2ZNIA

Crystal structure of pyrrolysyl-trna synthetase-trna(pyl) complex from desulfitobacterium hafniense
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
279
Chain Sequence
LSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolysyl-tRNA synthetase-tRNA(Pyl) structure reveals the molecular basis of orthogonality
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase/rna
molecule keywords Pyrrolysyl-tRNA synthetase
total genus 75
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2zniA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2zniA02
4P74A 3RKXA 2DEQA 4XEMA 3M4QA 4XU0A 2ZR2A 4HWSA 2I4LA 2ZT8A 1WNLA 2DXTA 4TVWA 2YIBD 1ADYA 2ALYA 2EJ9A 3I7FA 1E24A 4PG3A 4UP8A 1YB3A 2PMEA 2ALYB 1IL2A 2HEPA 3RUXA 4TQFA 3MEYA 1G5HA 2JVDA 1X55A 1X01A 4O2DA 3BJUA 2DQ0A 2DZCA 4H2TA 1NYRA 3HXXA 2Q7GA 2DQ3A 1RIQA 2ZXFA 1B76A 1ADJA 4ZIBA 2CGHA 4P71C 4HWTA 3RL6A 2AMCA 4XTUA 4YREA 4H2YA 4HA8A 2DXUA 1NJ8A 1B7YA 4EX5A 4YRCA 4YDQA 2DU5A 1NJ2A 2XTIA 3MF1A 3BHPA 1JJCB 3ERRA 4P73C 4K86A 2YI8A 3V8JA 4XTXA 4TTVA 4AH6A 2ZZGA 3L2ZA 1HXDA 2I4NA 2CIMA 2E41A 3NENA 2R72A 3L1AA 2DTOA 3A7RA 1WU7A 4G85A 4H2XB 1YFSA 4CH5A 1ATIA 1Z7NA 4WI1A 4RQFA 2R70A 3HXWA 3TEHA 4WJ4A 3G1ZA 4YRTA 4P3NA 2P0LA 4P3OA 3V7RA 3ICAA 2C7IA 2QJ1A 1C0AA 2CJAA 3IKMB 3OD1A 3IALA 2QHUA 2ZNIA 2ARTA 5C52B 3A5YA 2EJFA 4CH4A 2HNIA 2PMFA 4CH3A 4G84A 3QNEA 2ODRD 1KMMA 2ZIMA 4KR2A 4XTYA 4H2SA 5E3IA 1EQRA 4YP0A 1E22A 4YYEA 3REUA 4YCUA 4YRKA 3LSSA 3HFVA 1L0WA 3HXZA 4YRIA 4CS3A 2ARSA 3QO7A 3WQZA 1BBWA 2RHSA 3HRIA 2RHQB 4P72C 1BIAA 2ZINA 1X54A 1HC7A 4CS2A 2E5AA 2AMCB 4YRQA 4YPFA 3UFGA 4HWRA 1BBUA 1E1OA 2EL9A 2J3MA 2C8MA 2I4MA 3A7UA 3HRKA 4EO4A 2Q7EA 3UGQA 1J5WA 1HTTA 4X5OA 2CJ9A 4OP0A 2ARUA 4YROA 1LYLA 4YRLA 2ZZEA 2ODRC 3M4PA 4UP7A 4WF2A 3BFMA 4RMFA 4CH6A 1H4TA 2AKWA 4YCWA 12ASA 1SERA 1PYSA 4TQDA 2QHVA 2EWNA 1NNHA 3UGTA 1EOVA 2E1HA 3HXVA 1YFTA 1SETA 2Q5IA 2QHTA 2ZZFA 1JJCA 1EIYA 4BWAA 1NJ5A 3P8TA 2E3CA 3LC0A 2ZTGA 1H4VB 3VQWA 2QHSA 4H2WA 4K88A 3LSQA 2DJZA 4P74C 3VQYA 2ZR3A 3VQXA 4PHCA 4H02A 1KOGA 4YRNA 3RIRA 3HY0A 3EFRA 4HWOA 1B70B 2YIBA 3RKWA 4XU2A 2CJBA 1QE0A 1X56A 2E10A 4YRGA 3DSQA 5ELNA 3A31A 1Z7MA 3HY1A 4E51A 3REXA 1X2GA 2PUSA 3A74A 1X2HA 5C51B 1E1TA 1GGMA 3HXYA 1WYDA 1G5IA 3PCOA 2RHSB 3P8VA 3CMQA 2FYKA 1EIYB 2EJGA 4UPAA 2YIAA 3HTZA 4P71A 3UH0A 1PYSB 2P5IA 3TEHB 3PZCA 4P75A 3RKYA 3IG2A 2PGGA 4XU1A 4XTVA 4P73A 4P3PA 1WPYA 11ASA 5KNNA 3NETA 4TVYA 3RACA 4WJ3M 3VQVA 2ZT7A 3QTCA 3E9HA 2ZCEA 2RJZA 3RF1A 3E9IA 1YGBA 2XGTA 2J3LA 4P75C 3R07A 1H4SA 2DKGA 2DU7A 2Q5HA 4DPGA 3L4GB 4NCXA 4ZTZB 4XEOA 4TVAB 3ZEDA 1B70A 2ZGWA 4YRJA 1B8AA 1O9HA 2ZIOA 4RQEA 1SESA 4TWAA 3EFSA 2E65A 4TVAA 3V7CA 1WQ7A 4K87A 1SRYA 3FJPA 5ELOA 3HFZB 4YRFA 1EFWA 4YRSA 2E64A 4UP9A 2DDZA 3NEMA 3PCOB 2ZT6A 2AKWB 4H2UA 4XTWA 1EVKA 3QO8A 4H2VA 1EVLA 4HVCA 5F5WA 4YRPA 2IY5A 4P72A 5HGQA 3A7AA 2EAYA 1O9GA 1W66A 1YFRA 2I4OA 1USYC 5C53B 3W3SA 2DTHA 4OLFA 5K1PA 1N9WA 3A5ZA 1BIBA 3HXUA 2G4CA 4YRRA 4KR3A 3V8KA 2Q7HA 2IY5B 3V8LA 4RDXA 4H2XA 1FYFA 3A32A 3TUPA 2ZT5A 1VQZA 1USYA 3P8YA 2YI9A 1WLEA 1G6UA 4LNSA 4XTZA 3IKLA 2RQ6A 4HWPA 4XU3A 4J15A 1G51A 3MF2A 4YRMA 1NYQA 4ZTUB 4BW9A 2RHQA 3V7SA 4KQEA 4L87A 2DVEA 3TEGA 3HFZA 4YCVA 2DZ9A 1H4QA 2DTIA 3QO5A 1ASYA 1WQWA 1B7YB 5K1XA 2ZNJA 3VBBA 3RGLA 1NJ1A 3KFUA 4Q15A 1QF6A 3NELA 4CS4A 1ASZA 1NJ6A 1KMNA 4DQ2A 4Q6GA 3L4GA
chains in the Genus database with same CATH superfamily
2HR3A 1GK9A 1ZWIC 1R3LC 4DR2O 2I4LA 4GX2A 5KHKA 3AK1A 4UCUA 1D5AA 4X1IB 3DC5A 4MSWC 1E24A 3QF7A 1WB7A 4QE7A 2PMEA 1GN2A 4CC6A 3W7TA 4LR3A 3RUXA 4TQFA 1LNQA 2JK5C 3K0GA 3MEYA 5LHHA 1YDXA 4MT8A 4DV6B 2RMKB 1IDSA 1XBLA 4NKGB 5CBGA 2CTWA 1Q81W 2OTLV 2QM4A 4IHJB 4DUZO 4JZ2A 3OR6C 3SGIA 5E79Z 4EB6B 3T4ZA 2QWQB 4O4IA 3O9OA 2HHHB 3AEIA 4P71C 4FK5C 4HWTA 2F66C 2AMCA 3JD0A 5LYJA 1B7YA 4YRCA 2DU5A 3IFXA 3BHPA 4HZ3A 4PHZA 1JJCB 4QE9A 1FD9A 5B1BB 4P73C 4O4JA 1X59A 2P7TC 2OTJV 5IJ9A 4Q20A 1HXDA 4JI5O 4UCVA 1HNZO 4R6ZA 4MVQA 1PD3A 3A7RA 4B3RB 4TOIA 4G85A 2RN9A 5CB4A 1YFSA 1RPOA 4WI1A 4RQFA 1Q8IA 4B3RO 2R70A 3X2QC 1N36O 2EZPA 4KP4A 3SJBC 5B3SB 3TEHA 4WJ4A 4X1KB 5FPRA 3IALA 1OCZC 2ZNIA 2WA4A 2XHBA 4K8XA 2EZOA 1VQ5V 1I5XA 1OHHG 3JALA 1AJPA 4DR7B 1W0JG 2HNIA 3QNEA 2WLLA 2ODRD 1XUQA 4JV5B 1UPGA 5B1AB 4DR1O 5JJJB 5GONA 4YJ3A 1XNRO 2Q6AA 2C2AA 4KHPO 2ZE6A 4YCUA 3IC9A 5EIBC 2OCCB 1JFFB 4NR1A 4YRKA 1D2DA 1L0WA 3IGAC 4JYAB 5LP6C 3HXZA 1LR1A 5B1AC 4GKJB 1HDJA 1IZ3A 3ZHTA 1F4NA 2EILB 3HRIA 4P72C 3CCEV 1MMMA 2PYJA 2BOBC 4TV9B 4YRQA 3CRCA 2Q4PA 1K33A 3UFGA 4HWRA 4OPAA 3FB5C 1Q6HA 1V55C 4AILC 1JJ2U 1V55B 2ZE7A 1KKDA 1MSDA 4EO4A 4IHJA 4B7EA 2OYQA 1BS3A 2UXXA 3UGQA 4LFAB 4OX9O 3SYQA 2D3OW 4X5OA 4YIOA 3ICXA 2DOSA 4LWSB 4YRLA 3CP1A 4J80A 1S5LZ 2Q9LA 2ODRC 2QTOA 2JDIG 4UP7A 1FXKB 3ASOB 1VQPV 4LF9O 1IURA 4DK0A 2M7WA 1BQZA 4UCOA 1FXKA 3AG4C 4IIJA 4KHPB 4YCWA 2KG7B 12ASA 4H13B 4LF7B 2F4VO 4DR2B 1NNHA 4PV1B 2Y69C 4OXSA 1EOVA 2QHTA 2GHYA 1FYJA 1NJ5A 2E3CA 3A0RA 3CCLV 2ZTGA 1H4VB 1XDCA 2JJ2G 4EEQA 3LSQA 1BZKA 4GX0A 2ETNA 3HKDA 1OZ0A 4X8AA 2UXDB 3SYAA 2QKAA 3ABKC 4EFEA 4FLTA 3RIRA 2LW1A 3HB3B 1N0NA 3EFRA 1EZVH 1KB9F 1YSCA 2YIBA 4HYOA 4O4HA 3SYCA 3AK3A 4I4TA 4YRGA 4LFCB 1KP3A 3A31A 3K5NA 1S5JA 4FFBA 2JEXA 2NLJC 4E51A 1TA8A 4J7KA 4PA3A 3ETDA 1PP9H 4GT1A 1G5IA 3PCOA 5BMVB 3OFNG 2HVJC 2FYKA 5EC1C 3CCMV 4LF4B 2IM9A 1L0NH 2WPDG 2NS6A 4UCTA 2LFSA 2P5IA 3TEHB 3WG7C 3ZMTA 2A0LA 1VF6A 2RNBA 4P75A 3RKYA 2X6AA 1DK1A 5BMVA 3CCUV 1FXVA 2WLKA 3IG2A 3G67A 5KNNA 1G8MA 2QA4V 2UXBB 3VQVA 4DR4B 5CA3A 3TJTA 4TUYB 4FLYA 3AG1B 2ZDIC 3OE7G 3E9IA 3B77A 1YGBA 2XGTA 2XUMA 3ZN1A 2QR4A 4NYKA 1NTMH 4MVSA 5ITZB 4WFFA 2DU7A 2UXBO 1J5EO 1L8DA 4O4HB 2BSKB 4IYHA 4JF3A 4QPKA 2YEVB 5L3BA 3D3IA 5FNVB 4JI1O 3JAWA 1B8AA 2LO1A 2ZIOA 1EN6A 1H2GA 2ATKC 4RQEA 3SJCC 3A8TA 1SESA 3ABMC 1WNSA 5L3GA 4B3TO 2ITDC 2E65A 2L6LA 2R9IA 5BXZA 2CH7A 3BA8A 2F43G 4O2BA 1OJHA 1SRYA 5ELOA 3MAQA 3HFZB 4YRFA 5KHGA 4J41A 3R66A 4FLVA 2AGAA 3AG2C 4YRSA 3G6BA 3ZMZA 2E64A 4I7ZB 1WPBA 3CCQV 3NEMA 3W7UA 4DV5O 1NI8A 2ZT6A 4DK1A 3QO8A 1GKFA 1WB8A 4X66O 2F1MA 4DUZB 1IBKO 1S5HC 2IY5A 4U3FH 2EAYA 4JZGA 1YFRA 4XDKA 5KHJA 1XEQA 3W3SA 5IY5C 2CTRA 1GN6A 1N9WA 1BHAA 3A5ZA 3HXUA 1K97A 2UUCB 2GBOA 2G4CA 1IBLO 4B3MO 2IY5B 4MVUA 3UCSC 3L73H 5KAIZ 5L3EA 4H2XA 1XHXA 1M9NA 2VRZA 3TUPA 4NXNO 3OUFA 4LFBB 1Y4MA 2FMLA 4UB8Z 1NR1A 4X1IA 3K0DA 3CCRV 2D2CB 2CTQA 1TUBA 5JH7A 3AG4B 3OEHG 3SDLA 1QNMA 1JR9A 2PZSA 4JI7O 4A5UB 1QR9A 1H4QA 3QO5A 2WLNA 4NXMB 3ZIAG 2A79B 3C3TA 1U96A 4JI8B 2ZNJA 3VBBA 2ZM6O 3ZMSA 1OCRC 2UXNA 2VWKA 5EIBD 3A0HZ 3LNMB 5C8YB 4JAUA 3SJAC 4N23A 1KP2A 2FTKA 1HNXB 1AR4A 4BW5A 2BSKA 1BMFG 4JI3B 2ZXWC 4PD4F 2JEUA 3ZX6A 3RKXA 4G2KA 3AK2A 1CEZA 4XU0A 1I5YA 5B1OA 2ZR2A 5LGUA 1OCRB 4MTFA 2ZDIA 4DRXB 4X1KA 2ZT8A 5KA6A 4TVWA 2EX3A 1XNQB 3CWBH 2UUBB 4TV8A 3EVKA 2UUAO 2AZ0A 3CRRA 4FIPC 4PG3A 4YXWG 1K73W 4J9YB 3I5DA 5LP6B 4LP8A 2ALYB 2HEPA 2IU0A 4F4LA 1G4YB 1G5HA 5IJ9B 3T4DA 2HHHO 1X55A 4O2DA 2EINC 1PL4A 2Q7GA 1VEWA 2DQ3A 4I55B 1BT8A 3RBZA 1AI4A 2ZXFA 1AP6A 1YEWA 2DWDC 1B76A 2FKXA 3BCCH 4Q6GA 3DXRB 5IYDO 5KHHA 2HJDA 2QWNB 2ITCC 5EBMC 5JQGA 2GSMB 4YREA 2CAZC 4PI2A 4HA8A 2DXUA 1NJ8A 3H1JH 4EX5A 4LH7A 4X1YA 4YDQA 3CYOA 1YJNV 1VQOV 5CA1B 2XOKG 5J2TA 3OTOO 4WFHA 1JVMA 2IJIA 1QQCA 1ZX3A 3K03A 4LH6A 1HNWO 2LW7A 3JSLA 3STLC 4AH6A 3L2ZA 3CJHA 5HFMA 1M56B 2HKOA 3AG2B 2F4VB 3NENA 4K0KB 2DYRC 2IJHA 3LSUA 3P3PA 2QWPB 5JCOA 4CC5A 5B1BC 4DO2A 1A32A 2IJKA 1XILA 1FPOA 3CD6V 3B4SA 1Y76B 4P3OA 3ABMB 4W4LA 3V7RA 3UT5B 2QJ1A 1C0AA 5LMUO 4B3SO 3IKMB 2Q8VA 2Q5ZA 1M57B 1W59A 3CC2V 2G38A 3A5YA 2UUBO 5IYCO 3RYHA 4CH4A 1YZBA 2PMFA 2B9ZA 2XAFA 3E8HA 3E86A 4H2SA 5LL6Y 1E22A 4F6RA 4YYEA 1M5IA 3OMNB 3T1HB 1WAZA 3ABLC 3CMAV 3JARB 4ZKIA 5LXTB 3WFVA 5CBHA 3RYCA 4DR6O 3LSSA 3HFVA 1WN7A 4TT3G 5A9GA 2GUZA 1ROPA 4CS3A 1MZFA 2EIKB 5J2TB 3E22B 3WQZA 4D6TH 2QKSA 2P5OA 1BIAA 4YJ2A 1HC7A 3CMEV 1GO3F 2Z3YA 1S3JA 1BBUA 2GV9A 5KAFZ 4X65B 4TWKA 3B40A 2EL9A 4K3AA 3SYOA 4KUMA 5L3CA 3VOUA 2WWWA 4X65O 2I4MA 1VQMV 3DC6A 2E76B 4LF7O 1QLEC 3HRKA 3M8AA 2VQFB 1VF5B 1XNQO 1THZA 1J5WA 3JSNA 1ZL8B 1HTTA 4GYCB 2DYRB 4J11A 4U3JB 2EBOA 4DV1B 4B3MB 1U97A 5LBQA 3TCUA 2DJVA 1Q43A 4LF8O 4I50B 1QBZA 3BFMA 1SQPH 1HNXO 2XAHA 1NH2B 1NTZH 2LGWA 4X9QA 2X0LA 4IL6Z 4TV8B 3DTUB 4FLZA 2V4DA 3T2MA 2QHVA 4ZBMA 2EIJB 2H3OA 2EULA 4H37A 1N8RW 1YFTA 1NT2B 2MK3A 5HFLA 1JJCA 4PA6A 1AI6A 3CS5A 3P8TA 1URFA 4QJFB 4DW1A 5KLVH 2IW5A 4NVPA 5LYJB 2HFEC 1F23A 2KKWA 2QTSA 3CRQA 4P74C 5C8YA 3ZMVA 1TAEA 4PHCA 4H02A 1UJWB 1NS1A 4UCRA 1B70B 5IT9N 1KC8W 3MD0A 4LF9B 4XU2A 2CJBA 5JCOC 3OUSA 1N4CA 2P06A 1KKCA 4J42A 5BY1A 1M56C 1YVWA 3U11A 3HY1A 3M99B 1PPJH 4WFGA 1E79G 3K59A 1X2GA 3A74A 1X2HA 2A3QA 4O4IB 4R7CA 2H94A 1E1TA 1GGMA 2E5LB 1JCHA 1EIYB 3FX7A 3K3WA 4LF5B 2Q67A 2YIAA 4MVOA 4DR4O 1Z5VA 4P71A 4U7OA 3RFRA 4JI0B 1V54C 3UH0A 1COWG 1PYSB 5LXTA 1P49A 4ASUG 4LVKA 4IIJB 1JX9A 3PZCA 2Q0AA 1FFXB 1IBMB 2QE7G 4FMTA 4JI8O 2DE0X 4ZOLB 3JYCA 3J7AU 4FFKA 4P3PA 1WPYA 4P73A 1QLNA 4TVYA 3RACA 4D7SA 1JMKC 1YJWV 2ZT7A 2ZD9A 3QTCA 2ZCEA 2RJZA 1NVPD 2FL4A 4IYIA 2YEVA 1WP8A 4JYCA 4OGQB 4X89A 1L1FA 4WFBV 3R07A 3RVYA 3BAAA 4DPGA 1AI5A 2GDSA 1Q6IA 2Y48A 1Q6UA 5H2FZ 1B70A 4K0KO 1V54B 2K9PA 4HNAB 2ARHA 3AG3B 3F7VC 1N36B 5KUMA 4TWAA 4X64B 5GTIZ 5B3SC 4TVAA 3X2QB 3V7CA 2GTSA 3CCSV 3UO3A 2LP7A 3WB1A 1B6QA 1JFFA 1EFWA 4EFBA 3TXQA 2WLIA 5H9CA 5J2UA 1YTFB 2DDZA 3ZN0A 3PCOB 3W7XA 2AKWB 4Z1MG 1AILA 4ZI7B 5CA0B 3K04A 1AI7A 1EVLA 2ADPA 4PA4A 5LOVB 1K92A 3HKCA 4YRPA 3ABUA 2X7RB 1IXMA 3N2KB 3Q4HB 2Q68A 4I55A 2DYSC 4LFBO 4PA7A 4U3JA 1EM1A 2DTHA 1FFTB 4W4KA 4DR5B 5JWPA 4UUJC 4KR3A 1K4CC 1H38A 4RDXA 4KL1A 1MZEA 5CB4B 3ZRSA 1HNWB 2NR5A 1VQZA 4AQYB 4ZI7A 3P8YA 2YI9A 5IY5B 3OTOB 4LNSA 4GZRB 4FM2A 1VQ8V 2YXLA 4FJCC 4LF6O 1P84F 3HKBA 3LDDA 4O4LB 5L3FA 5FL7G 3I56V 1NYQA 2PI5A 3AG1C 3U10A 1GMGA 4BW9A 3N2GB 4QNHB 4BIOA 4I4TB 3V7SA 4KQEA 3OAAG 4L87A 1FKAO 4JI3O 5JVDA 2PY5A 2WLHA 5LMNO 2KB1A 3L9DA 4GX5A 4JYBA 2CGOA 3KCXA 1FS0G 1VIBA 1WQWA 1DGSA 3WG7B 4FZ0A 1H8EG 3ZHRA 3OEEG 3HKEA 5EYPA 5IJ0B 3G4SV 1KMIZ 3KFUA 1D5NA 1XL4A 3SR2C 4Q15A 1QF6A 3NELA 1GN4A 1XL6A 5H6RA 2P4VA 3L72H 3SPGA 4YY3O 1FJGB 1NJ6A 4FLWA 4FZ1A 4DUYB 2YUAA 4DQ2A 2H8PC 4PDMA 5LHGA 2UUCO 2DEQA 5CN0A 3M4QA 3CXCU 5A2QN 3QG5A 4HWSA 3FAVB 3APQA 2DXTA 2YIBD 3FKSG 1Y76A 1R73A 3F7YC 4X20A 3O65A 2XT9A 2QEXV 3I7FA 1H2MA 4PI0A 2K1EA 3OW2U 4NXNB 4DR3B 1IBMO 2KSDA 3BPZA 1JOYA 2B1GA 1P4RA 5EBLC 1NZ6A 1Z5WA 3ABLB 1M4UA 3CJHB 4DR6B 1RSOA 1X01A 4UVAA 3FB6C 3T1HO 1NYRA 5B1NA 1G1XB 4NTYA 4FVMA 3UKMA 3F5TA 1RIQA 1B3QA 2DWEC 1AJNA 1WA8A 4X1YB 2BTQA 1PNLA 2CGHA 3RL6A 4YJ3B 4XTUA 1M90W 2OCHA 4H2YA 3GWKC 1H8HG 1EN5A 3S3XA 2XTIA 5KHIA 1H2KA 2HG5C 1TVKA 4E4EA 1FJGO 5KUKA 3E89A 1RM1C 4K86A 1SQXH 3V8JA 4WFAV 3RN4A 4XTXA 1VQ9V 3K5LA 1B04A 3ASNB 1PKXA 3TXSA 4UCSA 1IBLB 2E41A 4RUFA 4LVJA 3H01A 1TUEB 2DTOA 3IC7A 3JAWB 3K9AA 5FNVA 1SC5B 3P30A 4ICGA 4DV0O 4J7ZA 4LF8B 1OCOC 3HXWA 3G1ZA 1F51A 2NN4A 4P3NA 4YRTA 2P0LA 3ABKB 3OGCC 3G80A 4BIZA 5CBFA 2CJAA 2QHUA 1SZXA 4JI6B 1BHBA 4WF9V 2HVKC 3Q4HA 1HR0O 3UO2A 5BR8B 4J10A 2OIGA 2HJFC 1K34A 4LVLA 1KMMA 1VMGA 2ZIMA 3U0ZA 4XTYA 1ORQC 1VQLV 3TK1A 3KKYA 4JI5B 3RGBA 1DTOA 3REUA 4P30A 1DLBA 4ABMA 4YJ2B 1NJIW 4FPPA 4C7UA 2AW9A 2GUZB 2ARSA 4XBFA 4MW8A 1R6KA 1JJOA 1BBWA 3FB7C 3B8MA 2A9HA 2L35A 1VQ6V 2E5AA 4PDVA 2AMCB 4YPFA 1E1OA 1K7DA 2UXCO 3K08A 5EK0A 3HR0A 3E8BA 1OCOB 4JI4O 4DR3O 2QDOA 3CC4V 1MSWD 2C8MA 3DGEA 3A7UA 1MA1A 2B5UA 3I55V 2Q7EA 2BE3A 4FLUA 4OP0A 3ZRXA 1L0LH 4JASA 1LYLA 4K35A 2VWJA 4GKJO 3L70H 1RM1B 1BE3H 1XHZA 4RMFA 1JA8A 3GB7C 4GX1A 3ZJZA 3BY6A 1J95A 2A7WA 3W7SA 4X88A 4JI7B 1BCCH 2IH3C 4YHHO 4UV9A 1SERA 4R50A 1QVFU 1PYSA 2EWNA 2X6CA 4JI1B 3G71V 2RCVA 5BZBA 3UGTA 4PDRA 1Q3EA 2ZZFA 1EIYA 4BWAA 4MVRA 3LC0A 4LVIA 5LMNB 1GM7A 3ZRWA 2OWOA 1YXBA 1SS3A 4K88A 1W2BU 1KYOF 3C3SA 3WU2Z 2DJZA 5CMUA 4PDLA 3FFQA 3VQYA 1NH2D 4J9ZB 2ZR3A 2EIJC 4P2ZA 1KOGA 4YRNA 1YIJV 3B2EE 3OR7C 3GVMA 2DW4A 3RKWA 5LA6A 2EJ7A 4LF5O 2FB5A 1OV9A 5H5NA 2UXDO 1UFIA 1QE0A 1NU1H 2UU9O 4X66B 1X56A 1E1RG 2OT5A 3E83A 1Z7MA 4KXRA 4MS2A 4TV9A 5GONB 5JQGB 1I94B 1AP5A 2PUSA 2JGDB 1IX9A 4L8JA 2WLLB 5C51B 4DR1B 1PV0A 1XREA 1WYDA 3ZHSA 2VQEB 1IVSA 1US6A 2ZE5A 5D5QA 3P8VA 3E8GA 4PJ0Z 5EZYB 2IU3A 3OM3B 4DV4B 2EJGA 4Z1VA 4JYAO 2WLIB 1NBMG 3HTZA 2A8EA 1IXBA 5KX5A 3H1LH 1N32B 2B1IA 3QVNA 2XTAA 1VQ7V 1XI1A 2R9RB 2AHYA 1NKDA 4XDJA 4B08A 1SQGA 2IJJA 3JAMN 1B06A 3TGUH 4XTVA 5TISZ 3PN1A 4DW0A 3APOA 3CCJV 4WJ3M 5LGTA 5BR8O 4WCEV 1HNZB 2XAQA 3JALB 5IDJA 2VS0A 3THOA 2ZM6B 1NR7A 3P3NA 4H44B 3JD3A 2DKGA 2Q5HA 1R3IC 2CE4A 2FYUH 3JAKB 1WP7A 5JH7B 5LA6B 4AHCA 3RVZA 4WFEA 4TVAB 4X64O 2ZGWA 1JPXA 2HLDG 4BIUA 4YRJA 1O9HA 1S76D 1CP9A 3ZHQA 2WLJA 5JJNB 2Z5UA 4DV2B 4NB5A 2DYSB 2QM8A 1VF6C 1FFXA 1ZSPA 4O4JB 3SPHA 1WQ7A 3S3WA 3ZS8C 4TSFG 4HT4A 2BOCC 2CTPA 1F7YA 3F5WC 1FAFA 4FM1A 1YTFD 3SYPA 2QSAA 1Q86W 4BR6A 2QKCA 1EBOA 1I94O 4OX9B 1XQ8A 4G27B 4DV6O 2EIMC 3K57A 1HR0B 1ENVA 1KBHA 2CGNA 2JS5A 3H1IH 2N74A 4JI4B 4H2VA 2BTQB 2E75B 1AR5A 2W0FC 3FB8C 1NVPB 4HVCA 5EBWC 3CEIA 5H6QA 2QGNA 4LF6B 4P72A 3A7AA 5LGNA 1W66A 3FAVA 2I4OA 3MDSA 1AROP 1I7FA 4PELA 4UFZA 5D5PA 2YSUB 3D3QA 4X62O 2AXTZ 5K1PA 4O2BB 1BIBA 3E8FA 4YRRA 3SPCA 3FYEB 2Q7HA 1N33O 3LDEA 1FYFA 3OTFA 4DYLA 3ML0A 3RW0A 2ZT5A 2N04A 5LHIA 4DV5B 1USYA 1W0KG 1WLEA 4LF4O 1GN3A 1G6UA 2EINB 4I9QA 4X20B 3BFRA 2RQ6A 3JCZA 3P32A 5EYPB 5IJ0A 3IKLA 4HWPA 4J15A 4WBNB 4QPJA 1BL8A 2F95B 3E2EA 4ZTUB 2YXYA 4JGSA 1YITV 3JATA 1S0VA 1KQSU 3JAKA 2DVEA 3HFZA 4JAVA 5CA1A 2PTMA 4YCVA 4YY3B 2QWRB 1H2LA 1FXKC 1S77D 5K1XA 4MVMA 3H1HH 3E35A 1NJ1A 5EC2C 2IH1C 2AZ2A 3CHXA 2ZXWB 3HKEB 2JJ1G 1I08A 4I50A 3BRCA 1ZAUA 3K79A 4FLXA 1YJ9V 2LFRA 2ZQMA 2CUGA 1K4DC 1QU7A 1Q7YW 4P74A 4XEMA 3JASA 4DV1O 1NQTA 5KX5B 3N2GA 1QR8A 2Y4TA 3ZRVA 1WNLA 3L74H 4UV8A 1ADYA 3OMIB 3HKCB 2ALYA 2EJ9A 1Y74A 4TUYA 3BVOA 5IWAB 4UP8A 1R3KC 1Y67A 3CSXA 4O2AA 3RYIB 1YB3A 5GW7A 4U7NA 1ZTEA 4GCZA 3J81N 1IL2A 4FFBB 2DN9A 3OGIB 4BAYA 2OCCC 4XDLA 2JGUA 5FLXN 2F93B 2JVDA 4MVZA 2YS8A 4LFCO 1T5EA 3BJUA 1EFRG 2DQ0A 2P22C 2DZCA 4H2TA 1BSMA 3HXXA 1HP8A 2PF4E 2YIDA 1NTKH 1SQVH 3LNNA 1JQ0A 4G28B 5EZYA 3N2KA 1GH6A 1R6TA 2WSSG 4MTOA 3WB2A 1ADJA 4JI0O 3ZHVA 2F23A 3B8NA 4ZIBA 5CA0A 3D36A 4D7TA 1H2NA 4LFAO 1AR1B 1MABG 3FD9A 4CZZA 1VQ4V 5FPOA 1XMOO 1N34B 1IBKB 1RP3B 5J2UB 1ZUQA 3RWRD 2E5LO 1PL0A 4JPRA 3LUTB 2UU9B 1NJ2A 3ETGA 3RYHB 3MF1A 1BQ0A 2NNUA 4DV7O 4GKKB 3ERRA 1R3JC 2YI8A 1F4MA 1RFYA 4NTWA 2PI4A 4WBNA 4TTVA 3K58A 2ZZGA 3JARA 2I4NA 2CIMA 2A06H 4LCUC 1LUWA 2R72A 2YXHA 3L1AA 4KFMA 1WU7A 3SPIA 2XASA 4RUEA 4RO2A 4H2XB 1YCIA 4CH5A 1ATIA 1KU9A 1Z7NA 4JTAB 1E1QG 3KG2A 5C93A 1XOUA 2JIZG 3ICAA 5E1AC 2C7IA 1AJQA 2P90A 3OD1A 2M6YA 1CXZB 2ARTA 3T1YO 3IAYA 1SKVA 5C52B 2EJFA 1EZJA 4P9PA 3K06A 1GAXA 3HPLC 4CH3A 4G84A 1R6NA 2EIKC 2V1DA 1V9PA 4KR2A 4ZOLA 4F6EA 1PNKA 4EKWA 5E3IA 1EQRA 1N34O 4YP0A 3JD1A 2CDYA 4LNUA 1HWYA 4DV0B 4LVMA 2ZE8A 1K3EA 2JRIA 4N21A 4LWSA 4YRIA 3UQ8A 4JI2B 3QO7A 3MHHC 1Q82W 1P7GA 5JVDB 4IT5A 4UVCA 2RHSA 2CK3G 2RHQB 2ZINA 4JTCB 1X54A 4AI8A 4CS2A 3PJSK 5LP6A 3CB2A 4O2AB 4JYYA 1SF9A 5J9PC 2J3MA 4MTXA 4JV5O 3T1CA 5DN6G 5IWAO 2YDEA 3WB0A 1P7BA 2WA3A 1MOFA 3BABA 5JJEB 4K8ZA 5ITZA 3JD4A 1QHTA 2QWOB 2CJ9A 4H0LB 4I5SA 5IYBO 3KCYA 2ARUA 4YROA 1HW7A 1N0JA 1S72V 3EXAA 5DECA 1N33B 2ZZEA 3CCVV 3M4PA 1K5QA 1OCCC 5B5EZ 4WF2A 1Y6XA 3H9VA 1Q90D 4X62B 4DR7O 4CH6A 1H4TA 2AKWA 3AG7A 1Y74B 3ZMUA 1LUVA 1FXHA 4TQDA 4I9WA 3UM7A 4PA9A 3D36C 3JD2A 3C90A 3TETA 2LGQA 3RYFA 1MNGA 4RAIA 3BEHA 2UXCB 2E1HA 3HXVA 3NR7A 1SETA 2Q5IA 3MQZA 3A2FA 3K5MA 4RWUA 2W6JG 5L3DA 2VQFO 3JATB 4AQYO 2P67A 1VQNV 3VQWA 1DF5A 3EHBB 2QHSA 3STZC 4H2WA 4R8CA 1GM8A 2WAMA 2PYLA 3SJQC 2JGDA 1YHQV 1M57C 4B7KA 4LBEC 1K5SA 1WPXA 4I0XA 2Q73A 2Y69B 2DMXA 5GTHZ 4DR5O 3VQXA 1X4TA 3A0BZ 1SA0B 2BTOA 3CXHF 1CPYA 4QIWF 3HY0A 4HWOA 1Q5OA 3IJ4A 3G6EV 3MHSC 4H33A 2VQEO 3CRMA 1TVKB 4OPHA 4DXWA 3ASOC 2E74B 2E10A 3DSQA 1TUBB 4LNUB 4P9OA 5ELNA 2WLMA 3OT7A 1J5EB 1DF4A 2Q69A 3HKDB 3ZBHA 3REXA 5KMGB 2XNDG 4JI6O 3ZRWB 4JAAA 3HXYA 4GUNA 2RHSB 3CMQA 3K9SA 1KD1W 4UPAA 1MG1A 3GWOA 3H1KH 2YC0A 1VQKV 1K8AW 1ZLZA 1K9MW 1GRJA 3AG3C 1TGOA 4UXNA 1RPRA 3RYCB 3UT5A 1RSOB 2ADQB 1VF7A 3L75H 2BCCH 2QM7A 2CH7B 2EILC 2AHZA 4MW3A 4DV3B 3M7MX 3LDCA 5IE9A 2PGGA 4XU1A 2W6IG 11ASA 2XAJA 3NETA 3K5OA 5KMGA 4CBCA 3E9HA 3SPJA 1SQFA 2IBZH 3RF1A 4NTXA 3T1YB 2J3LA 4P75C 1WJZA 2XAGA 5LMUB 4B3SB 2W0XA 2HP8A 1H4SA 2UUAB 3R65A 3EFFK 3L4GB 2ZT9B 1QVGU 1EN4A 3W7WA 4NCXA 3ABTA 4ZTZB 4XEOA 3ZEDA 5IYZA 1PNMA 2KQXA 1SA0A 1XMQB 4JI2O 3RT3C 1OCZB 3D8CA 4I0XB 2Y0IA 3DXRA 3ETQA 1H2SB 3JCUZ 3EFSA 1GM9A 1AVMA 4J7JA 5B66Z 3CX5F 4DV7B 4GKKO 4ZHQA 3ZHUA 2LJ2A 4K87A 5AG2A 3FJPA 1Y66A 1YI2V 3RYFB 2N05A 4LC1A 1PM9A 2EIMB 3ASNC 5DEDA 4NXMO 3N27A 2O57A 2Q0OC 3HKBB 4O4LA 4FM0A 4UP9A 4MTGA 3FYIB 5LOVA 4DV4O 1KUQA 1I0HA 1VARA 4H2UA 4XTWA 1EVKA 2ILMA 3RYIA 1YF2A 1VP7A 2V7QG 1AB3A 5KA5A 5F5WA 2P6JA 1QCEA 1SQBH 4HBNA 5HGQA 2Y4UA 1O9GA 1N32O 1USYC 2LQTA 2MW2B 4B3TB 5C53B 4Z2WA 3JASB 2R9AA 1ZL8A 3CRAA 4DV2O 4DV3O 4OLFA 2X6BA 3BA9A 3NXSA 1XNRB 3V8KA 3ZCCA 3V8LA 3L71H 1M1KW 5F2VO 1BGYH 3CPWU 3A32A 3CE2A 1R1BA 4JTDB 4XTZA 4XU3A 1G51A 3MF2A 4YRMA 2EJRA 4UB6Z 4DRXA 4IGGA 4QGPA 1M93A 2RHQA 2YICA 1XMOB 3TEGA 3E22A 2DZ9A 5DM6V 2DTIA 3OMAB 4ZHQB 1ASYA 3ETEA 2ZKOA 1OCCB 1B7YB 1Z2GA 4HAMA 2JS3A 3CC7V 2P4KA 3J80N 3B09A 1KECA 2KG7A 2Z0AA 1XMQO 4UVBA 3RGLA 2GTAA 4GLXA 1GTOA 4YHHB 4F6RB 1SQQH 4HNAA 4E2LA 4DUYO 2OIEA 2RDCA 4CS4A 5IYZB 1QLEB 4EB6A 3OD4A 1ASZA 1WA8B 2Y0PA 1SZTA 3KZIZ 2ODMA 1KMNA 4YIPA 3L4GA
chains in the Genus database with same CATH topology
4P74A 3RKXA 2DEQA 3JASA 4XEMA 3M4QA 4XU0A 3QG5A 2ZR2A 4HWSA 5KX5B 3N2GA 2I4LA 5KHKA 4DRXB 4UCUA 4X1KA 2ZT8A 1WNLA 2DXTA 1D5AA 2YIBD 2EX3A 4X1IB 4TVWA 1XNQB 1ADYA 2UUBB 3HKCB 2ALYA 2EJ9A 4X20A 4TV8A 4TUYA 3I7FA 1E24A 3QF7A 4NXNB 4PI0A 5IWAB 4DR3B 4PG3A 4UP8A 4O2AA 3CSXA 3RYIB 1YB3A 2PMEA 5LP6B 4CC6A 2ALYB 1IL2A 2HEPA 3BPZA 4FFBB 4LR3A 3RUXA 4TQFA 2JGUA 3MEYA 1G5HA 1Z5WA 2F93B 1M4UA 5IJ9B 4DR6B 4DV6B 1RSOA 2JVDA 1X55A 1X01A 1T5EA 3BJUA 4O2DA 2DQ0A 2P22C 2DZCA 4H2TA 1NYRA 3HXXA 2QM4A 2Q7GA 4IHJB 2DQ3A 4FVMA 3LNNA 4I55B 1RIQA 5EZYA 3N2KA 2ZXFA 3SGIA 4EB6B 1YEWA 3WB2A 1B76A 4X1YB 4Q6GA 1ADJA 4O4IA 5KHHA 2BTQA 4ZIBA 5CA0A 4D7TA 2HHHB 2CGHA 4P71C 4HWTA 3RL6A 5JQGA 2F66C 2AMCA 4YJ3B 5FPOA 4XTUA 1N34B 1IBKB 4YREA 2CAZC 5J2UB 4PI2A 4H2YA 2DXUA 4HA8A 3RWRD 5LYJA 1NJ8A 1B7YA 4EX5A 4LH7A 4YRCA 4X1YA 4YDQA 2DU5A 2UU9B 1NJ2A 3RYHB 2XTIA 5KHIA 3MF1A 5CA1B 1TVKA 3BHPA 4PHZA 1JJCB 5J2TA 4GKKB 3ERRA 4P73C 4K86A 4O4JA 2YI8A 3V8JA 1QQCA 4XTXA 4LH6A 4TTVA 3JSLA 4WBNA 3K58A 2ZZGA 3L2ZA 5IJ9A 4AH6A 3JARA 3K5LA 1B04A 1HXDA 2I4NA 4UCSA 1IBLB 2F4VB 2CIMA 2E41A 4K0KB 3NENA 4UCVA 4LVJA 2R72A 3L1AA 5JCOA 2DTOA 4CC5A 3A7RA 4B3RB 4TOIA 1WU7A 4G85A 3JAWB 5CB4A 1YFSA 4H2XB 5FNVA 4CH5A 1ATIA 1Z7NA 1KU9A 4WI1A 4RQFA 1Q8IA 2R70A 4LF8B 3HXWA 3SJBC 3TEHA 3G1ZA 4WJ4A 4YRTA 4P3NA 2P0LA 4P3OA 3V7RA 3ICAA 3UT5B 2C7IA 2QJ1A 4X1KB 2CJAA 5FPRA 3IKMB 3OD1A 3IALA 2QHUA 1C0AA 2ZNIA 2ARTA 4JI6B 3IAYA 2XHBA 4K8XA 1SKVA 5C52B 3A5YA 5BR8B 3JALA 2EJFA 3RYHA 4CH4A 4DR7B 2HNIA 2PMFA 4CH3A 4G84A 3QNEA 4LVLA 2ODRD 1KMMA 2ZIMA 4JV5B 1V9PA 4KR2A 4ZOLA 5JJJB 3U0ZA 5GONA 4YJ3A 4H2SA 4XTYA 5E3IA 1EQRA 4YP0A 4JI5B 1E22A 4F6RA 4YYEA 1M5IA 3RGBA 3T1HB 4LNUA 3REUA 3JARB 4DV0B 4LVMA 4YJ2B 4YCUA 5EIBC 5LXTB 1JFFB 4YRKA 3RYCA 3LSSA 3HFVA 1L0WA 4JYAB 1WN7A 5LP6C 3HXZA 4YRIA 3UQ8A 4GKJB 4JI2B 4CS3A 5J2TB 2ARSA 3QO7A 3E22B 5JVDB 3WQZA 1JJOA 1BBWA 2RHSA 3HRIA 2RHQB 2P5OA 4P72C 1BIAA 4YJ2A 2ZINA 1X54A 1HC7A 2PYJA 4TV9B 4CS2A 2E5AA 2AMCB 4YRQA 4YPFA 3UFGA 4HWRA 5LP6A 1BBUA 1E1OA 2GV9A 4X65B 3CB2A 4O2AB 2EL9A 2J3MA 4AILC 2C8MA 2I4MA 3WB0A 3A7UA 3HRKA 2VQFB 4EO4A 4IHJA 2OYQA 3BABA 2Q7EA 3UGQA 5JJEB 4K8ZA 4LFAB 5ITZA 1J5WA 3JSNA 1QHTA 4FLUA 1HTTA 4GYCB 4X5OA 2CJ9A 4OP0A 3ICXA 4U3JB 2ARUA 4YROA 1LYLA 4YRLA 1HW7A 4DV1B 2VWJA 4B3MB 1N33B 2ZZEA 2ODRC 3M4PA 4UP7A 4WF2A 1Q43A 4I50B 4X62B 3BFMA 1XHZA 4DK0A 4RMFA 4UCOA 4CH6A 1H4TA 4IIJA 4KHPB 4JI7B 2AKWA 4TV8B 4YCWA 12ASA 4LF7B 4FLZA 1SERA 2V4DA 1PYSA 4TQDA 4DR2B 2QHVA 2EWNA 4JI1B 1NNHA 3UGTA 3RYFA 1EOVA 2UXCB 2E1HA 1Q3EA 3HXVA 1YFTA 1NT2B 1SETA 2Q5IA 2QHTA 2ZZFA 1JJCA 3A2FA 3K5MA 3MQZA 1EIYA 4BWAA 1NJ5A 2E3CA 3P8TA 3LC0A 4LVIA 5LMNB 3JATB 2ZTGA 1H4VB 2OWOA 3VQWA 2QHSA 4NVPA 5LYJB 4H2WA 2PYLA 4K88A 4EEQA 3LSQA 2KKWA 2DJZA 4P74C 3HKDA 3FFQA 5C8YA 3VQYA 2ZR3A 1TAEA 3VQXA 2UXDB 4PHCA 1X4TA 4H02A 1SA0B 1KOGA 2BTOA 4YRNA 4EFEA 4FLTA 3RIRA 3HY0A 3EFRA 4HWOA 4UCRA 1B70B 3B2EE 1Q5OA 2YIBA 4LF9B 3RKWA 4XU2A 4O4HA 5LA6A 2CJBA 5JCOC 1QE0A 1TVKB 4X66B 1X56A 4I4TA 2E10A 4YRGA 3DSQA 1TUBB 4LFCB 4LNUB 5ELNA 3A31A 1J5EB 3K5NA 1S5JA 1Z7MA 4FFBA 3U11A 3HY1A 4E51A 1TA8A 3HKDB 5JQGB 4TV9A 5GONB 3K59A 3REXA 1X2GA 1I94B 2PUSA 5KMGB 3A74A 1X2HA 4L8JA 5C51B 4O4IB 4DR1B 1E1TA 1GGMA 2E5LB 3HXYA 1WYDA 1G5IA 2VQEB 5D5QA 2RHSB 3P8VA 5BMVB 3PCOA 3CMQA 2FYKA 1EIYB 5EZYB 4DV4B 4LF5B 2EJGA 4UPAA 2YIAA 3HTZA 4LF4B 1Z5VA 2IM9A 2A8EA 4P71A 5KX5A 1TGOA 1N32B 3RFRA 4JI0B 2NS6A 3RYCB 3UT5A 3UH0A 1PYSB 5LXTA 4UCTA 1P49A 1VF7A 1XI1A 2P5IA 3TEHB 4LVKA 4IIJB 3PZCA 4P75A 3RKYA 4B08A 5BMVA 1SQGA 2Q0AA 3IG2A 4DV3B 3M7MX 1FFXB 1IBMB 2PGGA 4XU1A 4ZOLB 4XTVA 4P73A 3PN1A 1WPYA 4P3PA 11ASA 5KNNA 3NETA 4TVYA 3RACA 4D7SA 1JMKC 3K5OA 3VQVA 5KMGA 4DR4B 2UXBB 2ZT7A 4WJ3M 4TUYB 4FLYA 3QTCA 3E9HA 1SQFA 2ZCEA 2RJZA 1HNZB 3RF1A 3E9IA 3JALB 1YGBA 2XGTA 3T1YB 2J3LA 4P75C 3THOA 2ZM6B 5LMUB 4B3SB 5ITZB 3R07A 1H4SA 2UUAB 3BAAA 2DKGA 2DU7A 2Q5HA 4DPGA 3L4GB 3JAKB 1L8DA 5JH7B 4O4HB 5LA6B 4AHCA 4NCXA 4ZTZB 4TVAB 4XEOA 3ZEDA 1B70A 5IYZA 2ZGWA 5FNVB 4YRJA 3JAWA 1B8AA 1O9HA 1SA0A 2ZIOA 1XMQB 4HNAB 4RQEA 5JJNB 1N36B 3SJCC 4DV2B 1SESA 4TWAA 4X64B 1WNSA 1H2SB 3ETQA 3EFSA 1FFXA 2E65A 4TVAA 4DV7B 3V7CA 3BA8A 4ZHQA 4O4JB 1WQ7A 4K87A 3ZS8C 4O2BA 4HT4A 1SRYA 3FJPA 5ELOA 3MAQA 3HFZB 4YRFA 5KHGA 3WB1A 4FM1A 4FLVA 1JFFA 1EFWA 3RYFB 4EFBA 4YRSA 4OX9B 1XQ8A 2E64A 1WPBA 5J2UA 3K57A 3HKBB 4O4LA 4FM0A 2DDZA 3NEMA 4UP9A 3PCOB 5LOVA 1HR0B 2ZT6A 2AKWB 4H2UA 4DK1A 4XTWA 1EVKA 2JS5A 3RYIA 4ZI7B 3QO8A 5CA0B 4H2VA 4JI4B 1EVLA 2BTQB 4HVCA 5LOVB 2F1MA 3HKCA 4DUZB 5F5WA 4YRPA 4LF6B 2IY5A 3N2KB 4HBNA 4P72A 4I55A 5HGQA 3A7AA 2EAYA 1O9GA 1W66A 1YFRA 2I4OA 1USYC 1I7FA 5KHJA 4B3TB 4U3JA 5C53B 3W3SA 4UFZA 5D5PA 3JASB 2DTHA 2R9AA 4OLFA 5K1PA 4O2BB 1N9WA 3A5ZA 4DR5B 3BA9A 1BIBA 3HXUA 2UUCB 2G4CA 1XNRB 4YRRA 4KR3A 3V8KA 2Q7HA 2IY5B 3V8LA 4RDXA 4KL1A 5CB4B 4H2XA 1HNWB 1XHXA 1FYFA 3OTFA 3A32A 3TUPA 2ZT5A 1VQZA 4AQYB 4DV5B 4ZI7A 1USYA 3P8YA 2YI9A 1WLEA 1G6UA 4LFBB 3OTOB 4LNSA 4XTZA 4I9QA 4FM2A 4X20B 2YXLA 3IKLA 2RQ6A 5EYPB 5IJ0A 4HWPA 4J15A 1G51A 3MF2A 4XU3A 4WBNB 3HKBA 4O4LB 4YRMA 1NYQA 4X1IA 2F95B 4DRXA 4ZTUB 3U10A 3N2GB 4BW9A 1TUBA 3JATA 5JH7A 1M93A 2RHQA 4I4TB 3V7SA 4KQEA 3JAKA 1XMOB 2DVEA 4L87A 3TEGA 2PY5A 3E22A 5JVDA 3HFZA 5CA1A 2PZSA 2PTMA 4YCVA 4YY3B 2DZ9A 1H4QA 2DTIA 3QO5A 4ZHQB 1ASYA 4NXMB 1WQWA 1B7YB 1DGSA 4JI8B 5K1XA 2ZNJA 3VBBA 3HKEA 5EYPA 5IJ0B 3RGLA 1NJ1A 1KMIZ 4GLXA 2VWKA 4YHHB 3KFUA 4F6RB 5EIBD 4HNAA 5C8YB 3SR2C 4Q15A 1QF6A 3NELA 3CHXA 3SJAC 3HKEB 4I50A 4CS4A 5IYZB 3BRCA 4EB6A 1HNXB 1ASZA 1ZAUA 4FLXA 1FJGB 1NJ6A 4FLWA 4DUYB 1KMNA 4DQ2A 4JI3B 3L4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P74 A;  3RKX A;  2DEQ A;  4XEM A;  3M4Q A;  4XU0 A;  2ZR2 A;  4HWS A;  2I4L A;  2ZT8 A;  1WNL A;  2DXT A;  4TVW A;  2YIB D;  1ADY A;  2ALY A;  2EJ9 A;  3I7F A;  1E24 A;  4PG3 A;  4UP8 A;  1YB3 A;  2PME A;  2ALY B;  1IL2 A;  2HEP A;  3RUX A;  4TQF A;  3MEY A;  1G5H A;  2JVD A;  1X55 A;  1X01 A;  4O2D A;  3BJU A;  2DQ0 A;  2DZC A;  4H2T A;  1NYR A;  3HXX A;  2Q7G A;  2DQ3 A;  1RIQ A;  2ZXF A;  1B76 A;  1ADJ A;  4ZIB A;  2CGH A;  4P71 C;  4HWT A;  3RL6 A;  2AMC A;  4XTU A;  4YRE A;  4H2Y A;  4HA8 A;  2DXU A;  1NJ8 A;  1B7Y A;  4EX5 A;  4YRC A;  4YDQ A;  2DU5 A;  1NJ2 A;  2XTI A;  3MF1 A;  3BHP A;  1JJC B;  3ERR A;  4P73 C;  4K86 A;  2YI8 A;  3V8J A;  4XTX A;  4TTV A;  4AH6 A;  2ZZG A;  3L2Z A;  1HXD A;  2I4N A;  2CIM A;  2E41 A;  3NEN A;  2R72 A;  3L1A A;  2DTO A;  3A7R A;  1WU7 A;  4G85 A;  4H2X B;  1YFS A;  4CH5 A;  1ATI A;  1Z7N A;  4WI1 A;  4RQF A;  2R70 A;  3HXW A;  3TEH A;  4WJ4 A;  3G1Z A;  4YRT A;  4P3N A;  2P0L A;  4P3O A;  3V7R A;  3ICA A;  2C7I A;  2QJ1 A;  1C0A A;  2CJA A;  3IKM B;  3OD1 A;  3IAL A;  2QHU A;  2ZNI A;  2ART A;  5C52 B;  3A5Y A;  2EJF A;  4CH4 A;  2HNI A;  2PMF A;  4CH3 A;  4G84 A;  3QNE A;  2ODR D;  1KMM A;  2ZIM A;  4KR2 A;  4XTY A;  4H2S A;  5E3I A;  1EQR A;  4YP0 A;  1E22 A;  4YYE A;  3REU A;  4YCU A;  4YRK A;  3LSS A;  3HFV A;  1L0W A;  3HXZ A;  4YRI A;  4CS3 A;  2ARS A;  3QO7 A;  3WQZ A;  1BBW A;  2RHS A;  3HRI A;  2RHQ B;  4P72 C;  1BIA A;  2ZIN A;  1X54 A;  1HC7 A;  4CS2 A;  2E5A A;  2AMC B;  4YRQ A;  4YPF A;  3UFG A;  4HWR A;  1BBU A;  1E1O A;  2EL9 A;  2J3M A;  2C8M A;  2I4M A;  3A7U A;  3HRK A;  4EO4 A;  2Q7E A;  3UGQ A;  1J5W A;  1HTT A;  4X5O A;  2CJ9 A;  4OP0 A;  2ARU A;  4YRO A;  1LYL A;  4YRL A;  2ZZE A;  2ODR C;  3M4P A;  4UP7 A;  4WF2 A;  3BFM A;  4RMF A;  4CH6 A;  1H4T A;  2AKW A;  4YCW A;  12AS A;  1SER A;  1PYS A;  4TQD A;  2QHV A;  2EWN A;  1NNH A;  3UGT A;  1EOV A;  2E1H A;  3HXV A;  1YFT A;  1SET A;  2Q5I A;  2QHT A;  2ZZF A;  1JJC A;  1EIY A;  4BWA A;  1NJ5 A;  3P8T A;  2E3C A;  3LC0 A;  2ZTG A;  1H4V B;  3VQW A;  2QHS A;  4H2W A;  4K88 A;  3LSQ A;  2DJZ A;  4P74 C;  3VQY A;  2ZR3 A;  3VQX A;  4PHC A;  4H02 A;  1KOG A;  4YRN A;  3RIR A;  3HY0 A;  3EFR A;  4HWO A;  1B70 B;  2YIB A;  3RKW A;  4XU2 A;  2CJB A;  1QE0 A;  1X56 A;  2E10 A;  4YRG A;  3DSQ A;  5ELN A;  3A31 A;  1Z7M A;  3HY1 A;  4E51 A;  3REX A;  1X2G A;  2PUS A;  3A74 A;  1X2H A;  5C51 B;  1E1T A;  1GGM A;  3HXY A;  1WYD A;  1G5I A;  3PCO A;  2RHS B;  3P8V A;  3CMQ A;  2FYK A;  1EIY B;  2EJG A;  4UPA A;  2YIA A;  3HTZ A;  4P71 A;  3UH0 A;  1PYS B;  2P5I A;  3TEH B;  3PZC A;  4P75 A;  3RKY A;  3IG2 A;  2PGG A;  4XU1 A;  4XTV A;  4P73 A;  4P3P A;  1WPY A;  11AS A;  5KNN A;  3NET A;  4TVY A;  3RAC A;  4WJ3 M;  3VQV A;  2ZT7 A;  3QTC A;  3E9H A;  2ZCE A;  2RJZ A;  3RF1 A;  3E9I A;  1YGB A;  2XGT A;  2J3L A;  4P75 C;  3R07 A;  1H4S A;  2DKG A;  2DU7 A;  2Q5H A;  4DPG A;  3L4G B;  4NCX A;  4ZTZ B;  4XEO A;  4TVA B;  3ZED A;  1B70 A;  2ZGW A;  4YRJ A;  1B8A A;  1O9H A;  2ZIO A;  4RQE A;  1SES A;  4TWA A;  3EFS A;  2E65 A;  4TVA A;  3V7C A;  1WQ7 A;  4K87 A;  1SRY A;  3FJP A;  5ELO A;  3HFZ B;  4YRF A;  1EFW A;  4YRS A;  2E64 A;  4UP9 A;  2DDZ A;  3NEM A;  3PCO B;  2ZT6 A;  2AKW B;  4H2U A;  4XTW A;  1EVK A;  3QO8 A;  4H2V A;  1EVL A;  4HVC A;  5F5W A;  4YRP A;  2IY5 A;  4P72 A;  5HGQ A;  3A7A A;  2EAY A;  1O9G A;  1W66 A;  1YFR A;  2I4O A;  1USY C;  5C53 B;  3W3S A;  2DTH A;  4OLF A;  5K1P A;  1N9W A;  3A5Z A;  1BIB A;  3HXU A;  2G4C A;  4YRR A;  4KR3 A;  3V8K A;  2Q7H A;  2IY5 B;  3V8L A;  4RDX A;  4H2X A;  1FYF A;  3A32 A;  3TUP A;  2ZT5 A;  1VQZ A;  1USY A;  3P8Y A;  2YI9 A;  1WLE A;  1G6U A;  4LNS A;  4XTZ A;  3IKL A;  2RQ6 A;  4HWP A;  4XU3 A;  4J15 A;  1G51 A;  3MF2 A;  4YRM A;  1NYQ A;  4ZTU B;  4BW9 A;  2RHQ A;  3V7S A;  4KQE A;  4L87 A;  2DVE A;  3TEG A;  3HFZ A;  4YCV A;  2DZ9 A;  1H4Q A;  2DTI A;  3QO5 A;  1ASY A;  1WQW A;  1B7Y B;  5K1X A;  2ZNJ A;  3VBB A;  3RGL A;  1NJ1 A;  3KFU A;  4Q15 A;  1QF6 A;  3NEL A;  4CS4 A;  1ASZ A;  1NJ6 A;  1KMN A;  4DQ2 A;  4Q6G A;  3L4G A; 
#chains in the Genus database with same CATH topology
 2HR3 A;  1GK9 A;  1ZWI C;  1R3L C;  4DR2 O;  2I4L A;  4GX2 A;  5KHK A;  3AK1 A;  4UCU A;  1D5A A;  4X1I B;  3DC5 A;  4MSW C;  1E24 A;  3QF7 A;  1WB7 A;  4QE7 A;  2PME A;  1GN2 A;  4CC6 A;  3W7T A;  4LR3 A;  3RUX A;  4TQF A;  1LNQ A;  2JK5 C;  3K0G A;  3MEY A;  5LHH A;  1YDX A;  4MT8 A;  4DV6 B;  2RMK B;  1IDS A;  1XBL A;  4NKG B;  5CBG A;  2CTW A;  1Q81 W;  2OTL V;  2QM4 A;  4IHJ B;  4DUZ O;  4JZ2 A;  3OR6 C;  3SGI A;  5E79 Z;  4EB6 B;  3T4Z A;  2QWQ B;  4O4I A;  3O9O A;  2HHH B;  3AEI A;  4P71 C;  4FK5 C;  4HWT A;  2F66 C;  2AMC A;  3JD0 A;  5LYJ A;  1B7Y A;  4YRC A;  2DU5 A;  3IFX A;  3BHP A;  4HZ3 A;  4PHZ A;  1JJC B;  4QE9 A;  1FD9 A;  5B1B B;  4P73 C;  4O4J A;  1X59 A;  2P7T C;  2OTJ V;  5IJ9 A;  4Q20 A;  1HXD A;  4JI5 O;  4UCV A;  1HNZ O;  4R6Z A;  4MVQ A;  1PD3 A;  3A7R A;  4B3R B;  4TOI A;  4G85 A;  2RN9 A;  5CB4 A;  1YFS A;  1RPO A;  4WI1 A;  4RQF A;  1Q8I A;  4B3R O;  2R70 A;  3X2Q C;  1N36 O;  2EZP A;  4KP4 A;  3SJB C;  5B3S B;  3TEH A;  4WJ4 A;  4X1K B;  5FPR A;  3IAL A;  1OCZ C;  2ZNI A;  2WA4 A;  2XHB A;  4K8X A;  2EZO A;  1VQ5 V;  1I5X A;  1OHH G;  3JAL A;  1AJP A;  4DR7 B;  1W0J G;  2HNI A;  3QNE A;  2WLL A;  2ODR D;  1XUQ A;  4JV5 B;  1UPG A;  5B1A B;  4DR1 O;  5JJJ B;  5GON A;  4YJ3 A;  1XNR O;  2Q6A A;  2C2A A;  4KHP O;  2ZE6 A;  4YCU A;  3IC9 A;  5EIB C;  2OCC B;  1JFF B;  4NR1 A;  4YRK A;  1D2D A;  1L0W A;  3IGA C;  4JYA B;  5LP6 C;  3HXZ A;  1LR1 A;  5B1A C;  4GKJ B;  1HDJ A;  1IZ3 A;  3ZHT A;  1F4N A;  2EIL B;  3HRI A;  4P72 C;  3CCE V;  1MMM A;  2PYJ A;  2BOB C;  4TV9 B;  4YRQ A;  3CRC A;  2Q4P A;  1K33 A;  3UFG A;  4HWR A;  4OPA A;  3FB5 C;  1Q6H A;  1V55 C;  4AIL C;  1JJ2 U;  1V55 B;  2ZE7 A;  1KKD A;  1MSD A;  4EO4 A;  4IHJ A;  4B7E A;  2OYQ A;  1BS3 A;  2UXX A;  3UGQ A;  4LFA B;  4OX9 O;  3SYQ A;  2D3O W;  4X5O A;  4YIO A;  3ICX A;  2DOS A;  4LWS B;  4YRL A;  3CP1 A;  4J80 A;  1S5L Z;  2Q9L A;  2ODR C;  2QTO A;  2JDI G;  4UP7 A;  1FXK B;  3ASO B;  1VQP V;  4LF9 O;  1IUR A;  4DK0 A;  2M7W A;  1BQZ A;  4UCO A;  1FXK A;  3AG4 C;  4IIJ A;  4KHP B;  4YCW A;  2KG7 B;  12AS A;  4H13 B;  4LF7 B;  2F4V O;  4DR2 B;  1NNH A;  4PV1 B;  2Y69 C;  4OXS A;  1EOV A;  2QHT A;  2GHY A;  1FYJ A;  1NJ5 A;  2E3C A;  3A0R A;  3CCL V;  2ZTG A;  1H4V B;  1XDC A;  2JJ2 G;  4EEQ A;  3LSQ A;  1BZK A;  4GX0 A;  2ETN A;  3HKD A;  1OZ0 A;  4X8A A;  2UXD B;  3SYA A;  2QKA A;  3ABK C;  4EFE A;  4FLT A;  3RIR A;  2LW1 A;  3HB3 B;  1N0N A;  3EFR A;  1EZV H;  1KB9 F;  1YSC A;  2YIB A;  4HYO A;  4O4H A;  3SYC A;  3AK3 A;  4I4T A;  4YRG A;  4LFC B;  1KP3 A;  3A31 A;  3K5N A;  1S5J A;  4FFB A;  2JEX A;  2NLJ C;  4E51 A;  1TA8 A;  4J7K A;  4PA3 A;  3ETD A;  1PP9 H;  4GT1 A;  1G5I A;  3PCO A;  5BMV B;  3OFN G;  2HVJ C;  2FYK A;  5EC1 C;  3CCM V;  4LF4 B;  2IM9 A;  1L0N H;  2WPD G;  2NS6 A;  4UCT A;  2LFS A;  2P5I A;  3TEH B;  3WG7 C;  3ZMT A;  2A0L A;  1VF6 A;  2RNB A;  4P75 A;  3RKY A;  2X6A A;  1DK1 A;  5BMV A;  3CCU V;  1FXV A;  2WLK A;  3IG2 A;  3G67 A;  5KNN A;  1G8M A;  2QA4 V;  2UXB B;  3VQV A;  4DR4 B;  5CA3 A;  3TJT A;  4TUY B;  4FLY A;  3AG1 B;  2ZDI C;  3OE7 G;  3E9I A;  3B77 A;  1YGB A;  2XGT A;  2XUM A;  3ZN1 A;  2QR4 A;  4NYK A;  1NTM H;  4MVS A;  5ITZ B;  4WFF A;  2DU7 A;  2UXB O;  1J5E O;  1L8D A;  4O4H B;  2BSK B;  4IYH A;  4JF3 A;  4QPK A;  2YEV B;  5L3B A;  3D3I A;  5FNV B;  4JI1 O;  3JAW A;  1B8A A;  2LO1 A;  2ZIO A;  1EN6 A;  1H2G A;  2ATK C;  4RQE A;  3SJC C;  3A8T A;  1SES A;  3ABM C;  1WNS A;  5L3G A;  4B3T O;  2ITD C;  2E65 A;  2L6L A;  2R9I A;  5BXZ A;  2CH7 A;  3BA8 A;  2F43 G;  4O2B A;  1OJH A;  1SRY A;  5ELO A;  3MAQ A;  3HFZ B;  4YRF A;  5KHG A;  4J41 A;  3R66 A;  4FLV A;  2AGA A;  3AG2 C;  4YRS A;  3G6B A;  3ZMZ A;  2E64 A;  4I7Z B;  1WPB A;  3CCQ V;  3NEM A;  3W7U A;  4DV5 O;  1NI8 A;  2ZT6 A;  4DK1 A;  3QO8 A;  1GKF A;  1WB8 A;  4X66 O;  2F1M A;  4DUZ B;  1IBK O;  1S5H C;  2IY5 A;  4U3F H;  2EAY A;  4JZG A;  1YFR A;  4XDK A;  5KHJ A;  1XEQ A;  3W3S A;  5IY5 C;  2CTR A;  1GN6 A;  1N9W A;  1BHA A;  3A5Z A;  3HXU A;  1K97 A;  2UUC B;  2GBO A;  2G4C A;  1IBL O;  4B3M O;  2IY5 B;  4MVU A;  3UCS C;  3L73 H;  5KAI Z;  5L3E A;  4H2X A;  1XHX A;  1M9N A;  2VRZ A;  3TUP A;  4NXN O;  3OUF A;  4LFB B;  1Y4M A;  2FML A;  4UB8 Z;  1NR1 A;  4X1I A;  3K0D A;  3CCR V;  2D2C B;  2CTQ A;  1TUB A;  5JH7 A;  3AG4 B;  3OEH G;  3SDL A;  1QNM A;  1JR9 A;  2PZS A;  4JI7 O;  4A5U B;  1QR9 A;  1H4Q A;  3QO5 A;  2WLN A;  4NXM B;  3ZIA G;  2A79 B;  3C3T A;  1U96 A;  4JI8 B;  2ZNJ A;  3VBB A;  2ZM6 O;  3ZMS A;  1OCR C;  2UXN A;  2VWK A;  5EIB D;  3A0H Z;  3LNM B;  5C8Y B;  4JAU A;  3SJA C;  4N23 A;  1KP2 A;  2FTK A;  1HNX B;  1AR4 A;  4BW5 A;  2BSK A;  1BMF G;  4JI3 B;  2ZXW C;  4PD4 F;  2JEU A;  3ZX6 A;  3RKX A;  4G2K A;  3AK2 A;  1CEZ A;  4XU0 A;  1I5Y A;  5B1O A;  2ZR2 A;  5LGU A;  1OCR B;  4MTF A;  2ZDI A;  4DRX B;  4X1K A;  2ZT8 A;  5KA6 A;  4TVW A;  2EX3 A;  1XNQ B;  3CWB H;  2UUB B;  4TV8 A;  3EVK A;  2UUA O;  2AZ0 A;  3CRR A;  4FIP C;  4PG3 A;  4YXW G;  1K73 W;  4J9Y B;  3I5D A;  5LP6 B;  4LP8 A;  2ALY B;  2HEP A;  2IU0 A;  4F4L A;  1G4Y B;  1G5H A;  5IJ9 B;  3T4D A;  2HHH O;  1X55 A;  4O2D A;  2EIN C;  1PL4 A;  2Q7G A;  1VEW A;  2DQ3 A;  4I55 B;  1BT8 A;  3RBZ A;  1AI4 A;  2ZXF A;  1AP6 A;  1YEW A;  2DWD C;  1B76 A;  2FKX A;  3BCC H;  4Q6G A;  3DXR B;  5IYD O;  5KHH A;  2HJD A;  2QWN B;  2ITC C;  5EBM C;  5JQG A;  2GSM B;  4YRE A;  2CAZ C;  4PI2 A;  4HA8 A;  2DXU A;  1NJ8 A;  3H1J H;  4EX5 A;  4LH7 A;  4X1Y A;  4YDQ A;  3CYO A;  1YJN V;  1VQO V;  5CA1 B;  2XOK G;  5J2T A;  3OTO O;  4WFH A;  1JVM A;  2IJI A;  1QQC A;  1ZX3 A;  3K03 A;  4LH6 A;  1HNW O;  2LW7 A;  3JSL A;  3STL C;  4AH6 A;  3L2Z A;  3CJH A;  5HFM A;  1M56 B;  2HKO A;  3AG2 B;  2F4V B;  3NEN A;  4K0K B;  2DYR C;  2IJH A;  3LSU A;  3P3P A;  2QWP B;  5JCO A;  4CC5 A;  5B1B C;  4DO2 A;  1A32 A;  2IJK A;  1XIL A;  1FPO A;  3CD6 V;  3B4S A;  1Y76 B;  4P3O A;  3ABM B;  4W4L A;  3V7R A;  3UT5 B;  2QJ1 A;  1C0A A;  5LMU O;  4B3S O;  3IKM B;  2Q8V A;  2Q5Z A;  1M57 B;  1W59 A;  3CC2 V;  2G38 A;  3A5Y A;  2UUB O;  5IYC O;  3RYH A;  4CH4 A;  1YZB A;  2PMF A;  2B9Z A;  2XAF A;  3E8H A;  3E86 A;  4H2S A;  5LL6 Y;  1E22 A;  4F6R A;  4YYE A;  1M5I A;  3OMN B;  3T1H B;  1WAZ A;  3ABL C;  3CMA V;  3JAR B;  4ZKI A;  5LXT B;  3WFV A;  5CBH A;  3RYC A;  4DR6 O;  3LSS A;  3HFV A;  1WN7 A;  4TT3 G;  5A9G A;  2GUZ A;  1ROP A;  4CS3 A;  1MZF A;  2EIK B;  5J2T B;  3E22 B;  3WQZ A;  4D6T H;  2QKS A;  2P5O A;  1BIA A;  4YJ2 A;  1HC7 A;  3CME V;  1GO3 F;  2Z3Y A;  1S3J A;  1BBU A;  2GV9 A;  5KAF Z;  4X65 B;  4TWK A;  3B40 A;  2EL9 A;  4K3A A;  3SYO A;  4KUM A;  5L3C A;  3VOU A;  2WWW A;  4X65 O;  2I4M A;  1VQM V;  3DC6 A;  2E76 B;  4LF7 O;  1QLE C;  3HRK A;  3M8A A;  2VQF B;  1VF5 B;  1XNQ O;  1THZ A;  1J5W A;  3JSN A;  1ZL8 B;  1HTT A;  4GYC B;  2DYR B;  4J11 A;  4U3J B;  2EBO A;  4DV1 B;  4B3M B;  1U97 A;  5LBQ A;  3TCU A;  2DJV A;  1Q43 A;  4LF8 O;  4I50 B;  1QBZ A;  3BFM A;  1SQP H;  1HNX O;  2XAH A;  1NH2 B;  1NTZ H;  2LGW A;  4X9Q A;  2X0L A;  4IL6 Z;  4TV8 B;  3DTU B;  4FLZ A;  2V4D A;  3T2M A;  2QHV A;  4ZBM A;  2EIJ B;  2H3O A;  2EUL A;  4H37 A;  1N8R W;  1YFT A;  1NT2 B;  2MK3 A;  5HFL A;  1JJC A;  4PA6 A;  1AI6 A;  3CS5 A;  3P8T A;  1URF A;  4QJF B;  4DW1 A;  5KLV H;  2IW5 A;  4NVP A;  5LYJ B;  2HFE C;  1F23 A;  2KKW A;  2QTS A;  3CRQ A;  4P74 C;  5C8Y A;  3ZMV A;  1TAE A;  4PHC A;  4H02 A;  1UJW B;  1NS1 A;  4UCR A;  1B70 B;  5IT9 N;  1KC8 W;  3MD0 A;  4LF9 B;  4XU2 A;  2CJB A;  5JCO C;  3OUS A;  1N4C A;  2P06 A;  1KKC A;  4J42 A;  5BY1 A;  1M56 C;  1YVW A;  3U11 A;  3HY1 A;  3M99 B;  1PPJ H;  4WFG A;  1E79 G;  3K59 A;  1X2G A;  3A74 A;  1X2H A;  2A3Q A;  4O4I B;  4R7C A;  2H94 A;  1E1T A;  1GGM A;  2E5L B;  1JCH A;  1EIY B;  3FX7 A;  3K3W A;  4LF5 B;  2Q67 A;  2YIA A;  4MVO A;  4DR4 O;  1Z5V A;  4P71 A;  4U7O A;  3RFR A;  4JI0 B;  1V54 C;  3UH0 A;  1COW G;  1PYS B;  5LXT A;  1P49 A;  4ASU G;  4LVK A;  4IIJ B;  1JX9 A;  3PZC A;  2Q0A A;  1FFX B;  1IBM B;  2QE7 G;  4FMT A;  4JI8 O;  2DE0 X;  4ZOL B;  3JYC A;  3J7A U;  4FFK A;  4P3P A;  1WPY A;  4P73 A;  1QLN A;  4TVY A;  3RAC A;  4D7S A;  1JMK C;  1YJW V;  2ZT7 A;  2ZD9 A;  3QTC A;  2ZCE A;  2RJZ A;  1NVP D;  2FL4 A;  4IYI A;  2YEV A;  1WP8 A;  4JYC A;  4OGQ B;  4X89 A;  1L1F A;  4WFB V;  3R07 A;  3RVY A;  3BAA A;  4DPG A;  1AI5 A;  2GDS A;  1Q6I A;  2Y48 A;  1Q6U A;  5H2F Z;  1B70 A;  4K0K O;  1V54 B;  2K9P A;  4HNA B;  2ARH A;  3AG3 B;  3F7V C;  1N36 B;  5KUM A;  4TWA A;  4X64 B;  5GTI Z;  5B3S C;  4TVA A;  3X2Q B;  3V7C A;  2GTS A;  3CCS V;  3UO3 A;  2LP7 A;  3WB1 A;  1B6Q A;  1JFF A;  1EFW A;  4EFB A;  3TXQ A;  2WLI A;  5H9C A;  5J2U A;  1YTF B;  2DDZ A;  3ZN0 A;  3PCO B;  3W7X A;  2AKW B;  4Z1M G;  1AIL A;  4ZI7 B;  5CA0 B;  3K04 A;  1AI7 A;  1EVL A;  2ADP A;  4PA4 A;  5LOV B;  1K92 A;  3HKC A;  4YRP A;  3ABU A;  2X7R B;  1IXM A;  3N2K B;  3Q4H B;  2Q68 A;  4I55 A;  2DYS C;  4LFB O;  4PA7 A;  4U3J A;  1EM1 A;  2DTH A;  1FFT B;  4W4K A;  4DR5 B;  5JWP A;  4UUJ C;  4KR3 A;  1K4C C;  1H38 A;  4RDX A;  4KL1 A;  1MZE A;  5CB4 B;  3ZRS A;  1HNW B;  2NR5 A;  1VQZ A;  4AQY B;  4ZI7 A;  3P8Y A;  2YI9 A;  5IY5 B;  3OTO B;  4LNS A;  4GZR B;  4FM2 A;  1VQ8 V;  2YXL A;  4FJC C;  4LF6 O;  1P84 F;  3HKB A;  3LDD A;  4O4L B;  5L3F A;  5FL7 G;  3I56 V;  1NYQ A;  2PI5 A;  3AG1 C;  3U10 A;  1GMG A;  4BW9 A;  3N2G B;  4QNH B;  4BIO A;  4I4T B;  3V7S A;  4KQE A;  3OAA G;  4L87 A;  1FKA O;  4JI3 O;  5JVD A;  2PY5 A;  2WLH A;  5LMN O;  2KB1 A;  3L9D A;  4GX5 A;  4JYB A;  2CGO A;  3KCX A;  1FS0 G;  1VIB A;  1WQW A;  1DGS A;  3WG7 B;  4FZ0 A;  1H8E G;  3ZHR A;  3OEE G;  3HKE A;  5EYP A;  5IJ0 B;  3G4S V;  1KMI Z;  3KFU A;  1D5N A;  1XL4 A;  3SR2 C;  4Q15 A;  1QF6 A;  3NEL A;  1GN4 A;  1XL6 A;  5H6R A;  2P4V A;  3L72 H;  3SPG A;  4YY3 O;  1FJG B;  1NJ6 A;  4FLW A;  4FZ1 A;  4DUY B;  2YUA A;  4DQ2 A;  2H8P C;  4PDM A;  5LHG A;  2UUC O;  2DEQ A;  5CN0 A;  3M4Q A;  3CXC U;  5A2Q N;  3QG5 A;  4HWS A;  3FAV B;  3APQ A;  2DXT A;  2YIB D;  3FKS G;  1Y76 A;  1R73 A;  3F7Y C;  4X20 A;  3O65 A;  2XT9 A;  2QEX V;  3I7F A;  1H2M A;  4PI0 A;  2K1E A;  3OW2 U;  4NXN B;  4DR3 B;  1IBM O;  2KSD A;  3BPZ A;  1JOY A;  2B1G A;  1P4R A;  5EBL C;  1NZ6 A;  1Z5W A;  3ABL B;  1M4U A;  3CJH B;  4DR6 B;  1RSO A;  1X01 A;  4UVA A;  3FB6 C;  3T1H O;  1NYR A;  5B1N A;  1G1X B;  4NTY A;  4FVM A;  3UKM A;  3F5T A;  1RIQ A;  1B3Q A;  2DWE C;  1AJN A;  1WA8 A;  4X1Y B;  2BTQ A;  1PNL A;  2CGH A;  3RL6 A;  4YJ3 B;  4XTU A;  1M90 W;  2OCH A;  4H2Y A;  3GWK C;  1H8H G;  1EN5 A;  3S3X A;  2XTI A;  5KHI A;  1H2K A;  2HG5 C;  1TVK A;  4E4E A;  1FJG O;  5KUK A;  3E89 A;  1RM1 C;  4K86 A;  1SQX H;  3V8J A;  4WFA V;  3RN4 A;  4XTX A;  1VQ9 V;  3K5L A;  1B04 A;  3ASN B;  1PKX A;  3TXS A;  4UCS A;  1IBL B;  2E41 A;  4RUF A;  4LVJ A;  3H01 A;  1TUE B;  2DTO A;  3IC7 A;  3JAW B;  3K9A A;  5FNV A;  1SC5 B;  3P30 A;  4ICG A;  4DV0 O;  4J7Z A;  4LF8 B;  1OCO C;  3HXW A;  3G1Z A;  1F51 A;  2NN4 A;  4P3N A;  4YRT A;  2P0L A;  3ABK B;  3OGC C;  3G80 A;  4BIZ A;  5CBF A;  2CJA A;  2QHU A;  1SZX A;  4JI6 B;  1BHB A;  4WF9 V;  2HVK C;  3Q4H A;  1HR0 O;  3UO2 A;  5BR8 B;  4J10 A;  2OIG A;  2HJF C;  1K34 A;  4LVL A;  1KMM A;  1VMG A;  2ZIM A;  3U0Z A;  4XTY A;  1ORQ C;  1VQL V;  3TK1 A;  3KKY A;  4JI5 B;  3RGB A;  1DTO A;  3REU A;  4P30 A;  1DLB A;  4ABM A;  4YJ2 B;  1NJI W;  4FPP A;  4C7U A;  2AW9 A;  2GUZ B;  2ARS A;  4XBF A;  4MW8 A;  1R6K A;  1JJO A;  1BBW A;  3FB7 C;  3B8M A;  2A9H A;  2L35 A;  1VQ6 V;  2E5A A;  4PDV A;  2AMC B;  4YPF A;  1E1O A;  1K7D A;  2UXC O;  3K08 A;  5EK0 A;  3HR0 A;  3E8B A;  1OCO B;  4JI4 O;  4DR3 O;  2QDO A;  3CC4 V;  1MSW D;  2C8M A;  3DGE A;  3A7U A;  1MA1 A;  2B5U A;  3I55 V;  2Q7E A;  2BE3 A;  4FLU A;  4OP0 A;  3ZRX A;  1L0L H;  4JAS A;  1LYL A;  4K35 A;  2VWJ A;  4GKJ O;  3L70 H;  1RM1 B;  1BE3 H;  1XHZ A;  4RMF A;  1JA8 A;  3GB7 C;  4GX1 A;  3ZJZ A;  3BY6 A;  1J95 A;  2A7W A;  3W7S A;  4X88 A;  4JI7 B;  1BCC H;  2IH3 C;  4YHH O;  4UV9 A;  1SER A;  4R50 A;  1QVF U;  1PYS A;  2EWN A;  2X6C A;  4JI1 B;  3G71 V;  2RCV A;  5BZB A;  3UGT A;  4PDR A;  1Q3E A;  2ZZF A;  1EIY A;  4BWA A;  4MVR A;  3LC0 A;  4LVI A;  5LMN B;  1GM7 A;  3ZRW A;  2OWO A;  1YXB A;  1SS3 A;  4K88 A;  1W2B U;  1KYO F;  3C3S A;  3WU2 Z;  2DJZ A;  5CMU A;  4PDL A;  3FFQ A;  3VQY A;  1NH2 D;  4J9Z B;  2ZR3 A;  2EIJ C;  4P2Z A;  1KOG A;  4YRN A;  1YIJ V;  3B2E E;  3OR7 C;  3GVM A;  2DW4 A;  3RKW A;  5LA6 A;  2EJ7 A;  4LF5 O;  2FB5 A;  1OV9 A;  5H5N A;  2UXD O;  1UFI A;  1QE0 A;  1NU1 H;  2UU9 O;  4X66 B;  1X56 A;  1E1R G;  2OT5 A;  3E83 A;  1Z7M A;  4KXR A;  4MS2 A;  4TV9 A;  5GON B;  5JQG B;  1I94 B;  1AP5 A;  2PUS A;  2JGD B;  1IX9 A;  4L8J A;  2WLL B;  5C51 B;  4DR1 B;  1PV0 A;  1XRE A;  1WYD A;  3ZHS A;  2VQE B;  1IVS A;  1US6 A;  2ZE5 A;  5D5Q A;  3P8V A;  3E8G A;  4PJ0 Z;  5EZY B;  2IU3 A;  3OM3 B;  4DV4 B;  2EJG A;  4Z1V A;  4JYA O;  2WLI B;  1NBM G;  3HTZ A;  2A8E A;  1IXB A;  5KX5 A;  3H1L H;  1N32 B;  2B1I A;  3QVN A;  2XTA A;  1VQ7 V;  1XI1 A;  2R9R B;  2AHY A;  1NKD A;  4XDJ A;  4B08 A;  1SQG A;  2IJJ A;  3JAM N;  1B06 A;  3TGU H;  4XTV A;  5TIS Z;  3PN1 A;  4DW0 A;  3APO A;  3CCJ V;  4WJ3 M;  5LGT A;  5BR8 O;  4WCE V;  1HNZ B;  2XAQ A;  3JAL B;  5IDJ A;  2VS0 A;  3THO A;  2ZM6 B;  1NR7 A;  3P3N A;  4H44 B;  3JD3 A;  2DKG A;  2Q5H A;  1R3I C;  2CE4 A;  2FYU H;  3JAK B;  1WP7 A;  5JH7 B;  5LA6 B;  4AHC A;  3RVZ A;  4WFE A;  4TVA B;  4X64 O;  2ZGW A;  1JPX A;  2HLD G;  4BIU A;  4YRJ A;  1O9H A;  1S76 D;  1CP9 A;  3ZHQ A;  2WLJ A;  5JJN B;  2Z5U A;  4DV2 B;  4NB5 A;  2DYS B;  2QM8 A;  1VF6 C;  1FFX A;  1ZSP A;  4O4J B;  3SPH A;  1WQ7 A;  3S3W A;  3ZS8 C;  4TSF G;  4HT4 A;  2BOC C;  2CTP A;  1F7Y A;  3F5W C;  1FAF A;  4FM1 A;  1YTF D;  3SYP A;  2QSA A;  1Q86 W;  4BR6 A;  2QKC A;  1EBO A;  1I94 O;  4OX9 B;  1XQ8 A;  4G27 B;  4DV6 O;  2EIM C;  3K57 A;  1HR0 B;  1ENV A;  1KBH A;  2CGN A;  2JS5 A;  3H1I H;  2N74 A;  4JI4 B;  4H2V A;  2BTQ B;  2E75 B;  1AR5 A;  2W0F C;  3FB8 C;  1NVP B;  4HVC A;  5EBW C;  3CEI A;  5H6Q A;  2QGN A;  4LF6 B;  4P72 A;  3A7A A;  5LGN A;  1W66 A;  3FAV A;  2I4O A;  3MDS A;  1ARO P;  1I7F A;  4PEL A;  4UFZ A;  5D5P A;  2YSU B;  3D3Q A;  4X62 O;  2AXT Z;  5K1P A;  4O2B B;  1BIB A;  3E8F A;  4YRR A;  3SPC A;  3FYE B;  2Q7H A;  1N33 O;  3LDE A;  1FYF A;  3OTF A;  4DYL A;  3ML0 A;  3RW0 A;  2ZT5 A;  2N04 A;  5LHI A;  4DV5 B;  1USY A;  1W0K G;  1WLE A;  4LF4 O;  1GN3 A;  1G6U A;  2EIN B;  4I9Q A;  4X20 B;  3BFR A;  2RQ6 A;  3JCZ A;  3P32 A;  5EYP B;  5IJ0 A;  3IKL A;  4HWP A;  4J15 A;  4WBN B;  4QPJ A;  1BL8 A;  2F95 B;  3E2E A;  4ZTU B;  2YXY A;  4JGS A;  1YIT V;  3JAT A;  1S0V A;  1KQS U;  3JAK A;  2DVE A;  3HFZ A;  4JAV A;  5CA1 A;  2PTM A;  4YCV A;  4YY3 B;  2QWR B;  1H2L A;  1FXK C;  1S77 D;  5K1X A;  4MVM A;  3H1H H;  3E35 A;  1NJ1 A;  5EC2 C;  2IH1 C;  2AZ2 A;  3CHX A;  2ZXW B;  3HKE B;  2JJ1 G;  1I08 A;  4I50 A;  3BRC A;  1ZAU A;  3K79 A;  4FLX A;  1YJ9 V;  2LFR A;  2ZQM A;  2CUG A;  1K4D C;  1QU7 A;  1Q7Y W;  4P74 A;  4XEM A;  3JAS A;  4DV1 O;  1NQT A;  5KX5 B;  3N2G A;  1QR8 A;  2Y4T A;  3ZRV A;  1WNL A;  3L74 H;  4UV8 A;  1ADY A;  3OMI B;  3HKC B;  2ALY A;  2EJ9 A;  1Y74 A;  4TUY A;  3BVO A;  5IWA B;  4UP8 A;  1R3K C;  1Y67 A;  3CSX A;  4O2A A;  3RYI B;  1YB3 A;  5GW7 A;  4U7N A;  1ZTE A;  4GCZ A;  3J81 N;  1IL2 A;  4FFB B;  2DN9 A;  3OGI B;  4BAY A;  2OCC C;  4XDL A;  2JGU A;  5FLX N;  2F93 B;  2JVD A;  4MVZ A;  2YS8 A;  4LFC O;  1T5E A;  3BJU A;  1EFR G;  2DQ0 A;  2P22 C;  2DZC A;  4H2T A;  1BSM A;  3HXX A;  1HP8 A;  2PF4 E;  2YID A;  1NTK H;  1SQV H;  3LNN A;  1JQ0 A;  4G28 B;  5EZY A;  3N2K A;  1GH6 A;  1R6T A;  2WSS G;  4MTO A;  3WB2 A;  1ADJ A;  4JI0 O;  3ZHV A;  2F23 A;  3B8N A;  4ZIB A;  5CA0 A;  3D36 A;  4D7T A;  1H2N A;  4LFA O;  1AR1 B;  1MAB G;  3FD9 A;  4CZZ A;  1VQ4 V;  5FPO A;  1XMO O;  1N34 B;  1IBK B;  1RP3 B;  5J2U B;  1ZUQ A;  3RWR D;  2E5L O;  1PL0 A;  4JPR A;  3LUT B;  2UU9 B;  1NJ2 A;  3ETG A;  3RYH B;  3MF1 A;  1BQ0 A;  2NNU A;  4DV7 O;  4GKK B;  3ERR A;  1R3J C;  2YI8 A;  1F4M A;  1RFY A;  4NTW A;  2PI4 A;  4WBN A;  4TTV A;  3K58 A;  2ZZG A;  3JAR A;  2I4N A;  2CIM A;  2A06 H;  4LCU C;  1LUW A;  2R72 A;  2YXH A;  3L1A A;  4KFM A;  1WU7 A;  3SPI A;  2XAS A;  4RUE A;  4RO2 A;  4H2X B;  1YCI A;  4CH5 A;  1ATI A;  1KU9 A;  1Z7N A;  4JTA B;  1E1Q G;  3KG2 A;  5C93 A;  1XOU A;  2JIZ G;  3ICA A;  5E1A C;  2C7I A;  1AJQ A;  2P90 A;  3OD1 A;  2M6Y A;  1CXZ B;  2ART A;  3T1Y O;  3IAY A;  1SKV A;  5C52 B;  2EJF A;  1EZJ A;  4P9P A;  3K06 A;  1GAX A;  3HPL C;  4CH3 A;  4G84 A;  1R6N A;  2EIK C;  2V1D A;  1V9P A;  4KR2 A;  4ZOL A;  4F6E A;  1PNK A;  4EKW A;  5E3I A;  1EQR A;  1N34 O;  4YP0 A;  3JD1 A;  2CDY A;  4LNU A;  1HWY A;  4DV0 B;  4LVM A;  2ZE8 A;  1K3E A;  2JRI A;  4N21 A;  4LWS A;  4YRI A;  3UQ8 A;  4JI2 B;  3QO7 A;  3MHH C;  1Q82 W;  1P7G A;  5JVD B;  4IT5 A;  4UVC A;  2RHS A;  2CK3 G;  2RHQ B;  2ZIN A;  4JTC B;  1X54 A;  4AI8 A;  4CS2 A;  3PJS K;  5LP6 A;  3CB2 A;  4O2A B;  4JYY A;  1SF9 A;  5J9P C;  2J3M A;  4MTX A;  4JV5 O;  3T1C A;  5DN6 G;  5IWA O;  2YDE A;  3WB0 A;  1P7B A;  2WA3 A;  1MOF A;  3BAB A;  5JJE B;  4K8Z A;  5ITZ A;  3JD4 A;  1QHT A;  2QWO B;  2CJ9 A;  4H0L B;  4I5S A;  5IYB O;  3KCY A;  2ARU A;  4YRO A;  1HW7 A;  1N0J A;  1S72 V;  3EXA A;  5DEC A;  1N33 B;  2ZZE A;  3CCV V;  3M4P A;  1K5Q A;  1OCC C;  5B5E Z;  4WF2 A;  1Y6X A;  3H9V A;  1Q90 D;  4X62 B;  4DR7 O;  4CH6 A;  1H4T A;  2AKW A;  3AG7 A;  1Y74 B;  3ZMU A;  1LUV A;  1FXH A;  4TQD A;  4I9W A;  3UM7 A;  4PA9 A;  3D36 C;  3JD2 A;  3C90 A;  3TET A;  2LGQ A;  3RYF A;  1MNG A;  4RAI A;  3BEH A;  2UXC B;  2E1H A;  3HXV A;  3NR7 A;  1SET A;  2Q5I A;  3MQZ A;  3A2F A;  3K5M A;  4RWU A;  2W6J G;  5L3D A;  2VQF O;  3JAT B;  4AQY O;  2P67 A;  1VQN V;  3VQW A;  1DF5 A;  3EHB B;  2QHS A;  3STZ C;  4H2W A;  4R8C A;  1GM8 A;  2WAM A;  2PYL A;  3SJQ C;  2JGD A;  1YHQ V;  1M57 C;  4B7K A;  4LBE C;  1K5S A;  1WPX A;  4I0X A;  2Q73 A;  2Y69 B;  2DMX A;  5GTH Z;  4DR5 O;  3VQX A;  1X4T A;  3A0B Z;  1SA0 B;  2BTO A;  3CXH F;  1CPY A;  4QIW F;  3HY0 A;  4HWO A;  1Q5O A;  3IJ4 A;  3G6E V;  3MHS C;  4H33 A;  2VQE O;  3CRM A;  1TVK B;  4OPH A;  4DXW A;  3ASO C;  2E74 B;  2E10 A;  3DSQ A;  1TUB B;  4LNU B;  4P9O A;  5ELN A;  2WLM A;  3OT7 A;  1J5E B;  1DF4 A;  2Q69 A;  3HKD B;  3ZBH A;  3REX A;  5KMG B;  2XND G;  4JI6 O;  3ZRW B;  4JAA A;  3HXY A;  4GUN A;  2RHS B;  3CMQ A;  3K9S A;  1KD1 W;  4UPA A;  1MG1 A;  3GWO A;  3H1K H;  2YC0 A;  1VQK V;  1K8A W;  1ZLZ A;  1K9M W;  1GRJ A;  3AG3 C;  1TGO A;  4UXN A;  1RPR A;  3RYC B;  3UT5 A;  1RSO B;  2ADQ B;  1VF7 A;  3L75 H;  2BCC H;  2QM7 A;  2CH7 B;  2EIL C;  2AHZ A;  4MW3 A;  4DV3 B;  3M7M X;  3LDC A;  5IE9 A;  2PGG A;  4XU1 A;  2W6I G;  11AS A;  2XAJ A;  3NET A;  3K5O A;  5KMG A;  4CBC A;  3E9H A;  3SPJ A;  1SQF A;  2IBZ H;  3RF1 A;  4NTX A;  3T1Y B;  2J3L A;  4P75 C;  1WJZ A;  2XAG A;  5LMU B;  4B3S B;  2W0X A;  2HP8 A;  1H4S A;  2UUA B;  3R65 A;  3EFF K;  3L4G B;  2ZT9 B;  1QVG U;  1EN4 A;  3W7W A;  4NCX A;  3ABT A;  4ZTZ B;  4XEO A;  3ZED A;  5IYZ A;  1PNM A;  2KQX A;  1SA0 A;  1XMQ B;  4JI2 O;  3RT3 C;  1OCZ B;  3D8C A;  4I0X B;  2Y0I A;  3DXR A;  3ETQ A;  1H2S B;  3JCU Z;  3EFS A;  1GM9 A;  1AVM A;  4J7J A;  5B66 Z;  3CX5 F;  4DV7 B;  4GKK O;  4ZHQ A;  3ZHU A;  2LJ2 A;  4K87 A;  5AG2 A;  3FJP A;  1Y66 A;  1YI2 V;  3RYF B;  2N05 A;  4LC1 A;  1PM9 A;  2EIM B;  3ASN C;  5DED A;  4NXM O;  3N27 A;  2O57 A;  2Q0O C;  3HKB B;  4O4L A;  4FM0 A;  4UP9 A;  4MTG A;  3FYI B;  5LOV A;  4DV4 O;  1KUQ A;  1I0H A;  1VAR A;  4H2U A;  4XTW A;  1EVK A;  2ILM A;  3RYI A;  1YF2 A;  1VP7 A;  2V7Q G;  1AB3 A;  5KA5 A;  5F5W A;  2P6J A;  1QCE A;  1SQB H;  4HBN A;  5HGQ A;  2Y4U A;  1O9G A;  1N32 O;  1USY C;  2LQT A;  2MW2 B;  4B3T B;  5C53 B;  4Z2W A;  3JAS B;  2R9A A;  1ZL8 A;  3CRA A;  4DV2 O;  4DV3 O;  4OLF A;  2X6B A;  3BA9 A;  3NXS A;  1XNR B;  3V8K A;  3ZCC A;  3V8L A;  3L71 H;  1M1K W;  5F2V O;  1BGY H;  3CPW U;  3A32 A;  3CE2 A;  1R1B A;  4JTD B;  4XTZ A;  4XU3 A;  1G51 A;  3MF2 A;  4YRM A;  2EJR A;  4UB6 Z;  4DRX A;  4IGG A;  4QGP A;  1M93 A;  2RHQ A;  2YIC A;  1XMO B;  3TEG A;  3E22 A;  2DZ9 A;  5DM6 V;  2DTI A;  3OMA B;  4ZHQ B;  1ASY A;  3ETE A;  2ZKO A;  1OCC B;  1B7Y B;  1Z2G A;  4HAM A;  2JS3 A;  3CC7 V;  2P4K A;  3J80 N;  3B09 A;  1KEC A;  2KG7 A;  2Z0A A;  1XMQ O;  4UVB A;  3RGL A;  2GTA A;  4GLX A;  1GTO A;  4YHH B;  4F6R B;  1SQQ H;  4HNA A;  4E2L A;  4DUY O;  2OIE A;  2RDC A;  4CS4 A;  5IYZ B;  1QLE B;  4EB6 A;  3OD4 A;  1ASZ A;  1WA8 B;  2Y0P A;  1SZT A;  3KZI Z;  2ODM A;  1KMN A;  4YIP A;  3L4G A; 
#chains in the Genus database with same CATH homology
 4P74 A;  3RKX A;  2DEQ A;  3JAS A;  4XEM A;  3M4Q A;  4XU0 A;  3QG5 A;  2ZR2 A;  4HWS A;  5KX5 B;  3N2G A;  2I4L A;  5KHK A;  4DRX B;  4UCU A;  4X1K A;  2ZT8 A;  1WNL A;  2DXT A;  1D5A A;  2YIB D;  2EX3 A;  4X1I B;  4TVW A;  1XNQ B;  1ADY A;  2UUB B;  3HKC B;  2ALY A;  2EJ9 A;  4X20 A;  4TV8 A;  4TUY A;  3I7F A;  1E24 A;  3QF7 A;  4NXN B;  4PI0 A;  5IWA B;  4DR3 B;  4PG3 A;  4UP8 A;  4O2A A;  3CSX A;  3RYI B;  1YB3 A;  2PME A;  5LP6 B;  4CC6 A;  2ALY B;  1IL2 A;  2HEP A;  3BPZ A;  4FFB B;  4LR3 A;  3RUX A;  4TQF A;  2JGU A;  3MEY A;  1G5H A;  1Z5W A;  2F93 B;  1M4U A;  5IJ9 B;  4DR6 B;  4DV6 B;  1RSO A;  2JVD A;  1X55 A;  1X01 A;  1T5E A;  3BJU A;  4O2D A;  2DQ0 A;  2P22 C;  2DZC A;  4H2T A;  1NYR A;  3HXX A;  2QM4 A;  2Q7G A;  4IHJ B;  2DQ3 A;  4FVM A;  3LNN A;  4I55 B;  1RIQ A;  5EZY A;  3N2K A;  2ZXF A;  3SGI A;  4EB6 B;  1YEW A;  3WB2 A;  1B76 A;  4X1Y B;  4Q6G A;  1ADJ A;  4O4I A;  5KHH A;  2BTQ A;  4ZIB A;  5CA0 A;  4D7T A;  2HHH B;  2CGH A;  4P71 C;  4HWT A;  3RL6 A;  5JQG A;  2F66 C;  2AMC A;  4YJ3 B;  5FPO A;  4XTU A;  1N34 B;  1IBK B;  4YRE A;  2CAZ C;  5J2U B;  4PI2 A;  4H2Y A;  2DXU A;  4HA8 A;  3RWR D;  5LYJ A;  1NJ8 A;  1B7Y A;  4EX5 A;  4LH7 A;  4YRC A;  4X1Y A;  4YDQ A;  2DU5 A;  2UU9 B;  1NJ2 A;  3RYH B;  2XTI A;  5KHI A;  3MF1 A;  5CA1 B;  1TVK A;  3BHP A;  4PHZ A;  1JJC B;  5J2T A;  4GKK B;  3ERR A;  4P73 C;  4K86 A;  4O4J A;  2YI8 A;  3V8J A;  1QQC A;  4XTX A;  4LH6 A;  4TTV A;  3JSL A;  4WBN A;  3K58 A;  2ZZG A;  3L2Z A;  5IJ9 A;  4AH6 A;  3JAR A;  3K5L A;  1B04 A;  1HXD A;  2I4N A;  4UCS A;  1IBL B;  2F4V B;  2CIM A;  2E41 A;  4K0K B;  3NEN A;  4UCV A;  4LVJ A;  2R72 A;  3L1A A;  5JCO A;  2DTO A;  4CC5 A;  3A7R A;  4B3R B;  4TOI A;  1WU7 A;  4G85 A;  3JAW B;  5CB4 A;  1YFS A;  4H2X B;  5FNV A;  4CH5 A;  1ATI A;  1Z7N A;  1KU9 A;  4WI1 A;  4RQF A;  1Q8I A;  2R70 A;  4LF8 B;  3HXW A;  3SJB C;  3TEH A;  3G1Z A;  4WJ4 A;  4YRT A;  4P3N A;  2P0L A;  4P3O A;  3V7R A;  3ICA A;  3UT5 B;  2C7I A;  2QJ1 A;  4X1K B;  2CJA A;  5FPR A;  3IKM B;  3OD1 A;  3IAL A;  2QHU A;  1C0A A;  2ZNI A;  2ART A;  4JI6 B;  3IAY A;  2XHB A;  4K8X A;  1SKV A;  5C52 B;  3A5Y A;  5BR8 B;  3JAL A;  2EJF A;  3RYH A;  4CH4 A;  4DR7 B;  2HNI A;  2PMF A;  4CH3 A;  4G84 A;  3QNE A;  4LVL A;  2ODR D;  1KMM A;  2ZIM A;  4JV5 B;  1V9P A;  4KR2 A;  4ZOL A;  5JJJ B;  3U0Z A;  5GON A;  4YJ3 A;  4H2S A;  4XTY A;  5E3I A;  1EQR A;  4YP0 A;  4JI5 B;  1E22 A;  4F6R A;  4YYE A;  1M5I A;  3RGB A;  3T1H B;  4LNU A;  3REU A;  3JAR B;  4DV0 B;  4LVM A;  4YJ2 B;  4YCU A;  5EIB C;  5LXT B;  1JFF B;  4YRK A;  3RYC A;  3LSS A;  3HFV A;  1L0W A;  4JYA B;  1WN7 A;  5LP6 C;  3HXZ A;  4YRI A;  3UQ8 A;  4GKJ B;  4JI2 B;  4CS3 A;  5J2T B;  2ARS A;  3QO7 A;  3E22 B;  5JVD B;  3WQZ A;  1JJO A;  1BBW A;  2RHS A;  3HRI A;  2RHQ B;  2P5O A;  4P72 C;  1BIA A;  4YJ2 A;  2ZIN A;  1X54 A;  1HC7 A;  2PYJ A;  4TV9 B;  4CS2 A;  2E5A A;  2AMC B;  4YRQ A;  4YPF A;  3UFG A;  4HWR A;  5LP6 A;  1BBU A;  1E1O A;  2GV9 A;  4X65 B;  3CB2 A;  4O2A B;  2EL9 A;  2J3M A;  4AIL C;  2C8M A;  2I4M A;  3WB0 A;  3A7U A;  3HRK A;  2VQF B;  4EO4 A;  4IHJ A;  2OYQ A;  3BAB A;  2Q7E A;  3UGQ A;  5JJE B;  4K8Z A;  4LFA B;  5ITZ A;  1J5W A;  3JSN A;  1QHT A;  4FLU A;  1HTT A;  4GYC B;  4X5O A;  2CJ9 A;  4OP0 A;  3ICX A;  4U3J B;  2ARU A;  4YRO A;  1LYL A;  4YRL A;  1HW7 A;  4DV1 B;  2VWJ A;  4B3M B;  1N33 B;  2ZZE A;  2ODR C;  3M4P A;  4UP7 A;  4WF2 A;  1Q43 A;  4I50 B;  4X62 B;  3BFM A;  1XHZ A;  4DK0 A;  4RMF A;  4UCO A;  4CH6 A;  1H4T A;  4IIJ A;  4KHP B;  4JI7 B;  2AKW A;  4TV8 B;  4YCW A;  12AS A;  4LF7 B;  4FLZ A;  1SER A;  2V4D A;  1PYS A;  4TQD A;  4DR2 B;  2QHV A;  2EWN A;  4JI1 B;  1NNH A;  3UGT A;  3RYF A;  1EOV A;  2UXC B;  2E1H A;  1Q3E A;  3HXV A;  1YFT A;  1NT2 B;  1SET A;  2Q5I A;  2QHT A;  2ZZF A;  1JJC A;  3A2F A;  3K5M A;  3MQZ A;  1EIY A;  4BWA A;  1NJ5 A;  2E3C A;  3P8T A;  3LC0 A;  4LVI A;  5LMN B;  3JAT B;  2ZTG A;  1H4V B;  2OWO A;  3VQW A;  2QHS A;  4NVP A;  5LYJ B;  4H2W A;  2PYL A;  4K88 A;  4EEQ A;  3LSQ A;  2KKW A;  2DJZ A;  4P74 C;  3HKD A;  3FFQ A;  5C8Y A;  3VQY A;  2ZR3 A;  1TAE A;  3VQX A;  2UXD B;  4PHC A;  1X4T A;  4H02 A;  1SA0 B;  1KOG A;  2BTO A;  4YRN A;  4EFE A;  4FLT A;  3RIR A;  3HY0 A;  3EFR A;  4HWO A;  4UCR A;  1B70 B;  3B2E E;  1Q5O A;  2YIB A;  4LF9 B;  3RKW A;  4XU2 A;  4O4H A;  5LA6 A;  2CJB A;  5JCO C;  1QE0 A;  1TVK B;  4X66 B;  1X56 A;  4I4T A;  2E10 A;  4YRG A;  3DSQ A;  1TUB B;  4LFC B;  4LNU B;  5ELN A;  3A31 A;  1J5E B;  3K5N A;  1S5J A;  1Z7M A;  4FFB A;  3U11 A;  3HY1 A;  4E51 A;  1TA8 A;  3HKD B;  5JQG B;  4TV9 A;  5GON B;  3K59 A;  3REX A;  1X2G A;  1I94 B;  2PUS A;  5KMG B;  3A74 A;  1X2H A;  4L8J A;  5C51 B;  4O4I B;  4DR1 B;  1E1T A;  1GGM A;  2E5L B;  3HXY A;  1WYD A;  1G5I A;  2VQE B;  5D5Q A;  2RHS B;  3P8V A;  5BMV B;  3PCO A;  3CMQ A;  2FYK A;  1EIY B;  5EZY B;  4DV4 B;  4LF5 B;  2EJG A;  4UPA A;  2YIA A;  3HTZ A;  4LF4 B;  1Z5V A;  2IM9 A;  2A8E A;  4P71 A;  5KX5 A;  1TGO A;  1N32 B;  3RFR A;  4JI0 B;  2NS6 A;  3RYC B;  3UT5 A;  3UH0 A;  1PYS B;  5LXT A;  4UCT A;  1P49 A;  1VF7 A;  1XI1 A;  2P5I A;  3TEH B;  4LVK A;  4IIJ B;  3PZC A;  4P75 A;  3RKY A;  4B08 A;  5BMV A;  1SQG A;  2Q0A A;  3IG2 A;  4DV3 B;  3M7M X;  1FFX B;  1IBM B;  2PGG A;  4XU1 A;  4ZOL B;  4XTV A;  4P73 A;  3PN1 A;  1WPY A;  4P3P A;  11AS A;  5KNN A;  3NET A;  4TVY A;  3RAC A;  4D7S A;  1JMK C;  3K5O A;  3VQV A;  5KMG A;  4DR4 B;  2UXB B;  2ZT7 A;  4WJ3 M;  4TUY B;  4FLY A;  3QTC A;  3E9H A;  1SQF A;  2ZCE A;  2RJZ A;  1HNZ B;  3RF1 A;  3E9I A;  3JAL B;  1YGB A;  2XGT A;  3T1Y B;  2J3L A;  4P75 C;  3THO A;  2ZM6 B;  5LMU B;  4B3S B;  5ITZ B;  3R07 A;  1H4S A;  2UUA B;  3BAA A;  2DKG A;  2DU7 A;  2Q5H A;  4DPG A;  3L4G B;  3JAK B;  1L8D A;  5JH7 B;  4O4H B;  5LA6 B;  4AHC A;  4NCX A;  4ZTZ B;  4TVA B;  4XEO A;  3ZED A;  1B70 A;  5IYZ A;  2ZGW A;  5FNV B;  4YRJ A;  3JAW A;  1B8A A;  1O9H A;  1SA0 A;  2ZIO A;  1XMQ B;  4HNA B;  4RQE A;  5JJN B;  1N36 B;  3SJC C;  4DV2 B;  1SES A;  4TWA A;  4X64 B;  1WNS A;  1H2S B;  3ETQ A;  3EFS A;  1FFX A;  2E65 A;  4TVA A;  4DV7 B;  3V7C A;  3BA8 A;  4ZHQ A;  4O4J B;  1WQ7 A;  4K87 A;  3ZS8 C;  4O2B A;  4HT4 A;  1SRY A;  3FJP A;  5ELO A;  3MAQ A;  3HFZ B;  4YRF A;  5KHG A;  3WB1 A;  4FM1 A;  4FLV A;  1JFF A;  1EFW A;  3RYF B;  4EFB A;  4YRS A;  4OX9 B;  1XQ8 A;  2E64 A;  1WPB A;  5J2U A;  3K57 A;  3HKB B;  4O4L A;  4FM0 A;  2DDZ A;  3NEM A;  4UP9 A;  3PCO B;  5LOV A;  1HR0 B;  2ZT6 A;  2AKW B;  4H2U A;  4DK1 A;  4XTW A;  1EVK A;  2JS5 A;  3RYI A;  4ZI7 B;  3QO8 A;  5CA0 B;  4H2V A;  4JI4 B;  1EVL A;  2BTQ B;  4HVC A;  5LOV B;  2F1M A;  3HKC A;  4DUZ B;  5F5W A;  4YRP A;  4LF6 B;  2IY5 A;  3N2K B;  4HBN A;  4P72 A;  4I55 A;  5HGQ A;  3A7A A;  2EAY A;  1O9G A;  1W66 A;  1YFR A;  2I4O A;  1USY C;  1I7F A;  5KHJ A;  4B3T B;  4U3J A;  5C53 B;  3W3S A;  4UFZ A;  5D5P A;  3JAS B;  2DTH A;  2R9A A;  4OLF A;  5K1P A;  4O2B B;  1N9W A;  3A5Z A;  4DR5 B;  3BA9 A;  1BIB A;  3HXU A;  2UUC B;  2G4C A;  1XNR B;  4YRR A;  4KR3 A;  3V8K A;  2Q7H A;  2IY5 B;  3V8L A;  4RDX A;  4KL1 A;  5CB4 B;  4H2X A;  1HNW B;  1XHX A;  1FYF A;  3OTF A;  3A32 A;  3TUP A;  2ZT5 A;  1VQZ A;  4AQY B;  4DV5 B;  4ZI7 A;  1USY A;  3P8Y A;  2YI9 A;  1WLE A;  1G6U A;  4LFB B;  3OTO B;  4LNS A;  4XTZ A;  4I9Q A;  4FM2 A;  4X20 B;  2YXL A;  3IKL A;  2RQ6 A;  5EYP B;  5IJ0 A;  4HWP A;  4J15 A;  1G51 A;  3MF2 A;  4XU3 A;  4WBN B;  3HKB A;  4O4L B;  4YRM A;  1NYQ A;  4X1I A;  2F95 B;  4DRX A;  4ZTU B;  3U10 A;  3N2G B;  4BW9 A;  1TUB A;  3JAT A;  5JH7 A;  1M93 A;  2RHQ A;  4I4T B;  3V7S A;  4KQE A;  3JAK A;  1XMO B;  2DVE A;  4L87 A;  3TEG A;  2PY5 A;  3E22 A;  5JVD A;  3HFZ A;  5CA1 A;  2PZS A;  2PTM A;  4YCV A;  4YY3 B;  2DZ9 A;  1H4Q A;  2DTI A;  3QO5 A;  4ZHQ B;  1ASY A;  4NXM B;  1WQW A;  1B7Y B;  1DGS A;  4JI8 B;  5K1X A;  2ZNJ A;  3VBB A;  3HKE A;  5EYP A;  5IJ0 B;  3RGL A;  1NJ1 A;  1KMI Z;  4GLX A;  2VWK A;  4YHH B;  3KFU A;  4F6R B;  5EIB D;  4HNA A;  5C8Y B;  3SR2 C;  4Q15 A;  1QF6 A;  3NEL A;  3CHX A;  3SJA C;  3HKE B;  4I50 A;  4CS4 A;  5IYZ B;  3BRC A;  4EB6 A;  1HNX B;  1ASZ A;  1ZAU A;  4FLX A;  1FJG B;  1NJ6 A;  4FLW A;  4DUY B;  1KMN A;  4DQ2 A;  4JI3 B;  3L4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...