2ZMVA

Crystal structure of synbindin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
202
Chain Sequence
AIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human synbindin reveals two conformations of longin domain
pubmed doi rcsb
molecule keywords Trafficking protein particle complex subunit 4
molecule tags Transport protein
source organism Homo sapiens
total genus 39
structure length 202
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04099 Sybindin Sybindin-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2zmvA01
2J3TC 2J3TD 1H3QA 2J3WA 2ZMVA 3CUEA 3CUEC 3PR6A
chains in the Genus database with same CATH superfamily
1K6RA 4Y13A 4FTXA 2Y2IA 2OWJA 1IELA 3M2JA 4EBNA 4KG6A 4GS9A 5DKKA 1ONHA 4GS9B 5FI7A 1NYYA 2B95A 2E8JA 1H8ZA 3HCYA 3C7VA 3TSGA 1IYOA 4EW7A 5FAQA 3DTKA 2ZM8A 3BFCA 3PBTA 5DTTA 1W8YA 2XQZA 5HD3A 2V2FF 4HY8A 1SZVA 1KGFA 4CJNA 1VETA 3IF6C 3VP2A 4PM7A 1BTLA 4NXGA 2WAFA 4OVDA 5EVIC 1CI9A 1VETB 5CHMA 1OT6A 4WUJA 4HP9A 4K91A 4WEJA 1HZOA 4YNRA 3U4LP 1GSWA 3EGXC 3GECA 4RX3A 4U0XA 4K08A 3CG5A 5A92A 2WK0A 3G32A 5AJGA 3UE3A 1YAXA 4JGOA 2GX5A 2UV0E 3W4QA 5J7EA 4Z9QA 1ESUA 1UWPX 2PU4A 2O9CA 2ZMAA 4PM8A 1DP6A 3BECA 3VV4A 4I38A 1IYSA 4QU3A 3O86A 4EERA 4S2MA 3AGFA 1ES3A 4LENA 4KQOA 1TF1A 4OH0A 2JC7A 3LIEA 1P9WA 1WA9A 4CLCC 2ZQ7A 4NXBA 3IF6A 3LIDA 3HLGA 5G4YA 2M7UA 3UDFA 5EVIA 3IF6B 1N9OA 5TR7A 1HVBA 3UDXA 4IBXA 4H6JA 5EVIB 1H3QA 5CEDA 4H6JB 1G6AA 1K4EA 1GSXA 1JNUA 1OJ5A 4Y0OA 3ZQ5A 4IUKA 3BW6A 2PD8A 1WYCA 3TW8A 3S4XA 4C75A 1Q2PA 4LRXC 4WELA 1N9BA 4MDZA 4DE3A 1CJFA 3PXPA 1LHYA 2W3DA 1Z09A 5EV0A 1GA9A 4JF4A 1F98A 2PR6A 3W4OA 3N8SA 4EV4A 4HOIA 4NEED 4HP4A 4LFUA 3P01A 2ZBBA 4CLCB 2H0YA 3VOYA 5GLBA 4BMWA 1SDNA 3IHAA 1MKIA 1BYWA 3SZTA 3L7HA 1SHVA 3H7WA 5GLAA 1KVMA 1GHMA 4ZJ3A 1DJBA 1SKFA 3H7WB 3WS0A 2W3HA 1T1CA 3FZCA 4KZ9A 3HBRA 3NDEA 5EM0A 3IH9A 2VA0A 3C5AA 4WBGA 4X55A 1L2SA 3ZCZA 1FOFA 3E0YA 3DWKA 1XP4A 2PYPA 4P6ZM 4RVAA 1ALQA 3KYZA 3MXQA 1OTAA 2P7JA 2ZQAA 2XSSA 1F2KA 4IHQA 4B88A 4PHTA 5G4ZA 4DN0A 4MCWA 3CI6A 2J3WA 4BBVA 2UWXA 3ZDJA 1ACFA 3LGOA 4OP8A 3JVUA 3WS4A 2J9PA 4KZBA 2JKGA 2WZZA 3ZGAB 1TD5A 5KZHA 5F1GA 3BLMA 3WS5A 3BQ8A 3NJAA 3LEQA 2PU2A 3V39A 4ZJ1A 5FEGA 3K2NA 2Y2PA 3LR3A 1FQGA 4ZRRA 4LV3A 2W1RA 5E2FA 1K6SA 3MXSA 4OPQA 3MQ0A 4GW9A 4I5SA 4PKYA 1CF0A 3PHYA 1YLJA 4Y0TA 3KSFA 5FQQA 1G28A 1DJAA 5A91A 3IXBA 4UAAA 3MBZA 3GQZA 2HDRA 2QHKA 2XLNA 2Z2MB 4Y5FA 5EE8A 4G3VA 3HLBA 5HDDA 3TJZC 2JHEA 3P7NA 3TE8A 4GNUA 2EX8A 2Q0OA 4DRTA 1H8MA 1W63Q 3IT9A 2MJ6A 4YINA 3SOIA 1ES2A 1OTEA 1YSPA 3Q1FA 3EQVA 1TVFA 3OPLA 3HL9A 3GMWA 1ONGA 2JBFA 2JKRM 4N1XA 4RQ9A 1JWZA 3EEHA 2WGVA 4WF0A 3MZFA 4GKUA 1N9NA 2WKHA 4ARZA 2R9XA 2JE5A 2WKPA 3EQUA 4ARZB 4S2KA 2G7UA 2PDRA 3LFVA 5HPIA 5K5BA 5CECA 3IXHA 1MXOA 3M6BA 3QP2A 3OCLA 1S66L 5DFYA 4C3QA 5G18A 2GNXA 2ZC7A 2ZD8A 1NY0A 3GVBA 4UA6A 5HARA 2R9WA 2HP9A 5EFWA 3DW0A 3FV7A 1K56A 4ME4A 2W27A 4QPRA 1QMEA 4WZ5A 2K31A 3G6OA 5L10A 3EWKA 1LI9A 2A2LA 5FQ9A 1AWIA 3Q7VA 4CQHA 2QMIA 2KLIA 3PAEA 3MSHA 3Q7VB 3T4KA 2V8CA 5FASA 2C6WB 5CGWA 1YMSA 2FFYA 1FIKA 2WADA 1FR1A 1NRFA 2ZQCA 3CJMA 4PM5A 3G2YA 3C7UA 4X25A 3T4QA 1KE0A 1D06A 3PR6A 2X71A 2QYBA 3QP8A 4E6XA 4I39A 5M18A 4UA9A 4MN7A 3Q82A 1J9MA 3BFEA 2Y4AA 3MFXA 3Q07A 1ZG6A 3UB6A 5GLCA 4OOMA 5FDHA 3F1NA 4R3BA 1YPRA 4RX2A 1L0GA 1Y28A 3F1NB 5M19A 4KG2A 5FSRA 4FUWA 2A49A 3PBSA 4FCFA 5IT5A 5HX9A 3SS4A 2OAQ1 2ZQ9A 4HNBA 1ODVA 1XA1A 1ES5A 3E2LA 5FAOA 3VP1A 5EM1A 1O7EA 1BULA 2ZJ9A 2PBYA 3VOLA 2O99A 3B33A 4I3AA 2VX8A 4XT2A 3V67A 4E3OA 3T4OA 4KZ8A 5HAQA 3ZG5A 4XT2B 5E43A 1JTDA 3BWLA 4K0XA 4QHCA 3MKFA 4JGPA 3T1RA 2P9VA 2Y91A 4QY5A 3FWLA 2XA7M 2Z6CA 4Y3IA 2P9VB 4LGWA 4BLMA 3HLFA 5L8MA 3VFHA 3SS3A 5A93A 5J3WA 3S7NA 5D3OA 4S2OA 4ETXA 1PI5A 3QP1A 2IWCA 4OPRA 5FAPA 1YSQA 4Q0JA 3LICA 3ZG0A 4PM9A 2X02A 3B47A 2WZXA 2PT7A 3IWQA 3AGDA 3C38A 3KYEA 4R23A 3G34A 1STZA 2P74A 1NJ4A 1TS8A 4R4RA 1G6OA 3ZG8B 4E3LA 3NI9A 3ZG9B 4Q0HA 1V9ZA 4LCMA 5JYOA 2AVXA 1HTZA 3FKWA 4X68A 4DE1A 1PWCA 3PAGA 2XROA 3MZEA 4EU0A 3T12B 4EWFA 1H0MA 4Y15A 5E2HA 3UMEA 3RTYA 1H8YA 2J3TC 3WRTA 4UQIM 4ZDXA 1HLUP 4ZJ2A 2BTFP 5CERA 1DP9A 4FSFA 3BJNA 4HH2A 2C5WB 1PIOA 4NG2A 5CEBA 1AXBA 2H10A 3ZNYA 4HHDA 1YM1A 2XH9A 1CEFA 3CWFA 2EA9A 4MMNA 3TOIA 4DXCA 2Q9MA 4DJ2A 1BZAA 5DVAA 3UB9A 1NZOA 3DTEA 2LB5A 3MF0A 4GCZA 4OLDA 4ZTKA 1EI5A 5FL3A 2VV8A 2WKEA 5TGFA 5EOEA 3B42A 1PW1A 2WYXA 1GSVA 4IUHA 3IBRA 3KSHA 2EX6A 1VB6A 1KDSA 1PWDA 2M7VA 4Y0UA 2H28A 2Y2HA 3GTCA 2YKFA 5CGXA 3ITAA 4KG5A 4Q8IA 1CK3A 1MY8A 3NCKA 1S67L 2J80A 2P04A 5DTSA 1NYMA 5FATA 4QD4A 3LR0A 4MN5A 1Y4OA 4GLQA 3D3OA 4P6ZS 5CXWA 4EEUA 2A24A 3NY4A 4FH4A 1FCMA 4R3JA 5HDSA 2A24B 4BL3A 4KUKA 2EWWA 3DBAA 1KE4A 4S2NC 3LR4A 1I5QA 2X01A 4B4ZA 5AQAA 3VMAA 3D4FA 3IQAA 3GR2A 4JXSA 2OLUA 3FKVA 4NK3A 1PW8A 4MBKA 4S2JA 3D72A 3NOPC 4DXBA 1MWSA 2VGLM 1RGYA 3LIAA 1FSWA 3QP4A 3T1SA 4EQIA 4KZ3A 4DE0A 4S2IA 2J8YA 1K0KA 3WRZA 4N9LA 5HWVA 1SCWA 3E4OA 4OQ0A 3QP5A 4A5RA 4E3IA 4P85A 2XRNA 1XGJA 3HUNA 2Y2JA 4ZBEA 1FSYA 2H5SA 2ZM0A 3UO9A 4P6BA 2HP6A 1K54C 4G3WA 2NUPC 4IEDA 4KZ5A 5EECA 3ITBA 4R3AA 4CLCA 4HBTA 2RCXA 3CZDA 1N4OA 1IOUA 3CUEC 3T4JA 5CTNA 4QWOA 2XR0A 3C30A 4GHIA 5CX7A 3NECA 4YWZA 1ZTUA 3CMZA 4GHIB 4GJ4A 3OCNA 1IYQA 2W0NA 4BD1A 4HIAA 3T1XA 2HJ9C 3CLOA 3QNBA 1PYYA 3HLDA 1YLTA 2EX9A 4R70A 2Y55A 3KSGA 3LYXA 3SS5A 2PAVP 3OPRA 1S4SA 3EOIA 4ESPA 4MN6A 4I3IA 5F1FA 5KIZA 4IBRA 5I94A 3VOZA 4B4XA 2V1AA 3G31A 3B3XA 1K56D 2W1TA 5MC7A 1MPLA 2W1TB 3GDIA 1ZG4A 4UA7A 4GDBA 1NXYA 2HDQA 2PHYA 4WM9A 2ZC4B 4WLAA 5A90A 3L9KA 4JLFA 4OKPA 1XJ6A 3V50A 1EW0A 3RH8B 2BLSA 1LSWA 4LV0A 4F3LB 3IX3A 3W8KA 3LCEA 4S2LA 2INWA 2Y2GA 4EQ1A 2JKRI 1PZPA 3ZG7B 4IJGA 2VZWA 4H8RA 3LIBA 4JKTA 3CPTA 3FC7A 3HVFA 2KX6A 3MS6A 1FCNA 3CPTB 4JGQA 1DRMA 5GHZA 2PBDP 2V1ZA 1VM1A 5U47A 1K38A 5HAIA 4HQAA 1XKZA 1LT0A 4NKPA 1VHMA 3VSKA 3SH8A 3E4PA 4WMCA 4FH2A 2OLVA 1S1YA 2VKSA 4R38A 5DF8A 1FCOA 4U0TA 1ERMA 4U3TA 5EUAA 5HSQA 2JCHA 2FH5A 3UE1A 4BBTA 2I9VA 4PAUA 3NIAA 1ZKJA 4HBUA 3UNWA 1NRJA 3LO7A 4LV2A 3WS2A 2ZQDA 3S22A 3SH7A 1YLWA 4E04A 2FFFB 2DCFA 2XGNA 3UE0A 2Y2NA 2XD5A 4B93A 3QP6A 4EUZA 5FQKA 3BYDA 3UY6A 1RP5A 1TS6A 3PBNA 1CI8A 2WGWA 1G5UA 4QB8A 4HI4A 4D60A 2ZQ8A 3CAXA 2VGJA 2WGWB 3FPVA 1W63M 4BENA 2Y79A 2J7VA 4OOLA 1D7EA 1D1JA 2CC1A 4PMAA 1BLHA 1P9RA 3IXDA 2KDKA 2DRWA 2HDSA 4O0PA 3T4TA 1K4FA 2VJWA 2XK1A 3VFFA 1MWRA 1XJ3A 3LI9A 3N4IA 3K3DA 1XFQA 3S7QA 1GHIA 1X0OA 4R1GA 3C4PA 1L0DA 2K2NA 5DTKA 1F5MA 1TS7A 2HP5A 3R4KA 2HDUA 1ZHHB 4MLLA 2HV1A 4D2OA 4XUXA 4BWIA 1S4RA 4BQMA 1GHPA 3IH8A 1E3UA 1K57C 5FEFA 1S6RA 3BFDA 4O01A 2PR5A 1JTGA 2RL3A 4R6LA 1WYBA 1BLPA 4KQRA 4OPYA 5KSCA 2V0WA 3UB5P 2QWSA 5HAPA 1OPXA 5KMWA 1FR6A 3PTEA 2NUTC 5HZHA 3N7WA 2XFSA 3AGEA 2B18A 3NC8A 1P97A 3ZNTA 3N6IA 2DNSA 4DKIA 3BFFA 4BBUA 4QJGA 1BLSA 1T18A 5IHVA 1L0FA 1JWVA 3MJQA 2QPNA 3QHYA 3T50A 3JYIA 3OOVA 3NOTC 2Q9NA 2EFXA 2Y8HA 3DWZA 2O9BA 4JBFA 3IWIA 3NBLA 1UWNX 3VP0A 4JXWA 3UE6A 1T1BA 4KZ6A 4L9EA 3HLCA 1GA0A 4L0LA 2PRFA 4M4XA 3BQAA 3ZYTA 2VK3A 1BT5A 1U60A 3HUOA 2W3EA 1PNEA 2Y2QA 5L09A 3SW1A 2V1BA 2BASA 3GV9A 2D02A 3PBRA 1YLZA 1H5XA 3CHWP 2OWHA 2V8FA 1PRQA 4RA7A 3DTMA 2EWVA 3OPHA 4E6WA 3BY9A 4CLCE 2ACGA 3LY4A 5EVID 1YT4A 3ULFA 5AVEA 2M1CA 5EOOA 1IEMA 3V3SA 2ZLYA 2BG1A 2W3FA 2V0UA 2O9AA 2K7SA 2XD1A 1MWUA 2WKRA 1S1ZA 1TDLA 1YMXA 4GD6A 4JF6A 2B02A 1RCJA 5TFQA 1PWGA 3UMDA 3O3VA 4P0MA 5J8XA 4Y17A 3HJKA 3KSIA 1TEMA 2YKHA 4X6TA 4E3NA 4IVKA 4Y7PA 1XFNA 2VGLS 2JN7A 1T1AA 5CGSA 4G3KA 4GB7A 4Z1WA 4CLCD 2HGVA 1TDGA 1W5DA 1SKOA 3O88A 5FI2A 5FQJA 3VE3A 1SKOB 1L0EA 5A8BA 4X56A 2V9AA 3KYQA 4X69A 2ZOIA 4HJ3A 5CHJA 2WGIA 5KSHA 4O8GA 3UPNA 3A0SA 1MC0A 3F1OA 1N9LA 2ZL1A 3I7JA 4GD8A 3LI8A 3A0VA 3T4LA 3F1OB 2Y2MA 5DJUA 4E3MA 2H0TA 2ZL1B 2JKTM 4KUOA 2Y2OA 1W8QA 3BFGA 5AQ9A 2Y2LA 2GDNA 3UB8A 1SDEA 5FA7A 4WL9A 3E4QA 1CQAA 3NOUC 4HH3A 2ZM2A 4PM6A 3MR0A 3UN7A 4NETA 2VV7A 4HESA 4XXRA 3BRMA 3CITA 1I2SA 3C2WA 2L1MA 2VV6A 2I72A 2VLGA 2L0WA 4CPKA 4KZAA 4EEPA 4KQDA 1LLBA 5I5LA 5F83A 1YQSA 5EPHA 3BM6A 3N8LA 4DE2A 4X53A 4L9GA 3KO6A 3GRJA 3PBQA 2Y59A 4P87A 4N92A 1MBLA 1GCEA 5J4EA 4HJ4A 2Z6DA 4WMCD 4DF6A 5HPFA 2FZ0A 1LI0A 1OTIA 3A3DA 3G35A 1A0KA 5C5KA 5F69A 5F5YA 2GJ3A 1MKMA 3A3FA 4Q0IA 4ETZA 1VEUA 1YLYA 5HW3A 1VEUB 2LB9A 3T1QB 2QKPA 3M2KA 3O87A 3D9YA 4LRZE 2EXBA 4LPZA 1QMFA 4OLGA 4OQHA 3SH9A 1S0WA 4S2NA 5M1AA 4HEFA 5DF7A 4OONA 1Z6FA 1LL8A 3A3IA 3PYPA 2WAEA 3UPPA 1NLZA 3DAVA 3G30A 3W4PA 1XPBA 1XGIA 1LL9A 1PZOA 1XA7A 4LV1A 4N9KA 1OTDA 1MZUA 4OP5A 4EXOA 5HL6A 3S7PA 1FILA 3FYZA 3MXRA 3JVVA 1T19A 1OJGA 4EBPA 3P98A 1BSGA 3EGDC 3MQOA 4GZBA 5HD5A 3FPWA 5F82A 3RXWA 4O7DA 2EFUA 3IX4A 3TRCA 5L07A 1K54A 4R0QA 2ZC6B 1E3UD 2DMWA 3GSGA 4OQIA 4IVIA 4II7A 3CUEA 1NZUA 5HDCA 2G2WA 5GHYA 4F3LA 2IA2A 3C4OA 1G68A 4FOFA 5E2EA 3LY3A 1RGZA 5IU1A 1ERQA 4KZ7A 3OLOA 4JXVA 4R4SA 3BY8A 1ZC2A 1BLCA 3LR5A 2P08A 3C8CA 4GDNA 2KOIA 5CTMA 3V5MA 3LEZA 1E25A 4LCLA 5FI6A 2OV5A 1DY6A 4Y2FA 4WZ4A 2CMNA 3PBOA 3ZVWA 3HREA 5DFXA 1KGGA 4KQQA 1PFLA 2XEPA 1DP8A 3HLWA 1K25A 2WKIA 3A3JA 3K3CA 1Y54A 5EVLA 4NXEA 1KDWA 5CHUA 3MFDA 2WUQA 3MQQA 2QJ7A 3QNCA 2IWDA 2ZMFA 3VP3A 3HUMA 3LIFA 4DJ3A 1C3BA 1W79A 5IS1A 5LBRA 5F6AA 4WEKA 3VE4A 1F9IA 4NXFA 4BJPA 4YFMA 1OT9A 3EEAA 3O5YA 4PPRA 2A3UA 3OPPA 3VSLA 3MMHA 2V20A 2B5RA 2ZMVA 1MWTA 1JWPA 5AQ7A 4WYYA 1XXMA 1I2WA 5CRFA 1XJ4A 3OC2A 2W3GA 5EVEA 2OSUA 4WZ5C 3W2ZA 2PYRA 3IS2A 2QJ5A 3IWOA 4E3JA 5JYPA 3NDGA 3E98A 3ZHHA 2HZ5A 3IS2B 4EETB 1CEGA 1KE3A 4RYEA 3BEBA 5HFOA 3T4SA 1W7FA 1KOUA 3Q7ZA 3H9WA 4S2PA 1DJCA 1NLYA 5HWTA 5L2FA 3UB7A 1HD8A 2XA7S 3RJUA 2L4RA 2XDMA 1KVLA 3ZFZA 1TS0A 3RFBA 4OPZA 3IF5A 3E2KA 4PKYG 3R7WA 3VP4A 4EESA 3R7WB 4B9OA 2OOLA 3A3EA 4GN2A 3Q81A 3V3RA 5DKLA 3WS1A 2R78A 2VGKA 1O07A 4YOFA 5GHXA 5HL1A 3F1PA 1XJ2A 2ZC3B 1JVJA 4EUVA 3F1PB 3S7OA 4MBHA 5DJTA 4WN5A 3U2AA 1WE4A 4UHUA 1M40A 4LRYC 5FDSA 1EWZA 4L9FA 1IKIA 4F94A 4AFIA 1YLPA 1IYPA 2Z2LB 5AVFA 3JPUA 1LSXA 4MEZA 3MZDA 1K55C 4QY6A 5FQMA 3HJIA 2WKQA 2Y2KA 1L3LA 5AQBA 3H82A 3IX8A 5DF9A 4OOYA 1PI4A 3G2ZA 5F68A 3ICYA 3H82B 3IHBA 4ID4A 4KZ4A 3UPOA 1YKDA 4KENB 4UQIS 1OMEA 3ZVTA 1K57A 4JXGA 4N1HA 3P09A 5GL9A 2XF3A 5HWWA 1XX2A 1UGUA 2ZOHA 4BD0A 3TG9A 4DMZA 4X1LA 2JKFA 4JF5A 3MKEA 3WWXA 3LUQA 1J3WA 4XUZA 2G2UA 1OTBA 5GLDA 5TBMA 4UEYA 2PD7A 3OBFA 5TBMB 1ES4A 2J3TD 4ZAMA 3NULA 1E4DA 1IKGA 4X1MA 2D01A 3NHQA 4BL2A 3A0RA 3S1YA 3OZHA 5E2GA 4JPMA 1LSVA 3RXXA 1V9YA 4JGRA 1K55A 1IFQA 4E3KA 4DDYA 2GZAA 3ISGA 4MBFA 4EBLA 3DTIA 2EX2A 4LLOB 2J9OA 2O0YA 1Q2QA 3G4PA 5TJJA 2E8IA 5FQIA 2IWBA 3UDIA 3HLEA 2QZ6A 1M6KA 3FG8A 2XFTA 2JKTI 1LL5A 4DDSA 5BOHA 1VQQA 4HJ6A 1ESIA 3KX0X 3IBJA 4OQGA 2HF6A 2HPBA 1BUEA 4C6YA 1NWZA 3M6HA 3IXGA 3N8RA 4MNRA 1P0ZA 2EXAA 2HJEA 2VEAA 4FD8A 1EROA 2OAP1 3BLSA 2ZC5B 1KGEA 4K0WA 4I3JA 4GOGA 4M3KA
chains in the Genus database with same CATH topology
2VKSA 2LB9A 4R38A 2OWJA 2QKPA 5HSQA 4LRZE 2FH5A 4BBTA 4I39A 4LPZA 4MN7A 2I9VA 4PAUA 4GS9A 1NRJA 5DKKA 4GS9B 3MFXA 3UB6A 3HCYA 1LL8A 4OOMA 4EW7A 3PYPA 4E04A 3F1NA 3PBTA 1NLZA 1Y28A 3F1NB 4B93A 3PBSA 5HD3A 5IT5A 1TS6A 3PBNA 1OTDA 1MZUA 4HY8A 2OAQ1 4HI4A 4HNBA 1ODVA 4EXOA 3CAXA 3FPVA 5HL6A 1W63M 3S7PA 2Y79A 4NXGA 4OOLA 3JVVA 3VOLA 1D7EA 2O99A 3B33A 1T19A 4I3AA 1OT6A 4WEJA 4HP9A 4WUJA 4YNRA 1P9RA 1OJGA 2VX8A 1GSWA 2KDKA 3EGDC 3MQOA 3EGXC 4XT2A 3GECA 5HD5A 3V67A 3T4OA 4O0PA 3T4TA 3FPWA 2VJWA 4K08A 4XT2B 3BWLA 1XJ3A 4JGPA 3LI9A 5AJGA 3TRCA 3UE3A 2XA7M 1YAXA 1XFQA 3K3DA 4JGOA 3S7QA 2GX5A 2Z6CA 4Y3IA 2DMWA 1X0OA 5J7EA 4II7A 1UWPX 3CUEA 2K2NA 2O9CA 5L8MA 1DP6A 1F5MA 1TS7A 5J3WA 3VV4A 3R4KA 4I38A 3S7NA 1ZHHB 5HDCA 4F3LA 4EERA 2HV1A 2IA2A 4ETXA 4KQOA 4FOFA 1TF1A 1YSQA 4Q0JA 5IU1A 4BWIA 1S4RA 3LIEA 3OLOA 1P9WA 3LICA 3BY8A 1WA9A 4CLCC 3LR5A 4O01A 2P08A 2PR5A 3C8CA 2KOIA 3B47A 4NXBA 2PT7A 3LIDA 4R6LA 5G4YA 2V0WA 3C38A 4Y2FA 2M7UA 2CMNA 1N9OA 3PBOA 2QWSA 1STZA 1TS8A 5DFXA 1OPXA 4H6JA 1G6OA 1H3QA 1DP8A 4H6JB 2NUTC 5HZHA 4Q0HA 1V9ZA 1GSXA 1JNUA 1OJ5A 3K3CA 3ZQ5A 2B18A 4IUKA 4NXEA 3BW6A 1P97A 2PD8A 3MQQA 3TW8A 2XROA 2QJ7A 4EU0A 2ZMFA 3LIFA 4DJ3A 4LRXC 4WELA 5IS1A 4BBUA 5LBRA 5F6AA 4MDZA 3UMEA 1T18A 4WEKA 3VE4A 3RTYA 3PXPA 1F9IA 2J3TC 4UQIM 2W3DA 4NXFA 3MJQA 4BJPA 1DP9A 1OT9A 1F98A 4FSFA 3BJNA 3T50A 4HH2A 3EEAA 3O5YA 3OOVA 3NOTC 2Y8HA 2PR6A 4HHDA 2O9BA 4HOIA 3CWFA 2EA9A 4NEED 3MMHA 4HP4A 2ZMVA 3P01A 2ZBBA 4MMNA 4CLCB 1UWNX 4DJ2A 3UB9A 3UE6A 4BMWA 1XJ4A 3OC2A 2LB5A 1BYWA 1T1BA 2W3GA 3MF0A 4GCZA 3H7WA 4L9EA 5FL3A 3W2ZA 2PYRA 2VV8A 3IS2A 3B42A 2QJ5A 3H7WB 4L0LA 2W3HA 3E98A 4M4XA 1GSVA 4IUHA 1T1CA 3BQAA 3IBRA 3IS2B 3KSHA 1VB6A 3ZYTA 4EETB 2M7VA 2H28A 2VA0A 2YKFA 2W3EA 3T4SA 3SW1A 2V1BA 2BASA 1KOUA 3H9WA 1S67L 2D02A 3E0YA 2J80A 2P04A 3PBRA 1NLYA 5HWTA 3UB7A 2OWHA 2XA7S 2PYPA 4P6ZM 2L4RA 1TS0A 2EWVA 3LR0A 4MN5A 3KYZA 3BY9A 3RFBA 3MXQA 4CLCE 1OTAA 2P7JA 3D3OA 4GLQA 2XSSA 4IHQA 4P6ZS 4PKYG 3R7WA 4PHTA 5G4ZA 4EEUA 2A24A 4DN0A 4MCWA 3ULFA 5AVEA 4EESA 2M1CA 3CI6A 2J3WA 3R7WB 4B9OA 4BBVA 2OOLA 5HDSA 2A24B 4KUKA 5DKLA 2EWWA 3DBAA 2W3FA 3JVUA 2V0UA 2R78A 2O9AA 2K7SA 4YOFA 3LR4A 1TD5A 2WKRA 1S1ZA 2B02A 3F1PA 1XJ2A 3BQ8A 3UMDA 3NJAA 4EUVA 3F1PB 3S7OA 3HJKA 3KSIA 2YKHA 5DJTA 3D72A 3NOPC 2VGLM 4WN5A 3K2NA 3LIAA 3U2AA 3LR3A 4LRYC 4ZRRA 1XFNA 2W1RA 2VGLS 2JN7A 1T1AA 4L9FA 4AFIA 5HWVA 4G3KA 4Z1WA 5AVFA 2HGVA 4CLCD 1LSXA 3E4OA 3MQ0A 4GW9A 4I5SA 3HJIA 2WKQA 4PKYA 3PHYA 3H82A 5DF9A 3VE3A 2XRNA 5A8BA 3KSFA 5F68A 2V9AA 3ICYA 1G28A 3KYQA 3H82B 2ZOIA 1YKDA 4HJ3A 5KSHA 4O8GA 4UQIS 4G3WA 2NUPC 4R3AA 2QHKA 4CLCA 4Y5FA 4G3VA 3A0SA 1IOUA 1MC0A 3CUEC 5HDDA 3T4JA 3TJZC 3F1OA 5HWWA 1N9LA 2JHEA 3P7NA 3C30A 3TE8A 1UGUA 2ZOHA 4DMZA 4GHIA 5CX7A 3LI8A 3A0VA 3T4LA 3F1OB 4YWZA 5DJUA 1ZTUA 1H8MA 1W63Q 3LUQA 2JKTM 2MJ6A 1OTBA 4KUOA 4GHIB 4GJ4A 5TBMA 3OCNA 4UEYA 2W0NA 2PD7A 1OTEA 3OBFA 2HJ9C 1YSPA 3CLOA 4HIAA 3EQVA 5TBMB 3UB8A 4R70A 2J3TD 4WL9A 3E4QA 2D01A 3NHQA 3A0RA 2JKRM 3NOUC 4RQ9A 3KSGA 3LYXA 4HH3A 3EEHA 3MR0A 1S4SA 4WF0A 2VV7A 3EOIA 1N9NA 1LSVA 4MN6A 3CITA 1V9YA 4ARZA 4JGRA 4I3IA 5KIZA 1IFQA 3C2WA 2L1MA 2WKPA 3EQUA 4ARZB 2GZAA 2VV6A 2G7UA 2V1AA 2PDRA 4LLOB 3LFVA 2VLGA 2W1TA 2L0WA 5HPIA 5MC7A 2O0YA 5K5BA 4EEPA 5TJJA 2W1TB 4KQDA 3OCLA 3GDIA 2PHYA 5I5LA 1S66L 5DFYA 2GNXA 4WLAA 3FG8A 4L9GA 1XJ6A 2JKTI 1EW0A 3KO6A 5EFWA 3PBQA 4ME4A 3RH8B 4HJ6A 2W27A 1LSWA 3KX0X 3IBJA 4QPRA 4F3LB 2K31A 2HF6A 3G6OA 3EWKA 2A2LA 2INWA 5J4EA 4CQHA 1NWZA 2Z6DA 4HJ4A 2KLIA 4EQ1A 2JKRI 4IJGA 2VZWA 5HPFA 3LIBA 2FZ0A 3T4KA 1P0ZA 3FC7A 2KX6A 1OTIA 2HJEA 2VEAA 4JGQA 1DRMA 2OAP1 5C5KA 5F69A 4HQAA 5F5YA 1LT0A 2GJ3A 1VHMA 4I3JA 4NKPA 1MKMA 4Q0IA 4ETZA 3T4QA 1D06A 3PR6A 3E4PA 1S1YA 2QYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3T C;  2J3T D;  1H3Q A;  2J3W A;  2ZMV A;  3CUE A;  3CUE C;  3PR6 A; 
#chains in the Genus database with same CATH topology
 1K6R A;  4Y13 A;  4FTX A;  2Y2I A;  2OWJ A;  1IEL A;  3M2J A;  4EBN A;  4KG6 A;  4GS9 A;  5DKK A;  1ONH A;  4GS9 B;  5FI7 A;  1NYY A;  2B95 A;  2E8J A;  1H8Z A;  3HCY A;  3C7V A;  3TSG A;  1IYO A;  4EW7 A;  5FAQ A;  3DTK A;  2ZM8 A;  3BFC A;  3PBT A;  5DTT A;  1W8Y A;  2XQZ A;  5HD3 A;  2V2F F;  4HY8 A;  1SZV A;  1KGF A;  4CJN A;  1VET A;  3IF6 C;  3VP2 A;  4PM7 A;  1BTL A;  4NXG A;  2WAF A;  4OVD A;  5EVI C;  1CI9 A;  1VET B;  5CHM A;  1OT6 A;  4WUJ A;  4HP9 A;  4K91 A;  4WEJ A;  1HZO A;  4YNR A;  3U4L P;  1GSW A;  3EGX C;  3GEC A;  4RX3 A;  4U0X A;  4K08 A;  3CG5 A;  5A92 A;  2WK0 A;  3G32 A;  5AJG A;  3UE3 A;  1YAX A;  4JGO A;  2GX5 A;  2UV0 E;  3W4Q A;  5J7E A;  4Z9Q A;  1ESU A;  1UWP X;  2PU4 A;  2O9C A;  2ZMA A;  4PM8 A;  1DP6 A;  3BEC A;  3VV4 A;  4I38 A;  1IYS A;  4QU3 A;  3O86 A;  4EER A;  4S2M A;  3AGF A;  1ES3 A;  4LEN A;  4KQO A;  1TF1 A;  4OH0 A;  2JC7 A;  3LIE A;  1P9W A;  1WA9 A;  4CLC C;  2ZQ7 A;  4NXB A;  3IF6 A;  3LID A;  3HLG A;  5G4Y A;  2M7U A;  3UDF A;  5EVI A;  3IF6 B;  1N9O A;  5TR7 A;  1HVB A;  3UDX A;  4IBX A;  4H6J A;  5EVI B;  1H3Q A;  5CED A;  4H6J B;  1G6A A;  1K4E A;  1GSX A;  1JNU A;  1OJ5 A;  4Y0O A;  3ZQ5 A;  4IUK A;  3BW6 A;  2PD8 A;  1WYC A;  3TW8 A;  3S4X A;  4C75 A;  1Q2P A;  4LRX C;  4WEL A;  1N9B A;  4MDZ A;  4DE3 A;  1CJF A;  3PXP A;  1LHY A;  2W3D A;  1Z09 A;  5EV0 A;  1GA9 A;  4JF4 A;  1F98 A;  2PR6 A;  3W4O A;  3N8S A;  4EV4 A;  4HOI A;  4NEE D;  4HP4 A;  4LFU A;  3P01 A;  2ZBB A;  4CLC B;  2H0Y A;  3VOY A;  5GLB A;  4BMW A;  1SDN A;  3IHA A;  1MKI A;  1BYW A;  3SZT A;  3L7H A;  1SHV A;  3H7W A;  5GLA A;  1KVM A;  1GHM A;  4ZJ3 A;  1DJB A;  1SKF A;  3H7W B;  3WS0 A;  2W3H A;  1T1C A;  3FZC A;  4KZ9 A;  3HBR A;  3NDE A;  5EM0 A;  3IH9 A;  2VA0 A;  3C5A A;  4WBG A;  4X55 A;  1L2S A;  3ZCZ A;  1FOF A;  3E0Y A;  3DWK A;  1XP4 A;  2PYP A;  4P6Z M;  4RVA A;  1ALQ A;  3KYZ A;  3MXQ A;  1OTA A;  2P7J A;  2ZQA A;  2XSS A;  1F2K A;  4IHQ A;  4B88 A;  4PHT A;  5G4Z A;  4DN0 A;  4MCW A;  3CI6 A;  2J3W A;  4BBV A;  2UWX A;  3ZDJ A;  1ACF A;  3LGO A;  4OP8 A;  3JVU A;  3WS4 A;  2J9P A;  4KZB A;  2JKG A;  2WZZ A;  3ZGA B;  1TD5 A;  5KZH A;  5F1G A;  3BLM A;  3WS5 A;  3BQ8 A;  3NJA A;  3LEQ A;  2PU2 A;  3V39 A;  4ZJ1 A;  5FEG A;  3K2N A;  2Y2P A;  3LR3 A;  1FQG A;  4ZRR A;  4LV3 A;  2W1R A;  5E2F A;  1K6S A;  3MXS A;  4OPQ A;  3MQ0 A;  4GW9 A;  4I5S A;  4PKY A;  1CF0 A;  3PHY A;  1YLJ A;  4Y0T A;  3KSF A;  5FQQ A;  1G28 A;  1DJA A;  5A91 A;  3IXB A;  4UAA A;  3MBZ A;  3GQZ A;  2HDR A;  2QHK A;  2XLN A;  2Z2M B;  4Y5F A;  5EE8 A;  4G3V A;  3HLB A;  5HDD A;  3TJZ C;  2JHE A;  3P7N A;  3TE8 A;  4GNU A;  2EX8 A;  2Q0O A;  4DRT A;  1H8M A;  1W63 Q;  3IT9 A;  2MJ6 A;  4YIN A;  3SOI A;  1ES2 A;  1OTE A;  1YSP A;  3Q1F A;  3EQV A;  1TVF A;  3OPL A;  3HL9 A;  3GMW A;  1ONG A;  2JBF A;  2JKR M;  4N1X A;  4RQ9 A;  1JWZ A;  3EEH A;  2WGV A;  4WF0 A;  3MZF A;  4GKU A;  1N9N A;  2WKH A;  4ARZ A;  2R9X A;  2JE5 A;  2WKP A;  3EQU A;  4ARZ B;  4S2K A;  2G7U A;  2PDR A;  3LFV A;  5HPI A;  5K5B A;  5CEC A;  3IXH A;  1MXO A;  3M6B A;  3QP2 A;  3OCL A;  1S66 L;  5DFY A;  4C3Q A;  5G18 A;  2GNX A;  2ZC7 A;  2ZD8 A;  1NY0 A;  3GVB A;  4UA6 A;  5HAR A;  2R9W A;  2HP9 A;  5EFW A;  3DW0 A;  3FV7 A;  1K56 A;  4ME4 A;  2W27 A;  4QPR A;  1QME A;  4WZ5 A;  2K31 A;  3G6O A;  5L10 A;  3EWK A;  1LI9 A;  2A2L A;  5FQ9 A;  1AWI A;  3Q7V A;  4CQH A;  2QMI A;  2KLI A;  3PAE A;  3MSH A;  3Q7V B;  3T4K A;  2V8C A;  5FAS A;  2C6W B;  5CGW A;  1YMS A;  2FFY A;  1FIK A;  2WAD A;  1FR1 A;  1NRF A;  2ZQC A;  3CJM A;  4PM5 A;  3G2Y A;  3C7U A;  4X25 A;  3T4Q A;  1KE0 A;  1D06 A;  3PR6 A;  2X71 A;  2QYB A;  3QP8 A;  4E6X A;  4I39 A;  5M18 A;  4UA9 A;  4MN7 A;  3Q82 A;  1J9M A;  3BFE A;  2Y4A A;  3MFX A;  3Q07 A;  1ZG6 A;  3UB6 A;  5GLC A;  4OOM A;  5FDH A;  3F1N A;  4R3B A;  1YPR A;  4RX2 A;  1L0G A;  1Y28 A;  3F1N B;  5M19 A;  4KG2 A;  5FSR A;  4FUW A;  2A49 A;  3PBS A;  4FCF A;  5IT5 A;  5HX9 A;  3SS4 A;  2OAQ 1;  2ZQ9 A;  4HNB A;  1ODV A;  1XA1 A;  1ES5 A;  3E2L A;  5FAO A;  3VP1 A;  5EM1 A;  1O7E A;  1BUL A;  2ZJ9 A;  2PBY A;  3VOL A;  2O99 A;  3B33 A;  4I3A A;  2VX8 A;  4XT2 A;  3V67 A;  4E3O A;  3T4O A;  4KZ8 A;  5HAQ A;  3ZG5 A;  4XT2 B;  5E43 A;  1JTD A;  3BWL A;  4K0X A;  4QHC A;  3MKF A;  4JGP A;  3T1R A;  2P9V A;  2Y91 A;  4QY5 A;  3FWL A;  2XA7 M;  2Z6C A;  4Y3I A;  2P9V B;  4LGW A;  4BLM A;  3HLF A;  5L8M A;  3VFH A;  3SS3 A;  5A93 A;  5J3W A;  3S7N A;  5D3O A;  4S2O A;  4ETX A;  1PI5 A;  3QP1 A;  2IWC A;  4OPR A;  5FAP A;  1YSQ A;  4Q0J A;  3LIC A;  3ZG0 A;  4PM9 A;  2X02 A;  3B47 A;  2WZX A;  2PT7 A;  3IWQ A;  3AGD A;  3C38 A;  3KYE A;  4R23 A;  3G34 A;  1STZ A;  2P74 A;  1NJ4 A;  1TS8 A;  4R4R A;  1G6O A;  3ZG8 B;  4E3L A;  3NI9 A;  3ZG9 B;  4Q0H A;  1V9Z A;  4LCM A;  5JYO A;  2AVX A;  1HTZ A;  3FKW A;  4X68 A;  4DE1 A;  1PWC A;  3PAG A;  2XRO A;  3MZE A;  4EU0 A;  3T12 B;  4EWF A;  1H0M A;  4Y15 A;  5E2H A;  3UME A;  3RTY A;  1H8Y A;  2J3T C;  3WRT A;  4UQI M;  4ZDX A;  1HLU P;  4ZJ2 A;  2BTF P;  5CER A;  1DP9 A;  4FSF A;  3BJN A;  4HH2 A;  2C5W B;  1PIO A;  4NG2 A;  5CEB A;  1AXB A;  2H10 A;  3ZNY A;  4HHD A;  1YM1 A;  2XH9 A;  1CEF A;  3CWF A;  2EA9 A;  4MMN A;  3TOI A;  4DXC A;  2Q9M A;  4DJ2 A;  1BZA A;  5DVA A;  3UB9 A;  1NZO A;  3DTE A;  2LB5 A;  3MF0 A;  4GCZ A;  4OLD A;  4ZTK A;  1EI5 A;  5FL3 A;  2VV8 A;  2WKE A;  5TGF A;  5EOE A;  3B42 A;  1PW1 A;  2WYX A;  1GSV A;  4IUH A;  3IBR A;  3KSH A;  2EX6 A;  1VB6 A;  1KDS A;  1PWD A;  2M7V A;  4Y0U A;  2H28 A;  2Y2H A;  3GTC A;  2YKF A;  5CGX A;  3ITA A;  4KG5 A;  4Q8I A;  1CK3 A;  1MY8 A;  3NCK A;  1S67 L;  2J80 A;  2P04 A;  5DTS A;  1NYM A;  5FAT A;  4QD4 A;  3LR0 A;  4MN5 A;  1Y4O A;  4GLQ A;  3D3O A;  4P6Z S;  5CXW A;  4EEU A;  2A24 A;  3NY4 A;  4FH4 A;  1FCM A;  4R3J A;  5HDS A;  2A24 B;  4BL3 A;  4KUK A;  2EWW A;  3DBA A;  1KE4 A;  4S2N C;  3LR4 A;  1I5Q A;  2X01 A;  4B4Z A;  5AQA A;  3VMA A;  3D4F A;  3IQA A;  3GR2 A;  4JXS A;  2OLU A;  3FKV A;  4NK3 A;  1PW8 A;  4MBK A;  4S2J A;  3D72 A;  3NOP C;  4DXB A;  1MWS A;  2VGL M;  1RGY A;  3LIA A;  1FSW A;  3QP4 A;  3T1S A;  4EQI A;  4KZ3 A;  4DE0 A;  4S2I A;  2J8Y A;  1K0K A;  3WRZ A;  4N9L A;  5HWV A;  1SCW A;  3E4O A;  4OQ0 A;  3QP5 A;  4A5R A;  4E3I A;  4P85 A;  2XRN A;  1XGJ A;  3HUN A;  2Y2J A;  4ZBE A;  1FSY A;  2H5S A;  2ZM0 A;  3UO9 A;  4P6B A;  2HP6 A;  1K54 C;  4G3W A;  2NUP C;  4IED A;  4KZ5 A;  5EEC A;  3ITB A;  4R3A A;  4CLC A;  4HBT A;  2RCX A;  3CZD A;  1N4O A;  1IOU A;  3CUE C;  3T4J A;  5CTN A;  4QWO A;  2XR0 A;  3C30 A;  4GHI A;  5CX7 A;  3NEC A;  4YWZ A;  1ZTU A;  3CMZ A;  4GHI B;  4GJ4 A;  3OCN A;  1IYQ A;  2W0N A;  4BD1 A;  4HIA A;  3T1X A;  2HJ9 C;  3CLO A;  3QNB A;  1PYY A;  3HLD A;  1YLT A;  2EX9 A;  4R70 A;  2Y55 A;  3KSG A;  3LYX A;  3SS5 A;  2PAV P;  3OPR A;  1S4S A;  3EOI A;  4ESP A;  4MN6 A;  4I3I A;  5F1F A;  5KIZ A;  4IBR A;  5I94 A;  3VOZ A;  4B4X A;  2V1A A;  3G31 A;  3B3X A;  1K56 D;  2W1T A;  5MC7 A;  1MPL A;  2W1T B;  3GDI A;  1ZG4 A;  4UA7 A;  4GDB A;  1NXY A;  2HDQ A;  2PHY A;  4WM9 A;  2ZC4 B;  4WLA A;  5A90 A;  3L9K A;  4JLF A;  4OKP A;  1XJ6 A;  3V50 A;  1EW0 A;  3RH8 B;  2BLS A;  1LSW A;  4LV0 A;  4F3L B;  3IX3 A;  3W8K A;  3LCE A;  4S2L A;  2INW A;  2Y2G A;  4EQ1 A;  2JKR I;  1PZP A;  3ZG7 B;  4IJG A;  2VZW A;  4H8R A;  3LIB A;  4JKT A;  3CPT A;  3FC7 A;  3HVF A;  2KX6 A;  3MS6 A;  1FCN A;  3CPT B;  4JGQ A;  1DRM A;  5GHZ A;  2PBD P;  2V1Z A;  1VM1 A;  5U47 A;  1K38 A;  5HAI A;  4HQA A;  1XKZ A;  1LT0 A;  4NKP A;  1VHM A;  3VSK A;  3SH8 A;  3E4P A;  4WMC A;  4FH2 A;  2OLV A;  1S1Y A;  2VKS A;  4R38 A;  5DF8 A;  1FCO A;  4U0T A;  1ERM A;  4U3T A;  5EUA A;  5HSQ A;  2JCH A;  2FH5 A;  3UE1 A;  4BBT A;  2I9V A;  4PAU A;  3NIA A;  1ZKJ A;  4HBU A;  3UNW A;  1NRJ A;  3LO7 A;  4LV2 A;  3WS2 A;  2ZQD A;  3S22 A;  3SH7 A;  1YLW A;  4E04 A;  2FFF B;  2DCF A;  2XGN A;  3UE0 A;  2Y2N A;  2XD5 A;  4B93 A;  3QP6 A;  4EUZ A;  5FQK A;  3BYD A;  3UY6 A;  1RP5 A;  1TS6 A;  3PBN A;  1CI8 A;  2WGW A;  1G5U A;  4QB8 A;  4HI4 A;  4D60 A;  2ZQ8 A;  3CAX A;  2VGJ A;  2WGW B;  3FPV A;  1W63 M;  4BEN A;  2Y79 A;  2J7V A;  4OOL A;  1D7E A;  1D1J A;  2CC1 A;  4PMA A;  1BLH A;  1P9R A;  3IXD A;  2KDK A;  2DRW A;  2HDS A;  4O0P A;  3T4T A;  1K4F A;  2VJW A;  2XK1 A;  3VFF A;  1MWR A;  1XJ3 A;  3LI9 A;  3N4I A;  3K3D A;  1XFQ A;  3S7Q A;  1GHI A;  1X0O A;  4R1G A;  3C4P A;  1L0D A;  2K2N A;  5DTK A;  1F5M A;  1TS7 A;  2HP5 A;  3R4K A;  2HDU A;  1ZHH B;  4MLL A;  2HV1 A;  4D2O A;  4XUX A;  4BWI A;  1S4R A;  4BQM A;  1GHP A;  3IH8 A;  1E3U A;  1K57 C;  5FEF A;  1S6R A;  3BFD A;  4O01 A;  2PR5 A;  1JTG A;  2RL3 A;  4R6L A;  1WYB A;  1BLP A;  4KQR A;  4OPY A;  5KSC A;  2V0W A;  3UB5 P;  2QWS A;  5HAP A;  1OPX A;  5KMW A;  1FR6 A;  3PTE A;  2NUT C;  5HZH A;  3N7W A;  2XFS A;  3AGE A;  2B18 A;  3NC8 A;  1P97 A;  3ZNT A;  3N6I A;  2DNS A;  4DKI A;  3BFF A;  4BBU A;  4QJG A;  1BLS A;  1T18 A;  5IHV A;  1L0F A;  1JWV A;  3MJQ A;  2QPN A;  3QHY A;  3T50 A;  3JYI A;  3OOV A;  3NOT C;  2Q9N A;  2EFX A;  2Y8H A;  3DWZ A;  2O9B A;  4JBF A;  3IWI A;  3NBL A;  1UWN X;  3VP0 A;  4JXW A;  3UE6 A;  1T1B A;  4KZ6 A;  4L9E A;  3HLC A;  1GA0 A;  4L0L A;  2PRF A;  4M4X A;  3BQA A;  3ZYT A;  2VK3 A;  1BT5 A;  1U60 A;  3HUO A;  2W3E A;  1PNE A;  2Y2Q A;  5L09 A;  3SW1 A;  2V1B A;  2BAS A;  3GV9 A;  2D02 A;  3PBR A;  1YLZ A;  1H5X A;  3CHW P;  2OWH A;  2V8F A;  1PRQ A;  4RA7 A;  3DTM A;  2EWV A;  3OPH A;  4E6W A;  3BY9 A;  4CLC E;  2ACG A;  3LY4 A;  5EVI D;  1YT4 A;  3ULF A;  5AVE A;  2M1C A;  5EOO A;  1IEM A;  3V3S A;  2ZLY A;  2BG1 A;  2W3F A;  2V0U A;  2O9A A;  2K7S A;  2XD1 A;  1MWU A;  2WKR A;  1S1Z A;  1TDL A;  1YMX A;  4GD6 A;  4JF6 A;  2B02 A;  1RCJ A;  5TFQ A;  1PWG A;  3UMD A;  3O3V A;  4P0M A;  5J8X A;  4Y17 A;  3HJK A;  3KSI A;  1TEM A;  2YKH A;  4X6T A;  4E3N A;  4IVK A;  4Y7P A;  1XFN A;  2VGL S;  2JN7 A;  1T1A A;  5CGS A;  4G3K A;  4GB7 A;  4Z1W A;  4CLC D;  2HGV A;  1TDG A;  1W5D A;  1SKO A;  3O88 A;  5FI2 A;  5FQJ A;  3VE3 A;  1SKO B;  1L0E A;  5A8B A;  4X56 A;  2V9A A;  3KYQ A;  4X69 A;  2ZOI A;  4HJ3 A;  5CHJ A;  2WGI A;  5KSH A;  4O8G A;  3UPN A;  3A0S A;  1MC0 A;  3F1O A;  1N9L A;  2ZL1 A;  3I7J A;  4GD8 A;  3LI8 A;  3A0V A;  3T4L A;  3F1O B;  2Y2M A;  5DJU A;  4E3M A;  2H0T A;  2ZL1 B;  2JKT M;  4KUO A;  2Y2O A;  1W8Q A;  3BFG A;  5AQ9 A;  2Y2L A;  2GDN A;  3UB8 A;  1SDE A;  5FA7 A;  4WL9 A;  3E4Q A;  1CQA A;  3NOU C;  4HH3 A;  2ZM2 A;  4PM6 A;  3MR0 A;  3UN7 A;  4NET A;  2VV7 A;  4HES A;  4XXR A;  3BRM A;  3CIT A;  1I2S A;  3C2W A;  2L1M A;  2VV6 A;  2I72 A;  2VLG A;  2L0W A;  4CPK A;  4KZA A;  4EEP A;  4KQD A;  1LLB A;  5I5L A;  5F83 A;  1YQS A;  5EPH A;  3BM6 A;  3N8L A;  4DE2 A;  4X53 A;  4L9G A;  3KO6 A;  3GRJ A;  3PBQ A;  2Y59 A;  4P87 A;  4N92 A;  1MBL A;  1GCE A;  5J4E A;  4HJ4 A;  2Z6D A;  4WMC D;  4DF6 A;  5HPF A;  2FZ0 A;  1LI0 A;  1OTI A;  3A3D A;  3G35 A;  1A0K A;  5C5K A;  5F69 A;  5F5Y A;  2GJ3 A;  1MKM A;  3A3F A;  4Q0I A;  4ETZ A;  1VEU A;  1YLY A;  5HW3 A;  1VEU B;  2LB9 A;  3T1Q B;  2QKP A;  3M2K A;  3O87 A;  3D9Y A;  4LRZ E;  2EXB A;  4LPZ A;  1QMF A;  4OLG A;  4OQH A;  3SH9 A;  1S0W A;  4S2N A;  5M1A A;  4HEF A;  5DF7 A;  4OON A;  1Z6F A;  1LL8 A;  3A3I A;  3PYP A;  2WAE A;  3UPP A;  1NLZ A;  3DAV A;  3G30 A;  3W4P A;  1XPB A;  1XGI A;  1LL9 A;  1PZO A;  1XA7 A;  4LV1 A;  4N9K A;  1OTD A;  1MZU A;  4OP5 A;  4EXO A;  5HL6 A;  3S7P A;  1FIL A;  3FYZ A;  3MXR A;  3JVV A;  1T19 A;  1OJG A;  4EBP A;  3P98 A;  1BSG A;  3EGD C;  3MQO A;  4GZB A;  5HD5 A;  3FPW A;  5F82 A;  3RXW A;  4O7D A;  2EFU A;  3IX4 A;  3TRC A;  5L07 A;  1K54 A;  4R0Q A;  2ZC6 B;  1E3U D;  2DMW A;  3GSG A;  4OQI A;  4IVI A;  4II7 A;  3CUE A;  1NZU A;  5HDC A;  2G2W A;  5GHY A;  4F3L A;  2IA2 A;  3C4O A;  1G68 A;  4FOF A;  5E2E A;  3LY3 A;  1RGZ A;  5IU1 A;  1ERQ A;  4KZ7 A;  3OLO A;  4JXV A;  4R4S A;  3BY8 A;  1ZC2 A;  1BLC A;  3LR5 A;  2P08 A;  3C8C A;  4GDN A;  2KOI A;  5CTM A;  3V5M A;  3LEZ A;  1E25 A;  4LCL A;  5FI6 A;  2OV5 A;  1DY6 A;  4Y2F A;  4WZ4 A;  2CMN A;  3PBO A;  3ZVW A;  3HRE A;  5DFX A;  1KGG A;  4KQQ A;  1PFL A;  2XEP A;  1DP8 A;  3HLW A;  1K25 A;  2WKI A;  3A3J A;  3K3C A;  1Y54 A;  5EVL A;  4NXE A;  1KDW A;  5CHU A;  3MFD A;  2WUQ A;  3MQQ A;  2QJ7 A;  3QNC A;  2IWD A;  2ZMF A;  3VP3 A;  3HUM A;  3LIF A;  4DJ3 A;  1C3B A;  1W79 A;  5IS1 A;  5LBR A;  5F6A A;  4WEK A;  3VE4 A;  1F9I A;  4NXF A;  4BJP A;  4YFM A;  1OT9 A;  3EEA A;  3O5Y A;  4PPR A;  2A3U A;  3OPP A;  3VSL A;  3MMH A;  2V20 A;  2B5R A;  2ZMV A;  1MWT A;  1JWP A;  5AQ7 A;  4WYY A;  1XXM A;  1I2W A;  5CRF A;  1XJ4 A;  3OC2 A;  2W3G A;  5EVE A;  2OSU A;  4WZ5 C;  3W2Z A;  2PYR A;  3IS2 A;  2QJ5 A;  3IWO A;  4E3J A;  5JYP A;  3NDG A;  3E98 A;  3ZHH A;  2HZ5 A;  3IS2 B;  4EET B;  1CEG A;  1KE3 A;  4RYE A;  3BEB A;  5HFO A;  3T4S A;  1W7F A;  1KOU A;  3Q7Z A;  3H9W A;  4S2P A;  1DJC A;  1NLY A;  5HWT A;  5L2F A;  3UB7 A;  1HD8 A;  2XA7 S;  3RJU A;  2L4R A;  2XDM A;  1KVL A;  3ZFZ A;  1TS0 A;  3RFB A;  4OPZ A;  3IF5 A;  3E2K A;  4PKY G;  3R7W A;  3VP4 A;  4EES A;  3R7W B;  4B9O A;  2OOL A;  3A3E A;  4GN2 A;  3Q81 A;  3V3R A;  5DKL A;  3WS1 A;  2R78 A;  2VGK A;  1O07 A;  4YOF A;  5GHX A;  5HL1 A;  3F1P A;  1XJ2 A;  2ZC3 B;  1JVJ A;  4EUV A;  3F1P B;  3S7O A;  4MBH A;  5DJT A;  4WN5 A;  3U2A A;  1WE4 A;  4UHU A;  1M40 A;  4LRY C;  5FDS A;  1EWZ A;  4L9F A;  1IKI A;  4F94 A;  4AFI A;  1YLP A;  1IYP A;  2Z2L B;  5AVF A;  3JPU A;  1LSX A;  4MEZ A;  3MZD A;  1K55 C;  4QY6 A;  5FQM A;  3HJI A;  2WKQ A;  2Y2K A;  1L3L A;  5AQB A;  3H82 A;  3IX8 A;  5DF9 A;  4OOY A;  1PI4 A;  3G2Z A;  5F68 A;  3ICY A;  3H82 B;  3IHB A;  4ID4 A;  4KZ4 A;  3UPO A;  1YKD A;  4KEN B;  4UQI S;  1OME A;  3ZVT A;  1K57 A;  4JXG A;  4N1H A;  3P09 A;  5GL9 A;  2XF3 A;  5HWW A;  1XX2 A;  1UGU A;  2ZOH A;  4BD0 A;  3TG9 A;  4DMZ A;  4X1L A;  2JKF A;  4JF5 A;  3MKE A;  3WWX A;  3LUQ A;  1J3W A;  4XUZ A;  2G2U A;  1OTB A;  5GLD A;  5TBM A;  4UEY A;  2PD7 A;  3OBF A;  5TBM B;  1ES4 A;  2J3T D;  4ZAM A;  3NUL A;  1E4D A;  1IKG A;  4X1M A;  2D01 A;  3NHQ A;  4BL2 A;  3A0R A;  3S1Y A;  3OZH A;  5E2G A;  4JPM A;  1LSV A;  3RXX A;  1V9Y A;  4JGR A;  1K55 A;  1IFQ A;  4E3K A;  4DDY A;  2GZA A;  3ISG A;  4MBF A;  4EBL A;  3DTI A;  2EX2 A;  4LLO B;  2J9O A;  2O0Y A;  1Q2Q A;  3G4P A;  5TJJ A;  2E8I A;  5FQI A;  2IWB A;  3UDI A;  3HLE A;  2QZ6 A;  1M6K A;  3FG8 A;  2XFT A;  2JKT I;  1LL5 A;  4DDS A;  5BOH A;  1VQQ A;  4HJ6 A;  1ESI A;  3KX0 X;  3IBJ A;  4OQG A;  2HF6 A;  2HPB A;  1BUE A;  4C6Y A;  1NWZ A;  3M6H A;  3IXG A;  3N8R A;  4MNR A;  1P0Z A;  2EXA A;  2HJE A;  2VEA A;  4FD8 A;  1ERO A;  2OAP 1;  3BLS A;  2ZC5 B;  1KGE A;  4K0W A;  4I3J A;  4GOG A;  4M3K A; 
#chains in the Genus database with same CATH homology
 2VKS A;  2LB9 A;  4R38 A;  2OWJ A;  2QKP A;  5HSQ A;  4LRZ E;  2FH5 A;  4BBT A;  4I39 A;  4LPZ A;  4MN7 A;  2I9V A;  4PAU A;  4GS9 A;  1NRJ A;  5DKK A;  4GS9 B;  3MFX A;  3UB6 A;  3HCY A;  1LL8 A;  4OOM A;  4EW7 A;  3PYP A;  4E04 A;  3F1N A;  3PBT A;  1NLZ A;  1Y28 A;  3F1N B;  4B93 A;  3PBS A;  5HD3 A;  5IT5 A;  1TS6 A;  3PBN A;  1OTD A;  1MZU A;  4HY8 A;  2OAQ 1;  4HI4 A;  4HNB A;  1ODV A;  4EXO A;  3CAX A;  3FPV A;  5HL6 A;  1W63 M;  3S7P A;  2Y79 A;  4NXG A;  4OOL A;  3JVV A;  3VOL A;  1D7E A;  2O99 A;  3B33 A;  1T19 A;  4I3A A;  1OT6 A;  4WEJ A;  4HP9 A;  4WUJ A;  4YNR A;  1P9R A;  1OJG A;  2VX8 A;  1GSW A;  2KDK A;  3EGD C;  3MQO A;  3EGX C;  4XT2 A;  3GEC A;  5HD5 A;  3V67 A;  3T4O A;  4O0P A;  3T4T A;  3FPW A;  2VJW A;  4K08 A;  4XT2 B;  3BWL A;  1XJ3 A;  4JGP A;  3LI9 A;  5AJG A;  3TRC A;  3UE3 A;  2XA7 M;  1YAX A;  1XFQ A;  3K3D A;  4JGO A;  3S7Q A;  2GX5 A;  2Z6C A;  4Y3I A;  2DMW A;  1X0O A;  5J7E A;  4II7 A;  1UWP X;  3CUE A;  2K2N A;  2O9C A;  5L8M A;  1DP6 A;  1F5M A;  1TS7 A;  5J3W A;  3VV4 A;  3R4K A;  4I38 A;  3S7N A;  1ZHH B;  5HDC A;  4F3L A;  4EER A;  2HV1 A;  2IA2 A;  4ETX A;  4KQO A;  4FOF A;  1TF1 A;  1YSQ A;  4Q0J A;  5IU1 A;  4BWI A;  1S4R A;  3LIE A;  3OLO A;  1P9W A;  3LIC A;  3BY8 A;  1WA9 A;  4CLC C;  3LR5 A;  4O01 A;  2P08 A;  2PR5 A;  3C8C A;  2KOI A;  3B47 A;  4NXB A;  2PT7 A;  3LID A;  4R6L A;  5G4Y A;  2V0W A;  3C38 A;  4Y2F A;  2M7U A;  2CMN A;  1N9O A;  3PBO A;  2QWS A;  1STZ A;  1TS8 A;  5DFX A;  1OPX A;  4H6J A;  1G6O A;  1H3Q A;  1DP8 A;  4H6J B;  2NUT C;  5HZH A;  4Q0H A;  1V9Z A;  1GSX A;  1JNU A;  1OJ5 A;  3K3C A;  3ZQ5 A;  2B18 A;  4IUK A;  4NXE A;  3BW6 A;  1P97 A;  2PD8 A;  3MQQ A;  3TW8 A;  2XRO A;  2QJ7 A;  4EU0 A;  2ZMF A;  3LIF A;  4DJ3 A;  4LRX C;  4WEL A;  5IS1 A;  4BBU A;  5LBR A;  5F6A A;  4MDZ A;  3UME A;  1T18 A;  4WEK A;  3VE4 A;  3RTY A;  3PXP A;  1F9I A;  2J3T C;  4UQI M;  2W3D A;  4NXF A;  3MJQ A;  4BJP A;  1DP9 A;  1OT9 A;  1F98 A;  4FSF A;  3BJN A;  3T50 A;  4HH2 A;  3EEA A;  3O5Y A;  3OOV A;  3NOT C;  2Y8H A;  2PR6 A;  4HHD A;  2O9B A;  4HOI A;  3CWF A;  2EA9 A;  4NEE D;  3MMH A;  4HP4 A;  2ZMV A;  3P01 A;  2ZBB A;  4MMN A;  4CLC B;  1UWN X;  4DJ2 A;  3UB9 A;  3UE6 A;  4BMW A;  1XJ4 A;  3OC2 A;  2LB5 A;  1BYW A;  1T1B A;  2W3G A;  3MF0 A;  4GCZ A;  3H7W A;  4L9E A;  5FL3 A;  3W2Z A;  2PYR A;  2VV8 A;  3IS2 A;  3B42 A;  2QJ5 A;  3H7W B;  4L0L A;  2W3H A;  3E98 A;  4M4X A;  1GSV A;  4IUH A;  1T1C A;  3BQA A;  3IBR A;  3IS2 B;  3KSH A;  1VB6 A;  3ZYT A;  4EET B;  2M7V A;  2H28 A;  2VA0 A;  2YKF A;  2W3E A;  3T4S A;  3SW1 A;  2V1B A;  2BAS A;  1KOU A;  3H9W A;  1S67 L;  2D02 A;  3E0Y A;  2J80 A;  2P04 A;  3PBR A;  1NLY A;  5HWT A;  3UB7 A;  2OWH A;  2XA7 S;  2PYP A;  4P6Z M;  2L4R A;  1TS0 A;  2EWV A;  3LR0 A;  4MN5 A;  3KYZ A;  3BY9 A;  3RFB A;  3MXQ A;  4CLC E;  1OTA A;  2P7J A;  3D3O A;  4GLQ A;  2XSS A;  4IHQ A;  4P6Z S;  4PKY G;  3R7W A;  4PHT A;  5G4Z A;  4EEU A;  2A24 A;  4DN0 A;  4MCW A;  3ULF A;  5AVE A;  4EES A;  2M1C A;  3CI6 A;  2J3W A;  3R7W B;  4B9O A;  4BBV A;  2OOL A;  5HDS A;  2A24 B;  4KUK A;  5DKL A;  2EWW A;  3DBA A;  2W3F A;  3JVU A;  2V0U A;  2R78 A;  2O9A A;  2K7S A;  4YOF A;  3LR4 A;  1TD5 A;  2WKR A;  1S1Z A;  2B02 A;  3F1P A;  1XJ2 A;  3BQ8 A;  3UMD A;  3NJA A;  4EUV A;  3F1P B;  3S7O A;  3HJK A;  3KSI A;  2YKH A;  5DJT A;  3D72 A;  3NOP C;  2VGL M;  4WN5 A;  3K2N A;  3LIA A;  3U2A A;  3LR3 A;  4LRY C;  4ZRR A;  1XFN A;  2W1R A;  2VGL S;  2JN7 A;  1T1A A;  4L9F A;  4AFI A;  5HWV A;  4G3K A;  4Z1W A;  5AVF A;  2HGV A;  4CLC D;  1LSX A;  3E4O A;  3MQ0 A;  4GW9 A;  4I5S A;  3HJI A;  2WKQ A;  4PKY A;  3PHY A;  3H82 A;  5DF9 A;  3VE3 A;  2XRN A;  5A8B A;  3KSF A;  5F68 A;  2V9A A;  3ICY A;  1G28 A;  3KYQ A;  3H82 B;  2ZOI A;  1YKD A;  4HJ3 A;  5KSH A;  4O8G A;  4UQI S;  4G3W A;  2NUP C;  4R3A A;  2QHK A;  4CLC A;  4Y5F A;  4G3V A;  3A0S A;  1IOU A;  1MC0 A;  3CUE C;  5HDD A;  3T4J A;  3TJZ C;  3F1O A;  5HWW A;  1N9L A;  2JHE A;  3P7N A;  3C30 A;  3TE8 A;  1UGU A;  2ZOH A;  4DMZ A;  4GHI A;  5CX7 A;  3LI8 A;  3A0V A;  3T4L A;  3F1O B;  4YWZ A;  5DJU A;  1ZTU A;  1H8M A;  1W63 Q;  3LUQ A;  2JKT M;  2MJ6 A;  1OTB A;  4KUO A;  4GHI B;  4GJ4 A;  5TBM A;  3OCN A;  4UEY A;  2W0N A;  2PD7 A;  1OTE A;  3OBF A;  2HJ9 C;  1YSP A;  3CLO A;  4HIA A;  3EQV A;  5TBM B;  3UB8 A;  4R70 A;  2J3T D;  4WL9 A;  3E4Q A;  2D01 A;  3NHQ A;  3A0R A;  2JKR M;  3NOU C;  4RQ9 A;  3KSG A;  3LYX A;  4HH3 A;  3EEH A;  3MR0 A;  1S4S A;  4WF0 A;  2VV7 A;  3EOI A;  1N9N A;  1LSV A;  4MN6 A;  3CIT A;  1V9Y A;  4ARZ A;  4JGR A;  4I3I A;  5KIZ A;  1IFQ A;  3C2W A;  2L1M A;  2WKP A;  3EQU A;  4ARZ B;  2GZA A;  2VV6 A;  2G7U A;  2V1A A;  2PDR A;  4LLO B;  3LFV A;  2VLG A;  2W1T A;  2L0W A;  5HPI A;  5MC7 A;  2O0Y A;  5K5B A;  4EEP A;  5TJJ A;  2W1T B;  4KQD A;  3OCL A;  3GDI A;  2PHY A;  5I5L A;  1S66 L;  5DFY A;  2GNX A;  4WLA A;  3FG8 A;  4L9G A;  1XJ6 A;  2JKT I;  1EW0 A;  3KO6 A;  5EFW A;  3PBQ A;  4ME4 A;  3RH8 B;  4HJ6 A;  2W27 A;  1LSW A;  3KX0 X;  3IBJ A;  4QPR A;  4F3L B;  2K31 A;  2HF6 A;  3G6O A;  3EWK A;  2A2L A;  2INW A;  5J4E A;  4CQH A;  1NWZ A;  2Z6D A;  4HJ4 A;  2KLI A;  4EQ1 A;  2JKR I;  4IJG A;  2VZW A;  5HPF A;  3LIB A;  2FZ0 A;  3T4K A;  1P0Z A;  3FC7 A;  2KX6 A;  1OTI A;  2HJE A;  2VEA A;  4JGQ A;  1DRM A;  2OAP 1;  5C5K A;  5F69 A;  4HQA A;  5F5Y A;  1LT0 A;  2GJ3 A;  1VHM A;  4I3J A;  4NKP A;  1MKM A;  4Q0I A;  4ETZ A;  3T4Q A;  1D06 A;  3PR6 A;  3E4P A;  1S1Y A;  2QYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...