2ZMZB

The 1.37-a crystal structure of the hydroxylamine-induced deoxy-form of the copper-bound tyrosinase in complex with a caddie protein from streptomyces castaneoglobisporus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
79
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title X-Ray Snapshots of a Hydroxylation Mechanism of Tyrosinase
rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 16
structure length 79
sequence length 85
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 2zmzB01
1WX2B 2AHKB 1WXCB 2ZWGB 3AWYB 1WX5B 2AHLB 3AWVB 1WX4B 3AWWB 2ZWFB 3AWTB 3AWSB 2ZWDB 2ZMZB 2JV8A 3AWZB 2ZMYB 2ZMXB 3AX0B 3AWXB 3AWUB 2ZWEB
chains in the Genus database with same CATH superfamily
1WX2B 4NBGA 4NBCA 2AHKB 1WXCB 2ZWGB 1Z03A 4NBBA 3AWYB 1WX5B 2AHLB 3VMIA 3AWVB 1WX4B 4NBEA 4NB9A 3AWWB 2ZWFB 4NBDA 3AWUB 3AWTB 3AWSB 4NBFA 2ZWDB 1Z01A 2ZMZB 2JV8A 2DE7A 1WW9A 2DE6A 2ZMYB 3AWZB 3GKQA 4NB8A 2ZMXB 4NBAA 3VMGA 3AX0B 3GCFA 2DE5A 3AWXB 1Z02A 3VMHA 4NBHA 2ZWEB
chains in the Genus database with same CATH topology
1WX2B 2AHKB 1WXCB 2ZWGB 3AWYB 1WX5B 2AHLB 3AWVB 1WX4B 3AWWB 2ZWFB 3AWTB 3AWSB 2ZWDB 2ZMZB 2JV8A 3AWZB 2ZMYB 2ZMXB 3AX0B 3AWXB 3AWUB 2ZWEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX2 B;  2AHK B;  1WXC B;  2ZWG B;  3AWY B;  1WX5 B;  2AHL B;  3AWV B;  1WX4 B;  3AWW B;  2ZWF B;  3AWT B;  3AWS B;  2ZWD B;  2ZMZ B;  2JV8 A;  3AWZ B;  2ZMY B;  2ZMX B;  3AX0 B;  3AWX B;  3AWU B;  2ZWE B; 
#chains in the Genus database with same CATH topology
 1WX2 B;  4NBG A;  4NBC A;  2AHK B;  1WXC B;  2ZWG B;  1Z03 A;  4NBB A;  3AWY B;  1WX5 B;  2AHL B;  3VMI A;  3AWV B;  1WX4 B;  4NBE A;  4NB9 A;  3AWW B;  2ZWF B;  4NBD A;  3AWU B;  3AWT B;  3AWS B;  4NBF A;  2ZWD B;  1Z01 A;  2ZMZ B;  2JV8 A;  2DE7 A;  1WW9 A;  2DE6 A;  2ZMY B;  3AWZ B;  3GKQ A;  4NB8 A;  2ZMX B;  4NBA A;  3VMG A;  3AX0 B;  3GCF A;  2DE5 A;  3AWX B;  1Z02 A;  3VMH A;  4NBH A;  2ZWE B; 
#chains in the Genus database with same CATH homology
 1WX2 B;  2AHK B;  1WXC B;  2ZWG B;  3AWY B;  1WX5 B;  2AHL B;  3AWV B;  1WX4 B;  3AWW B;  2ZWF B;  3AWT B;  3AWS B;  2ZWD B;  2ZMZ B;  2JV8 A;  3AWZ B;  2ZMY B;  2ZMX B;  3AX0 B;  3AWX B;  3AWU B;  2ZWE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...