2ZMVA

Crystal structure of synbindin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
202
Chain Sequence
AIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trafficking protein particle complex subunit 4
publication title Crystal structure of human synbindin reveals two conformations of longin domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 39
structure length 202
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04099 Sybindin Sybindin-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.70 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2zmvA01
1H3QA 3CUEA 3CUEC 2ZMVA 2J3WA 2J3TD 3PR6A 2J3TC
chains in the Genus database with same CATH superfamily
2PR5A 3WRTA 5E2GA 3QP8A 1FCMA 4B4XA 1YT4A 2ZQDA 5CHUA 2J9OA 3S7NA 1IYOA 3EWKA 4LCLA 3OPPA 3Q7ZA 2BASA 1FIKA 2JKGA 4NETA 2JKFA 3UO9A 4N9LA 4K0XA 3UE0A 2A49A 3N8LA 2A24A 4FCFA 3GQZA 2LB5A 2B02A 1L0EA 1P97A 3VOLA 3GRJA 5GLAA 1YMXA 1TS6A 4F3LB 4L9GA 5G4ZA 3IXDA 4Y5FA 3A0RA 5HD3A 1H5XA 3ZNYA 4GOGA 4ZAMA 4K0WA 5GLCA 4LPZA 4GD8A 3B42A 4IHQA 1JNUA 1PW1A 2PT7A 1IEMA 5J4EA 3QHYA 4OLGA 4RVAA 5HDDA 1G5UA 3Q81A 1BLPA 3H82A 4FD8A 2ZL1B 1LL5A 1E25A 2XEPA 4EBLA 5TJJA 4GW9A 3N8SA 2C6WB 3IHAA 2VZWA 2EA9A 5A91A 4QPRA 4WM9A 1QMEA 1RP5A 2W1TA 4ZDXA 5HX9A 4BD1A 1PZPA 5EPHA 1VQQA 4BBVA 4YNRA 1N4OA 1SDNA 2Z2MB 1BLCA 1NLZA 3C5AA 3NECA 3LICA 3V67A 5FI2A 4U0TA 3E2LA 3RH8B 1KE0A 2VGLM 1GSXA 1JWVA 2A24B 4DXCA 3DBAA 3Q7VA 2HDSA 3E98A 4B93A 4JXSA 1DY6A 1JTGA 3O3VA 5KZHA 2V0UA 2V2FF 4KQQA 1IKGA 3A3EA 4P87A 3A0VA 4OOMA 2ZMVA 3M6HA 4WF0A 4YOFA 2W1RA 2Y2KA 3PBQA 3L9KA 3HJIA 3BY8A 2OV5A 3AGFA 4OP8A 1FR6A 1V9ZA 2JKTM 4HH3A 4IEDA 3NJAA 4EEUA 2XGNA 1G6OA 3IF6A 3LFVA 3RJUA 1OJ5A 4E04A 1N9BA 3HLEA 4MMNA 3H82B 1FQGA 2W3GA 4A5RA 3OPRA 4JGPA 5L2FA 4KZ7A 5FQMA 2XRNA 4ETZA 2HP5A 2K2NA 3LY4A 1QMFA 1V9YA 1NYYA 3BFEA 2JCHA 3O86A 4JXGA 2W1TB 2XFSA 5J3WA 1OT9A 2H0TA 2O9CA 2WGWA 3CMZA 4WLAA 5D3OA 4LV0A 3BYDA 5CEBA 2P74A 4N92A 1K4EA 4MEZA 5AJGA 3A3DA 2V1BA 1K25A 2GJ3A 2GX5A 2WKPA 3I7JA 4JF6A 3SS5A 4KZBA 3KSHA 2XQZA 3Q7VB 3OOVA 2PRFA 4QU3A 3TRCA 3E4PA 2CC1A 2B18A 1BLSA 3O5YA 4JGRA 3BQAA 3B33A 2XK1A 3LR3A 1LI9A 2WYXA 1LHYA 3PYPA 2I9VA 3WWXA 2C5WB 4S2IA 1VB6A 3EGXC 4KZ8A 3GTCA 1FILA 5DF9A 2Y2QA 5AQAA 5HZHA 3C4PA 3MKFA 3UPNA 3IF6B 2OAP1 2V8CA 2WK0A 5EOEA 2HDRA 4X55A 3UMEA 3HUOA 1NY0A 2D02A 3KSGA 3SS3A 4R4RA 5TGFA 4U0XA 3ZG8B 1J9MA 1CEGA 4EESA 3NCKA 3VE3A 2VV6A 4P6ZS 1P9RA 3DWZA 2VKSA 5FQQA 4CLCE 4CQHA 2WGWB 2B5RA 1SCWA 4UA7A 3CHWP 4IUHA 1TD5A 3BQ8A 3G2YA 3PR6A 3BLSA 4HP4A 5K5BA 1Z09A 1F5MA 3VMAA 5KIZA 3IH8A 3PBSA 1Y4OA 4F94A 2ZM2A 4GKUA 5AVFA 4Y0UA 4BLMA 3HREA 1VETA 2GDNA 2QJ7A 2A3UA 2Y2IA 4DRTA 3AGEA 1MC0A 1H8ZA 2QKPA 4R4SA 1STZA 3CITA 5A8BA 4DMZA 3RXXA 1EROA 1IKIA 4WMCD 5CERA 4JLFA 1XJ6A 5HSQA 3IWOA 3NI9A 3GSGA 3SH7A 1ACFA 2O9AA 4LCMA 3MQOA 1XGIA 2PYPA 5A93A 3LIFA 4MBKA 1JWZA 4S2NA 4I5SA 3MZFA 3LR4A 2Y8HA 3OCNA 2HGVA 5FEGA 2ZOIA 1X0OA 5F1FA 4ETXA 2E8JA 3K2NA 4P85A 3UE3A 4JKTA 3T12B 1EWZA 1A0KA 3S1YA 1G28A 4M4XA 4ARZA 2P08A 2X71A 4DN0A 5GHYA 3TOIA 3MXSA 3FKWA 1VETB 3Q82A 3PAEA 5DKKA 5FDHA 4EU0A 4OQ0A 4FH2A 2ZQ8A 2UWXA 3M2JA 3EEAA 4E6XA 1GSVA 2G7UA 3QP4A 4NXFA 5IU1A 1L2SA 3K3DA 4Z1WA 2OSUA 4OPQA 2KDKA 1MWSA 1S0WA 1YQSA 2W3HA 5HDSA 3B3XA 3OPHA 5E2EA 5GHZA 1GHMA 1NJ4A 3QNCA 3IX4A 1UWPX 3FC7A 4DDSA 3LR5A 4OVDA 3RXWA 4EQIA 3CJMA 4LRXC 5FL3A 2OWJA 3BW6A 2EFUA 1PYYA 3T4LA 2EX8A 4EBNA 5FAOA 2H28A 2V8FA 4GLQA 3U4LP 5F5YA 5CHMA 1OTIA 5FASA 4GHIA 2WKQA 4DF6A 1F98A 2Y2GA 3N7WA 4JPMA 3CZDA 4IJGA 2PU4A 4S2JA 4HEFA 4MN5A 4ESPA 1YLWA 2ZC5B 5C5KA 2BG1A 4YINA 4NK3A 4ZRRA 4KUKA 5FQ9A 1HD8A 5L10A 3KO6A 4IBRA 1P9WA 4R6LA 1IFQA 4ARZB 4WBGA 4PMAA 1BTLA 3W4PA 4QWOA 1MPLA 1CQAA 1O7EA 5HWVA 2EX9A 2WKHA 5CRFA 1CF0A 2QHKA 3HLGA 1Q2QA 2ZC6B 1FCNA 2K31A 3M2KA 3TE8A 1BT5A 5LBRA 5DJUA 1SZVA 3FPWA 4HHDA 3ZG7B 2UV0E 4YFMA 3G32A 2PD7A 3UDIA 2X02A 5TFQA 3QNBA 4OOLA 5GHXA 4EBPA 2J3TD 1DP6A 2ZJ9A 4HNBA 3S22A 2WKIA 4PKYA 1K6RA 4S2LA 5EUAA 4KZAA 5EVIC 4XUZA 3T4OA 1NZUA 4FH4A 2D01A 1I2SA 5JYOA 1PWCA 3BFCA 4GHIB 1LI0A 1ESUA 3CI6A 3T1RA 3UB6A 4WL9A 5E43A 1OPXA 3LIDA 3IHBA 3FKVA 3IH9A 4OPRA 1OTAA 2JC7A 2DRWA 1W5DA 2J8YA 1HTZA 1TS8A 4N1HA 4S2NC 3V50A 5GLBA 5HARA 1EW0A 2XA7M 2PR6A 4B4ZA 4E6WA 4RA7A 2ZQCA 1T1AA 3UN7A 1JVJA 2X01A 1OTEA 2VLGA 3G34A 4OOYA 3NBLA 2WADA 4Y2FA 1LLBA 3LUQA 2G2UA 3P7NA 4IVKA 1W63M 4PPRA 1PI4A 4I3JA 3OC2A 1ZHHB 3A3FA 4EERA 4O01A 1H8MA 1XFNA 3MS6A 3UY6A 4BENA 2JE5A 4OONA 1P0ZA 1PWGA 3IQAA 5CGWA 4FTXA 2J80A 3DAVA 4N1XA 3ZG0A 4E3MA 4G3WA 3E0YA 2PU2A 3BFDA 4AFIA 2DCFA 1W79A 1CI9A 2V1ZA 5F68A 4EWFA 1MWUA 1MBLA 2Y2PA 4P6ZM 3LIEA 2ZD8A 1U60A 3IWQA 1WYCA 1CJFA 1SHVA 3ZYTA 3HBRA 2ZC7A 1ES2A 3OCLA 1ZTUA 2EWVA 4CLCC 3G31A 5HPFA 3LO7A 2OOLA 2ZBBA 1DJBA 4QY5A 3LCEA 4KZ6A 3S4XA 2QPNA 1IOUA 5FQJA 4HH2A 2W3FA 2XFTA 1M40A 1AXBA 2NUTC 2JN7A 4S2MA 3MXQA 4XXRA 5IS1A 2WAEA 4UA6A 1KE3A 3GMWA 1UGUA 1DJCA 2QMIA 4I38A 5FDSA 2HF6A 2IWCA 3JYIA 4UHUA 1FSYA 4QJGA 1GCEA 4DDYA 3EGDC 2Y2MA 2Z2LB 4EQ1A 2XD5A 1Q2PA 1FSWA 3BECA 3CAXA 1H0MA 4HY8A 4RYEA 3RFBA 2IWBA 2V0WA 5HAIA 4OPZA 2PBYA 4O7DA 3SH9A 2WUQA 5DTTA 4BL3A 4KZ5A 2Y4AA 3UB9A 2ACGA 1S4SA 2W3DA 5EVEA 4HJ3A 2VX8A 4H8RA 4OP5A 4BQMA 4HP9A 3NOPC 1JWPA 4PM8A 4IBXA 3CG5A 4E3OA 2INWA 1ZG6A 1F9IA 3HL9A 1OTBA 5HFOA 3WS2A 4NXBA 3JVVA 4BBUA 3A0SA 2WAFA 4NXEA 2L0WA 3JPUA 1Z6FA 5I5LA 1PZOA 1S1YA 1DJAA 3ICYA 3ITAA 3HCYA 2BTFP 1PW8A 3ULFA 1Y54A 4WEKA 2GNXA 3MJQA 2H0YA 4Q0IA 1WE4A 2P9VA 3G35A 4KZ9A 5IHVA 1LSXA 4HBTA 1K38A 4JBFA 3ZCZA 3FPVA 4EETB 2EXBA 3T1SA 1K6SA 1E3UD 3ZFZA 3C2WA 3P01A 2Q0OA 3F1OA 3FYZA 5EECA 3N6IA 2Y2LA 3S7QA 4UEYA 3W4OA 3IT9A 2BLSA 2RL3A 4OKPA 1LSWA 5DTSA 2JKRI 4Y13A 5JYPA 1IYQA 1W7FA 3HLBA 5CGSA 5CGXA 2K7SA 2PHYA 5EE8A 1J3WA 2J3WA 5AQBA 2IA2A 2I72A 1XJ4A 1XA1A 4N9KA 1S6RA 3QP6A 4GN2A 1KE4A 4KQRA 3UE6A 4JGQA 4KQOA 5KSCA 4R70A 1PWDA 3O87A 1N9NA 5FQIA 5AVEA 1N9OA 4EV4A 2E8IA 2Y79A 1EI5A 4I39A 5HAPA 5EV0A 1NWZA 1Y28A 2ZC4B 3KSIA 1ZG4A 3MFXA 1XGJA 3UNWA 5M19A 4KQDA 3VFFA 5BOHA 4E3KA 1ERMA 1K56A 2P9VB 3NOTC 3S7PA 2VGLS 2EXAA 1YMSA 3WS4A 4WUJA 3VP1A 1O07A 4MNRA 3DW0A 2FZ0A 2QWSA 1KVMA 4R3AA 1FR1A 1F2KA 2PYRA 4UQIM 4DJ3A 3EQUA 3F1OB 3BY9A 4IUKA 1BSGA 5DFYA 5EVIA 4X56A 3KYQA 5HL6A 1HLUP 2XLNA 4CPKA 1T1BA 4MBFA 4Y3IA 2O99A 3ZNTA 1IYPA 1TEMA 2ZM0A 5EVLA 3NC8A 3QP5A 5FATA 5MC7A 3G6OA 4KENB 2GZAA 1T19A 4OLDA 5IT5A 2W3EA 3C7VA 3MMHA 2MJ6A 5I94A 4HJ4A 3OBFA 4WZ4A 1W63Q 2M7VA 2HP6A 5HL1A 4BMWA 3C30A 4HI4A 1MZUA 4HIAA 1H3QA 1MXOA 2ZMFA 3NULA 3UB7A 4H6JA 2WKEA 1ERQA 5DFXA 3LGOA 5F83A 2XROA 4GS9A 4C3QA 1YLPA 2G2WA 3PTEA 3DTKA 3LI8A 4X53A 1YAXA 3KYEA 4D2OA 1W8QA 4K91A 4LENA 3ZQ5A 4B88A 2HZ5A 1ESIA 3F1NA 3MZEA 3D4FA 2J7VA 4KG6A 5A90A 5HPIA 2VV8A 5EFWA 4RX3A 5EVIB 5E2FA 1YM1A 2OLVA 3L7HA 3IXBA 4FUWA 4OQIA 4L9EA 5HWTA 1GA0A 1K57A 3C8CA 4R38A 2HDQA 2ZQ9A 4OPYA 1ONHA 2WGIA 3MQQA 3LEQA 3ZDJA 3IXGA 3OPLA 3UPOA 3PXPA 1TDLA 3T4TA 4CLCA 4PM9A 3OLOA 1RCJA 5E2HA 3GDIA 2NUPC 1T1CA 4L9FA 4ME4A 4LV2A 4H6JB 1S4RA 5FSRA 4RX2A 2H10A 4HQAA 4DE0A 3V5MA 3W4QA 4GS9B 1NXYA 5TR7A 4LFUA 1DRMA 3OZHA 1LL8A 2VV7A 5GL9A 4Z9QA 1TF1A 2VJWA 1GA9A 2XD1A 5DF7A 3MZDA 3DTEA 2P7JA 4DXBA 3ZG9B 2VGKA 4GZBA 4K08A 3F1NB 1MWTA 2IWDA 4II7A 4L0LA 3T4QA 4S2OA 4ZTKA 1JTDA 4WELA 3FV7A 2DNSA 5CEDA 2R78A 1YLJA 3G4PA 5DTKA 4BL2A 5J7EA 5F1GA 3ITBA 4X1LA 1ODVA 3E4OA 4ZJ2A 3ZHHA 1GHPA 3BFFA 3MKEA 1DP8A 2AVXA 3KYZA 2Y2NA 3NOUC 3T1QB 3IX3A 5AQ9A 1PIOA 3NHQA 4GB7A 4B9OA 4NEED 4E3NA 4CLCB 3IX8A 4CJNA 4WN5A 3MR0A 2KOIA 4X25A 3NIAA 4I3AA 3KSFA 5FI6A 1D7EA 2O0YA 3DTIA 5FA7A 3GV9A 1TS0A 4ZJ1A 1K54A 2XSSA 4LGWA 5EOOA 2LB9A 3ZGAB 3MFDA 1MKMA 4I3IA 4EW7A 3D9YA 2V1AA 3H9WA 1TDGA 1D06A 5DF8A 4PM7A 4S2PA 1FOFA 3NDGA 3H7WA 4G3KA 1TVFA 1MY8A 3KX0X 4XT2A 3QP2A 2HDUA 2YKFA 2HV1A 5M1AA 5A92A 3SZTA 2Y2JA 3EOIA 2QYBA 1K4FA 1AWIA 1BZAA 1K0KA 3CWFA 2PDRA 1T18A 3IBJA 4R3JA 1VEUA 1KDSA 5CECA 1XPBA 1H8YA 4KUOA 4FSFA 4LV3A 1CK3A 3MF0A 4NXGA 4R1GA 3IXHA 3FZCA 3BLMA 5FEFA 4MLLA 3GVBA 3TG9A 4Y7PA 4JF4A 2W27A 1LT0A 4PHTA 1K57C 2XF3A 2Y55A 4KZ3A 2R9WA 1ONGA 1L0FA 2EFXA 5CTNA 1S66L 1RGZA 3PBTA 1XJ3A 3PBNA 1TS7A 1PNEA 1NRJA 4KZ4A 2V9AA 1K55A 5CX7A 2ZC3B 2ZLYA 2O9BA 3HLCA 4MN7A 3HLFA 4ZJ3A 3H7WB 4LLOB 1OMEA 4MDZA 4XT2B 2L1MA 4WZ5C 2EX6A 4Q8IA 4IVIA 4MBHA 4R0QA 4C6YA 1ALQA 4GDBA 3UB8A 2J3TC 4C75A 4WYYA 3NY4A 3HJKA 3V39A 2Z6DA 1FCOA 4XUXA 4HJ6A 5KMWA 1BULA 1XFQA 1VEUB 2J9PA 4E3LA 3HVFA 4G3VA 4OQGA 1ES5A 3LIBA 4GD6A 3BM6A 2V20A 3T50A 3Q07A 2Q9MA 3BFGA 3EQVA 1KDWA 4O8GA 1ES4A 1W8YA 3VSKA 1MKIA 2VGJA 5CTMA 2PD8A 2XR0A 3V3RA 3DTMA 1KGEA 2M7UA 1SKOA 1E3UA 3SW1A 3TSGA 1L0DA 3HUMA 2ZOHA 4Y15A 2QJ5A 3EEHA 2JBFA 3QP1A 1YSQA 3GR2A 3UPPA 3VP0A 4UA9A 2JHEA 4Q0JA 4DJ2A 4RQ9A 1OT6A 1K54C 4PM5A 4X69A 1BLHA 5U47A 3V3SA 3E4QA 5HDCA 1N9LA 3D3OA 1I2WA 1XJ2A 2EX2A 2OWHA 3JVUA 3ZVWA 3T1XA 3CUEA 3B47A 3O88A 1ZC2A 2XA7S 5AQ7A 4BD0A 5L07A 5FAPA 2VK3A 2ZMAA 4DKIA 3K3CA 3VV4A 4BWIA 5CHJA 3MQ0A 3C4OA 3T4JA 2OAQ1 5J8XA 1YLYA 5HD5A 3IWIA 3S7OA 2EWWA 3IF5A 1SKFA 4M3KA 1KOUA 4P0MA 3T4KA 2WKRA 3FG8A 3LY3A 2L4RA 2P04A 3LEZA 3A3JA 5FQKA 1YLTA 4LRZE 4MN6A 1PRQA 4ID4A 1BUEA 1SKOB 2ZQ7A 5EM0A 1G6AA 1L3LA 5HAQA 1ZKJA 3WRZA 4WMCA 3LYXA 1OJGA 2PAVP 1I5QA 4X1MA 2FFFB 4LRYC 4LV1A 3VFHA 3P98A 2HP9A 2W0NA 3R4KA 4NKPA 2DMWA 1IYSA 4S2KA 3LR0A 4Q0HA 3BRMA 3BWLA 1K55C 2PBDP 2Z6CA 1E4DA 2RCXA 2FH5A 2KX6A 4OQHA 5M18A 3BEBA 3HUNA 3WS1A 4E3JA 5L09A 5FI7A 4QHCA 3CPTA 2WZXA 3IBRA 4PAUA 3GECA 4GCZA 1OTDA 4JXVA 3M6BA 4R23A 5F6AA 2R9XA 1NLYA 1NRFA 1XX2A 4FOFA 4JXWA 4PKYG 3RTYA 1NYMA 3ISGA 3ZG5A 3LI9A 3PHYA 2WZZA 4WEJA 4D60A 3D72A 3N4IA 4QD4A 1RGYA 4PM6A 1NZOA 3LIAA 1K56D 1KVLA 3P09A 3IF6C 5F82A 3VOYA 1HZOA 5F69A 2Y2HA 4UAAA 4P6BA 5DJTA 4EUVA 3Q1FA 2QZ6A 2Y2OA 4NG2A 4GNUA 3PBRA 1BYWA 1PFLA 4QB8A 2Y91A 4MCWA 4EEPA 5EVID 3VE4A 1M6KA 2Y59A 4HOIA 1LSVA 4DE1A 1G68A 4YWZA 3BJNA 1IELA 4GJ4A 4EUZA 1DP9A 2FFYA 4X6TA 4BJPA 2YKHA 3F1PA 2ZM8A 4DE3A 2KLIA 3WS5A 1CI8A 3CPTB 1UWNX 3CUEC 5DVAA 1YPRA 3G2ZA 3SS4A 3W8KA 2XDMA 3TW8A 5TBMA 3ZVTA 3R7WA 3MSHA 3UDFA 3VP2A 2Q9NA 3A3IA 1SDEA 3W2ZA 5HWWA 3E2KA 3N8RA 3UDXA 1WA9A 3G30A 3PBOA 5G4YA 1GSWA 2VA0A 1LL9A 4OH0A 1S1ZA 2WGVA 3DWKA 3VSLA 2HJEA 3CLOA 2ZQAA 3UE1A 4Y0OA 1XP4A 1XKZA 3WS0A 3IS2A 2HPBA 1XA7A 2JKRM 3T4SA 4WZ5A 2VEAA 3C7UA 5EM1A 3UB5P 4BBTA 1HVBA 4EXOA 1ES3A 4JGOA 4ZBEA 3SH8A 1S67L 3PAGA 1YLZA 1KGFA 1C3BA 1D1JA 5FAQA 4Y17A 4R3BA 1WYBA 5G18A 1L0GA 3C38A 3U2AA 2B95A 4KG2A 3FWLA 1CEFA 1PI5A 3VOZA 3HLWA 4DE2A 3F1PB 5KSHA 4F3LA 2JKTI 2OLUA 3TJZC 4CLCD 4GDNA 4X68A 1KGGA 5TBMB 3UMDA 3SOIA 2XH9A 4E3IA 3R7WB 2A2LA 2CMNA 4HBUA 4UQIS 2H5SA 4KG5A 1VM1A 3VP3A 1MWRA 4U3TA 1YKDA 1VHMA 2HJ9C 3VP4A 1GHIA 5L8MA 3HLDA 4HESA 5HW3A 5GLDA 4Y0TA 2ZL1A 3IS2B 3MBZA 3NDEA 4JF5A 5DKLA 4O0PA 5CXWA 1XXMA 3MXRA 2M1CA 3AGDA 1YSPA 4QY6A
chains in the Genus database with same CATH topology
1XFQA 2PR5A 3EEAA 4R70A 1GSVA 2G7UA 4NXFA 5IU1A 4G3VA 1N9NA 3K3DA 5AVEA 4Z1WA 1N9OA 2KDKA 3LIBA 3EWKA 3S7NA 2Y79A 2W3HA 4I39A 1NWZA 1Y28A 3KSIA 5HDSA 3T50A 2BASA 3EQVA 3MFXA 4O8GA 4KQDA 1UWPX 3FC7A 2A24A 3LR5A 2LB5A 2B02A 3VOLA 1P97A 4LRXC 3NOTC 5FL3A 3S7PA 2OWJA 2VGLS 3BW6A 2PD8A 1TS6A 4F3LB 4WUJA 3T4LA 2FZ0A 2QWSA 4R3AA 4L9GA 5G4ZA 2H28A 4GLQA 4Y5FA 2M7UA 3A0RA 5HD3A 5F5YA 3SW1A 2PYRA 4UQIM 4DJ3A 1OTIA 3EQUA 2ZOHA 3F1OB 4GHIA 3BY9A 2QJ5A 2WKQA 3EEHA 4IUKA 1YSQA 5DFYA 5HL6A 1F98A 3KYQA 1T1BA 4IJGA 4Y3IA 2O99A 2JHEA 4Q0JA 4DJ2A 4RQ9A 4LPZA 4MN5A 1OT6A 5C5KA 5MC7A 3G6OA 3B42A 4IHQA 2GZAA 4ZRRA 1JNUA 1T19A 2PT7A 4KUKA 3KO6A 5IT5A 3E4QA 5HDCA 1N9LA 2W3EA 5J4EA 3D3OA 1P9WA 4R6LA 1IFQA 5HDDA 4ARZB 3MMHA 1XJ2A 2MJ6A 3H82A 2OWHA 3JVUA 4HJ4A 3CUEA 3OBFA 3B47A 1W63Q 2M7VA 5HWVA 5TJJA 4GW9A 2XA7S 4BMWA 2VZWA 3C30A 4HI4A 1MZUA 2EA9A 4QPRA 4HIAA 1H3QA 2QHKA 3K3CA 3VV4A 2K31A 4BWIA 3TE8A 3MQ0A 2ZMFA 2W1TA 3T4JA 2OAQ1 5LBRA 5DJUA 3FPWA 3UB7A 4H6JA 4HHDA 4BBVA 4YNRA 5HD5A 5DFXA 2PD7A 3S7OA 1NLZA 2EWWA 2XROA 4GS9A 3LICA 3V67A 3RH8B 1KOUA 4OOLA 2VGLM 1GSXA 3T4KA 2WKRA 2A24B 2J3TD 1DP6A 3FG8A 3LI8A 4HNBA 2L4RA 3DBAA 1YAXA 2P04A 4PKYA 3E98A 4B93A 3T4OA 4LRZE 4MN6A 2V0UA 3ZQ5A 4OOMA 3A0VA 3F1NA 2ZMVA 4WF0A 4YOFA 2D01A 5HPIA 2VV8A 2W1RA 4GHIB 5EFWA 3PBQA 3HJIA 3CI6A 3LYXA 3UB6A 1OJGA 4WL9A 1OPXA 3LIDA 1OTAA 3BY8A 4LRYC 4L9EA 5HWTA 3C8CA 1V9ZA 2JKTM 1TS8A 4HH3A 4R38A 2W0NA 3NJAA 3R4KA 4NKPA 4EEUA 1G6OA 2DMWA 3LFVA 4E04A 1OJ5A 3MQQA 3LR0A 4Q0HA 3BWLA 4MMNA 1EW0A 2XA7M 2PR6A 3H82B 2W3GA 4JGPA 3PXPA 3T4TA 1T1AA 4CLCA 2Z6CA 3OLOA 2FH5A 1OTEA 2KX6A 2VLGA 2XRNA 4ETZA 4Y2FA 3LUQA 2K2NA 3GDIA 2NUPC 3P7NA 1V9YA 1T1CA 1W63M 4L9FA 4ME4A 4I3JA 3OC2A 1ZHHB 2W1TB 5J3WA 1OT9A 4EERA 2O9CA 1S4RA 4H6JB 3IBRA 4PAUA 3GECA 4GCZA 1OTDA 4HQAA 1H8MA 4O01A 1XFNA 4WLAA 1P0ZA 5AJGA 5F6AA 4GS9B 1NLYA 2V1BA 2GJ3A 2GX5A 1DRMA 2J80A 1LL8A 2WKPA 2VV7A 3KSHA 4FOFA 4PKYG 1TF1A 2VJWA 3OOVA 4G3WA 3RTYA 3TRCA 3E0YA 3E4PA 2P7JA 2B18A 3LI9A 4AFIA 3PHYA 3O5YA 4WEJA 4JGRA 3BQAA 4K08A 5F68A 3F1NB 3D72A 3B33A 4P6ZM 4II7A 3LR3A 4L0LA 3LIEA 3T4QA 3LIAA 4WELA 3PYPA 2I9VA 5F69A 2R78A 5J7EA 5DJTA 4EUVA 1VB6A 3EGXC 1ODVA 3ZYTA 3E4OA 3OCLA 1ZTUA 2EWVA 5DF9A 4CLCC 5HPFA 3PBRA 1BYWA 2OOLA 2ZBBA 5HZHA 4MCWA 1DP8A 3KYZA 3NOUC 4EEPA 1IOUA 2OAP1 4HH2A 2W3FA 3VE4A 3NHQA 4HOIA 1LSVA 3UMEA 4B9OA 2NUTC 2JN7A 4NEED 3MXQA 4CLCB 2D02A 3BJNA 3KSGA 4YWZA 5IS1A 4GJ4A 1DP9A 1UGUA 4WN5A 3MR0A 4I38A 2KOIA 4BJPA 2HF6A 2YKHA 3F1PA 4I3AA 4EESA 3VE3A 3KSFA 1D7EA 2O0YA 2KLIA 2VV6A 3EGDC 4P6ZS 1P9RA 1TS0A 4EQ1A 2VKSA 2XSSA 4CLCE 4CQHA 1UWNX 2LB9A 3CUEC 1MKMA 4I3IA 3CAXA 3TW8A 4EW7A 5TBMA 2V1AA 4HY8A 3RFBA 3H9WA 3R7WA 4IUHA 2V0WA 1D06A 1TD5A 3W2ZA 3BQ8A 5HWWA 3PR6A 1WA9A 3H7WA 3PBOA 4HP4A 3UB9A 5G4YA 4G3KA 1GSWA 2VA0A 5K5BA 1S1ZA 3KX0X 1S4SA 2W3DA 1F5MA 4XT2A 2HJEA 5KIZA 2YKFA 3PBSA 2HV1A 3CLOA 4HJ3A 2VX8A 5AVFA 3EOIA 2QYBA 3NOPC 4HP9A 3IS2A 2QJ7A 3CWFA 2PDRA 2JKRM 3T4SA 1T18A 2INWA 3IBJA 1F9IA 1MC0A 2VEAA 1OTBA 4BBUA 4NXBA 3JVVA 4BBTA 4EXOA 2QKPA 3A0SA 1STZA 3CITA 4KUOA 4FSFA 4NXEA 5A8BA 4JGOA 2L0WA 4DMZA 3MF0A 4NXGA 1S67L 5I5LA 1S1YA 3ICYA 3HCYA 1XJ6A 5HSQA 3ULFA 4WEKA 2GNXA 3C38A 2W27A 1LT0A 3MJQA 4PHTA 3U2AA 4Q0IA 3F1PB 5KSHA 1LSXA 2O9AA 4F3LA 2JKTI 3TJZC 3MQOA 1S66L 2PYPA 3FPVA 3PBTA 1XJ3A 4CLCD 4EETB 3LIFA 3PBNA 1TS7A 3C2WA 3P01A 3F1OA 1NRJA 4I5SA 5TBMB 3UMDA 2V9AA 3LR4A 2Y8HA 3R7WB 2A2LA 2CMNA 3OCNA 2HGVA 4UQIS 5CX7A 2O9BA 2ZOIA 4MN7A 4UEYA 3S7QA 1X0OA 4ETXA 3H7WB 4LLOB 4MDZA 3K2NA 1LSWA 3UE3A 2JKRI 4XT2B 2L1MA 1YKDA 1VHMA 2HJ9C 1G28A 4M4XA 2K7SA 2PHYA 5L8MA 4ARZA 3UB8A 2J3WA 2P08A 2J3TC 4DN0A 2IA2A 1XJ4A 3HJKA 3IS2B 4O0PA 5DKKA 2Z6DA 5DKLA 4HJ6A 4EU0A 2M1CA 3UE6A 1YSPA 4JGQA 4KQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3Q A;  3CUE A;  3CUE C;  2ZMV A;  2J3W A;  2J3T D;  3PR6 A;  2J3T C; 
#chains in the Genus database with same CATH topology
 2PR5 A;  3WRT A;  5E2G A;  3QP8 A;  1FCM A;  4B4X A;  1YT4 A;  2ZQD A;  5CHU A;  2J9O A;  3S7N A;  1IYO A;  3EWK A;  4LCL A;  3OPP A;  3Q7Z A;  2BAS A;  1FIK A;  2JKG A;  4NET A;  2JKF A;  3UO9 A;  4N9L A;  4K0X A;  3UE0 A;  2A49 A;  3N8L A;  2A24 A;  4FCF A;  3GQZ A;  2LB5 A;  2B02 A;  1L0E A;  1P97 A;  3VOL A;  3GRJ A;  5GLA A;  1YMX A;  1TS6 A;  4F3L B;  4L9G A;  5G4Z A;  3IXD A;  4Y5F A;  3A0R A;  5HD3 A;  1H5X A;  3ZNY A;  4GOG A;  4ZAM A;  4K0W A;  5GLC A;  4LPZ A;  4GD8 A;  3B42 A;  4IHQ A;  1JNU A;  1PW1 A;  2PT7 A;  1IEM A;  5J4E A;  3QHY A;  4OLG A;  4RVA A;  5HDD A;  1G5U A;  3Q81 A;  1BLP A;  3H82 A;  4FD8 A;  2ZL1 B;  1LL5 A;  1E25 A;  2XEP A;  4EBL A;  5TJJ A;  4GW9 A;  3N8S A;  2C6W B;  3IHA A;  2VZW A;  2EA9 A;  5A91 A;  4QPR A;  4WM9 A;  1QME A;  1RP5 A;  2W1T A;  4ZDX A;  5HX9 A;  4BD1 A;  1PZP A;  5EPH A;  1VQQ A;  4BBV A;  4YNR A;  1N4O A;  1SDN A;  2Z2M B;  1BLC A;  1NLZ A;  3C5A A;  3NEC A;  3LIC A;  3V67 A;  5FI2 A;  4U0T A;  3E2L A;  3RH8 B;  1KE0 A;  2VGL M;  1GSX A;  1JWV A;  2A24 B;  4DXC A;  3DBA A;  3Q7V A;  2HDS A;  3E98 A;  4B93 A;  4JXS A;  1DY6 A;  1JTG A;  3O3V A;  5KZH A;  2V0U A;  2V2F F;  4KQQ A;  1IKG A;  3A3E A;  4P87 A;  3A0V A;  4OOM A;  2ZMV A;  3M6H A;  4WF0 A;  4YOF A;  2W1R A;  2Y2K A;  3PBQ A;  3L9K A;  3HJI A;  3BY8 A;  2OV5 A;  3AGF A;  4OP8 A;  1FR6 A;  1V9Z A;  2JKT M;  4HH3 A;  4IED A;  3NJA A;  4EEU A;  2XGN A;  1G6O A;  3IF6 A;  3LFV A;  3RJU A;  1OJ5 A;  4E04 A;  1N9B A;  3HLE A;  4MMN A;  3H82 B;  1FQG A;  2W3G A;  4A5R A;  3OPR A;  4JGP A;  5L2F A;  4KZ7 A;  5FQM A;  2XRN A;  4ETZ A;  2HP5 A;  2K2N A;  3LY4 A;  1QMF A;  1V9Y A;  1NYY A;  3BFE A;  2JCH A;  3O86 A;  4JXG A;  2W1T B;  2XFS A;  5J3W A;  1OT9 A;  2H0T A;  2O9C A;  2WGW A;  3CMZ A;  4WLA A;  5D3O A;  4LV0 A;  3BYD A;  5CEB A;  2P74 A;  4N92 A;  1K4E A;  4MEZ A;  5AJG A;  3A3D A;  2V1B A;  1K25 A;  2GJ3 A;  2GX5 A;  2WKP A;  3I7J A;  4JF6 A;  3SS5 A;  4KZB A;  3KSH A;  2XQZ A;  3Q7V B;  3OOV A;  2PRF A;  4QU3 A;  3TRC A;  3E4P A;  2CC1 A;  2B18 A;  1BLS A;  3O5Y A;  4JGR A;  3BQA A;  3B33 A;  2XK1 A;  3LR3 A;  1LI9 A;  2WYX A;  1LHY A;  3PYP A;  2I9V A;  3WWX A;  2C5W B;  4S2I A;  1VB6 A;  3EGX C;  4KZ8 A;  3GTC A;  1FIL A;  5DF9 A;  2Y2Q A;  5AQA A;  5HZH A;  3C4P A;  3MKF A;  3UPN A;  3IF6 B;  2OAP 1;  2V8C A;  2WK0 A;  5EOE A;  2HDR A;  4X55 A;  3UME A;  3HUO A;  1NY0 A;  2D02 A;  3KSG A;  3SS3 A;  4R4R A;  5TGF A;  4U0X A;  3ZG8 B;  1J9M A;  1CEG A;  4EES A;  3NCK A;  3VE3 A;  2VV6 A;  4P6Z S;  1P9R A;  3DWZ A;  2VKS A;  5FQQ A;  4CLC E;  4CQH A;  2WGW B;  2B5R A;  1SCW A;  4UA7 A;  3CHW P;  4IUH A;  1TD5 A;  3BQ8 A;  3G2Y A;  3PR6 A;  3BLS A;  4HP4 A;  5K5B A;  1Z09 A;  1F5M A;  3VMA A;  5KIZ A;  3IH8 A;  3PBS A;  1Y4O A;  4F94 A;  2ZM2 A;  4GKU A;  5AVF A;  4Y0U A;  4BLM A;  3HRE A;  1VET A;  2GDN A;  2QJ7 A;  2A3U A;  2Y2I A;  4DRT A;  3AGE A;  1MC0 A;  1H8Z A;  2QKP A;  4R4S A;  1STZ A;  3CIT A;  5A8B A;  4DMZ A;  3RXX A;  1ERO A;  1IKI A;  4WMC D;  5CER A;  4JLF A;  1XJ6 A;  5HSQ A;  3IWO A;  3NI9 A;  3GSG A;  3SH7 A;  1ACF A;  2O9A A;  4LCM A;  3MQO A;  1XGI A;  2PYP A;  5A93 A;  3LIF A;  4MBK A;  1JWZ A;  4S2N A;  4I5S A;  3MZF A;  3LR4 A;  2Y8H A;  3OCN A;  2HGV A;  5FEG A;  2ZOI A;  1X0O A;  5F1F A;  4ETX A;  2E8J A;  3K2N A;  4P85 A;  3UE3 A;  4JKT A;  3T12 B;  1EWZ A;  1A0K A;  3S1Y A;  1G28 A;  4M4X A;  4ARZ A;  2P08 A;  2X71 A;  4DN0 A;  5GHY A;  3TOI A;  3MXS A;  3FKW A;  1VET B;  3Q82 A;  3PAE A;  5DKK A;  5FDH A;  4EU0 A;  4OQ0 A;  4FH2 A;  2ZQ8 A;  2UWX A;  3M2J A;  3EEA A;  4E6X A;  1GSV A;  2G7U A;  3QP4 A;  4NXF A;  5IU1 A;  1L2S A;  3K3D A;  4Z1W A;  2OSU A;  4OPQ A;  2KDK A;  1MWS A;  1S0W A;  1YQS A;  2W3H A;  5HDS A;  3B3X A;  3OPH A;  5E2E A;  5GHZ A;  1GHM A;  1NJ4 A;  3QNC A;  3IX4 A;  1UWP X;  3FC7 A;  4DDS A;  3LR5 A;  4OVD A;  3RXW A;  4EQI A;  3CJM A;  4LRX C;  5FL3 A;  2OWJ A;  3BW6 A;  2EFU A;  1PYY A;  3T4L A;  2EX8 A;  4EBN A;  5FAO A;  2H28 A;  2V8F A;  4GLQ A;  3U4L P;  5F5Y A;  5CHM A;  1OTI A;  5FAS A;  4GHI A;  2WKQ A;  4DF6 A;  1F98 A;  2Y2G A;  3N7W A;  4JPM A;  3CZD A;  4IJG A;  2PU4 A;  4S2J A;  4HEF A;  4MN5 A;  4ESP A;  1YLW A;  2ZC5 B;  5C5K A;  2BG1 A;  4YIN A;  4NK3 A;  4ZRR A;  4KUK A;  5FQ9 A;  1HD8 A;  5L10 A;  3KO6 A;  4IBR A;  1P9W A;  4R6L A;  1IFQ A;  4ARZ B;  4WBG A;  4PMA A;  1BTL A;  3W4P A;  4QWO A;  1MPL A;  1CQA A;  1O7E A;  5HWV A;  2EX9 A;  2WKH A;  5CRF A;  1CF0 A;  2QHK A;  3HLG A;  1Q2Q A;  2ZC6 B;  1FCN A;  2K31 A;  3M2K A;  3TE8 A;  1BT5 A;  5LBR A;  5DJU A;  1SZV A;  3FPW A;  4HHD A;  3ZG7 B;  2UV0 E;  4YFM A;  3G32 A;  2PD7 A;  3UDI A;  2X02 A;  5TFQ A;  3QNB A;  4OOL A;  5GHX A;  4EBP A;  2J3T D;  1DP6 A;  2ZJ9 A;  4HNB A;  3S22 A;  2WKI A;  4PKY A;  1K6R A;  4S2L A;  5EUA A;  4KZA A;  5EVI C;  4XUZ A;  3T4O A;  1NZU A;  4FH4 A;  2D01 A;  1I2S A;  5JYO A;  1PWC A;  3BFC A;  4GHI B;  1LI0 A;  1ESU A;  3CI6 A;  3T1R A;  3UB6 A;  4WL9 A;  5E43 A;  1OPX A;  3LID A;  3IHB A;  3FKV A;  3IH9 A;  4OPR A;  1OTA A;  2JC7 A;  2DRW A;  1W5D A;  2J8Y A;  1HTZ A;  1TS8 A;  4N1H A;  4S2N C;  3V50 A;  5GLB A;  5HAR A;  1EW0 A;  2XA7 M;  2PR6 A;  4B4Z A;  4E6W A;  4RA7 A;  2ZQC A;  1T1A A;  3UN7 A;  1JVJ A;  2X01 A;  1OTE A;  2VLG A;  3G34 A;  4OOY A;  3NBL A;  2WAD A;  4Y2F A;  1LLB A;  3LUQ A;  2G2U A;  3P7N A;  4IVK A;  1W63 M;  4PPR A;  1PI4 A;  4I3J A;  3OC2 A;  1ZHH B;  3A3F A;  4EER A;  4O01 A;  1H8M A;  1XFN A;  3MS6 A;  3UY6 A;  4BEN A;  2JE5 A;  4OON A;  1P0Z A;  1PWG A;  3IQA A;  5CGW A;  4FTX A;  2J80 A;  3DAV A;  4N1X A;  3ZG0 A;  4E3M A;  4G3W A;  3E0Y A;  2PU2 A;  3BFD A;  4AFI A;  2DCF A;  1W79 A;  1CI9 A;  2V1Z A;  5F68 A;  4EWF A;  1MWU A;  1MBL A;  2Y2P A;  4P6Z M;  3LIE A;  2ZD8 A;  1U60 A;  3IWQ A;  1WYC A;  1CJF A;  1SHV A;  3ZYT A;  3HBR A;  2ZC7 A;  1ES2 A;  3OCL A;  1ZTU A;  2EWV A;  4CLC C;  3G31 A;  5HPF A;  3LO7 A;  2OOL A;  2ZBB A;  1DJB A;  4QY5 A;  3LCE A;  4KZ6 A;  3S4X A;  2QPN A;  1IOU A;  5FQJ A;  4HH2 A;  2W3F A;  2XFT A;  1M40 A;  1AXB A;  2NUT C;  2JN7 A;  4S2M A;  3MXQ A;  4XXR A;  5IS1 A;  2WAE A;  4UA6 A;  1KE3 A;  3GMW A;  1UGU A;  1DJC A;  2QMI A;  4I38 A;  5FDS A;  2HF6 A;  2IWC A;  3JYI A;  4UHU A;  1FSY A;  4QJG A;  1GCE A;  4DDY A;  3EGD C;  2Y2M A;  2Z2L B;  4EQ1 A;  2XD5 A;  1Q2P A;  1FSW A;  3BEC A;  3CAX A;  1H0M A;  4HY8 A;  4RYE A;  3RFB A;  2IWB A;  2V0W A;  5HAI A;  4OPZ A;  2PBY A;  4O7D A;  3SH9 A;  2WUQ A;  5DTT A;  4BL3 A;  4KZ5 A;  2Y4A A;  3UB9 A;  2ACG A;  1S4S A;  2W3D A;  5EVE A;  4HJ3 A;  2VX8 A;  4H8R A;  4OP5 A;  4BQM A;  4HP9 A;  3NOP C;  1JWP A;  4PM8 A;  4IBX A;  3CG5 A;  4E3O A;  2INW A;  1ZG6 A;  1F9I A;  3HL9 A;  1OTB A;  5HFO A;  3WS2 A;  4NXB A;  3JVV A;  4BBU A;  3A0S A;  2WAF A;  4NXE A;  2L0W A;  3JPU A;  1Z6F A;  5I5L A;  1PZO A;  1S1Y A;  1DJA A;  3ICY A;  3ITA A;  3HCY A;  2BTF P;  1PW8 A;  3ULF A;  1Y54 A;  4WEK A;  2GNX A;  3MJQ A;  2H0Y A;  4Q0I A;  1WE4 A;  2P9V A;  3G35 A;  4KZ9 A;  5IHV A;  1LSX A;  4HBT A;  1K38 A;  4JBF A;  3ZCZ A;  3FPV A;  4EET B;  2EXB A;  3T1S A;  1K6S A;  1E3U D;  3ZFZ A;  3C2W A;  3P01 A;  2Q0O A;  3F1O A;  3FYZ A;  5EEC A;  3N6I A;  2Y2L A;  3S7Q A;  4UEY A;  3W4O A;  3IT9 A;  2BLS A;  2RL3 A;  4OKP A;  1LSW A;  5DTS A;  2JKR I;  4Y13 A;  5JYP A;  1IYQ A;  1W7F A;  3HLB A;  5CGS A;  5CGX A;  2K7S A;  2PHY A;  5EE8 A;  1J3W A;  2J3W A;  5AQB A;  2IA2 A;  2I72 A;  1XJ4 A;  1XA1 A;  4N9K A;  1S6R A;  3QP6 A;  4GN2 A;  1KE4 A;  4KQR A;  3UE6 A;  4JGQ A;  4KQO A;  5KSC A;  4R70 A;  1PWD A;  3O87 A;  1N9N A;  5FQI A;  5AVE A;  1N9O A;  4EV4 A;  2E8I A;  2Y79 A;  1EI5 A;  4I39 A;  5HAP A;  5EV0 A;  1NWZ A;  1Y28 A;  2ZC4 B;  3KSI A;  1ZG4 A;  3MFX A;  1XGJ A;  3UNW A;  5M19 A;  4KQD A;  3VFF A;  5BOH A;  4E3K A;  1ERM A;  1K56 A;  2P9V B;  3NOT C;  3S7P A;  2VGL S;  2EXA A;  1YMS A;  3WS4 A;  4WUJ A;  3VP1 A;  1O07 A;  4MNR A;  3DW0 A;  2FZ0 A;  2QWS A;  1KVM A;  4R3A A;  1FR1 A;  1F2K A;  2PYR A;  4UQI M;  4DJ3 A;  3EQU A;  3F1O B;  3BY9 A;  4IUK A;  1BSG A;  5DFY A;  5EVI A;  4X56 A;  3KYQ A;  5HL6 A;  1HLU P;  2XLN A;  4CPK A;  1T1B A;  4MBF A;  4Y3I A;  2O99 A;  3ZNT A;  1IYP A;  1TEM A;  2ZM0 A;  5EVL A;  3NC8 A;  3QP5 A;  5FAT A;  5MC7 A;  3G6O A;  4KEN B;  2GZA A;  1T19 A;  4OLD A;  5IT5 A;  2W3E A;  3C7V A;  3MMH A;  2MJ6 A;  5I94 A;  4HJ4 A;  3OBF A;  4WZ4 A;  1W63 Q;  2M7V A;  2HP6 A;  5HL1 A;  4BMW A;  3C30 A;  4HI4 A;  1MZU A;  4HIA A;  1H3Q A;  1MXO A;  2ZMF A;  3NUL A;  3UB7 A;  4H6J A;  2WKE A;  1ERQ A;  5DFX A;  3LGO A;  5F83 A;  2XRO A;  4GS9 A;  4C3Q A;  1YLP A;  2G2W A;  3PTE A;  3DTK A;  3LI8 A;  4X53 A;  1YAX A;  3KYE A;  4D2O A;  1W8Q A;  4K91 A;  4LEN A;  3ZQ5 A;  4B88 A;  2HZ5 A;  1ESI A;  3F1N A;  3MZE A;  3D4F A;  2J7V A;  4KG6 A;  5A90 A;  5HPI A;  2VV8 A;  5EFW A;  4RX3 A;  5EVI B;  5E2F A;  1YM1 A;  2OLV A;  3L7H A;  3IXB A;  4FUW A;  4OQI A;  4L9E A;  5HWT A;  1GA0 A;  1K57 A;  3C8C A;  4R38 A;  2HDQ A;  2ZQ9 A;  4OPY A;  1ONH A;  2WGI A;  3MQQ A;  3LEQ A;  3ZDJ A;  3IXG A;  3OPL A;  3UPO A;  3PXP A;  1TDL A;  3T4T A;  4CLC A;  4PM9 A;  3OLO A;  1RCJ A;  5E2H A;  3GDI A;  2NUP C;  1T1C A;  4L9F A;  4ME4 A;  4LV2 A;  4H6J B;  1S4R A;  5FSR A;  4RX2 A;  2H10 A;  4HQA A;  4DE0 A;  3V5M A;  3W4Q A;  4GS9 B;  1NXY A;  5TR7 A;  4LFU A;  1DRM A;  3OZH A;  1LL8 A;  2VV7 A;  5GL9 A;  4Z9Q A;  1TF1 A;  2VJW A;  1GA9 A;  2XD1 A;  5DF7 A;  3MZD A;  3DTE A;  2P7J A;  4DXB A;  3ZG9 B;  2VGK A;  4GZB A;  4K08 A;  3F1N B;  1MWT A;  2IWD A;  4II7 A;  4L0L A;  3T4Q A;  4S2O A;  4ZTK A;  1JTD A;  4WEL A;  3FV7 A;  2DNS A;  5CED A;  2R78 A;  1YLJ A;  3G4P A;  5DTK A;  4BL2 A;  5J7E A;  5F1G A;  3ITB A;  4X1L A;  1ODV A;  3E4O A;  4ZJ2 A;  3ZHH A;  1GHP A;  3BFF A;  3MKE A;  1DP8 A;  2AVX A;  3KYZ A;  2Y2N A;  3NOU C;  3T1Q B;  3IX3 A;  5AQ9 A;  1PIO A;  3NHQ A;  4GB7 A;  4B9O A;  4NEE D;  4E3N A;  4CLC B;  3IX8 A;  4CJN A;  4WN5 A;  3MR0 A;  2KOI A;  4X25 A;  3NIA A;  4I3A A;  3KSF A;  5FI6 A;  1D7E A;  2O0Y A;  3DTI A;  5FA7 A;  3GV9 A;  1TS0 A;  4ZJ1 A;  1K54 A;  2XSS A;  4LGW A;  5EOO A;  2LB9 A;  3ZGA B;  3MFD A;  1MKM A;  4I3I A;  4EW7 A;  3D9Y A;  2V1A A;  3H9W A;  1TDG A;  1D06 A;  5DF8 A;  4PM7 A;  4S2P A;  1FOF A;  3NDG A;  3H7W A;  4G3K A;  1TVF A;  1MY8 A;  3KX0 X;  4XT2 A;  3QP2 A;  2HDU A;  2YKF A;  2HV1 A;  5M1A A;  5A92 A;  3SZT A;  2Y2J A;  3EOI A;  2QYB A;  1K4F A;  1AWI A;  1BZA A;  1K0K A;  3CWF A;  2PDR A;  1T18 A;  3IBJ A;  4R3J A;  1VEU A;  1KDS A;  5CEC A;  1XPB A;  1H8Y A;  4KUO A;  4FSF A;  4LV3 A;  1CK3 A;  3MF0 A;  4NXG A;  4R1G A;  3IXH A;  3FZC A;  3BLM A;  5FEF A;  4MLL A;  3GVB A;  3TG9 A;  4Y7P A;  4JF4 A;  2W27 A;  1LT0 A;  4PHT A;  1K57 C;  2XF3 A;  2Y55 A;  4KZ3 A;  2R9W A;  1ONG A;  1L0F A;  2EFX A;  5CTN A;  1S66 L;  1RGZ A;  3PBT A;  1XJ3 A;  3PBN A;  1TS7 A;  1PNE A;  1NRJ A;  4KZ4 A;  2V9A A;  1K55 A;  5CX7 A;  2ZC3 B;  2ZLY A;  2O9B A;  3HLC A;  4MN7 A;  3HLF A;  4ZJ3 A;  3H7W B;  4LLO B;  1OME A;  4MDZ A;  4XT2 B;  2L1M A;  4WZ5 C;  2EX6 A;  4Q8I A;  4IVI A;  4MBH A;  4R0Q A;  4C6Y A;  1ALQ A;  4GDB A;  3UB8 A;  2J3T C;  4C75 A;  4WYY A;  3NY4 A;  3HJK A;  3V39 A;  2Z6D A;  1FCO A;  4XUX A;  4HJ6 A;  5KMW A;  1BUL A;  1XFQ A;  1VEU B;  2J9P A;  4E3L A;  3HVF A;  4G3V A;  4OQG A;  1ES5 A;  3LIB A;  4GD6 A;  3BM6 A;  2V20 A;  3T50 A;  3Q07 A;  2Q9M A;  3BFG A;  3EQV A;  1KDW A;  4O8G A;  1ES4 A;  1W8Y A;  3VSK A;  1MKI A;  2VGJ A;  5CTM A;  2PD8 A;  2XR0 A;  3V3R A;  3DTM A;  1KGE A;  2M7U A;  1SKO A;  1E3U A;  3SW1 A;  3TSG A;  1L0D A;  3HUM A;  2ZOH A;  4Y15 A;  2QJ5 A;  3EEH A;  2JBF A;  3QP1 A;  1YSQ A;  3GR2 A;  3UPP A;  3VP0 A;  4UA9 A;  2JHE A;  4Q0J A;  4DJ2 A;  4RQ9 A;  1OT6 A;  1K54 C;  4PM5 A;  4X69 A;  1BLH A;  5U47 A;  3V3S A;  3E4Q A;  5HDC A;  1N9L A;  3D3O A;  1I2W A;  1XJ2 A;  2EX2 A;  2OWH A;  3JVU A;  3ZVW A;  3T1X A;  3CUE A;  3B47 A;  3O88 A;  1ZC2 A;  2XA7 S;  5AQ7 A;  4BD0 A;  5L07 A;  5FAP A;  2VK3 A;  2ZMA A;  4DKI A;  3K3C A;  3VV4 A;  4BWI A;  5CHJ A;  3MQ0 A;  3C4O A;  3T4J A;  2OAQ 1;  5J8X A;  1YLY A;  5HD5 A;  3IWI A;  3S7O A;  2EWW A;  3IF5 A;  1SKF A;  4M3K A;  1KOU A;  4P0M A;  3T4K A;  2WKR A;  3FG8 A;  3LY3 A;  2L4R A;  2P04 A;  3LEZ A;  3A3J A;  5FQK A;  1YLT A;  4LRZ E;  4MN6 A;  1PRQ A;  4ID4 A;  1BUE A;  1SKO B;  2ZQ7 A;  5EM0 A;  1G6A A;  1L3L A;  5HAQ A;  1ZKJ A;  3WRZ A;  4WMC A;  3LYX A;  1OJG A;  2PAV P;  1I5Q A;  4X1M A;  2FFF B;  4LRY C;  4LV1 A;  3VFH A;  3P98 A;  2HP9 A;  2W0N A;  3R4K A;  4NKP A;  2DMW A;  1IYS A;  4S2K A;  3LR0 A;  4Q0H A;  3BRM A;  3BWL A;  1K55 C;  2PBD P;  2Z6C A;  1E4D A;  2RCX A;  2FH5 A;  2KX6 A;  4OQH A;  5M18 A;  3BEB A;  3HUN A;  3WS1 A;  4E3J A;  5L09 A;  5FI7 A;  4QHC A;  3CPT A;  2WZX A;  3IBR A;  4PAU A;  3GEC A;  4GCZ A;  1OTD A;  4JXV A;  3M6B A;  4R23 A;  5F6A A;  2R9X A;  1NLY A;  1NRF A;  1XX2 A;  4FOF A;  4JXW A;  4PKY G;  3RTY A;  1NYM A;  3ISG A;  3ZG5 A;  3LI9 A;  3PHY A;  2WZZ A;  4WEJ A;  4D60 A;  3D72 A;  3N4I A;  4QD4 A;  1RGY A;  4PM6 A;  1NZO A;  3LIA A;  1K56 D;  1KVL A;  3P09 A;  3IF6 C;  5F82 A;  3VOY A;  1HZO A;  5F69 A;  2Y2H A;  4UAA A;  4P6B A;  5DJT A;  4EUV A;  3Q1F A;  2QZ6 A;  2Y2O A;  4NG2 A;  4GNU A;  3PBR A;  1BYW A;  1PFL A;  4QB8 A;  2Y91 A;  4MCW A;  4EEP A;  5EVI D;  3VE4 A;  1M6K A;  2Y59 A;  4HOI A;  1LSV A;  4DE1 A;  1G68 A;  4YWZ A;  3BJN A;  1IEL A;  4GJ4 A;  4EUZ A;  1DP9 A;  2FFY A;  4X6T A;  4BJP A;  2YKH A;  3F1P A;  2ZM8 A;  4DE3 A;  2KLI A;  3WS5 A;  1CI8 A;  3CPT B;  1UWN X;  3CUE C;  5DVA A;  1YPR A;  3G2Z A;  3SS4 A;  3W8K A;  2XDM A;  3TW8 A;  5TBM A;  3ZVT A;  3R7W A;  3MSH A;  3UDF A;  3VP2 A;  2Q9N A;  3A3I A;  1SDE A;  3W2Z A;  5HWW A;  3E2K A;  3N8R A;  3UDX A;  1WA9 A;  3G30 A;  3PBO A;  5G4Y A;  1GSW A;  2VA0 A;  1LL9 A;  4OH0 A;  1S1Z A;  2WGV A;  3DWK A;  3VSL A;  2HJE A;  3CLO A;  2ZQA A;  3UE1 A;  4Y0O A;  1XP4 A;  1XKZ A;  3WS0 A;  3IS2 A;  2HPB A;  1XA7 A;  2JKR M;  3T4S A;  4WZ5 A;  2VEA A;  3C7U A;  5EM1 A;  3UB5 P;  4BBT A;  1HVB A;  4EXO A;  1ES3 A;  4JGO A;  4ZBE A;  3SH8 A;  1S67 L;  3PAG A;  1YLZ A;  1KGF A;  1C3B A;  1D1J A;  5FAQ A;  4Y17 A;  4R3B A;  1WYB A;  5G18 A;  1L0G A;  3C38 A;  3U2A A;  2B95 A;  4KG2 A;  3FWL A;  1CEF A;  1PI5 A;  3VOZ A;  3HLW A;  4DE2 A;  3F1P B;  5KSH A;  4F3L A;  2JKT I;  2OLU A;  3TJZ C;  4CLC D;  4GDN A;  4X68 A;  1KGG A;  5TBM B;  3UMD A;  3SOI A;  2XH9 A;  4E3I A;  3R7W B;  2A2L A;  2CMN A;  4HBU A;  4UQI S;  2H5S A;  4KG5 A;  1VM1 A;  3VP3 A;  1MWR A;  4U3T A;  1YKD A;  1VHM A;  2HJ9 C;  3VP4 A;  1GHI A;  5L8M A;  3HLD A;  4HES A;  5HW3 A;  5GLD A;  4Y0T A;  2ZL1 A;  3IS2 B;  3MBZ A;  3NDE A;  4JF5 A;  5DKL A;  4O0P A;  5CXW A;  1XXM A;  3MXR A;  2M1C A;  3AGD A;  1YSP A;  4QY6 A; 
#chains in the Genus database with same CATH homology
 1XFQ A;  2PR5 A;  3EEA A;  4R70 A;  1GSV A;  2G7U A;  4NXF A;  5IU1 A;  4G3V A;  1N9N A;  3K3D A;  5AVE A;  4Z1W A;  1N9O A;  2KDK A;  3LIB A;  3EWK A;  3S7N A;  2Y79 A;  2W3H A;  4I39 A;  1NWZ A;  1Y28 A;  3KSI A;  5HDS A;  3T50 A;  2BAS A;  3EQV A;  3MFX A;  4O8G A;  4KQD A;  1UWP X;  3FC7 A;  2A24 A;  3LR5 A;  2LB5 A;  2B02 A;  3VOL A;  1P97 A;  4LRX C;  3NOT C;  5FL3 A;  3S7P A;  2OWJ A;  2VGL S;  3BW6 A;  2PD8 A;  1TS6 A;  4F3L B;  4WUJ A;  3T4L A;  2FZ0 A;  2QWS A;  4R3A A;  4L9G A;  5G4Z A;  2H28 A;  4GLQ A;  4Y5F A;  2M7U A;  3A0R A;  5HD3 A;  5F5Y A;  3SW1 A;  2PYR A;  4UQI M;  4DJ3 A;  1OTI A;  3EQU A;  2ZOH A;  3F1O B;  4GHI A;  3BY9 A;  2QJ5 A;  2WKQ A;  3EEH A;  4IUK A;  1YSQ A;  5DFY A;  5HL6 A;  1F98 A;  3KYQ A;  1T1B A;  4IJG A;  4Y3I A;  2O99 A;  2JHE A;  4Q0J A;  4DJ2 A;  4RQ9 A;  4LPZ A;  4MN5 A;  1OT6 A;  5C5K A;  5MC7 A;  3G6O A;  3B42 A;  4IHQ A;  2GZA A;  4ZRR A;  1JNU A;  1T19 A;  2PT7 A;  4KUK A;  3KO6 A;  5IT5 A;  3E4Q A;  5HDC A;  1N9L A;  2W3E A;  5J4E A;  3D3O A;  1P9W A;  4R6L A;  1IFQ A;  5HDD A;  4ARZ B;  3MMH A;  1XJ2 A;  2MJ6 A;  3H82 A;  2OWH A;  3JVU A;  4HJ4 A;  3CUE A;  3OBF A;  3B47 A;  1W63 Q;  2M7V A;  5HWV A;  5TJJ A;  4GW9 A;  2XA7 S;  4BMW A;  2VZW A;  3C30 A;  4HI4 A;  1MZU A;  2EA9 A;  4QPR A;  4HIA A;  1H3Q A;  2QHK A;  3K3C A;  3VV4 A;  2K31 A;  4BWI A;  3TE8 A;  3MQ0 A;  2ZMF A;  2W1T A;  3T4J A;  2OAQ 1;  5LBR A;  5DJU A;  3FPW A;  3UB7 A;  4H6J A;  4HHD A;  4BBV A;  4YNR A;  5HD5 A;  5DFX A;  2PD7 A;  3S7O A;  1NLZ A;  2EWW A;  2XRO A;  4GS9 A;  3LIC A;  3V67 A;  3RH8 B;  1KOU A;  4OOL A;  2VGL M;  1GSX A;  3T4K A;  2WKR A;  2A24 B;  2J3T D;  1DP6 A;  3FG8 A;  3LI8 A;  4HNB A;  2L4R A;  3DBA A;  1YAX A;  2P04 A;  4PKY A;  3E98 A;  4B93 A;  3T4O A;  4LRZ E;  4MN6 A;  2V0U A;  3ZQ5 A;  4OOM A;  3A0V A;  3F1N A;  2ZMV A;  4WF0 A;  4YOF A;  2D01 A;  5HPI A;  2VV8 A;  2W1R A;  4GHI B;  5EFW A;  3PBQ A;  3HJI A;  3CI6 A;  3LYX A;  3UB6 A;  1OJG A;  4WL9 A;  1OPX A;  3LID A;  1OTA A;  3BY8 A;  4LRY C;  4L9E A;  5HWT A;  3C8C A;  1V9Z A;  2JKT M;  1TS8 A;  4HH3 A;  4R38 A;  2W0N A;  3NJA A;  3R4K A;  4NKP A;  4EEU A;  1G6O A;  2DMW A;  3LFV A;  4E04 A;  1OJ5 A;  3MQQ A;  3LR0 A;  4Q0H A;  3BWL A;  4MMN A;  1EW0 A;  2XA7 M;  2PR6 A;  3H82 B;  2W3G A;  4JGP A;  3PXP A;  3T4T A;  1T1A A;  4CLC A;  2Z6C A;  3OLO A;  2FH5 A;  1OTE A;  2KX6 A;  2VLG A;  2XRN A;  4ETZ A;  4Y2F A;  3LUQ A;  2K2N A;  3GDI A;  2NUP C;  3P7N A;  1V9Y A;  1T1C A;  1W63 M;  4L9F A;  4ME4 A;  4I3J A;  3OC2 A;  1ZHH B;  2W1T B;  5J3W A;  1OT9 A;  4EER A;  2O9C A;  1S4R A;  4H6J B;  3IBR A;  4PAU A;  3GEC A;  4GCZ A;  1OTD A;  4HQA A;  1H8M A;  4O01 A;  1XFN A;  4WLA A;  1P0Z A;  5AJG A;  5F6A A;  4GS9 B;  1NLY A;  2V1B A;  2GJ3 A;  2GX5 A;  1DRM A;  2J80 A;  1LL8 A;  2WKP A;  2VV7 A;  3KSH A;  4FOF A;  4PKY G;  1TF1 A;  2VJW A;  3OOV A;  4G3W A;  3RTY A;  3TRC A;  3E0Y A;  3E4P A;  2P7J A;  2B18 A;  3LI9 A;  4AFI A;  3PHY A;  3O5Y A;  4WEJ A;  4JGR A;  3BQA A;  4K08 A;  5F68 A;  3F1N B;  3D72 A;  3B33 A;  4P6Z M;  4II7 A;  3LR3 A;  4L0L A;  3LIE A;  3T4Q A;  3LIA A;  4WEL A;  3PYP A;  2I9V A;  5F69 A;  2R78 A;  5J7E A;  5DJT A;  4EUV A;  1VB6 A;  3EGX C;  1ODV A;  3ZYT A;  3E4O A;  3OCL A;  1ZTU A;  2EWV A;  5DF9 A;  4CLC C;  5HPF A;  3PBR A;  1BYW A;  2OOL A;  2ZBB A;  5HZH A;  4MCW A;  1DP8 A;  3KYZ A;  3NOU C;  4EEP A;  1IOU A;  2OAP 1;  4HH2 A;  2W3F A;  3VE4 A;  3NHQ A;  4HOI A;  1LSV A;  3UME A;  4B9O A;  2NUT C;  2JN7 A;  4NEE D;  3MXQ A;  4CLC B;  2D02 A;  3BJN A;  3KSG A;  4YWZ A;  5IS1 A;  4GJ4 A;  1DP9 A;  1UGU A;  4WN5 A;  3MR0 A;  4I38 A;  2KOI A;  4BJP A;  2HF6 A;  2YKH A;  3F1P A;  4I3A A;  4EES A;  3VE3 A;  3KSF A;  1D7E A;  2O0Y A;  2KLI A;  2VV6 A;  3EGD C;  4P6Z S;  1P9R A;  1TS0 A;  4EQ1 A;  2VKS A;  2XSS A;  4CLC E;  4CQH A;  1UWN X;  2LB9 A;  3CUE C;  1MKM A;  4I3I A;  3CAX A;  3TW8 A;  4EW7 A;  5TBM A;  2V1A A;  4HY8 A;  3RFB A;  3H9W A;  3R7W A;  4IUH A;  2V0W A;  1D06 A;  1TD5 A;  3W2Z A;  3BQ8 A;  5HWW A;  3PR6 A;  1WA9 A;  3H7W A;  3PBO A;  4HP4 A;  3UB9 A;  5G4Y A;  4G3K A;  1GSW A;  2VA0 A;  5K5B A;  1S1Z A;  3KX0 X;  1S4S A;  2W3D A;  1F5M A;  4XT2 A;  2HJE A;  5KIZ A;  2YKF A;  3PBS A;  2HV1 A;  3CLO A;  4HJ3 A;  2VX8 A;  5AVF A;  3EOI A;  2QYB A;  3NOP C;  4HP9 A;  3IS2 A;  2QJ7 A;  3CWF A;  2PDR A;  2JKR M;  3T4S A;  1T18 A;  2INW A;  3IBJ A;  1F9I A;  1MC0 A;  2VEA A;  1OTB A;  4BBU A;  4NXB A;  3JVV A;  4BBT A;  4EXO A;  2QKP A;  3A0S A;  1STZ A;  3CIT A;  4KUO A;  4FSF A;  4NXE A;  5A8B A;  4JGO A;  2L0W A;  4DMZ A;  3MF0 A;  4NXG A;  1S67 L;  5I5L A;  1S1Y A;  3ICY A;  3HCY A;  1XJ6 A;  5HSQ A;  3ULF A;  4WEK A;  2GNX A;  3C38 A;  2W27 A;  1LT0 A;  3MJQ A;  4PHT A;  3U2A A;  4Q0I A;  3F1P B;  5KSH A;  1LSX A;  2O9A A;  4F3L A;  2JKT I;  3TJZ C;  3MQO A;  1S66 L;  2PYP A;  3FPV A;  3PBT A;  1XJ3 A;  4CLC D;  4EET B;  3LIF A;  3PBN A;  1TS7 A;  3C2W A;  3P01 A;  3F1O A;  1NRJ A;  4I5S A;  5TBM B;  3UMD A;  2V9A A;  3LR4 A;  2Y8H A;  3R7W B;  2A2L A;  2CMN A;  3OCN A;  2HGV A;  4UQI S;  5CX7 A;  2O9B A;  2ZOI A;  4MN7 A;  4UEY A;  3S7Q A;  1X0O A;  4ETX A;  3H7W B;  4LLO B;  4MDZ A;  3K2N A;  1LSW A;  3UE3 A;  2JKR I;  4XT2 B;  2L1M A;  1YKD A;  1VHM A;  2HJ9 C;  1G28 A;  4M4X A;  2K7S A;  2PHY A;  5L8M A;  4ARZ A;  3UB8 A;  2J3W A;  2P08 A;  2J3T C;  4DN0 A;  2IA2 A;  1XJ4 A;  3HJK A;  3IS2 B;  4O0P A;  5DKK A;  2Z6D A;  5DKL A;  4HJ6 A;  4EU0 A;  2M1C A;  3UE6 A;  1YSP A;  4JGQ A;  4KQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...