MN6A 4YWZA 4I5SA 1LL8A 1GSVA 3MQQA 5I5LA 1H8MA 2O9AA 3B33A 2V0WA 4HQAA 2HJ9C 2P04A 3IBRA 3MFXA 4L9GA 2D01A 2V1AA 1V9YA 2W3HA 5C5KA 5F69A 3T4QA 2KDKA 2PR5A 3UB8A 3UMEA 2V0UA 4HJ3A 4CLCD 5DKKA 3PBQA 4E04A 2KX6A 3A0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9B A;  4Q0J A;  5K5B A;  4QPR A;  4ZRR A;  5HL6 A;  3MMH A;  3NHQ A;  3S7N A;  4ME4 A;  2GX5 A;  3NOP C;  4DMZ A;  3KSI A;  2B18 A;  4MMN A;  4YOF A;  4LRZ E;  2O99 A;  2W1R A;  3E98 A;  2LB5 A;  2O9C A;  2OOL A;  2W3G A;  2XRN A;  3HCY A;  2Y8H A;  1ZTU A;  4Q0I A;  2W3F A;  4G3V A;  2IA2 A;  4Y5F A;  4MCW A;  4R70 A;  4G3K A;  2K2N A;  5L8M A;  2LB9 A;  3OBF A;  1F5M A;  3DBA A;  3G6O A;  3IBJ A;  3RFB A;  5HPI A;  3NOT C;  5DFY A;  2XRO A;  2VZW A;  3S7Q A;  3CIT A;  5AJG A;  3MF0 A;  2W1T B;  3W2Z A;  3ZQ5 A;  4YNR A;  3S7O A;  2VJW A;  1TD5 A;  4IUK A;  3KSF A;  2ZMF A;  3OOV A;  4EUV A;  4O8G A;  4GW9 A;  3VV4 A;  2VEA A;  3CI6 A;  4LRX C;  1MKM A;  1YKD A;  4Y2F A;  3R4K A;  4IUH A;  5LBR A;  2W3E A;  2W1T A;  3C2W A;  1YSQ A;  3LFV A;  4FOF A;  5DFX A;  5TJJ A;  4BWI A;  2VKS A;  4MDZ A;  4Y3I A;  3E0Y A;  4RQ9 A;  3KO6 A;  4MN7 A;  1YSP A;  4EU0 A;  3EEA A;  4LRY C;  2KLI A;  4DN0 A;  2QYB A;  5HSQ A;  3BJN A;  3KSH A;  1TF1 A;  2KOI A;  2Y79 A;  4G3W A;  5HPF A;  3MQ0 A;  3NOU C;  2XSS A;  4PAU A;  1MC0 A;  2K31 A;  3S7P A;  3K2N A;  1STZ A;  2M7V A;  4Z1W A;  2G7U A;  2HGV A;  4Q0H A;  2M7U A;  4R6L A;  3TRC A;  4ETX A;  5I5L A;  2W3D A;  2O9A A;  4IJG A;  3KSG A;  4CQH A;  3IBR A;  2W3H A;  5C5K A;  3D3O A;  4O0P A;  1VHM A;  4E04 A;  2O0Y A;  4O01 A;  4GLQ A;  3O5Y A;  4ETZ A; 
#chains in the Genus database with same CATH topology
 2O9B A;  5EE8 A;  4CLC C;  4KQD A;  4D2O A;  2PYP A;  5FAO A;  3T4J A;  1W63 M;  1JTG A;  4B93 A;  1W79 A;  4OOL A;  3D72 A;  1PWG A;  2V8F A;  2W3G A;  2IWB A;  3UDX A;  1IKI A;  3DWZ A;  3C38 A;  2B95 A;  4R70 A;  2BG1 A;  3RTY A;  3WWX A;  5F5Y A;  2ZL1 B;  5BOH A;  5HAP A;  4B4X A;  1PZO A;  3BFF A;  3N7W A;  4YNR A;  1ALQ A;  4X69 A;  3OCN A;  3IX4 A;  3Q7V B;  2FZ0 A;  4L0L A;  4S2M A;  5DTK A;  1K54 C;  3UO9 A;  3WRZ A;  1I2S A;  2ZM0 A;  5JYP A;  4KQO A;  4Y3I A;  3PBR A;  3TSG A;  3E0Y A;  5F1F A;  2HDQ A;  3GMW A;  1AWI A;  3MFD A;  4MN7 A;  3AGD A;  1P97 A;  4XUZ A;  3G31 A;  3SZT A;  1G5U A;  1TF1 A;  4WEK A;  5HX9 A;  2XSS A;  3F1O B;  1E3U A;  3ZCZ A;  1FQG A;  5FI6 A;  4HES A;  1XJ2 A;  1BZA A;  5FSR A;  3PXP A;  1S0W A;  2ZM8 A;  5FQI A;  2Q9M A;  4Y15 A;  1ERO A;  3RXW A;  1RP5 A;  5DF7 A;  5EOE A;  1LI9 A;  2V2F F;  5KIZ A;  5IT5 A;  4UQI S;  3UB9 A;  1IKG A;  4GD8 A;  2HP6 A;  3C4O A;  3VP1 A;  4EV4 A;  2PR6 A;  3CPT B;  2WK0 A;  1DRM A;  3NOP C;  3OCL A;  3BFD A;  4WN5 A;  1YLY A;  1OTI A;  3OLO A;  2Y8H A;  1LHY A;  5J7E A;  4Y0T A;  3G30 A;  3KYQ A;  4HY8 A;  4WYY A;  4EBP A;  1IYS A;  4LV3 A;  2VZW A;  3CG5 A;  5CGS A;  2Y2M A;  5FI7 A;  5FQK A;  2VJW A;  4RVA A;  3MXS A;  4S2P A;  5HAQ A;  1AXB A;  3IX3 A;  4JBF A;  2IWC A;  1FIL A;  4BBU A;  1MKM A;  2BLS A;  2X01 A;  3O88 A;  2QZ6 A;  2ZMA A;  2JCH A;  2VGK A;  3ULF A;  4QU3 A;  3ZHH A;  4OQH A;  1L0G A;  1FR1 A;  2HF6 A;  3EOI A;  5CRF A;  4CLC E;  2ZQ8 A;  3LR3 A;  2VGL M;  3HLF A;  2ZL1 A;  1QMF A;  2JBF A;  3VOY A;  2JC7 A;  4OOM A;  3A3D A;  5FDS A;  4ETX A;  2WKR A;  2OAQ 1;  3B42 A;  3SS5 A;  2H0T A;  3KSG A;  1K0K A;  3V3R A;  2WKH A;  3LYX A;  2PT7 A;  3LUQ A;  4MBK A;  3E2L A;  1IYP A;  4Y7P A;  1PIO A;  4ETZ A;  1ZKJ A;  1ES5 A;  3UPO A;  3HVF A;  3QHY A;  3IT9 A;  4KG2 A;  1BUE A;  1BLH A;  3TOI A;  4YOF A;  4BMW A;  3ITB A;  2J9P A;  3LIF A;  4ESP A;  2OOL A;  3F1O A;  3UE0 A;  4IBX A;  3ZG0 A;  4BD1 A;  3JYI A;  4UEY A;  4JF4 A;  3IS2 A;  3W4O A;  1WE4 A;  4WEJ A;  1TS6 A;  1F5M A;  3MR0 A;  1MXO A;  1ACF A;  1NYY A;  4P85 A;  2HV1 A;  3BFE A;  3M2K A;  1W8Q A;  2J9O A;  4WZ5 A;  3LEQ A;  4CJN A;  3T1X A;  2WAE A;  1CEF A;  4JGO A;  4X1M A;  3UMD A;  4Y0O A;  3HLW A;  4MEZ A;  5HDC A;  3FKW A;  3OC2 A;  2IWD A;  5EV0 A;  3IF6 B;  4DRT A;  2E8J A;  1ZG6 A;  2HDS A;  4MLL A;  5GLC A;  4RQ9 A;  2DRW A;  2ZQC A;  3WS2 A;  3H9W A;  4UA9 A;  2HP5 A;  2KLI A;  5AVF A;  3O87 A;  2P74 A;  1NLY A;  2INW A;  5GLD A;  2A2L A;  3CMZ A;  3LR0 A;  3M6B A;  1OPX A;  4PAU A;  1ES3 A;  1K55 A;  4X55 A;  5KSH A;  4Q0H A;  1Y4O A;  3C8C A;  1W7F A;  2W3D A;  4RA7 A;  2WGW B;  3DTM A;  1KE0 A;  1BYW A;  3BFC A;  4H6J A;  1KGF A;  4OQI A;  2GNX A;  4JXV A;  3EEH A;  4DF6 A;  1L0D A;  3FPV A;  4R4S A;  2ZBB A;  2GZA A;  4Q0J A;  2Y2I A;  4WM9 A;  5CEB A;  1P9R A;  5F82 A;  4WL9 A;  1FSY A;  3KYZ A;  1XA7 A;  4GCZ A;  4F3L B;  2EX6 A;  3GEC A;  4S2J A;  3PBT A;  1NXY A;  3HCY A;  4Y13 A;  2Y2H A;  2OLV A;  3O3V A;  2PD8 A;  3F1N B;  1NZO A;  2Y2K A;  4L9E A;  5I94 A;  3H82 B;  4DJ3 A;  1N9O A;  2HDU A;  4N9L A;  1TDL A;  3S7O A;  2L4R A;  1YLW A;  2ZC3 B;  1CI8 A;  1ZG4 A;  3TW8 A;  1XP4 A;  4X6T A;  2CC1 A;  3LID A;  1XGI A;  3QP4 A;  2G2U A;  5F68 A;  4HP9 A;  3JVU A;  5AQA A;  1Y54 A;  4KZ6 A;  4WMC D;  5CGX A;  4RX2 A;  3JVV A;  1OME A;  2EX8 A;  2JE5 A;  1CEG A;  3IWQ A;  2ZC4 B;  4P6B A;  3P98 A;  4DE2 A;  4OKP A;  1DP8 A;  5EPH A;  5HPF A;  3V39 A;  3MSH A;  4I5S A;  1LL8 A;  2PBY A;  3BEB A;  4DKI A;  4S2N C;  1DJC A;  2DCF A;  1LL5 A;  4PMA A;  1NJ4 A;  1SZV A;  3HLB A;  1FIK A;  1V9Y A;  5F69 A;  2XF3 A;  1JWZ A;  3LEZ A;  3GSG A;  3MXR A;  3LY3 A;  3GQZ A;  1BLC A;  1FSW A;  4R1G A;  4OP8 A;  1E25 A;  1KE3 A;  4C3Q A;  4B88 A;  1S4R A;  3MMH A;  3NHQ A;  3IH9 A;  4PM6 A;  4PKY A;  4E6W A;  2GX5 A;  4Y17 A;  5EEC A;  3D9Y A;  2NUT C;  4JXS A;  3VFF A;  5HAI A;  3NEC A;  2PRF A;  5HWV A;  3UNW A;  1Z09 A;  5A92 A;  4U3T A;  2ZOI A;  5TBM A;  2RL3 A;  3VSK A;  5HL1 A;  2XA7 S;  4HH2 A;  1M40 A;  4BEN A;  4OP5 A;  2PDR A;  3IF5 A;  5G18 A;  3AGE A;  1N4O A;  1S4S A;  5FQJ A;  3NIA A;  2H10 A;  3WS5 A;  2L1M A;  3CUE C;  2W1T A;  5EVE A;  4CPK A;  4F3L A;  3WRT A;  3BFG A;  3ICY A;  4QY5 A;  2GJ3 A;  4X53 A;  3LIE A;  4PM8 A;  1T1A A;  2EXB A;  1K56 D;  2EWW A;  4DJ2 A;  4E3M A;  2PD7 A;  1XJ6 A;  2WGV A;  5M1A A;  2Z2L B;  3DTI A;  4P6Z S;  4XXR A;  4KQQ A;  5L09 A;  3BEC A;  4NXG A;  1D7E A;  3ZNY A;  3ZVW A;  5DKL A;  5K5B A;  1K57 C;  3MQO A;  4WF0 A;  2D02 A;  4PM9 A;  5IU1 A;  2W1R A;  3A3E A;  3T50 A;  2O9C A;  1MPL A;  3NY4 A;  4EXO A;  2WUQ A;  3OPP A;  2ZOH A;  3HLE A;  1CK3 A;  2FH5 A;  3VE4 A;  3PBS A;  5IHV A;  4E3L A;  5A8B A;  1U60 A;  1SDN A;  1S1Y A;  4WMC A;  3EGD C;  1O7E A;  1K6S A;  3RH8 B;  1GHI A;  5FEG A;  3OOV A;  4BBT A;  2E8I A;  1PRQ A;  2M1C A;  4II7 A;  3MBZ A;  4WUJ A;  5MC7 A;  1IFQ A;  4YFM A;  4Y2F A;  1T1B A;  2EXA A;  1UGU A;  5DFX A;  3V67 A;  4KZ7 A;  4A5R A;  2ZLY A;  2J8Y A;  4GHI A;  2DMW A;  3Q81 A;  1C3B A;  4R3A A;  1IEM A;  3KO6 A;  4CLC B;  1DJB A;  2JN7 A;  4JGP A;  1VB6 A;  4LRY C;  2I9V A;  2QYB A;  5L10 A;  4OLG A;  3VP0 A;  3SS3 A;  4DDY A;  3S7P A;  2M7V A;  2JKT M;  1EWZ A;  4GNU A;  3QP2 A;  3C7V A;  2G2W A;  5KZH A;  1PI4 A;  2B5R A;  5CHM A;  3UY6 A;  4EER A;  2QHK A;  4E3I A;  5J4E A;  1OTD A;  3IX8 A;  1T19 A;  4CQH A;  2VX8 A;  1NZU A;  3E4Q A;  4QD4 A;  1GCE A;  3LO7 A;  5FAT A;  4O0P A;  2PHY A;  4LCM A;  2MJ6 A;  2C5W B;  3QP1 A;  1ONG A;  3BLM A;  5HL6 A;  5M19 A;  1XXM A;  4ME4 A;  3IS2 B;  1F9I A;  3L9K A;  3V3S A;  4MCW A;  2YKH A;  3QP5 A;  3M2J A;  3G6O A;  4NK3 A;  5GHY A;  1BTL A;  4JF6 A;  3VSL A;  3HUN A;  4KEN B;  1YQS A;  1XJ3 A;  3LGO A;  1UWN X;  4R23 A;  4NKP A;  1GHM A;  4K08 A;  2VEA A;  4XT2 A;  3K3D A;  4E6X A;  4S2I A;  5HDD A;  3R4K A;  1BLP A;  1ONH A;  1YPR A;  4RX3 A;  3ZG5 A;  3U4L P;  1W5D A;  2Z6C A;  3IXH A;  2ACG A;  1OJG A;  1XKZ A;  3QP8 A;  1KVM A;  4HJ4 A;  3WS1 A;  4IVK A;  3HBR A;  3MZE A;  3T1R A;  4H6J B;  2V1B A;  5FA7 A;  1SKO B;  5FQ9 A;  4Z1W A;  1BUL A;  2XH9 A;  1K25 A;  4R6L A;  3TRC A;  4JKT A;  5E43 A;  3A3J A;  4KUK A;  3NDG A;  4I38 A;  5FDH A;  1FCM A;  1SCW A;  3PAG A;  4HBU A;  4S2K A;  1J9M A;  4WBG A;  4GLQ A;  3U2A A;  5DF8 A;  4FCF A;  4BD0 A;  4QPR A;  3EQV A;  2YKF A;  4CLC A;  4PHT A;  1D1J A;  4DMZ A;  3AGF A;  5CER A;  4MMN A;  1CQA A;  2QMI A;  1BT5 A;  1FCO A;  4OPZ A;  3IXG A;  4EUZ A;  1YLZ A;  3C5A A;  1MWT A;  2R78 A;  1G6O A;  2V9A A;  1TDG A;  4G3V A;  3MZF A;  1L3L A;  2PYR A;  4KZ4 A;  3IBJ A;  1MY8 A;  3LCE A;  3NOT C;  2XRO A;  4JGQ A;  4Q8I A;  2FFY A;  2JHE A;  3K3C A;  3SH9 A;  3BLS A;  4O8G A;  5GL9 A;  5FAQ A;  2UV0 E;  1K54 A;  1XFQ A;  1IEL A;  4ZJ1 A;  1YKD A;  5AQB A;  5EVI C;  5LBR A;  3VFH A;  4FH2 A;  4FOF A;  5EM1 A;  2VKS A;  2XFT A;  3GR2 A;  2Z2M B;  4FH4 A;  4QHC A;  3IF6 C;  3ZNT A;  4IHQ A;  1WA9 A;  3BJN A;  4PM5 A;  5HWT A;  5HW3 A;  4BBV A;  3NOU C;  3HJK A;  1O07 A;  5L2F A;  2OAP 1;  1MWR A;  2CMN A;  2OSU A;  2G7U A;  3NI9 A;  4MN6 A;  4MBF A;  2Y2L A;  3HLC A;  3B33 A;  3O86 A;  4HQA A;  2HJ9 C;  2P04 A;  3CZD A;  1RGZ A;  2W3H A;  3GV9 A;  3T4Q A;  1HD8 A;  2V0U A;  4OPR A;  3WS4 A;  3PBQ A;  4E04 A;  2KX6 A;  3I7J A;  3FKV A;  4X56 A;  4IBR A;  1G28 A;  4NXE A;  3LIB A;  1Y28 A;  5TBM B;  3QNC A;  1FCN A;  4LRZ E;  4NEE D;  4FSF A;  1LSW A;  1SKO A;  4HJ6 A;  3P01 A;  1ERM A;  3A0R A;  2W3F A;  4OQG A;  1PFL A;  4JF5 A;  3A3F A;  5HPI A;  2W1T B;  1L2S A;  4QJG A;  1NLZ A;  2JKR I;  2WKE A;  1G68 A;  2EFU A;  2ZMF A;  3E2K A;  1T18 A;  4GB7 A;  3VV4 A;  4H8R A;  2I72 A;  5GLB A;  5AQ7 A;  3N4I A;  5DJU A;  3EGX C;  2VGL S;  2EX9 A;  1KE4 A;  1L0F A;  4ARZ A;  1NRF A;  4MDZ A;  3LR5 A;  5D3O A;  2XD1 A;  3BRM A;  4K0W A;  1YSP A;  2BTF P;  3T4O A;  4DN0 A;  4KZB A;  3Q07 A;  5HSQ A;  3KSH A;  5CHJ A;  1MC0 A;  1XGJ A;  3K2N A;  4R3J A;  4HHD A;  2JKG A;  2VLG A;  1YMS A;  2M7U A;  4GOG A;  5FL3 A;  1JVJ A;  3TJZ C;  1HZO A;  2J3T D;  3N6I A;  3BQ8 A;  4GN2 A;  1H8Y A;  4KZ9 A;  2ZQD A;  4EQ1 A;  4Z9Q A;  2J3T C;  1VHM A;  4O01 A;  4I3A A;  3B47 A;  1W63 Q;  2ZC5 B;  2OV5 A;  1PW8 A;  2C6W B;  2UWX A;  3UDI A;  2L0W A;  4C6Y A;  3SW1 A;  1V9Z A;  4N1H A;  3PHY A;  3FPW A;  3UB5 P;  2J3W A;  2QJ7 A;  2ZJ9 A;  3QNB A;  3E98 A;  1X0O A;  4OLD A;  3S1Y A;  4I3I A;  2P9V A;  3RJU A;  4U0X A;  2OWH A;  4EBN A;  1VET B;  1SDE A;  4R0Q A;  1HLU P;  2VGJ A;  1LT0 A;  1NYM A;  4KZ3 A;  2XD5 A;  3CIT A;  2Y4A A;  3DTE A;  3V5M A;  3ZQ5 A;  1OT6 A;  3F1P B;  1TD5 A;  4GHI B;  2EX2 A;  3VMA A;  3UN7 A;  4F94 A;  3T1S A;  4MN5 A;  1UWP X;  2Y2N A;  4BJP A;  3LR4 A;  5J3W A;  3C2W A;  3SH7 A;  3C7U A;  3MZD A;  1LSV A;  4BLM A;  4GKU A;  3QP6 A;  1Z6F A;  1KGG A;  5CGW A;  2OWJ A;  4EU0 A;  2WGI A;  5GHZ A;  4QWO A;  2VA0 A;  4OQ0 A;  1VEU A;  5A90 A;  2EWV A;  5HZH A;  5DJT A;  4BL2 A;  3NC8 A;  4JXW A;  3N8R A;  1I2W A;  5HD5 A;  3TE8 A;  4K0X A;  3T4L A;  2O0Y A;  2VV6 A;  5EOO A;  1FOF A;  4GZB A;  3H7W B;  4HI4 A;  2ZQ9 A;  1MZU A;  4I39 A;  1YT4 A;  4UQI M;  4BQM A;  1TS0 A;  1RGY A;  3ZG8 B;  1ZTU A;  3BYD A;  4NG2 A;  4G3K A;  3P09 A;  4JGR A;  2ZQ7 A;  3PR6 A;  4KZ5 A;  4XT2 B;  2LB9 A;  3D4F A;  4R3B A;  3MXQ A;  1XA1 A;  1NWZ A;  3G35 A;  4WLA A;  3RXX A;  3T4S A;  2XGN A;  4N9K A;  2GDN A;  2VV7 A;  1WYC A;  5HFO A;  1XJ4 A;  4PPR A;  1IYQ A;  4IUK A;  3DTK A;  2PU2 A;  3DAV A;  2A49 A;  3G2Y A;  3CWF A;  4LRX C;  2WKI A;  2H28 A;  4HH3 A;  2Y59 A;  5TFQ A;  3Q7Z A;  1GA0 A;  4FUW A;  5E2G A;  1CF0 A;  1HVB A;  3KX0 X;  5FI2 A;  3E4O A;  1ES2 A;  3N8S A;  3ZG9 B;  1G6A A;  1KDW A;  4G3W A;  3G2Z A;  4PKY G;  2P7J A;  4XUX A;  2EA9 A;  3VOL A;  1VET A;  3A0S A;  2XK1 A;  4JLF A;  3IWO A;  3BW6 A;  1PZP A;  3SOI A;  4S2N A;  3F1P A;  2XDM A;  4IJG A;  1YAX A;  4EQI A;  4N1X A;  3S4X A;  5G4Y A;  1EW0 A;  1D06 A;  1OTA A;  1XFN A;  3O5Y A;  5FQQ A;  4OON A;  5EVL A;  4LV2 A;  2PAV P;  3S7N A;  2WAD A;  1P9W A;  3V50 A;  5GLA A;  5G4Z A;  2B18 A;  4LCL A;  2V1Z A;  4WEL A;  2NUP C;  2A24 A;  1NY0 A;  1ODV A;  4KUO A;  4Y5F A;  1OJ5 A;  1BLS A;  4GD6 A;  3NBL A;  2Q0O A;  4D60 A;  5U47 A;  3ITA A;  5DTT A;  5E2E A;  3G34 A;  3MF0 A;  3LIC A;  2H5S A;  4WZ5 C;  2AVX A;  5EUA A;  2Y2P A;  4DXB A;  3VP2 A;  2FFF B;  5F83 A;  2ZMV A;  5HDS A;  4KG6 A;  3CUE A;  3H7W A;  1YMX A;  5TJJ A;  5IS1 A;  1EI5 A;  3UPP A;  1JWP A;  2VK3 A;  2VV8 A;  1H8Z A;  2W27 A;  3JPU A;  1JWV A;  4DE1 A;  5E2F A;  3PAE A;  4NXB A;  5HD3 A;  2Y2O A;  1KOU A;  2Y2Q A;  1PW1 A;  4IVI A;  3CLO A;  1MKI A;  1K55 C;  1HTZ A;  4C75 A;  1OTE A;  4X25 A;  4EWF A;  4YWZ A;  1VQQ A;  1GSV A;  3MQQ A;  1K56 A;  5I5L A;  1H8M A;  3HL9 A;  2HPB A;  2O9A A;  3NCK A;  2XLN A;  4L9G A;  3IBR A;  3MFX A;  2D01 A;  2V1A A;  5A91 A;  2ZC6 B;  5C5K A;  4ZBE A;  2KDK A;  2PR5 A;  3UB8 A;  1F2K A;  1PYY A;  4ZDX A;  4OPY A;  3W8K A;  1PWC A;  2JKF A;  1YM1 A;  1S6R A;  1K57 A;  2QKP A;  2Q9N A;  4MBH A;  3CAX A;  4LGW A;  2Y2J A;  4L9F A;  2O99 A;  1SKF A;  3KYE A;  1GHP A;  5EM0 A;  4KG5 A;  4QY6 A;  3ZYT A;  3UB6 A;  3NDE A;  4HIA A;  1I5Q A;  1M6K A;  4S2O A;  3HJI A;  3EQU A;  2B02 A;  3DBA A;  3N8L A;  4U0T A;  2EFX A;  3RFB A;  4ARZ B;  5DFY A;  2ZC7 A;  1DY6 A;  5AQ9 A;  4ZJ3 A;  2J80 A;  5KSC A;  5A93 A;  4FTX A;  4RYE A;  1JNU A;  4NET A;  5FEF A;  1OT9 A;  5HWW A;  4P0M A;  4LPZ A;  3HLG A;  3FWL A;  1XPB A;  1KGE A;  1MWS A;  4LV0 A;  4OOY A;  3CI6 A;  3M6H A;  2J7V A;  1YLJ A;  4ZAM A;  2QJ5 A;  2WZZ A;  4IUH A;  4HNB A;  1YSQ A;  1DP6 A;  2Z6D A;  3GTC A;  1ES4 A;  3FG8 A;  2R9X A;  3Q7V A;  4LLO B;  4N92 A;  3EEA A;  1S1Z A;  3MKF A;  3NUL A;  5HAR A;  2XQZ A;  1Q2Q A;  2Y55 A;  5CED A;  3FZC A;  5EVI D;  2Y79 A;  2K31 A;  4DE3 A;  3ZDJ A;  1TVF A;  1PI5 A;  2HDR A;  4EW7 A;  4EBL A;  4K91 A;  5F1G A;  2V8C A;  5CX7 A;  4HP4 A;  1P0Z A;  3VP4 A;  1K38 A;  3ZG7 B;  4E3K A;  5KMW A;  3ZVT A;  2P9V B;  4LEN A;  5CEC A;  2XFS A;  3GRJ A;  3IXB A;  3C30 A;  2WKQ A;  3KSI A;  5EVI B;  1S67 L;  2WKP A;  2Y2G A;  2LB5 A;  4Y0U A;  3T4T A;  2P08 A;  1PNE A;  4GJ4 A;  4FD8 A;  3FV7 A;  2Y91 A;  3IXD A;  2IA2 A;  3CPT A;  3PBO A;  1NRJ A;  1ZHH B;  3CHW P;  3BY9 A;  3IQA A;  5E2H A;  5FAP A;  4O7D A;  3ZFZ A;  1H0M A;  5CXW A;  3MKE A;  4ZTK A;  5DTS A;  3B3X A;  4GW9 A;  1GSW A;  3IWI A;  1ESI A;  3GVB A;  1K4F A;  4I3J A;  3PBN A;  5AVE A;  2PU4 A;  1VEU B;  1N9B A;  5J8X A;  2XA7 M;  4BWI A;  4GS9 B;  2DNS A;  4YIN A;  4GDN A;  3VE3 A;  3LI9 A;  4AFI A;  3FC7 A;  1DJA A;  4BL3 A;  1TS8 A;  2HGV A;  1PWD A;  2W0N A;  2HJE A;  2K7S A;  4R38 A;  3UE1 A;  4P87 A;  1KVL A;  4UAA A;  4M4X A;  1F98 A;  3CJM A;  1L0E A;  2A3U A;  1QME A;  4X68 A;  4OPQ A;  4DDS A;  1IOU A;  4P6Z M;  1GSX A;  3T4K A;  3T1Q B;  1WYB A;  3R7W B;  2X71 A;  4X1L A;  5GHX A;  4B4Z A;  3OPH A;  1A0K A;  4UA7 A;  5JYO A;  3S22 A;  3G4P A;  2XEP A;  3Q82 A;  4B9O A;  3IHB A;  2V20 A;  3BY8 A;  2ZM2 A;  3L7H A;  2K2N A;  3ZGA B;  5L8M A;  4DE0 A;  1CJF A;  4GDB A;  4EEU A;  5CTN A;  3BQA A;  1K6R A;  3OBF A;  4KQR A;  4ZJ2 A;  3E4P A;  1IYO A;  3OZH A;  4E3O A;  1TS7 A;  1ESU A;  5F6A A;  3W2Z A;  3NJA A;  5CHU A;  4UHU A;  2ZQA A;  1YLP A;  3G32 A;  3KSF A;  1LSX A;  3Q1F A;  2JKR M;  5TR7 A;  4QB8 A;  3W4Q A;  3EWK A;  4LFU A;  3LY4 A;  2WAF A;  3VOZ A;  3OPL A;  4KZA A;  2BAS A;  2W3E A;  3WS0 A;  5EVI A;  1T1C A;  2ZD8 A;  2WYX A;  1TEM A;  1FR6 A;  1K4E A;  3IH8 A;  4DXC A;  3PYP A;  3IF6 A;  4IED A;  4EET B;  1H3Q A;  4JXG A;  2RCX A;  5DF9 A;  3MQ0 A;  1ERQ A;  4NXF A;  1N9N A;  3FYZ A;  3DW0 A;  2QWS A;  3MJQ A;  1LL9 A;  4OH0 A;  4E3N A;  1Q2P A;  3LI8 A;  4HOI A;  1E3U D;  3D3O A;  1OTB A;  4MNR A;  5DVA A;  3P7N A;  3PTE A;  3MS6 A;  2A24 B;  2X02 A;  2WGW A;  4GS9 A;  4ZRR A;  3C4P A;  4OVD A;  3GDI A;  5L07 A;  3SS4 A;  4KZ8 A;  5CTM A;  1JTD A;  3LIA A;  3BWL A;  3UE6 A;  1GA9 A;  4E3J A;  5FAS A;  4HBT A;  2XRN A;  3UPN A;  3DWK A;  4EEP A;  1BSG A;  1XX2 A;  4Q0I A;  2HP9 A;  1J3W A;  1LI0 A;  1LLB A;  3A3I A;  5M18 A;  2PBD P;  1W8Y A;  2QPN A;  3IHA A;  1KDS A;  3OPR A;  4PM7 A;  1MBL A;  3S7Q A;  3HUM A;  5AJG A;  3UDF A;  4EUV A;  4R4R A;  3F1N A;  3UB7 A;  3W4P A;  5FQM A;  3T12 B;  4M3K A;  2XR0 A;  3A0V A;  3H82 A;  3R7W A;  2OLU A;  3VP3 A;  4ID4 A;  3LFV A;  4S2L A;  1CI9 A;  1N9L A;  4EES A;  1DP9 A;  3ISG A;  1S66 L;  2WZX A;  1H5X A;  2R9W A;  3SH8 A;  4JPM A;  1MWU A;  3UE3 A;  2JKT I;  2KOI A;  2H0Y A;  1STZ A;  5EFW A;  3HRE A;  1ZC2 A;  1VM1 A;  4HEF A;  1SHV A;  5TGF A;  1E4D A;  2V0W A;  4UA6 A;  4WZ4 A;  1RCJ A;  4LV1 A;  3UME A;  4HJ3 A;  3TG9 A;  4CLC D;  1YLT A;  5DKK A;  3HUO A;  2HZ5 A;  3BM6 A;  3HLD A; 
#chains in the Genus database with same CATH homology
 2O9B A;  1S4R A;  3MMH A;  3NHQ A;  4CLC C;  2QKP A;  1G28 A;  4NXE A;  4PKY A;  4KQD A;  2GX5 A;  3LIB A;  3CAX A;  1Y28 A;  2PYP A;  5TBM B;  3T4J A;  2NUT C;  4L9F A;  1W63 M;  2O99 A;  4LRZ E;  4NEE D;  4B93 A;  4OOL A;  3D72 A;  4FSF A;  1LSW A;  2W3G A;  4HJ6 A;  3P01 A;  5HWV A;  3A0R A;  2W3F A;  3ZYT A;  3UB6 A;  3C38 A;  4HIA A;  4R70 A;  3HJI A;  3RTY A;  2ZOI A;  3EQU A;  2B02 A;  5TBM A;  3DBA A;  5F5Y A;  3RFB A;  5HPI A;  4ARZ B;  5DFY A;  2XA7 S;  2J80 A;  4HH2 A;  2W1T B;  1NLZ A;  1JNU A;  2JKR I;  4YNR A;  1OT9 A;  3OCN A;  2PDR A;  5HWW A;  2ZMF A;  1T18 A;  1S4S A;  2FZ0 A;  3VV4 A;  4L0L A;  4LPZ A;  5DJU A;  3CI6 A;  3EGX C;  2L1M A;  2VGL S;  3CUE C;  2QJ5 A;  4ARZ A;  4IUH A;  2W1T A;  4HNB A;  1YSQ A;  4KQO A;  1DP6 A;  2Z6D A;  3LR5 A;  4MDZ A;  3PBR A;  4Y3I A;  4F3L A;  3ICY A;  3E0Y A;  2GJ3 A;  3FG8 A;  4MN7 A;  4LLO B;  1P97 A;  1YSP A;  3LIE A;  3EEA A;  3T4O A;  1S1Z A;  4DN0 A;  5HSQ A;  1T1A A;  1TF1 A;  3KSH A;  2EWW A;  2Y79 A;  4DJ2 A;  4WEK A;  2PD7 A;  2XSS A;  3F1O B;  1MC0 A;  2K31 A;  1XJ6 A;  3K2N A;  4HHD A;  2VLG A;  2M7U A;  5FL3 A;  4P6Z S;  4EW7 A;  3TJZ C;  1XJ2 A;  2J3T D;  3PXP A;  5CX7 A;  4HP4 A;  3BQ8 A;  1P0Z A;  4NXG A;  4EQ1 A;  2J3T C;  1VHM A;  1D7E A;  5KIZ A;  5IT5 A;  4UQI S;  3UB9 A;  4O01 A;  4I3A A;  3B47 A;  5DKL A;  1W63 Q;  5K5B A;  3SW1 A;  2L0W A;  2PR6 A;  1V9Z A;  3MQO A;  4WF0 A;  3PHY A;  3FPW A;  1DRM A;  3C30 A;  3NOP C;  2WKQ A;  2D02 A;  3KSI A;  1S67 L;  2J3W A;  5IU1 A;  2WKP A;  3OCL A;  2QJ7 A;  2W1R A;  3E98 A;  3T50 A;  4WN5 A;  2LB5 A;  1X0O A;  2O9C A;  3T4T A;  1OTI A;  3OLO A;  2P08 A;  2Y8H A;  4I3I A;  4GJ4 A;  4EXO A;  2IA2 A;  5J7E A;  3PBO A;  1NRJ A;  2ZOH A;  2FH5 A;  3VE4 A;  3PBS A;  2OWH A;  1ZHH B;  3KYQ A;  3BY9 A;  4HY8 A;  5A8B A;  1LT0 A;  1S1Y A;  2VZW A;  3EGD C;  3CIT A;  3ZQ5 A;  1OT6 A;  3F1P B;  2VJW A;  3RH8 B;  1TD5 A;  4GHI B;  3OOV A;  4BBT A;  4GW9 A;  2M1C A;  4MN5 A;  1GSW A;  1UWP X;  4II7 A;  4WUJ A;  4I3J A;  4BJP A;  4BBU A;  5MC7 A;  1MKM A;  1IFQ A;  3PBN A;  5AVE A;  3LR4 A;  4Y2F A;  1T1B A;  5J3W A;  1UGU A;  3C2W A;  5DFX A;  2XA7 M;  3V67 A;  4BWI A;  1LSV A;  4GHI A;  2DMW A;  4GS9 B;  3ULF A;  4R3A A;  3KO6 A;  4CLC B;  2JN7 A;  2OWJ A;  4JGP A;  4EU0 A;  1VB6 A;  4LRY C;  2I9V A;  2QYB A;  2HF6 A;  3VE3 A;  3EOI A;  4CLC E;  3LI9 A;  4AFI A;  3FC7 A;  3LR3 A;  2VA0 A;  2VGL M;  3S7P A;  2M7V A;  2JKT M;  4OOM A;  1TS8 A;  2HGV A;  2EWV A;  5HZH A;  2W0N A;  4ETX A;  5DJT A;  2WKR A;  2HJE A;  2OAQ 1;  3B42 A;  2K7S A;  4R38 A;  4EER A;  2QHK A;  5J4E A;  1OTD A;  1T19 A;  3KSG A;  4CQH A;  2VX8 A;  4M4X A;  1F98 A;  3E4Q A;  3LYX A;  5HD5 A;  3TE8 A;  2PT7 A;  3LUQ A;  4O0P A;  3T4L A;  2PHY A;  2MJ6 A;  2O0Y A;  2VV6 A;  4ETZ A;  1IOU A;  4P6Z M;  1GSX A;  3T4K A;  5HL6 A;  3R7W B;  4ME4 A;  3H7W B;  3IS2 B;  1F9I A;  4HI4 A;  4YOF A;  4BMW A;  3LIF A;  1MZU A;  4I39 A;  2OOL A;  3F1O A;  4UQI M;  1TS0 A;  4B9O A;  1ZTU A;  3BY8 A;  4MCW A;  4UEY A;  4G3K A;  2K2N A;  4JGR A;  5L8M A;  2YKH A;  3IS2 A;  3PR6 A;  1TS6 A;  4WEJ A;  4EEU A;  2LB9 A;  3BQA A;  4XT2 B;  3OBF A;  1F5M A;  3E4P A;  3MXQ A;  3G6O A;  3MR0 A;  1NWZ A;  4WLA A;  3T4S A;  1TS7 A;  2HV1 A;  5F6A A;  3W2Z A;  3NJA A;  2VV7 A;  1XJ4 A;  4IUK A;  3KSF A;  1XJ3 A;  1LSX A;  1UWN X;  4NKP A;  4JGO A;  2JKR M;  4K08 A;  3UMD A;  3CWF A;  2VEA A;  5HDC A;  4XT2 A;  3OC2 A;  3EWK A;  3K3D A;  4LRX C;  2H28 A;  2BAS A;  5HDD A;  3R4K A;  4HH3 A;  2W3E A;  1T1C A;  4RQ9 A;  2Z6C A;  3H9W A;  3KX0 X;  3E4O A;  2KLI A;  1OJG A;  5AVF A;  3PYP A;  4HJ4 A;  1NLY A;  4EET B;  2INW A;  1H3Q A;  2A2L A;  3LR0 A;  4G3W A;  2V1B A;  4H6J B;  3MQ0 A;  5DF9 A;  4PKY G;  1OPX A;  4NXF A;  4PAU A;  1N9N A;  2P7J A;  2EA9 A;  3VOL A;  3A0S A;  5KSH A;  4Z1W A;  4Q0H A;  3BW6 A;  4R6L A;  3TRC A;  2QWS A;  3C8C A;  3F1P A;  2W3D A;  3MJQ A;  4IJG A;  1YAX A;  4KUK A;  1BYW A;  4I38 A;  4H6J A;  3LI8 A;  4HOI A;  2GNX A;  3D3O A;  1OTB A;  3EEH A;  3FPV A;  5G4Y A;  1EW0 A;  1D06 A;  1OTA A;  1XFN A;  3O5Y A;  3P7N A;  2ZBB A;  4GLQ A;  2GZA A;  2A24 B;  4Q0J A;  3U2A A;  4QPR A;  1P9R A;  4GS9 A;  4ZRR A;  3EQV A;  3GDI A;  2YKF A;  4WL9 A;  3S7N A;  4CLC A;  1P9W A;  4PHT A;  4DMZ A;  3LIA A;  3KYZ A;  2B18 A;  5G4Z A;  4GCZ A;  3BWL A;  4MMN A;  4WEL A;  3UE6 A;  4F3L B;  3GEC A;  2NUP C;  3PBT A;  2R78 A;  2A24 A;  2XRN A;  3HCY A;  4EEP A;  1ODV A;  1G6O A;  4KUO A;  2V9A A;  4Q0I A;  1OJ5 A;  4G3V A;  4Y5F A;  2PD8 A;  3F1N B;  4L9E A;  2PYR A;  3H82 B;  3IBJ A;  4DJ3 A;  1N9O A;  3NOT C;  2XRO A;  3S7Q A;  4JGQ A;  5AJG A;  3MF0 A;  3LIC A;  3S7O A;  2L4R A;  2JHE A;  3TW8 A;  3K3C A;  4EUV A;  4O8G A;  3LID A;  3F1N A;  3UB7 A;  5F68 A;  2ZMV A;  3JVU A;  1XFQ A;  4HP9 A;  3H82 A;  5HDS A;  3R7W A;  3CUE A;  1YKD A;  3H7W A;  5TJJ A;  5LBR A;  3LFV A;  5IS1 A;  4FOF A;  1N9L A;  2VKS A;  4EES A;  1DP9 A;  3JVV A;  1S66 L;  2VV8 A;  2W27 A;  4IHQ A;  3UE3 A;  4NXB A;  1WA9 A;  3BJN A;  5HD3 A;  1DP8 A;  1KOU A;  5HWT A;  2JKT I;  2KOI A;  3CLO A;  4BBV A;  5HPF A;  3NOU C;  3HJK A;  1STZ A;  5EFW A;  2OAP 1;  2CMN A;  1OTE A;  2G7U A;  4MN6 A;  4YWZ A;  4I5S A;  1LL8 A;  1GSV A;  3MQQ A;  5I5L A;  1H8M A;  2O9A A;  3B33 A;  2V0W A;  4HQA A;  2HJ9 C;  2P04 A;  3IBR A;  3MFX A;  4L9G A;  2D01 A;  2V1A A;  1V9Y A;  2W3H A;  5C5K A;  5F69 A;  3T4Q A;  2KDK A;  2PR5 A;  3UB8 A;  3UME A;  2V0U A;  4HJ3 A;  4CLC D;  5DKK A;  3PBQ A;  4E04 A;  2KX6 A;  3A0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...