2ZNIA

Crystal structure of pyrrolysyl-trna synthetase-trna(pyl) complex from desulfitobacterium hafniense
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
279
Chain Sequence
LSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolysyl-tRNA synthetase
publication title Pyrrolysyl-tRNA synthetase-tRNA(Pyl) structure reveals the molecular basis of orthogonality
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase/rna
total genus 75
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2zniA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2zniA02
3CMQA 4H2XB 3NENA 1G6UA 3HFZB 2E64A 4LNSA 1C0AA 1WLEA 2RHQB 4K86A 4TQFA 3RKWA 4P73A 1NJ8A 2ZIMA 2ZNIA 3RUXA 2XGTA 2ZT7A 3KFUA 1WPYA 3EFSA 2DXUA 4P72C 2PMFA 3A7UA 4TQDA 1J5WA 2QHVA 2P0LA 4ZTZB 3TEGA 3I7FA 2ZCEA 1NNHA 2ALYB 4YRCA 4OP0A 2Q7HA 1H4QA 3DSQA 5K1XA 2E41A 4XEMA 4H2YA 3E9HA 1E24A 2ZT8A 2RQ6A 2YI8A 1O9HA 3UH0A 3V8LA 4YRRA 3LSSA 4UP9A 4DQ2A 2DKGA 2PMEA 2ZZFA 2ZZEA 4H2XA 4P73C 4E51A 4RMFA 5K1PA 3HFZA 1KMNA 3V8JA 2DDZA 2ZTGA 1L0WA 1BBWA 4YRFA 2RHQA 3HXVA 2DU5A 4CH3A 1YGBA 4YRJA 4O2DA 3QNEA 2CJ9A 2EWNA 4XTVA 1X56A 1B7YB 1SESA 2RHSB 2E3CA 2EL9A 3L1AA 1JJCA 3A5ZA 3MEYA 4UPAA 4HVCA 1X2GA 1YFTA 4YRMA 2DEQA 3VBBA 4P3NA 1E1OA 3V7CA 3RGLA 4DPGA 3P8VA 1H4VB 4TVWA 2ZR2A 4XU1A 2J3LA 3ERRA 3R07A 1H4TA 2C7IA 1SETA 3IG2A 3PZCA 2QHTA 1QE0A 3IKMB 3P8TA 1X2HA 2JVDA 3HRIA 3QO7A 2QHUA 4UP7A 5ELNA 4YRQA 2DQ0A 3V8KA 4HA8A 3A5YA 4K88A 2E1HA 1X01A 2RHSA 1PYSB 3HTZA 3HXZA 4P75C 4HWSA 1ASZA 1IL2A 2YI9A 3EFRA 2AKWB 4PHCA 2R72A 3MF1A 4XTWA 2I4OA 4RQFA 1H4SA 1NJ5A 4X5OA 4CS4A 3M4PA 1NJ1A 2DXTA 1B76A 3A32A 3VQVA 5C53B 2QJ1A 2DJZA 1SERA 1JJCB 4P74A 1G51A 3HXUA 1GGMA 2ZGWA 2EJFA 3BHPA 3A74A 3NETA 2ZNJA 1USYA 4J15A 1N9WA 1RIQA 3ZEDA 1EIYB 2CJBA 1WU7A 4BWAA 4YRSA 4H2UA 3HXYA 3M4QA 1O9GA 2PGGA 1EVKA 1G5IA 3A7RA 3HFVA 1PYSA 3LSQA 2AKWA 1EVLA 4XU0A 2ZT6A 5ELOA 4P74C 3TEHB 2ZIOA 1WQWA 1QF6A 3L2ZA 2ZT5A 1USYC 4TTVA 3RACA 4RQEA 1ADYA 2ZINA 3MF2A 1EOVA 4YRTA 1EFWA 3HY0A 4AH6A 4YCVA 4YP0A 2Q5IA 1FYFA 4H02A 3FJPA 2AMCB 2YIBA 3VQYA 4YRNA 2XTIA 4XTZA 1KMMA 2CIMA 1EIYA 3HRKA 4P71A 3QO8A 2DQ3A 1W66A 2Q5HA 2ODRC 4HWPA 4XU2A 3UGTA 4YCUA 4CH5A 1BIAA 4H2VA 3L4GB 4YYEA 2HNIA 2ARSA 4EX5A 4RDXA 3E9IA 2I4MA 4YPFA 1NYQA 2EJGA 4YREA 1VQZA 3TEHA 11ASA 4YCWA 4YRPA 4WJ4A 2ODRD 3RF1A 4PG3A 1B8AA 4Q6GA 4P71C 4P3PA 3RL6A 4YDQA 2DU7A 2DTOA 2DZ9A 2AMCA 1YB3A 4WF2A 2ZXFA 4G85A 2Q7EA 2EJ9A 4TWAA 3IALA 3REXA 3RKXA 1WQ7A 2YIBD 4YRLA 4NCXA 1BIBA 2EAYA 2ZZGA 4XU3A 2C8MA 4YRGA 1E1TA 3HXXA 3L4GA 2IY5B 1G5HA 4HWOA 4EO4A 3PCOB 3TUPA 1BBUA 4TVAB 2HEPA 4YROA 3HXWA 3QO5A 4XTUA 4H2SA 1NJ6A 4Q15A 2CJAA 4KR2A 4CH6A 2G4CA 1WYDA 3UGQA 4ZTUB 4CH4A 3A7AA 3NELA 4H2WA 5KNNA 1SRYA 2ARUA 2DZCA 4XEOA 1E22A 2QHSA 3HY1A 4HWRA 4HWTA 12ASA 1B70B 2YIAA 4WJ3M 3UFGA 2J3MA 1HXDA 3ICAA 1ADJA 5E3IA 3RIRA 4WI1A 4YRKA 3BFMA 2IY5A 2E65A 2RJZA 3PCOA 1YFRA 4XTYA 4YRIA 4KQEA 3OD1A 2FYKA 4TVAA 1HTTA 3A31A 4P3OA 4CS2A 3VQWA 5C52B 1Z7MA 2I4NA 2R70A 3BJUA 3NEMA 4OLFA 2P5IA 2E10A 2E5AA 2PUSA 4ZIBA 4G84A 3IKLA 2ALYA 2Q7GA 3REUA 4UP8A 1ATIA 3VQXA 1NYRA 2DTIA 2DVEA 5HGQA 5C51B 1X54A 1WNLA 3RKYA 4P75A 1Z7NA 2CGHA 1LYLA 4TVYA 1NJ2A 3LC0A 1X55A 1ASYA 4BW9A 2DTHA 2ARTA 3G1ZA 4XTXA 1B70A 5F5WA 3V7SA 1YFSA 3P8YA 3WQZA 4KR3A 4CS3A 2I4LA 4H2TA 3W3SA 4P72A 1EQRA 3QTCA 3V7RA 1KOGA 1B7YA 1HC7A 2ZR3A 4L87A 4K87A
chains in the Genus database with same CATH superfamily
4H2XB 5KHGA 4B3TO 3CSXA 4X1KB 4FZ0A 4EB6B 4AI8A 2P7TC 4N21A 5B1BC 5KA6A 2Q67A 1C0AA 3SPJA 1HNXO 3OGIB 1KUQA 3HKDB 5KUKA 1MNGA 2ZIMA 1W0JG 4DK1A 4MVQA 1ENVA 3CS5A 3KFUA 4C7UA 3AG7A 1B6QA 5JJNB 1H2SB 2CE4A 3LDEA 1OCZB 3UQ8A 1J5WA 2LW7A 1FS0G 1VF7A 2ZCEA 3CXHF 3HKBA 1JPXA 4P9PA 3K03A 3JD4A 5LMNO 1W2BU 5L3BA 1OHHG 5J2TA 4ABMA 1JOYA 3HKCB 4PDRA 4DRXA 3CC4V 4H2YA 1E24A 3E9HA 1N32O 3FYIB 2JGDA 4MTOA 4U7NA 4RUFA 4X1YA 4YRRA 4TV8B 3EFFK 5EYPA 3IC9A 2AGAA 4XDKA 3LNMB 4TOIA 3FB5C 4IT5A 4NTWA 2LJ2A 3W7WA 5K1PA 4LF8B 1WPBA 3Q4HA 1H2GA 2VRZA 3V8JA 1N33B 1L0WA 1BMFG 4FIPC 5LOVB 1BE3H 1GN3A 2RHQA 2DU5A 1FD9A 5LHIA 2CTPA 4DR3B 4O2DA 4K0KO 4XTVA 4B7KA 2GUZA 1NU1H 1XDCA 4LNUA 4WFGA 1L1FA 4J9YB 1Y66A 5B1NA 2W0XA 1M90W 2Q6AA 3ZHRA 1X2GA 5GONB 3CXCU 4KL1A 1PL4A 1RFYA 2DEQA 1QVGU 4P3NA 5JCOA 1K9MW 3FAVA 4UCVA 1E1OA 3RGLA 1H8HG 2R9AA 3BA8A 1PNLA 4MTGA 1I0HA 2JGUA 4LR3A 1AJNA 4QE7A 4X89A 2J3LA 1I5XA 5CBHA 1M57B 2ZT9B 4JTAB 3STLC 3LDCA 4O4HB 3HKEA 3IKMB 3P8TA 1X2HA 1FXHA 5ELNA 1GO3F 2DQ0A 2QWNB 1OCOC 5KX5A 3V8KA 4FK5C 4HA8A 4DR4B 1HNZO 1NTKH 2OWOA 5LYJA 4B3MB 4EFEA 1RPRA 2OIGA 5LHGA 1NTMH 2P90A 3HTZA 4GX2A 3HXZA 2P67A 4NXMB 4PELA 3OMNB 1TUBA 4GX0A 4GLXA 3ZHTA 1IL2A 5JQGA 1YDXA 2EIKC 2BTQB 2YI9A 3EFRA 3WB0A 2HJFC 1OCRC 5KHIA 2DJVA 2PI5A 3L9DA 1NJ5A 1H4SA 3ZHUA 3ZBHA 1NJ1A 2NS6A 2MW2B 1FXKB 1PKXA 3VQVA 2ITCC 4JI7B 2DJZA 1M5IA 1QNMA 2IH1C 1PM9A 2YXYA 4FFKA 1W0KG 1GN6A 2V4DA 3BHPA 4LF6O 3JAMN 1USYA 3S3WA 2WLIA 2UU9B 1N9WA 1RIQA 4I9QA 4DO2A 3PJSK 2YEVB 4YRSA 4DR5O 3SJCC 3M4QA 3SJQC 2JJ2G 1SA0A 3B40A 5KUMA 2CTRA 5L3DA 4B08A 1VIBA 4LWSA 3K5MA 1R6KA 1G5IA 1PYSA 2E74B 2CDYA 1M9NA 3CD6V 3RBZA 3A2FA 1TA8A 1VMGA 3SYOA 2WWWA 4IIJA 4DV3B 2CGNA 1Q43A 3RT3C 5C8YB 1K3EA 2K9PA 4XU0A 2ZT6A 2WLLA 1SQXH 2ZIOA 1OZ0A 3ABKC 2ZT5A 1USYC 2QWQB 2ILMA 2OCHA 3K58A 2ZINA 3ZMZA 3CRMA 4JYBA 5DN6G 2PYLA 4J42A 4RWUA 1EOVA 2F4VB 4I0XA 4YCVA 1W59A 3OE7G 1NS1A 3FJPA 2YIBA 4YRNA 3IFXA 1EIYA 1NR7A 3G4SV 1I94O 1W66A 4JI0O 1EFRG 4LH7A 3E89A 2F93B 1GM7A 3CCVV 1VQNV 4XU2A 1Q3EA 3CCLV 1X59A 1BQ0A 3P30A 3BPZA 4OXSA 2HNIA 1XL6A 2ARSA 4EX5A 5BXZA 3E9IA 2EIJC 4AHCA 3R65A 2LP7A 4P30A 3E22A 2GTSA 4B3RO 4K8XA 1Q90D 5IE9A 4AQYO 1Q5OA 2WPDG 4LP8A 3BEHA 2L6LA 3A0BZ 2DW4A 2A0LA 4X20B 4DK0A 1F4MA 1VQ7V 2IJKA 5BR8B 3IGAC 1ZTEA 4Q6GA 4P3PA 3RL6A 2MK3A 2JRIA 4UFZA 3ASNB 2DU7A 3K5OA 2CH7A 5LP6A 5BMVA 1YJWV 5LGTA 1K8AW 3BCCH 1YB3A 4LF5B 4U3FH 2EINB 4G85A 1V54B 4JYYA 4WBNB 3TK1A 4I5SA 5B1AC 4B3TB 5ITZA 4FPPA 2ZQMA 4EEQA 5LGNA 1JVMA 4X62O 1JX9A 3WG7C 4NCXA 1BIBA 2PI4A 2V1DA 5C93A 1YTFB 1V9PA 4U3JB 1D5AA 1GN4A 2ADQB 4Z2WA 1HNXB 3OR6C 4YRGA 4JI3O 4WFFA 3PCOB 4UCUA 1M56C 3RYHB 2Q68A 2DYRB 4TVAB 2B1IA 4YROA 2Y4TA 3ZHSA 1D5NA 4LF7O 1EN5A 3D8CA 3ZHQA 3DC6A 3AG1B 4JI8O 3RYIB 1RSOA 2QDOA 5LMNB 4DV7O 4KR2A 1XHXA 2DOSA 4QNHB 2ZM6B 1MSDA 2EBOA 2ZDIA 3NELA 3L74H 3WB1A 2AZ0A 2QHSA 3HY1A 2K1EA 1RM1C 3ML0A 1K7DA 3D3IA 2BOCC 3SPIA 1HNWO 12ASA 5LA6B 3JCUZ 3K06A 1JQ0A 4DR7O 4J7JA 1VQOV 4I55A 2ZD9A 2HKOA 4YJ2A 5CA1B 2J3MA 1EZVH 1WJZA 4H0LB 3RIRA 2E65A 2ZE7A 3M99B 2UUBB 1TVKB 1EM1A 1GRJA 2RJZA 4KQEA 3PN1A 4LCUC 2WA4A 4NR1A 1NTZH 2NLJC 2RMKB 4CS2A 4KP4A 5FL7G 2IJIA 3LDDA 3LNNA 1P7BA 3CB2A 3L72H 2UXCB 4F6RB 4IYHA 4ZIBA 3IKLA 3CRRA 1K5QA 3RVYA 2DVEA 3KCYA 5IJ9A 5HGQA 5C51B 3MDSA 4UV9A 4HBNA 1ZWIC 2CGHA 1LYLA 3ZMTA 2F66C 2VS0A 4J41A 2LQTA 5EIBC 2EILC 3RYFB 1ASYA 2VQFB 2DTHA 2ARTA 1SQVH 5GTHZ 2EZPA 4YJ3A 1BL8A 3V7SA 3CP1A 4H13B 3IAYA 2A3QA 2XAGA 4JTCB 1YFSA 3P8YA 4KR3A 1VQLV 4H2TA 4O2AA 3ZCCA 2JK5C 4UVAA 4GKJO 2UXBO 1HC7A 3FYEB 3CMQA 2IJJA 1G6UA 1COWG 2LW1A 3HFZB 5J2UB 2E64A 2E76B 2Y69B 3S3XA 2OTLV 1WLEA 3P3NA 2A79B 4P9OA 3ABLC 4P73A 1YXBA 2ZNIA 3K3WA 2ZT7A 1WPYA 3EFSA 1XMQB 1LNQA 2PMFA 4TQDA 2QHVA 5IYBO 4LF6B 5GTIZ 4E4EA 4ZTZB 3I7FA 1NNHA 1YHQV 4YRCA 4PI2A 4GKKB 4FFBA 2P22C 4DR5B 4JV5O 4JI6B 4HAMA 3ZRVA 4XBFA 4JYAO 3H1HH 3JATA 3LSSA 4BAYA 2WLKA 5H9CA 1S3JA 4KHPO 4DQ2A 1P7GA 4TT3G 4GX1A 2PMEA 1XEQA 4IHJB 4P73C 4X1IA 5IY5B 5CA0A 5CBFA 5IWAB 3OR7C 3HB3B 5B3SC 2DDZA 5EZYB 3STZC 2ZTGA 1NT2B 3N27A 3TXQA 4D7TA 1M57C 3X2QC 4W4KA 1XMOB 3GB7C 4X64O 3HXVA 4CH3A 4DYLA 4YRJA 3CCSV 2CJ9A 5B66Z 2QKCA 2Y0PA 2WLHA 1B7YB 3AG2B 2RHSB 4JAVA 3L1AA 3F7YC 4WFHA 1FFTB 3A5ZA 5KA5A 4HVCA 4LVLA 4NVPA 1G8MA 1GH6A 4UCRA 5IYCO 3VBBA 1L0LH 4HNAA 2VWKA 4JI4O 1BGYH 3APQA 1BT8A 3N2GA 4WFAV 3V7CA 2GSMB 3OTFA 4GUNA 1SZXA 4JI5O 1WP8A 4UXNA 4DV2B 2ATKC 3FFQA 2F23A 4XU1A 1H38A 2HHHO 4J10A 1H4TA 2RDCA 3CCQV 1SETA 3DGEA 3TCUA 3OTOO 4NXNO 3ZN1A 2JVDA 5DM6V 3JASB 2QHUA 4UP7A 3RYCA 5JJEB 1ZUQA 4B3RB 1IZ3A 1S0VA 1NBMG 2XHBA 5EIBD 3ZX6A 4P75C 2GHYA 2GTAA 4FLZA 4HWSA 4ZKIA 4ICGA 2ZE6A 5HFLA 2PTMA 4OX9B 3AG3B 4BR6A 4PHCA 4RQFA 1N36O 2EX3A 1R3LC 3APOA 4O2BA 4B3SO 5JWPA 2X0LA 2JS3A 3JALB 3A32A 3UT5B 4PDVA 3ZIAG 2QJ1A 3KG2A 4PD4F 4JASA 3G71V 2XUMA 4JI2B 3HXUA 1WB7A 4JI3B 1V55B 4FZ1A 3A74A 1KYOF 3NETA 1FJGO 2JS5A 4J15A 3MHHC 1DK1A 5IJ0A 1D2DA 5KAIZ 3SDLA 3ETQA 3VOUA 5KHHA 3BA9A 4LF7B 5IT9N 1WU7A 4YIOA 1S5JA 4DR2O 4JI8B 4ZHQB 1NVPB 3W7XA 3U11A 1O9GA 5E79Z 3ZN0A 1QR8A 1CEZA 1JFFB 3AEIA 1ZL8B 3K04A 5CB4A 3O65A 2A9HA 2AKWA 2CK3G 5KLVH 2D2CB 3TEHB 4LFBB 1N8RW 4AILC 3AG4B 3UO3A 1IBMB 3H1LH 1AI4A 5FNVB 4LH6A 3BVOA 2P4VA 1BQZA 4TTVA 4RQEA 1OCCC 4LFCO 1BS3A 3SYCA 3I55V 4F6EA 2AZ2A 3HPLC 4GCZA 1N34O 3SR2C 4JTDB 3JAKA 4AH6A 1Q81W 2VQEO 1IURA 4XTZA 2M6YA 1F7YA 1FFXB 4JGSA 3HRKA 2YICA 4FLWA 2DQ3A 2DYSC 2WLJA 3CRAA 4PI0A 4DV1O 2IH3C 3OFNG 3O9OA 4G2KA 3TJTA 3UGTA 4YCUA 2FMLA 4H2VA 3JD0A 3EXAA 4O4LA 1Y67A 4ZI7B 4MTFA 1Y74A 4YPFA 2HVKC 3E8BA 1AROP 4YREA 3ABMC 3J80N 1VQZA 2CAZC 4X66O 2Q8VA 4YRPA 4WJ4A 5JCOC 1AILA 2PF4E 1XUQA 5EC1C 4MVSA 1MOFA 2FL4A 4CC6A 3ZHVA 5BY1A 3J7AU 1IBLO 5KMGA 3DXRA 4FMTA 3TGUH 4TV9B 3E8GA 2AMCA 1IX9A 4TUYA 1JJ2U 1YCIA 2BSKA 2Q0OC 3MHSC 1NQTA 1QLEB 2ZXFA 4WF2A 2Q0AA 2Q7EA 2UXBB 2X6AA 1PL0A 1HR0O 1NR1A 2OYQA 1F4NA 4YRLA 3FB7C 3OMIB 1XQ8A 1AR1B 3A0HZ 1G4YB 2KG7B 3OUFA 3UCSC 4F6RA 2C8MA 1MSWD 1E1TA 3HXXA 4K3AA 3L4GA 5H6QA 2IY5B 3JYCA 5CN0A 4EO4A 2CUGA 3BFRA 1IBKB 1Y6XA 3OUSA 1VQMV 3F5TA 4LBEC 3SYPA 1NJ6A 1VQPV 2EIMB 4O4JA 3T4DA 1YSCA 1WA8A 2OCCB 4Q15A 3T1HB 4CH6A 4DV0B 4RAIA 3E86A 4PA3A 3OW2U 2B5UA 3M8AA 4CH4A 2V7QG 4FM1A 3A7AA 4H2WA 4ZOLB 1URFA 5J9PC 4J11A 1E22A 5B1BB 1AR5A 3SPHA 2QWRB 3JD2A 4I4TB 2JEXA 1B70B 3BAAA 3JARB 4WJ3M 1XNQO 5J2UA 3UFGA 1SF9A 2LGWA 4X64B 1ADJA 4H44B 2IW5A 4YRKA 4MVOA 4PHZA 3OAAG 1YFRA 4HYOA 1WB8A 4UB6Z 1HTTA 5CA3A 4JF3A 5C52B 2I4NA 1ZAUA 4PA9A 1I5YA 3JAWA 4H33A 2AHZA 1B3QA 3BJUA 1Y4MA 2H8PC 3NR7A 4JI4B 4G84A 1XNRO 2UUAO 2B9ZA 3REUA 1ATIA 4PDLA 3VQXA 1VQ8V 2DTIA 3E8FA 4JI5B 4DV4B 1VQ5V 1JJOA 3K0GA 1XBLA 1GAXA 3HR0A 4I50A 5JH7B 1S5HC 2HHHB 4NXNB 4DV6B 2UUCB 3HKBB 1XHZA 2AXTZ 1K73W 3T2MA 3U10A 3ASOC 5J2TB 2D3OW 3P32A 4X88A 2QM4A 2WAMA 2ZE8A 4DRXB 2WA3A 1K97A 2YUAA 4PA4A 3L75H 4CS3A 2JGDB 3W3SA 2ITDC 4P72A 1Y76A 3C90A 4JI1B 5LMUO 3V7RA 1YTFD 1U96A 5EYPB 1B7YA 4DV5O 2KQXA 2QKSA 4N23A 3GWOA 1YI2V 3NENA 2EULA 2FKXA 3Q4HB 2E5LO 2Q4PA 4WCEV 3R66A 4BIOA 4B3SB 5IDJA 2RHQB 4P2ZA 2GUZB 4YXWG 4LNUB 2XGTA 1H2LA 3E2EA 4GX5A 1FAFA 1OCOB 3ICXA 5LP6C 1SC5B 4J9ZB 4P72C 3QF7A 3A7UA 3JD3A 1Q86W 2P0LA 1M93A 2ZXWC 3F5WC 2ALYB 1R73A 4JYCA 4OP0A 2Q7HA 3FAVB 1VARA 4XDLA 3DSQA 1N32B 3ETDA 4DR2B 2NR5A 1FPOA 1LUWA 1O9HA 3UH0A 1H2MA 2EIKB 3V8LA 1DLBA 1YZBA 4GYCB 4WFBV 1OCRB 4UP9A 2ETNA 3SJAC 2DE0X 3CMAV 4H2XA 3HKEB 2ARHA 2VWJA 1IXMA 1CPYA 4X1KA 4RMFA 3CCRV 4EB6A 1KMNA 4LF8O 4NTYA 3BY6A 5KX5B 4LVIA 1N33O 1BBWA 1A32A 4K0KB 1YGBA 3HKDA 2P5OA 5A2QN 3QNEA 2EWNA 2QKAA 2QWOB 3JALA 4DR3O 3WB2A 2ZDIC 2JDIG 1LUVA 5LGUA 4UPAA 5JQGB 1YFTA 4O4IB 2O57A 4UCSA 3EVKA 2R9RB 5B5EZ 2DMXA 2F95B 1KP2A 3HKCA 3P8VA 1NH2B 1SQPH 1MA1A 2W6IG 2OIEA 2FTKA 4TVWA 4IYIA 1B06A 4TV8A 1IVSA 2C7IA 4X8AA 2ZE5A 2QGNA 1Q82W 2QHTA 4QIWF 3ABKB 1QE0A 3K57A 5D5PA 3QO7A 2WLIB 5LHHA 1FXVA 4YRQA 4L8JA 5IYZB 3JCZA 3L71H 1OCZC 1CP9A 2HR3A 3L70H 3A5YA 1SQGA 5LOVA 1HNZB 4K88A 4DR4O 2E1HA 1SA0B 5FNVA 4LWSB 1X01A 4OPAA 1PYSB 5EBLC 4DXWA 4EKWA 3K9SA 2YC0A 3RGBA 5GONA 4IIJB 4FM2A 2R72A 3MF1A 3ETEA 4JPRA 4XTWA 2I4OA 2WLLB 4CS4A 3THOA 2IJHA 1VQ9V 1FFXA 5H6RA 4HT4A 3K08A 5C53B 1GM9A 2KSDA 2EIJB 3CCMV 3CCJV 2YXHA 1JJCB 4JI7O 2JEUA 2YDEA 3G6BA 2Q73A 1PNKA 4I0XB 1R3IC 3W7SA 2Y48A 4K8ZA 4O4HA 2ZGWA 1FKAO 5EBWC 3A0RA 4J7ZA 1Q6HA 1WN7A 1EIYB 2CJBA 4BWAA 4GZRB 4MSWC 2IU3A 4LFAO 1JA8A 2PGGA 4R50A 3A7RA 1QR9A 3LSQA 3FX7A 1G1XB 5FLXN 5B1AB 4Q20A 2AHYA 2BTQA 4MW3A 4CZZA 1QVFU 1VEWA 3QVNA 4RUEA 4DV3O 3WG7B 2EJ7A 3E22B 1E1RG 4FM0A 2HLDG 3WFVA 3L2ZA 3UO2A 3H01A 3K9AA 4YY3O 1FXKA 5JVDB 1YEWA 2A7WA 2XT9A 1SZTA 1M56B 4F4LA 1XNQB 4DR6O 2QTSA 3B77A 1R3KC 2F4VO 2CTQA 2N04A 5HFMA 1F51A 4YRTA 3N2KB 3HY0A 1YIJV 1EFWA 4YP0A 2Q5IA 1FYFA 4H02A 3G6EV 2CH7B 5BMVB 4LF4O 2CTWA 2NN4A 5E1AC 1P84F 2ZKOA 3SYAA 1WP7A 2YEVA 2QM7A 2RN9A 5H5NA 1I94B 4LF9O 3QO8A 4JI0B 1XL4A 2XNDG 2E75B 3CE2A 5CMUA 2Q5HA 1KKDA 4HWPA 3P3PA 4CH5A 2C2AA 1XNRB 2UUAB 1VP7A 4YYEA 3CJHB 4TSFG 3WU2Z 1RM1B 3ABUA 1FXKC 1BHBA 1YF2A 2RCVA 1NYQA 2EJGA 1OJHA 5C8YA 1SQFA 1KB9F 3CMEV 4QPKA 11ASA 4AQYB 4FJCC 2LO1A 3OD4A 3SJBC 2ODRD 3IJ4A 5L3EA 4PG3A 1QQCA 1ZLZA 1B04A 3JARA 1GTOA 2N05A 5BR8O 2XTAA 3GWKC 2BTOA 2L35A 2QR4A 2ADPA 2YIDA 2LFRA 3KCXA 2HP8A 2DTOA 2DZ9A 2IBZH 1VF6A 3FB8C 4LVKA 3B2EE 3QG5A 1K4CC 2Y4UA 1R1BA 3IALA 4LF5O 3DTUB 4FLUA 3AK2A 2KB1A 1Q8IA 1UPGA 4X62B 1KBHA 1Z2GA 3BRCA 1R3JC 4I55B 2E5LB 2UXNA 2GBOA 5B1OA 2EAYA 4YJ2B 2ZZGA 4XU3A 3OMAB 2EILB 4ASUG 4MT8A 1NVPD 1G5HA 4Z1VA 1BBUA 2UXXA 2HEPA 3QO5A 3CCEV 5KHKA 3G67A 5JH7A 4XTUA 1R6NA 1VF6C 4Z1MG 4A5UB 1R6TA 4J80A 1WPXA 1GMGA 4DV7B 4X20A 2QA4V 2CJAA 2G4CA 2G38A 4PA7A 3T1YO 2ZM6O 5IJ9B 5D5QA 2FYUH 1WYDA 3UGQA 3H9VA 1M4UA 2QTOA 5KNNA 5JJJB 1BHAA 1HDJA 2X7RB 1SRYA 2ARUA 2DZCA 1L0NH 4LVJA 4WBNA 1HNWB 4HWRA 1VF5B 4DR7B 1MG1A 4YJ3B 1DF5A 3ABLB 4KUMA 1K92A 2YIAA 2UXDO 2W6JG 1E1QG 3K79A 4U3JA 1HXDA 1GM8A 3ICAA 4WI1A 4O2AB 3BFMA 1I08A 2Z3YA 4GT1A 3ABTA 2M7WA 3PCOA 1P49A 2UUBO 4XTYA 3RYHA 4TVAA 1RP3B 3A31A 4P3OA 5LL6Y 2P4KA 1YITV 2P06A 3VQWA 3ASNC 1Z7MA 2HFEC 4DUZO 3RYIA 3B4SA 3B8MA 2EINC 1AVMA 1NKDA 1V54C 4K35A 2E5AA 2UXCO 2ALYA 4DR1O 3MAQA 3D36A 4UP8A 1PD3A 3H1JH 3ZRSA 2FB5A 1WNLA 3RKYA 1QHTA 1Z7NA 4J7KA 4TVYA 1TUEB 3OM3B 1UJWB 3LC0A 5B3SB 1X55A 3OT7A 3X2QB 2VQFO 5LA6A 2DYRC 2BCCH 1US6A 5DEDA 3JSNA 3EHBB 2HVJC 4FFBB 5CA1A 3AG1C 3ZRXA 4FVMA 4D7SA 3IC7A 2I4LA 3CC2V 4GKJB 1TVKA 3CPWU 3JATB 2Q9LA 3QTCA 1EQRA 1KOGA 4KFMA 3D36C 2ZR3A 4FLXA 4YRMA 4K87A 3U0ZA 3ZRWB 1Z5WA 5LXTB 4X1IB 1K34A 5CA0B 1K5SA 4LNSA 1JCHA 3CYOA 4O4IA 4IL6Z 1P4RA 1AR4A 1EN6A 1EZJA 1JMKC 1KP3A 1N0NA 3I5DA 2HJDA 4K86A 1XILA 4TQFA 3RKWA 1SQBH 1M1KW 3NXSA 1NJ8A 1QLNA 1K33A 3RUXA 4UVBA 3FD9A 2QEXV 3TXSA 3RYFA 2XAQA 1DF4A 1XMQO 1NI8A 3CEIA 2DXUA 1NZ6A 2Q5ZA 1ORQC 5FPOA 3TEGA 4HNAB 1H4QA 2Q69A 3N2GB 1T5EA 1YJ9V 2H3OA 5K1XA 4JV5B 2E41A 1E79G 4XEMA 5IYZA 1AB3A 4GKKO 2ZT8A 2RQ6A 2YI8A 1AI7A 4JYAB 4DW1A 4G28B 4JI6O 4LFAB 4KHPB 3CRCA 2DKGA 4HZ3A 1SQQH 4I9WA 2ZZFA 2ZZEA 3T1CA 4JZGA 4E51A 3HFZA 5L3GA 3SYQA 3RYCB 5IWAO 4I7ZB 1AI5A 1JR9A 4YRFA 1AJQA 1XMOO 4H37A 2GDSA 4YY3B 3F7VC 1X56A 1SESA 2E3CA 4DR6B 2EL9A 4DUYO 4OPHA 4JAAA 1JJCA 5F2VO 3MEYA 3UM7A 4PA6A 2H94A 1KQSU 5BZBA 1AP6A 4LF4B 4CBCA 1J5EO 1KECA 4O2BB 1YVWA 1F23A 4B7EA 3FB6C 4LF9B 4DPGA 3E35A 3JSLA 2NNUA 2XAFA 4R8CA 4LC1A 2OT5A 3K59A 1H4VB 1KU9A 2ZR2A 1UFIA 2Y69C 4DV2O 3ERRA 3R07A 1BZKA 3OTOB 3IG2A 3PZCA 2IU0A 4IHJA 1PV0A 3H1IH 3HRIA 5IJ0B 1OCCB 3C3TA 1N4CA 4YHHO 1MZFA 1EBOA 5EZYA 1PPJH 5IYDO 3ZS8C 4X1YB 2KKWA 1AP5A 4OGQB 5AG2A 2CGOA 4MTXA 3CRQA 3G80A 5TISZ 5JVDA 4X65O 2RHSA 1AJPA 4BW5A 1PNMA 2IM9A 2WLMA 1H2NA 1RPOA 1ASZA 2OTJV 2DYSB 5CB4B 3N2KA 4WFEA 2AKWB 1N36B 2PYJA 4LVMA 4OX9O 1AI6A 4MVMA 2JJ1G 1IXBA 2Z5UA 3UKMA 4X5OA 4NKGB 2YS8A 3M4PA 2N74A 2DXTA 4R7CA 1B76A 2AW9A 3CX5F 5IY5C 1XI1A 3MD0A 3OEEG 4JZ2A 1SERA 4YIPA 3ABMB 3JAKB 1G51A 4P74A 1ZX3A 4QE9A 4NB5A 4JI2O 3OGCC 1GGMA 1FJGB 2EJFA 3CJHA 2ZNJA 1X4TA 2WLNA 3AG2C 3JASA 1ZSPA 2RNBA 3RW0A 3ZEDA 3DC5A 1MMMA 1DGSA 3ZMUA 3I56V 1NJIW 4H2UA 1ROPA 1OV9A 3HXYA 3C3SA 3B09A 4BIZA 2X6BA 4NYKA 2Z0AA 2F43G 4MVUA 1EVKA 4MS2A 3J81N 5A9GA 3HFVA 2F1MA 4NTXA 4WF9V 3T1YB 4O4LB 5L3FA 1THZA 1Y74B 2QM8A 1EVLA 1VQ6V 3H1KH 4QPJA 5ELOA 4P74C 2XAHA 1BSMA 3FKSG 5LBQA 4MVZA 4LFBO 1WQWA 1QF6A 3A8TA 4LFCB 1N0JA 5LYJB 1IBMO 3RACA 3UT5A 1ADYA 2ODMA 2QE7G 3MF2A 5H2FZ 3E8HA 1N34B 2UXDB 1TUBB 1S77D 2BOBC 3E83A 1Q7YW 5KMGB 3DXRB 1NH2D 2AMCB 2VQEB 3VQYA 4TUYB 2XTIA 2BSKB 1KMMA 2CIMA 3CHXA 1QBZA 4FLTA 2W0FC 3CC7V 4UCTA 4P71A 4DV1B 3AG3C 1XREA 4DUZB 4ZHQA 1WNSA 2ODRC 4MW8A 1S72V 4JAUA 4PV1B 4UV8A 4DR1B 1BIAA 3L4GB 3RVZA 3OEHG 4UUJC 1JFFA 4RDXA 1ZL8A 5FPRA 4CC5A 2YSUB 2I4MA 5GW7A 3SPCA 4X66B 3LUTB 3JD1A 1VQKV 3TEHA 1IDSA 2X6CA 4YCWA 1KKCA 1V55C 4UVCA 4O4JB 1HW7A 1WA8B 2EZOA 1S5LZ 4B3MO 3MQZA 3RF1A 5EC2C 1FYJA 1XOUA 1B8AA 4P71C 4NXMO 1IBLB 1HWYA 3ETGA 4YDQA 3K0DA 1WAZA 3RWRD 4MVRA 3T4ZA 4UCOA 3RKXA 2EJ9A 4TWAA 3REXA 1WQ7A 3CWBH 1HR0B 3GVMA 2YIBD 4KXRA 3L73H 2P6JA 4PDMA 4TWKA 3B8NA 2A06H 1KMIZ 3AG4C 1YJNV 1TGOA 4FLYA 1QU7A 2B1GA 1Z5VA 4HWOA 4ZI7A 2UU9O 3TUPA 4ZBMA 4U7OA 3ASOB 1IBKO 3LSUA 3HXWA 4UB8Z 5CBGA 5KAFZ 1L8DA 3JAWB 4QJFB 4H2SA 3CCUV 1HP8A 2Y0IA 4XDJA 1H2KA 3ZMVA 2DWEC 5DECA 3T1HO 2GV9A 4DV0O 1EN4A 4ZTUB 3SPGA 3SGIA 1GK9A 4QGPA 1S76D 4TV9A 3RFRA 4XEOA 4I50B 2BE3A 2YXLA 5EK0A 1MABG 4HWTA 1SS3A 2QWPB 3ZRWA 3K5NA 5LXTA 1TAEA 1Q6UA 1Q6IA 1I7FA 1KD1W 1BCCH 2LFSA 3TETA 4DW0A 2KG7A 5E3IA 5LP6B 2IY5A 4PJ0Z 1GN2A 3RN4A 3AK1A 1Y76B 3ZMSA 4YRIA 2ZXWB 3OD1A 2FYKA 2LGQA 3KKYA 2A8EA 2DN9A 1J95A 4DUYB 5ITZB 3KZIZ 2R70A 2XAJA 2HG5C 3K5LA 3NEMA 4OLFA 2QSAA 2P5IA 1QLEC 2E10A 4FLVA 2PUSA 1PP9H 1J5EB 2Q7GA 1GKFA 5KHJA 1NYRA 2WSSG 1X54A 2XOKG 2R9IA 4P75A 4E2LA 4DV4O 1K4DC 4ZOLA 4EFBA 2XASA 1NJ2A 1SKVA 1DTOA 4G27B 1H8EG 3M7MX 4RO2A 4BW9A 3W7UA 4X9QA 1RSOB 2PZSA 3AK3A 4I4TA 4D6TH 3G1ZA 3BABA 4BIUA 1B70A 4XTXA 5F5WA 4IGGA 4DV6O 5EBMC 4YHHB 2UUCO 3D3QA 3WQZA 1VQ4V 4R6ZA 2DWDC 3ZJZA 2PY5A 2EIMC 2EJRA 2OCCC 2JIZG 4W4LA 1KC8W 1MZEA 5LMUB 1CXZB 1U97A 5L3CA 1QCEA 4X65B 4JI1O 4DV5B 3W7TA 1LR1A 4L87A
chains in the Genus database with same CATH topology
3U0ZA 3CMQA 1Z5WA 4H2XB 5LXTB 5KHGA 4X1IB 3NENA 3CSXA 5CA0B 4X1KB 1G6UA 4EB6B 3HFZB 5J2UB 2E64A 4LNSA 4O4IA 1C0AA 1WLEA 1JMKC 4B3SB 2RHQB 4K86A 3HKDB 4TQFA 3RKWA 4P73A 1NJ8A 2ZIMA 4LNUB 2ZNIA 3RUXA 2XGTA 4DK1A 2ZT7A 3KFUA 5JJNB 1H2SB 3RYFA 3ICXA 5LP6C 1XMQB 1WPYA 3EFSA 3UQ8A 2DXUA 4P72C 2PMFA 3QF7A 4TQDA 1J5WA 2QHVA 3A7UA 4LF6B 2P0LA 1M93A 5FPOA 3I7FA 3TEGA 4ZTZB 1VF7A 2ZCEA 3HKBA 4HNAB 1NNHA 2ALYB 4OP0A 4YRCA 4XEMA 2Q7HA 1H4QA 3N2GB 1T5EA 5J2TA 4PI2A 4GKKB 3DSQA 5K1XA 3HKCB 4FFBA 4JV5B 1N32B 2P22C 4DRXA 4DR2B 5IYZA 4DR5B 1E24A 2ZT8A 3E9HA 4H2YA 2RQ6A 2YI8A 1O9HA 4JI6B 4JYAB 3UH0A 3V8LA 4X1YA 4LFAB 4YRRA 3JATA 4GYCB 4KHPB 3LSSA 4TV8B 4UP9A 5EYPA 4DQ2A 3SJAC 2DKGA 2PMEA 2ZZFA 3HKEB 2ZZEA 4IHJB 2VWJA 4H2XA 4P73C 4TOIA 4X1IA 4E51A 5CA0A 4X1KA 4RMFA 5K1PA 4LF8B 1WPBA 4EB6A 3HFZA 1KMNA 5IWAB 3V8JA 3RYCB 2DDZA 1N33B 5EZYB 2ZTGA 5KX5B 1L0WA 4LVIA 1NT2B 4D7TA 1BBWA 5LOVB 1XMOB 4YRFA 2RHQA 3HXVA 2DU5A 4K0KB 4CH3A 1YGBA 3HKDA 4YRJA 2P5OA 4YY3B 4DR3B 3QNEA 2CJ9A 2EWNA 4O2DA 4XTVA 3JALA 1X56A 4LNUA 1B7YB 1SESA 3WB2A 2RHSB 2E3CA 4DR6B 2EL9A 3L1AA 1JJCA 3A5ZA 3MEYA 4UPAA 5JQGB 4HVCA 1X2GA 4LVLA 5GONB 4NVPA 1YFTA 4O4IB 4YRMA 4KL1A 4UCRA 4UCSA 4LF4B 2DEQA 3VBBA 4P3NA 5JCOA 4HNAA 2VWKA 4UCVA 3N2GA 1E1OA 4O2BB 2F95B 3V7CA 3OTFA 3HKCA 4LF9B 3RGLA 4DPGA 3P8VA 2R9AA 3JSLA 3BA8A 3K59A 1H4VB 4DV2B 3FFQA 1KU9A 4TVWA 2JGUA 4LR3A 2ZR2A 4XU1A 2J3LA 4TV8A 3ERRA 3R07A 1H4TA 2C7IA 3OTOB 1SETA 3IG2A 3PZCA 2QHTA 4O4HB 3HKEA 4IHJA 1QE0A 3IKMB 3P8TA 3K57A 1X2HA 2JVDA 5D5PA 3HRIA 3JASB 5IJ0B 3QO7A 2QHUA 4UP7A 5ELNA 3RYCA 4YRQA 4L8JA 2DQ0A 5IYZB 5EZYA 5JJEB 5KX5A 3V8KA 4B3RB 4HA8A 3A5YA 3ZS8C 1SQGA 5LOVA 1HNZB 4DR4B 4X1YB 2KKWA 4K88A 2OWOA 2E1HA 1SA0B 5FNVA 5LYJA 2XHBA 4B3MB 4EFEA 5EIBD 1X01A 5JVDA 2RHSA 1PYSB 3HTZA 3HXZA 4NXMB 4P75C 2IM9A 1TUBA 4FLZA 4HWSA 4GLXA 1ASZA 1IL2A 5JQGA 2BTQB 2YI9A 3EFRA 3RGBA 3WB0A 5GONA 5CB4B 2PTMA 3N2KA 4IIJB 4OX9B 2AKWB 4PHCA 1N36B 4FM2A 2PYJA 4LVMA 2R72A 3MF1A 5KHIA 4XTWA 2I4OA 4RQFA 2EX3A 1H4SA 1NJ5A 4X5OA 4CS4A 3THOA 3M4PA 1NJ1A 4O2BA 2DXTA 2NS6A 1B76A 1FFXA 3JALB 4HT4A 3A32A 3UT5B 3VQVA 5C53B 2QJ1A 1XI1A 4JI7B 2DJZA 1SERA 1JJCB 1M5IA 3JAKB 4JI2B 1G51A 4P74A 3HXUA 4K8ZA 1GGMA 2V4DA 4O4HA 3BHPA 4JI3B 1FJGB 2EJFA 2ZGWA 3A74A 3NETA 2ZNJA 1X4TA 2JS5A 1USYA 4J15A 3JASA 5IJ0A 2UU9B 1N9WA 1RIQA 3ZEDA 1WN7A 1EIYB 4I9QA 2CJBA 1DGSA 3ETQA 5KHHA 3BA9A 4LF7B 4BWAA 1WU7A 4YRSA 1S5JA 4H2UA 3HXYA 3SJCC 4JI8B 4ZHQB 3M4QA 1SA0A 3K5MA 4B08A 3U11A 1O9GA 2PGGA 1EVKA 1G5IA 3A7RA 3HFVA 1PYSA 2F1MA 3LSQA 3T1YB 1JFFB 4O4LB 3A2FA 1TA8A 2BTQA 5CB4A 4IIJA 4DV3B 2AKWA 1Q43A 1EVLA 5C8YB 4XU0A 2ZT6A 5ELOA 4P74C 3E22B 3TEHB 4LFBB 4AILC 4FM0A 2ZIOA 1IBMB 1WQWA 1QF6A 3L2ZA 2ZT5A 4LFCB 5FNVB 5LYJB 4LH6A 1USYC 4TTVA 3RACA 4RQEA 3UT5A 1ADYA 5JVDB 1YEWA 3K58A 2ZINA 3MF2A 2PYLA 1N34B 2UXDB 1XNQB 1TUBB 1EOVA 2F4VB 3SR2C 3JAKA 5KMGB 4YRTA 3N2KB 3HY0A 4YCVA 4AH6A 1EFWA 4YP0A 2Q5IA 1FYFA 4H02A 3FJPA 2AMCB 2VQEB 2YIBA 3VQYA 5BMVB 4YRNA 4TUYB 2XTIA 4XTZA 1KMMA 2CIMA 3CHXA 1EIYA 4FLTA 1FFXB 3HRKA 1I94B 4FLWA 4UCTA 4P71A 4JI0B 3QO8A 4DV1B 2DQ3A 4PI0A 1W66A 4DUZB 4LH7A 2Q5HA 4ZHQA 1WNSA 2ODRC 2F93B 4HWPA 4XU2A 1Q3EA 4YCUA 4CH5A 3UGTA 1XNRB 2UUAB 3BPZA 4DR1B 1BIAA 4H2VA 3L4GB 4YYEA 2HNIA 1JFFA 4O4LA 2ARSA 4EX5A 4RDXA 5FPRA 4CC5A 4ZI7B 3E9IA 2I4MA 4YPFA 4AHCA 1NYQA 2EJGA 5C8YA 4X66B 4YREA 1VQZA 1SQFA 2CAZC 3E22A 3TEHA 11ASA 4AQYB 4K8XA 4YCWA 1Q5OA 4YRPA 4WJ4A 3SJBC 4O4JB 5JCOC 1HW7A 2ODRD 4X20B 4DK0A 3MQZA 3RF1A 4PG3A 1QQCA 5BR8B 4CC6A 1B8AA 1B04A 3JARA 4Q6GA 4P71C 4P3PA 3RL6A 1IBLB 4YDQA 2BTOA 4UFZA 5KMGA 2DU7A 3RWRD 3K5OA 2DTOA 2DZ9A 4TV9B 5LP6A 2AMCA 5BMVA 4LVKA 3B2EE 3QG5A 4TUYA 4UCOA 1YB3A 4LF5B 4WF2A 2ZXFA 4G85A 2Q0AA 2Q7EA 2EJ9A 3IALA 2UXBB 4TWAA 3REXA 4WBNB 4FLUA 1WQ7A 1HR0B 1Q8IA 4B3TB 5ITZA 2YIBD 4X62B 2OYQA 4EEQA 3BRCA 4YRLA 4I55B 1XQ8A 2E5LB 4NCXA 1BIBA 2EAYA 1KMIZ 4YJ2B 2ZZGA 4XU3A 2C8MA 1V9PA 1TGOA 4U3JB 4F6RA 4FLYA 1D5AA 4YRGA 1E1TA 3HXXA 1HNXB 3L4GA 1Z5VA 2IY5B 1G5HA 4HWOA 4EO4A 3PCOB 4ZI7A 4UCUA 3TUPA 1BBUA 3RYHB 1IBKB 4TVAB 2HEPA 4YROA 3HXWA 3QO5A 5KHKA 1L8DA 5JH7A 4XTUA 3JAWB 3RYIB 1NJ6A 4H2SA 4O4JA 1RSOA 4Q15A 4DV7B 4X20A 5LMNB 3T1HB 2CJAA 4KR2A 1XHXA 4CH6A 2G4CA 2ZM6B 4DV0B 2GV9A 5IJ9B 5D5QA 1WYDA 3UGQA 4ZTUB 1M4UA 3SGIA 4CH4A 4FM1A 3A7AA 4TV9A 4ZOLB 5JJJB 3NELA 4H2WA 5KNNA 1SRYA 3WB1A 3RFRA 2ARUA 2DZCA 4XEOA 4I50B 1E22A 4LVJA 2QHSA 3HY1A 2YXLA 4WBNA 1HNWB 4HWRA 4HWTA 12ASA 4DR7B 4I4TB 5LA6B 1B70B 4YJ3B 3K5NA 5LXTA 1TAEA 4I55A 3BAAA 3JARB 1I7FA 2YIAA 4WJ3M 2E41A 5J2UA 3UFGA 4YJ2A 5CA1B 4U3JA 2J3MA 1HXDA 3ICAA 4X64B 1ADJA 5LP6B 5E3IA 3RIRA 4WI1A 4O2AB 4YRKA 3BFMA 2IY5A 2E65A 2UUBB 4PHZA 1TVKB 2RJZA 3PCOA 1YFRA 1P49A 4XTYA 4YRIA 4KQEA 3OD1A 3PN1A 3RYHA 2FYKA 4L87A 1HTTA 2A8EA 4TVAA 3A31A 4P3OA 4DUYB 5ITZB 4CS2A 3VQWA 3LNNA 5C52B 1Z7MA 2I4NA 1ZAUA 2R70A 3JAWA 3RYIA 3K5LA 3CB2A 3BJUA 3NEMA 4OLFA 2P5IA 2UXCB 4F6RB 4FLVA 2E10A 2E5AA 2PUSA 4ZIBA 4JI4B 3IKLA 4G84A 1J5EB 2ALYA 2Q7GA 3REUA 3MAQA 5KHJA 1ATIA 4UP8A 3VQXA 1NYRA 5IJ9A 2DTIA 2DVEA 5HGQA 4JI5B 4DV4B 5C51B 1X54A 1WNLA 3RKYA 4P75A 1QHTA 4HBNA 1JJOA 1Z7NA 2CGHA 4ZOLA 1LYLA 2F66C 4EFBA 4TVYA 1NJ2A 1SKVA 3LC0A 4I50A 5EIBC 5JH7B 2HHHB 3RYFB 1X55A 3M7MX 4BW9A 1ASYA 2VQFB 2PZSA 2DTHA 2ARTA 4NXNB 4I4TA 5LA6A 3G1ZA 3BABA 1B70A 4YJ3A 4DV6B 4XTXA 5F5WA 2UUCB 3V7SA 3IAYA 3HKBB 1XHZA 3RKXA 3U10A 4YHHB 3JSNA 5J2TB 1YFSA 3P8YA 3WQZA 4KR3A 4FFBB 2QM4A 5CA1A 4DRXB 2PY5A 4FVMA 4D7SA 4CS3A 2I4LA 4H2TA 3W3SA 4O2AA 5LMUB 4GKJB 1TVKA 4P72A 3JATB 1EQRA 3QTCA 4JI1B 3V7RA 1KOGA 5EYPB 4X65B 4DV5B 1B7YA 1HC7A 2ZR3A 4FLXA 4K87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMQ A;  4H2X B;  3NEN A;  1G6U A;  3HFZ B;  2E64 A;  4LNS A;  1C0A A;  1WLE A;  2RHQ B;  4K86 A;  4TQF A;  3RKW A;  4P73 A;  1NJ8 A;  2ZIM A;  2ZNI A;  3RUX A;  2XGT A;  2ZT7 A;  3KFU A;  1WPY A;  3EFS A;  2DXU A;  4P72 C;  2PMF A;  3A7U A;  4TQD A;  1J5W A;  2QHV A;  2P0L A;  4ZTZ B;  3TEG A;  3I7F A;  2ZCE A;  1NNH A;  2ALY B;  4YRC A;  4OP0 A;  2Q7H A;  1H4Q A;  3DSQ A;  5K1X A;  2E41 A;  4XEM A;  4H2Y A;  3E9H A;  1E24 A;  2ZT8 A;  2RQ6 A;  2YI8 A;  1O9H A;  3UH0 A;  3V8L A;  4YRR A;  3LSS A;  4UP9 A;  4DQ2 A;  2DKG A;  2PME A;  2ZZF A;  2ZZE A;  4H2X A;  4P73 C;  4E51 A;  4RMF A;  5K1P A;  3HFZ A;  1KMN A;  3V8J A;  2DDZ A;  2ZTG A;  1L0W A;  1BBW A;  4YRF A;  2RHQ A;  3HXV A;  2DU5 A;  4CH3 A;  1YGB A;  4YRJ A;  4O2D A;  3QNE A;  2CJ9 A;  2EWN A;  4XTV A;  1X56 A;  1B7Y B;  1SES A;  2RHS B;  2E3C A;  2EL9 A;  3L1A A;  1JJC A;  3A5Z A;  3MEY A;  4UPA A;  4HVC A;  1X2G A;  1YFT A;  4YRM A;  2DEQ A;  3VBB A;  4P3N A;  1E1O A;  3V7C A;  3RGL A;  4DPG A;  3P8V A;  1H4V B;  4TVW A;  2ZR2 A;  4XU1 A;  2J3L A;  3ERR A;  3R07 A;  1H4T A;  2C7I A;  1SET A;  3IG2 A;  3PZC A;  2QHT A;  1QE0 A;  3IKM B;  3P8T A;  1X2H A;  2JVD A;  3HRI A;  3QO7 A;  2QHU A;  4UP7 A;  5ELN A;  4YRQ A;  2DQ0 A;  3V8K A;  4HA8 A;  3A5Y A;  4K88 A;  2E1H A;  1X01 A;  2RHS A;  1PYS B;  3HTZ A;  3HXZ A;  4P75 C;  4HWS A;  1ASZ A;  1IL2 A;  2YI9 A;  3EFR A;  2AKW B;  4PHC A;  2R72 A;  3MF1 A;  4XTW A;  2I4O A;  4RQF A;  1H4S A;  1NJ5 A;  4X5O A;  4CS4 A;  3M4P A;  1NJ1 A;  2DXT A;  1B76 A;  3A32 A;  3VQV A;  5C53 B;  2QJ1 A;  2DJZ A;  1SER A;  1JJC B;  4P74 A;  1G51 A;  3HXU A;  1GGM A;  2ZGW A;  2EJF A;  3BHP A;  3A74 A;  3NET A;  2ZNJ A;  1USY A;  4J15 A;  1N9W A;  1RIQ A;  3ZED A;  1EIY B;  2CJB A;  1WU7 A;  4BWA A;  4YRS A;  4H2U A;  3HXY A;  3M4Q A;  1O9G A;  2PGG A;  1EVK A;  1G5I A;  3A7R A;  3HFV A;  1PYS A;  3LSQ A;  2AKW A;  1EVL A;  4XU0 A;  2ZT6 A;  5ELO A;  4P74 C;  3TEH B;  2ZIO A;  1WQW A;  1QF6 A;  3L2Z A;  2ZT5 A;  1USY C;  4TTV A;  3RAC A;  4RQE A;  1ADY A;  2ZIN A;  3MF2 A;  1EOV A;  4YRT A;  1EFW A;  3HY0 A;  4AH6 A;  4YCV A;  4YP0 A;  2Q5I A;  1FYF A;  4H02 A;  3FJP A;  2AMC B;  2YIB A;  3VQY A;  4YRN A;  2XTI A;  4XTZ A;  1KMM A;  2CIM A;  1EIY A;  3HRK A;  4P71 A;  3QO8 A;  2DQ3 A;  1W66 A;  2Q5H A;  2ODR C;  4HWP A;  4XU2 A;  3UGT A;  4YCU A;  4CH5 A;  1BIA A;  4H2V A;  3L4G B;  4YYE A;  2HNI A;  2ARS A;  4EX5 A;  4RDX A;  3E9I A;  2I4M A;  4YPF A;  1NYQ A;  2EJG A;  4YRE A;  1VQZ A;  3TEH A;  11AS A;  4YCW A;  4YRP A;  4WJ4 A;  2ODR D;  3RF1 A;  4PG3 A;  1B8A A;  4Q6G A;  4P71 C;  4P3P A;  3RL6 A;  4YDQ A;  2DU7 A;  2DTO A;  2DZ9 A;  2AMC A;  1YB3 A;  4WF2 A;  2ZXF A;  4G85 A;  2Q7E A;  2EJ9 A;  4TWA A;  3IAL A;  3REX A;  3RKX A;  1WQ7 A;  2YIB D;  4YRL A;  4NCX A;  1BIB A;  2EAY A;  2ZZG A;  4XU3 A;  2C8M A;  4YRG A;  1E1T A;  3HXX A;  3L4G A;  2IY5 B;  1G5H A;  4HWO A;  4EO4 A;  3PCO B;  3TUP A;  1BBU A;  4TVA B;  2HEP A;  4YRO A;  3HXW A;  3QO5 A;  4XTU A;  4H2S A;  1NJ6 A;  4Q15 A;  2CJA A;  4KR2 A;  4CH6 A;  2G4C A;  1WYD A;  3UGQ A;  4ZTU B;  4CH4 A;  3A7A A;  3NEL A;  4H2W A;  5KNN A;  1SRY A;  2ARU A;  2DZC A;  4XEO A;  1E22 A;  2QHS A;  3HY1 A;  4HWR A;  4HWT A;  12AS A;  1B70 B;  2YIA A;  4WJ3 M;  3UFG A;  2J3M A;  1HXD A;  3ICA A;  1ADJ A;  5E3I A;  3RIR A;  4WI1 A;  4YRK A;  3BFM A;  2IY5 A;  2E65 A;  2RJZ A;  3PCO A;  1YFR A;  4XTY A;  4YRI A;  4KQE A;  3OD1 A;  2FYK A;  4TVA A;  1HTT A;  3A31 A;  4P3O A;  4CS2 A;  3VQW A;  5C52 B;  1Z7M A;  2I4N A;  2R70 A;  3BJU A;  3NEM A;  4OLF A;  2P5I A;  2E10 A;  2E5A A;  2PUS A;  4ZIB A;  4G84 A;  3IKL A;  2ALY A;  2Q7G A;  3REU A;  4UP8 A;  1ATI A;  3VQX A;  1NYR A;  2DTI A;  2DVE A;  5HGQ A;  5C51 B;  1X54 A;  1WNL A;  3RKY A;  4P75 A;  1Z7N A;  2CGH A;  1LYL A;  4TVY A;  1NJ2 A;  3LC0 A;  1X55 A;  1ASY A;  4BW9 A;  2DTH A;  2ART A;  3G1Z A;  4XTX A;  1B70 A;  5F5W A;  3V7S A;  1YFS A;  3P8Y A;  3WQZ A;  4KR3 A;  4CS3 A;  2I4L A;  4H2T A;  3W3S A;  4P72 A;  1EQR A;  3QTC A;  3V7R A;  1KOG A;  1B7Y A;  1HC7 A;  2ZR3 A;  4L87 A;  4K87 A; 
#chains in the Genus database with same CATH topology
 4H2X B;  5KHG A;  4B3T O;  3CSX A;  4X1K B;  4FZ0 A;  4EB6 B;  4AI8 A;  2P7T C;  4N21 A;  5B1B C;  5KA6 A;  2Q67 A;  1C0A A;  3SPJ A;  1HNX O;  3OGI B;  1KUQ A;  3HKD B;  5KUK A;  1MNG A;  2ZIM A;  1W0J G;  4DK1 A;  4MVQ A;  1ENV A;  3CS5 A;  3KFU A;  4C7U A;  3AG7 A;  1B6Q A;  5JJN B;  1H2S B;  2CE4 A;  3LDE A;  1OCZ B;  3UQ8 A;  1J5W A;  2LW7 A;  1FS0 G;  1VF7 A;  2ZCE A;  3CXH F;  3HKB A;  1JPX A;  4P9P A;  3K03 A;  3JD4 A;  5LMN O;  1W2B U;  5L3B A;  1OHH G;  5J2T A;  4ABM A;  1JOY A;  3HKC B;  4PDR A;  4DRX A;  3CC4 V;  4H2Y A;  1E24 A;  3E9H A;  1N32 O;  3FYI B;  2JGD A;  4MTO A;  4U7N A;  4RUF A;  4X1Y A;  4YRR A;  4TV8 B;  3EFF K;  5EYP A;  3IC9 A;  2AGA A;  4XDK A;  3LNM B;  4TOI A;  3FB5 C;  4IT5 A;  4NTW A;  2LJ2 A;  3W7W A;  5K1P A;  4LF8 B;  1WPB A;  3Q4H A;  1H2G A;  2VRZ A;  3V8J A;  1N33 B;  1L0W A;  1BMF G;  4FIP C;  5LOV B;  1BE3 H;  1GN3 A;  2RHQ A;  2DU5 A;  1FD9 A;  5LHI A;  2CTP A;  4DR3 B;  4O2D A;  4K0K O;  4XTV A;  4B7K A;  2GUZ A;  1NU1 H;  1XDC A;  4LNU A;  4WFG A;  1L1F A;  4J9Y B;  1Y66 A;  5B1N A;  2W0X A;  1M90 W;  2Q6A A;  3ZHR A;  1X2G A;  5GON B;  3CXC U;  4KL1 A;  1PL4 A;  1RFY A;  2DEQ A;  1QVG U;  4P3N A;  5JCO A;  1K9M W;  3FAV A;  4UCV A;  1E1O A;  3RGL A;  1H8H G;  2R9A A;  3BA8 A;  1PNL A;  4MTG A;  1I0H A;  2JGU A;  4LR3 A;  1AJN A;  4QE7 A;  4X89 A;  2J3L A;  1I5X A;  5CBH A;  1M57 B;  2ZT9 B;  4JTA B;  3STL C;  3LDC A;  4O4H B;  3HKE A;  3IKM B;  3P8T A;  1X2H A;  1FXH A;  5ELN A;  1GO3 F;  2DQ0 A;  2QWN B;  1OCO C;  5KX5 A;  3V8K A;  4FK5 C;  4HA8 A;  4DR4 B;  1HNZ O;  1NTK H;  2OWO A;  5LYJ A;  4B3M B;  4EFE A;  1RPR A;  2OIG A;  5LHG A;  1NTM H;  2P90 A;  3HTZ A;  4GX2 A;  3HXZ A;  2P67 A;  4NXM B;  4PEL A;  3OMN B;  1TUB A;  4GX0 A;  4GLX A;  3ZHT A;  1IL2 A;  5JQG A;  1YDX A;  2EIK C;  2BTQ B;  2YI9 A;  3EFR A;  3WB0 A;  2HJF C;  1OCR C;  5KHI A;  2DJV A;  2PI5 A;  3L9D A;  1NJ5 A;  1H4S A;  3ZHU A;  3ZBH A;  1NJ1 A;  2NS6 A;  2MW2 B;  1FXK B;  1PKX A;  3VQV A;  2ITC C;  4JI7 B;  2DJZ A;  1M5I A;  1QNM A;  2IH1 C;  1PM9 A;  2YXY A;  4FFK A;  1W0K G;  1GN6 A;  2V4D A;  3BHP A;  4LF6 O;  3JAM N;  1USY A;  3S3W A;  2WLI A;  2UU9 B;  1N9W A;  1RIQ A;  4I9Q A;  4DO2 A;  3PJS K;  2YEV B;  4YRS A;  4DR5 O;  3SJC C;  3M4Q A;  3SJQ C;  2JJ2 G;  1SA0 A;  3B40 A;  5KUM A;  2CTR A;  5L3D A;  4B08 A;  1VIB A;  4LWS A;  3K5M A;  1R6K A;  1G5I A;  1PYS A;  2E74 B;  2CDY A;  1M9N A;  3CD6 V;  3RBZ A;  3A2F A;  1TA8 A;  1VMG A;  3SYO A;  2WWW A;  4IIJ A;  4DV3 B;  2CGN A;  1Q43 A;  3RT3 C;  5C8Y B;  1K3E A;  2K9P A;  4XU0 A;  2ZT6 A;  2WLL A;  1SQX H;  2ZIO A;  1OZ0 A;  3ABK C;  2ZT5 A;  1USY C;  2QWQ B;  2ILM A;  2OCH A;  3K58 A;  2ZIN A;  3ZMZ A;  3CRM A;  4JYB A;  5DN6 G;  2PYL A;  4J42 A;  4RWU A;  1EOV A;  2F4V B;  4I0X A;  4YCV A;  1W59 A;  3OE7 G;  1NS1 A;  3FJP A;  2YIB A;  4YRN A;  3IFX A;  1EIY A;  1NR7 A;  3G4S V;  1I94 O;  1W66 A;  4JI0 O;  1EFR G;  4LH7 A;  3E89 A;  2F93 B;  1GM7 A;  3CCV V;  1VQN V;  4XU2 A;  1Q3E A;  3CCL V;  1X59 A;  1BQ0 A;  3P30 A;  3BPZ A;  4OXS A;  2HNI A;  1XL6 A;  2ARS A;  4EX5 A;  5BXZ A;  3E9I A;  2EIJ C;  4AHC A;  3R65 A;  2LP7 A;  4P30 A;  3E22 A;  2GTS A;  4B3R O;  4K8X A;  1Q90 D;  5IE9 A;  4AQY O;  1Q5O A;  2WPD G;  4LP8 A;  3BEH A;  2L6L A;  3A0B Z;  2DW4 A;  2A0L A;  4X20 B;  4DK0 A;  1F4M A;  1VQ7 V;  2IJK A;  5BR8 B;  3IGA C;  1ZTE A;  4Q6G A;  4P3P A;  3RL6 A;  2MK3 A;  2JRI A;  4UFZ A;  3ASN B;  2DU7 A;  3K5O A;  2CH7 A;  5LP6 A;  5BMV A;  1YJW V;  5LGT A;  1K8A W;  3BCC H;  1YB3 A;  4LF5 B;  4U3F H;  2EIN B;  4G85 A;  1V54 B;  4JYY A;  4WBN B;  3TK1 A;  4I5S A;  5B1A C;  4B3T B;  5ITZ A;  4FPP A;  2ZQM A;  4EEQ A;  5LGN A;  1JVM A;  4X62 O;  1JX9 A;  3WG7 C;  4NCX A;  1BIB A;  2PI4 A;  2V1D A;  5C93 A;  1YTF B;  1V9P A;  4U3J B;  1D5A A;  1GN4 A;  2ADQ B;  4Z2W A;  1HNX B;  3OR6 C;  4YRG A;  4JI3 O;  4WFF A;  3PCO B;  4UCU A;  1M56 C;  3RYH B;  2Q68 A;  2DYR B;  4TVA B;  2B1I A;  4YRO A;  2Y4T A;  3ZHS A;  1D5N A;  4LF7 O;  1EN5 A;  3D8C A;  3ZHQ A;  3DC6 A;  3AG1 B;  4JI8 O;  3RYI B;  1RSO A;  2QDO A;  5LMN B;  4DV7 O;  4KR2 A;  1XHX A;  2DOS A;  4QNH B;  2ZM6 B;  1MSD A;  2EBO A;  2ZDI A;  3NEL A;  3L74 H;  3WB1 A;  2AZ0 A;  2QHS A;  3HY1 A;  2K1E A;  1RM1 C;  3ML0 A;  1K7D A;  3D3I A;  2BOC C;  3SPI A;  1HNW O;  12AS A;  5LA6 B;  3JCU Z;  3K06 A;  1JQ0 A;  4DR7 O;  4J7J A;  1VQO V;  4I55 A;  2ZD9 A;  2HKO A;  4YJ2 A;  5CA1 B;  2J3M A;  1EZV H;  1WJZ A;  4H0L B;  3RIR A;  2E65 A;  2ZE7 A;  3M99 B;  2UUB B;  1TVK B;  1EM1 A;  1GRJ A;  2RJZ A;  4KQE A;  3PN1 A;  4LCU C;  2WA4 A;  4NR1 A;  1NTZ H;  2NLJ C;  2RMK B;  4CS2 A;  4KP4 A;  5FL7 G;  2IJI A;  3LDD A;  3LNN A;  1P7B A;  3CB2 A;  3L72 H;  2UXC B;  4F6R B;  4IYH A;  4ZIB A;  3IKL A;  3CRR A;  1K5Q A;  3RVY A;  2DVE A;  3KCY A;  5IJ9 A;  5HGQ A;  5C51 B;  3MDS A;  4UV9 A;  4HBN A;  1ZWI C;  2CGH A;  1LYL A;  3ZMT A;  2F66 C;  2VS0 A;  4J41 A;  2LQT A;  5EIB C;  2EIL C;  3RYF B;  1ASY A;  2VQF B;  2DTH A;  2ART A;  1SQV H;  5GTH Z;  2EZP A;  4YJ3 A;  1BL8 A;  3V7S A;  3CP1 A;  4H13 B;  3IAY A;  2A3Q A;  2XAG A;  4JTC B;  1YFS A;  3P8Y A;  4KR3 A;  1VQL V;  4H2T A;  4O2A A;  3ZCC A;  2JK5 C;  4UVA A;  4GKJ O;  2UXB O;  1HC7 A;  3FYE B;  3CMQ A;  2IJJ A;  1G6U A;  1COW G;  2LW1 A;  3HFZ B;  5J2U B;  2E64 A;  2E76 B;  2Y69 B;  3S3X A;  2OTL V;  1WLE A;  3P3N A;  2A79 B;  4P9O A;  3ABL C;  4P73 A;  1YXB A;  2ZNI A;  3K3W A;  2ZT7 A;  1WPY A;  3EFS A;  1XMQ B;  1LNQ A;  2PMF A;  4TQD A;  2QHV A;  5IYB O;  4LF6 B;  5GTI Z;  4E4E A;  4ZTZ B;  3I7F A;  1NNH A;  1YHQ V;  4YRC A;  4PI2 A;  4GKK B;  4FFB A;  2P22 C;  4DR5 B;  4JV5 O;  4JI6 B;  4HAM A;  3ZRV A;  4XBF A;  4JYA O;  3H1H H;  3JAT A;  3LSS A;  4BAY A;  2WLK A;  5H9C A;  1S3J A;  4KHP O;  4DQ2 A;  1P7G A;  4TT3 G;  4GX1 A;  2PME A;  1XEQ A;  4IHJ B;  4P73 C;  4X1I A;  5IY5 B;  5CA0 A;  5CBF A;  5IWA B;  3OR7 C;  3HB3 B;  5B3S C;  2DDZ A;  5EZY B;  3STZ C;  2ZTG A;  1NT2 B;  3N27 A;  3TXQ A;  4D7T A;  1M57 C;  3X2Q C;  4W4K A;  1XMO B;  3GB7 C;  4X64 O;  3HXV A;  4CH3 A;  4DYL A;  4YRJ A;  3CCS V;  2CJ9 A;  5B66 Z;  2QKC A;  2Y0P A;  2WLH A;  1B7Y B;  3AG2 B;  2RHS B;  4JAV A;  3L1A A;  3F7Y C;  4WFH A;  1FFT B;  3A5Z A;  5KA5 A;  4HVC A;  4LVL A;  4NVP A;  1G8M A;  1GH6 A;  4UCR A;  5IYC O;  3VBB A;  1L0L H;  4HNA A;  2VWK A;  4JI4 O;  1BGY H;  3APQ A;  1BT8 A;  3N2G A;  4WFA V;  3V7C A;  2GSM B;  3OTF A;  4GUN A;  1SZX A;  4JI5 O;  1WP8 A;  4UXN A;  4DV2 B;  2ATK C;  3FFQ A;  2F23 A;  4XU1 A;  1H38 A;  2HHH O;  4J10 A;  1H4T A;  2RDC A;  3CCQ V;  1SET A;  3DGE A;  3TCU A;  3OTO O;  4NXN O;  3ZN1 A;  2JVD A;  5DM6 V;  3JAS B;  2QHU A;  4UP7 A;  3RYC A;  5JJE B;  1ZUQ A;  4B3R B;  1IZ3 A;  1S0V A;  1NBM G;  2XHB A;  5EIB D;  3ZX6 A;  4P75 C;  2GHY A;  2GTA A;  4FLZ A;  4HWS A;  4ZKI A;  4ICG A;  2ZE6 A;  5HFL A;  2PTM A;  4OX9 B;  3AG3 B;  4BR6 A;  4PHC A;  4RQF A;  1N36 O;  2EX3 A;  1R3L C;  3APO A;  4O2B A;  4B3S O;  5JWP A;  2X0L A;  2JS3 A;  3JAL B;  3A32 A;  3UT5 B;  4PDV A;  3ZIA G;  2QJ1 A;  3KG2 A;  4PD4 F;  4JAS A;  3G71 V;  2XUM A;  4JI2 B;  3HXU A;  1WB7 A;  4JI3 B;  1V55 B;  4FZ1 A;  3A74 A;  1KYO F;  3NET A;  1FJG O;  2JS5 A;  4J15 A;  3MHH C;  1DK1 A;  5IJ0 A;  1D2D A;  5KAI Z;  3SDL A;  3ETQ A;  3VOU A;  5KHH A;  3BA9 A;  4LF7 B;  5IT9 N;  1WU7 A;  4YIO A;  1S5J A;  4DR2 O;  4JI8 B;  4ZHQ B;  1NVP B;  3W7X A;  3U11 A;  1O9G A;  5E79 Z;  3ZN0 A;  1QR8 A;  1CEZ A;  1JFF B;  3AEI A;  1ZL8 B;  3K04 A;  5CB4 A;  3O65 A;  2A9H A;  2AKW A;  2CK3 G;  5KLV H;  2D2C B;  3TEH B;  4LFB B;  1N8R W;  4AIL C;  3AG4 B;  3UO3 A;  1IBM B;  3H1L H;  1AI4 A;  5FNV B;  4LH6 A;  3BVO A;  2P4V A;  1BQZ A;  4TTV A;  4RQE A;  1OCC C;  4LFC O;  1BS3 A;  3SYC A;  3I55 V;  4F6E A;  2AZ2 A;  3HPL C;  4GCZ A;  1N34 O;  3SR2 C;  4JTD B;  3JAK A;  4AH6 A;  1Q81 W;  2VQE O;  1IUR A;  4XTZ A;  2M6Y A;  1F7Y A;  1FFX B;  4JGS A;  3HRK A;  2YIC A;  4FLW A;  2DQ3 A;  2DYS C;  2WLJ A;  3CRA A;  4PI0 A;  4DV1 O;  2IH3 C;  3OFN G;  3O9O A;  4G2K A;  3TJT A;  3UGT A;  4YCU A;  2FML A;  4H2V A;  3JD0 A;  3EXA A;  4O4L A;  1Y67 A;  4ZI7 B;  4MTF A;  1Y74 A;  4YPF A;  2HVK C;  3E8B A;  1ARO P;  4YRE A;  3ABM C;  3J80 N;  1VQZ A;  2CAZ C;  4X66 O;  2Q8V A;  4YRP A;  4WJ4 A;  5JCO C;  1AIL A;  2PF4 E;  1XUQ A;  5EC1 C;  4MVS A;  1MOF A;  2FL4 A;  4CC6 A;  3ZHV A;  5BY1 A;  3J7A U;  1IBL O;  5KMG A;  3DXR A;  4FMT A;  3TGU H;  4TV9 B;  3E8G A;  2AMC A;  1IX9 A;  4TUY A;  1JJ2 U;  1YCI A;  2BSK A;  2Q0O C;  3MHS C;  1NQT A;  1QLE B;  2ZXF A;  4WF2 A;  2Q0A A;  2Q7E A;  2UXB B;  2X6A A;  1PL0 A;  1HR0 O;  1NR1 A;  2OYQ A;  1F4N A;  4YRL A;  3FB7 C;  3OMI B;  1XQ8 A;  1AR1 B;  3A0H Z;  1G4Y B;  2KG7 B;  3OUF A;  3UCS C;  4F6R A;  2C8M A;  1MSW D;  1E1T A;  3HXX A;  4K3A A;  3L4G A;  5H6Q A;  2IY5 B;  3JYC A;  5CN0 A;  4EO4 A;  2CUG A;  3BFR A;  1IBK B;  1Y6X A;  3OUS A;  1VQM V;  3F5T A;  4LBE C;  3SYP A;  1NJ6 A;  1VQP V;  2EIM B;  4O4J A;  3T4D A;  1YSC A;  1WA8 A;  2OCC B;  4Q15 A;  3T1H B;  4CH6 A;  4DV0 B;  4RAI A;  3E86 A;  4PA3 A;  3OW2 U;  2B5U A;  3M8A A;  4CH4 A;  2V7Q G;  4FM1 A;  3A7A A;  4H2W A;  4ZOL B;  1URF A;  5J9P C;  4J11 A;  1E22 A;  5B1B B;  1AR5 A;  3SPH A;  2QWR B;  3JD2 A;  4I4T B;  2JEX A;  1B70 B;  3BAA A;  3JAR B;  4WJ3 M;  1XNQ O;  5J2U A;  3UFG A;  1SF9 A;  2LGW A;  4X64 B;  1ADJ A;  4H44 B;  2IW5 A;  4YRK A;  4MVO A;  4PHZ A;  3OAA G;  1YFR A;  4HYO A;  1WB8 A;  4UB6 Z;  1HTT A;  5CA3 A;  4JF3 A;  5C52 B;  2I4N A;  1ZAU A;  4PA9 A;  1I5Y A;  3JAW A;  4H33 A;  2AHZ A;  1B3Q A;  3BJU A;  1Y4M A;  2H8P C;  3NR7 A;  4JI4 B;  4G84 A;  1XNR O;  2UUA O;  2B9Z A;  3REU A;  1ATI A;  4PDL A;  3VQX A;  1VQ8 V;  2DTI A;  3E8F A;  4JI5 B;  4DV4 B;  1VQ5 V;  1JJO A;  3K0G A;  1XBL A;  1GAX A;  3HR0 A;  4I50 A;  5JH7 B;  1S5H C;  2HHH B;  4NXN B;  4DV6 B;  2UUC B;  3HKB B;  1XHZ A;  2AXT Z;  1K73 W;  3T2M A;  3U10 A;  3ASO C;  5J2T B;  2D3O W;  3P32 A;  4X88 A;  2QM4 A;  2WAM A;  2ZE8 A;  4DRX B;  2WA3 A;  1K97 A;  2YUA A;  4PA4 A;  3L75 H;  4CS3 A;  2JGD B;  3W3S A;  2ITD C;  4P72 A;  1Y76 A;  3C90 A;  4JI1 B;  5LMU O;  3V7R A;  1YTF D;  1U96 A;  5EYP B;  1B7Y A;  4DV5 O;  2KQX A;  2QKS A;  4N23 A;  3GWO A;  1YI2 V;  3NEN A;  2EUL A;  2FKX A;  3Q4H B;  2E5L O;  2Q4P A;  4WCE V;  3R66 A;  4BIO A;  4B3S B;  5IDJ A;  2RHQ B;  4P2Z A;  2GUZ B;  4YXW G;  4LNU B;  2XGT A;  1H2L A;  3E2E A;  4GX5 A;  1FAF A;  1OCO B;  3ICX A;  5LP6 C;  1SC5 B;  4J9Z B;  4P72 C;  3QF7 A;  3A7U A;  3JD3 A;  1Q86 W;  2P0L A;  1M93 A;  2ZXW C;  3F5W C;  2ALY B;  1R73 A;  4JYC A;  4OP0 A;  2Q7H A;  3FAV B;  1VAR A;  4XDL A;  3DSQ A;  1N32 B;  3ETD A;  4DR2 B;  2NR5 A;  1FPO A;  1LUW A;  1O9H A;  3UH0 A;  1H2M A;  2EIK B;  3V8L A;  1DLB A;  1YZB A;  4GYC B;  4WFB V;  1OCR B;  4UP9 A;  2ETN A;  3SJA C;  2DE0 X;  3CMA V;  4H2X A;  3HKE B;  2ARH A;  2VWJ A;  1IXM A;  1CPY A;  4X1K A;  4RMF A;  3CCR V;  4EB6 A;  1KMN A;  4LF8 O;  4NTY A;  3BY6 A;  5KX5 B;  4LVI A;  1N33 O;  1BBW A;  1A32 A;  4K0K B;  1YGB A;  3HKD A;  2P5O A;  5A2Q N;  3QNE A;  2EWN A;  2QKA A;  2QWO B;  3JAL A;  4DR3 O;  3WB2 A;  2ZDI C;  2JDI G;  1LUV A;  5LGU A;  4UPA A;  5JQG B;  1YFT A;  4O4I B;  2O57 A;  4UCS A;  3EVK A;  2R9R B;  5B5E Z;  2DMX A;  2F95 B;  1KP2 A;  3HKC A;  3P8V A;  1NH2 B;  1SQP H;  1MA1 A;  2W6I G;  2OIE A;  2FTK A;  4TVW A;  4IYI A;  1B06 A;  4TV8 A;  1IVS A;  2C7I A;  4X8A A;  2ZE5 A;  2QGN A;  1Q82 W;  2QHT A;  4QIW F;  3ABK B;  1QE0 A;  3K57 A;  5D5P A;  3QO7 A;  2WLI B;  5LHH A;  1FXV A;  4YRQ A;  4L8J A;  5IYZ B;  3JCZ A;  3L71 H;  1OCZ C;  1CP9 A;  2HR3 A;  3L70 H;  3A5Y A;  1SQG A;  5LOV A;  1HNZ B;  4K88 A;  4DR4 O;  2E1H A;  1SA0 B;  5FNV A;  4LWS B;  1X01 A;  4OPA A;  1PYS B;  5EBL C;  4DXW A;  4EKW A;  3K9S A;  2YC0 A;  3RGB A;  5GON A;  4IIJ B;  4FM2 A;  2R72 A;  3MF1 A;  3ETE A;  4JPR A;  4XTW A;  2I4O A;  2WLL B;  4CS4 A;  3THO A;  2IJH A;  1VQ9 V;  1FFX A;  5H6R A;  4HT4 A;  3K08 A;  5C53 B;  1GM9 A;  2KSD A;  2EIJ B;  3CCM V;  3CCJ V;  2YXH A;  1JJC B;  4JI7 O;  2JEU A;  2YDE A;  3G6B A;  2Q73 A;  1PNK A;  4I0X B;  1R3I C;  3W7S A;  2Y48 A;  4K8Z A;  4O4H A;  2ZGW A;  1FKA O;  5EBW C;  3A0R A;  4J7Z A;  1Q6H A;  1WN7 A;  1EIY B;  2CJB A;  4BWA A;  4GZR B;  4MSW C;  2IU3 A;  4LFA O;  1JA8 A;  2PGG A;  4R50 A;  3A7R A;  1QR9 A;  3LSQ A;  3FX7 A;  1G1X B;  5FLX N;  5B1A B;  4Q20 A;  2AHY A;  2BTQ A;  4MW3 A;  4CZZ A;  1QVF U;  1VEW A;  3QVN A;  4RUE A;  4DV3 O;  3WG7 B;  2EJ7 A;  3E22 B;  1E1R G;  4FM0 A;  2HLD G;  3WFV A;  3L2Z A;  3UO2 A;  3H01 A;  3K9A A;  4YY3 O;  1FXK A;  5JVD B;  1YEW A;  2A7W A;  2XT9 A;  1SZT A;  1M56 B;  4F4L A;  1XNQ B;  4DR6 O;  2QTS A;  3B77 A;  1R3K C;  2F4V O;  2CTQ A;  2N04 A;  5HFM A;  1F51 A;  4YRT A;  3N2K B;  3HY0 A;  1YIJ V;  1EFW A;  4YP0 A;  2Q5I A;  1FYF A;  4H02 A;  3G6E V;  2CH7 B;  5BMV B;  4LF4 O;  2CTW A;  2NN4 A;  5E1A C;  1P84 F;  2ZKO A;  3SYA A;  1WP7 A;  2YEV A;  2QM7 A;  2RN9 A;  5H5N A;  1I94 B;  4LF9 O;  3QO8 A;  4JI0 B;  1XL4 A;  2XND G;  2E75 B;  3CE2 A;  5CMU A;  2Q5H A;  1KKD A;  4HWP A;  3P3P A;  4CH5 A;  2C2A A;  1XNR B;  2UUA B;  1VP7 A;  4YYE A;  3CJH B;  4TSF G;  3WU2 Z;  1RM1 B;  3ABU A;  1FXK C;  1BHB A;  1YF2 A;  2RCV A;  1NYQ A;  2EJG A;  1OJH A;  5C8Y A;  1SQF A;  1KB9 F;  3CME V;  4QPK A;  11AS A;  4AQY B;  4FJC C;  2LO1 A;  3OD4 A;  3SJB C;  2ODR D;  3IJ4 A;  5L3E A;  4PG3 A;  1QQC A;  1ZLZ A;  1B04 A;  3JAR A;  1GTO A;  2N05 A;  5BR8 O;  2XTA A;  3GWK C;  2BTO A;  2L35 A;  2QR4 A;  2ADP A;  2YID A;  2LFR A;  3KCX A;  2HP8 A;  2DTO A;  2DZ9 A;  2IBZ H;  1VF6 A;  3FB8 C;  4LVK A;  3B2E E;  3QG5 A;  1K4C C;  2Y4U A;  1R1B A;  3IAL A;  4LF5 O;  3DTU B;  4FLU A;  3AK2 A;  2KB1 A;  1Q8I A;  1UPG A;  4X62 B;  1KBH A;  1Z2G A;  3BRC A;  1R3J C;  4I55 B;  2E5L B;  2UXN A;  2GBO A;  5B1O A;  2EAY A;  4YJ2 B;  2ZZG A;  4XU3 A;  3OMA B;  2EIL B;  4ASU G;  4MT8 A;  1NVP D;  1G5H A;  4Z1V A;  1BBU A;  2UXX A;  2HEP A;  3QO5 A;  3CCE V;  5KHK A;  3G67 A;  5JH7 A;  4XTU A;  1R6N A;  1VF6 C;  4Z1M G;  4A5U B;  1R6T A;  4J80 A;  1WPX A;  1GMG A;  4DV7 B;  4X20 A;  2QA4 V;  2CJA A;  2G4C A;  2G38 A;  4PA7 A;  3T1Y O;  2ZM6 O;  5IJ9 B;  5D5Q A;  2FYU H;  1WYD A;  3UGQ A;  3H9V A;  1M4U A;  2QTO A;  5KNN A;  5JJJ B;  1BHA A;  1HDJ A;  2X7R B;  1SRY A;  2ARU A;  2DZC A;  1L0N H;  4LVJ A;  4WBN A;  1HNW B;  4HWR A;  1VF5 B;  4DR7 B;  1MG1 A;  4YJ3 B;  1DF5 A;  3ABL B;  4KUM A;  1K92 A;  2YIA A;  2UXD O;  2W6J G;  1E1Q G;  3K79 A;  4U3J A;  1HXD A;  1GM8 A;  3ICA A;  4WI1 A;  4O2A B;  3BFM A;  1I08 A;  2Z3Y A;  4GT1 A;  3ABT A;  2M7W A;  3PCO A;  1P49 A;  2UUB O;  4XTY A;  3RYH A;  4TVA A;  1RP3 B;  3A31 A;  4P3O A;  5LL6 Y;  2P4K A;  1YIT V;  2P06 A;  3VQW A;  3ASN C;  1Z7M A;  2HFE C;  4DUZ O;  3RYI A;  3B4S A;  3B8M A;  2EIN C;  1AVM A;  1NKD A;  1V54 C;  4K35 A;  2E5A A;  2UXC O;  2ALY A;  4DR1 O;  3MAQ A;  3D36 A;  4UP8 A;  1PD3 A;  3H1J H;  3ZRS A;  2FB5 A;  1WNL A;  3RKY A;  1QHT A;  1Z7N A;  4J7K A;  4TVY A;  1TUE B;  3OM3 B;  1UJW B;  3LC0 A;  5B3S B;  1X55 A;  3OT7 A;  3X2Q B;  2VQF O;  5LA6 A;  2DYR C;  2BCC H;  1US6 A;  5DED A;  3JSN A;  3EHB B;  2HVJ C;  4FFB B;  5CA1 A;  3AG1 C;  3ZRX A;  4FVM A;  4D7S A;  3IC7 A;  2I4L A;  3CC2 V;  4GKJ B;  1TVK A;  3CPW U;  3JAT B;  2Q9L A;  3QTC A;  1EQR A;  1KOG A;  4KFM A;  3D36 C;  2ZR3 A;  4FLX A;  4YRM A;  4K87 A;  3U0Z A;  3ZRW B;  1Z5W A;  5LXT B;  4X1I B;  1K34 A;  5CA0 B;  1K5S A;  4LNS A;  1JCH A;  3CYO A;  4O4I A;  4IL6 Z;  1P4R A;  1AR4 A;  1EN6 A;  1EZJ A;  1JMK C;  1KP3 A;  1N0N A;  3I5D A;  2HJD A;  4K86 A;  1XIL A;  4TQF A;  3RKW A;  1SQB H;  1M1K W;  3NXS A;  1NJ8 A;  1QLN A;  1K33 A;  3RUX A;  4UVB A;  3FD9 A;  2QEX V;  3TXS A;  3RYF A;  2XAQ A;  1DF4 A;  1XMQ O;  1NI8 A;  3CEI A;  2DXU A;  1NZ6 A;  2Q5Z A;  1ORQ C;  5FPO A;  3TEG A;  4HNA B;  1H4Q A;  2Q69 A;  3N2G B;  1T5E A;  1YJ9 V;  2H3O A;  5K1X A;  4JV5 B;  2E41 A;  1E79 G;  4XEM A;  5IYZ A;  1AB3 A;  4GKK O;  2ZT8 A;  2RQ6 A;  2YI8 A;  1AI7 A;  4JYA B;  4DW1 A;  4G28 B;  4JI6 O;  4LFA B;  4KHP B;  3CRC A;  2DKG A;  4HZ3 A;  1SQQ H;  4I9W A;  2ZZF A;  2ZZE A;  3T1C A;  4JZG A;  4E51 A;  3HFZ A;  5L3G A;  3SYQ A;  3RYC B;  5IWA O;  4I7Z B;  1AI5 A;  1JR9 A;  4YRF A;  1AJQ A;  1XMO O;  4H37 A;  2GDS A;  4YY3 B;  3F7V C;  1X56 A;  1SES A;  2E3C A;  4DR6 B;  2EL9 A;  4DUY O;  4OPH A;  4JAA A;  1JJC A;  5F2V O;  3MEY A;  3UM7 A;  4PA6 A;  2H94 A;  1KQS U;  5BZB A;  1AP6 A;  4LF4 B;  4CBC A;  1J5E O;  1KEC A;  4O2B B;  1YVW A;  1F23 A;  4B7E A;  3FB6 C;  4LF9 B;  4DPG A;  3E35 A;  3JSL A;  2NNU A;  2XAF A;  4R8C A;  4LC1 A;  2OT5 A;  3K59 A;  1H4V B;  1KU9 A;  2ZR2 A;  1UFI A;  2Y69 C;  4DV2 O;  3ERR A;  3R07 A;  1BZK A;  3OTO B;  3IG2 A;  3PZC A;  2IU0 A;  4IHJ A;  1PV0 A;  3H1I H;  3HRI A;  5IJ0 B;  1OCC B;  3C3T A;  1N4C A;  4YHH O;  1MZF A;  1EBO A;  5EZY A;  1PPJ H;  5IYD O;  3ZS8 C;  4X1Y B;  2KKW A;  1AP5 A;  4OGQ B;  5AG2 A;  2CGO A;  4MTX A;  3CRQ A;  3G80 A;  5TIS Z;  5JVD A;  4X65 O;  2RHS A;  1AJP A;  4BW5 A;  1PNM A;  2IM9 A;  2WLM A;  1H2N A;  1RPO A;  1ASZ A;  2OTJ V;  2DYS B;  5CB4 B;  3N2K A;  4WFE A;  2AKW B;  1N36 B;  2PYJ A;  4LVM A;  4OX9 O;  1AI6 A;  4MVM A;  2JJ1 G;  1IXB A;  2Z5U A;  3UKM A;  4X5O A;  4NKG B;  2YS8 A;  3M4P A;  2N74 A;  2DXT A;  4R7C A;  1B76 A;  2AW9 A;  3CX5 F;  5IY5 C;  1XI1 A;  3MD0 A;  3OEE G;  4JZ2 A;  1SER A;  4YIP A;  3ABM B;  3JAK B;  1G51 A;  4P74 A;  1ZX3 A;  4QE9 A;  4NB5 A;  4JI2 O;  3OGC C;  1GGM A;  1FJG B;  2EJF A;  3CJH A;  2ZNJ A;  1X4T A;  2WLN A;  3AG2 C;  3JAS A;  1ZSP A;  2RNB A;  3RW0 A;  3ZED A;  3DC5 A;  1MMM A;  1DGS A;  3ZMU A;  3I56 V;  1NJI W;  4H2U A;  1ROP A;  1OV9 A;  3HXY A;  3C3S A;  3B09 A;  4BIZ A;  2X6B A;  4NYK A;  2Z0A A;  2F43 G;  4MVU A;  1EVK A;  4MS2 A;  3J81 N;  5A9G A;  3HFV A;  2F1M A;  4NTX A;  4WF9 V;  3T1Y B;  4O4L B;  5L3F A;  1THZ A;  1Y74 B;  2QM8 A;  1EVL A;  1VQ6 V;  3H1K H;  4QPJ A;  5ELO A;  4P74 C;  2XAH A;  1BSM A;  3FKS G;  5LBQ A;  4MVZ A;  4LFB O;  1WQW A;  1QF6 A;  3A8T A;  4LFC B;  1N0J A;  5LYJ B;  1IBM O;  3RAC A;  3UT5 A;  1ADY A;  2ODM A;  2QE7 G;  3MF2 A;  5H2F Z;  3E8H A;  1N34 B;  2UXD B;  1TUB B;  1S77 D;  2BOB C;  3E83 A;  1Q7Y W;  5KMG B;  3DXR B;  1NH2 D;  2AMC B;  2VQE B;  3VQY A;  4TUY B;  2XTI A;  2BSK B;  1KMM A;  2CIM A;  3CHX A;  1QBZ A;  4FLT A;  2W0F C;  3CC7 V;  4UCT A;  4P71 A;  4DV1 B;  3AG3 C;  1XRE A;  4DUZ B;  4ZHQ A;  1WNS A;  2ODR C;  4MW8 A;  1S72 V;  4JAU A;  4PV1 B;  4UV8 A;  4DR1 B;  1BIA A;  3L4G B;  3RVZ A;  3OEH G;  4UUJ C;  1JFF A;  4RDX A;  1ZL8 A;  5FPR A;  4CC5 A;  2YSU B;  2I4M A;  5GW7 A;  3SPC A;  4X66 B;  3LUT B;  3JD1 A;  1VQK V;  3TEH A;  1IDS A;  2X6C A;  4YCW A;  1KKC A;  1V55 C;  4UVC A;  4O4J B;  1HW7 A;  1WA8 B;  2EZO A;  1S5L Z;  4B3M O;  3MQZ A;  3RF1 A;  5EC2 C;  1FYJ A;  1XOU A;  1B8A A;  4P71 C;  4NXM O;  1IBL B;  1HWY A;  3ETG A;  4YDQ A;  3K0D A;  1WAZ A;  3RWR D;  4MVR A;  3T4Z A;  4UCO A;  3RKX A;  2EJ9 A;  4TWA A;  3REX A;  1WQ7 A;  3CWB H;  1HR0 B;  3GVM A;  2YIB D;  4KXR A;  3L73 H;  2P6J A;  4PDM A;  4TWK A;  3B8N A;  2A06 H;  1KMI Z;  3AG4 C;  1YJN V;  1TGO A;  4FLY A;  1QU7 A;  2B1G A;  1Z5V A;  4HWO A;  4ZI7 A;  2UU9 O;  3TUP A;  4ZBM A;  4U7O A;  3ASO B;  1IBK O;  3LSU A;  3HXW A;  4UB8 Z;  5CBG A;  5KAF Z;  1L8D A;  3JAW B;  4QJF B;  4H2S A;  3CCU V;  1HP8 A;  2Y0I A;  4XDJ A;  1H2K A;  3ZMV A;  2DWE C;  5DEC A;  3T1H O;  2GV9 A;  4DV0 O;  1EN4 A;  4ZTU B;  3SPG A;  3SGI A;  1GK9 A;  4QGP A;  1S76 D;  4TV9 A;  3RFR A;  4XEO A;  4I50 B;  2BE3 A;  2YXL A;  5EK0 A;  1MAB G;  4HWT A;  1SS3 A;  2QWP B;  3ZRW A;  3K5N A;  5LXT A;  1TAE A;  1Q6U A;  1Q6I A;  1I7F A;  1KD1 W;  1BCC H;  2LFS A;  3TET A;  4DW0 A;  2KG7 A;  5E3I A;  5LP6 B;  2IY5 A;  4PJ0 Z;  1GN2 A;  3RN4 A;  3AK1 A;  1Y76 B;  3ZMS A;  4YRI A;  2ZXW B;  3OD1 A;  2FYK A;  2LGQ A;  3KKY A;  2A8E A;  2DN9 A;  1J95 A;  4DUY B;  5ITZ B;  3KZI Z;  2R70 A;  2XAJ A;  2HG5 C;  3K5L A;  3NEM A;  4OLF A;  2QSA A;  2P5I A;  1QLE C;  2E10 A;  4FLV A;  2PUS A;  1PP9 H;  1J5E B;  2Q7G A;  1GKF A;  5KHJ A;  1NYR A;  2WSS G;  1X54 A;  2XOK G;  2R9I A;  4P75 A;  4E2L A;  4DV4 O;  1K4D C;  4ZOL A;  4EFB A;  2XAS A;  1NJ2 A;  1SKV A;  1DTO A;  4G27 B;  1H8E G;  3M7M X;  4RO2 A;  4BW9 A;  3W7U A;  4X9Q A;  1RSO B;  2PZS A;  3AK3 A;  4I4T A;  4D6T H;  3G1Z A;  3BAB A;  4BIU A;  1B70 A;  4XTX A;  5F5W A;  4IGG A;  4DV6 O;  5EBM C;  4YHH B;  2UUC O;  3D3Q A;  3WQZ A;  1VQ4 V;  4R6Z A;  2DWD C;  3ZJZ A;  2PY5 A;  2EIM C;  2EJR A;  2OCC C;  2JIZ G;  4W4L A;  1KC8 W;  1MZE A;  5LMU B;  1CXZ B;  1U97 A;  5L3C A;  1QCE A;  4X65 B;  4JI1 O;  4DV5 B;  3W7T A;  1LR1 A;  4L87 A; 
#chains in the Genus database with same CATH homology
 3U0Z A;  3CMQ A;  1Z5W A;  4H2X B;  5LXT B;  5KHG A;  4X1I B;  3NEN A;  3CSX A;  5CA0 B;  4X1K B;  1G6U A;  4EB6 B;  3HFZ B;  5J2U B;  2E64 A;  4LNS A;  4O4I A;  1C0A A;  1WLE A;  1JMK C;  4B3S B;  2RHQ B;  4K86 A;  3HKD B;  4TQF A;  3RKW A;  4P73 A;  1NJ8 A;  2ZIM A;  4LNU B;  2ZNI A;  3RUX A;  2XGT A;  4DK1 A;  2ZT7 A;  3KFU A;  5JJN B;  1H2S B;  3RYF A;  3ICX A;  5LP6 C;  1XMQ B;  1WPY A;  3EFS A;  3UQ8 A;  2DXU A;  4P72 C;  2PMF A;  3QF7 A;  4TQD A;  1J5W A;  2QHV A;  3A7U A;  4LF6 B;  2P0L A;  1M93 A;  5FPO A;  3I7F A;  3TEG A;  4ZTZ B;  1VF7 A;  2ZCE A;  3HKB A;  4HNA B;  1NNH A;  2ALY B;  4OP0 A;  4YRC A;  4XEM A;  2Q7H A;  1H4Q A;  3N2G B;  1T5E A;  5J2T A;  4PI2 A;  4GKK B;  3DSQ A;  5K1X A;  3HKC B;  4FFB A;  4JV5 B;  1N32 B;  2P22 C;  4DRX A;  4DR2 B;  5IYZ A;  4DR5 B;  1E24 A;  2ZT8 A;  3E9H A;  4H2Y A;  2RQ6 A;  2YI8 A;  1O9H A;  4JI6 B;  4JYA B;  3UH0 A;  3V8L A;  4X1Y A;  4LFA B;  4YRR A;  3JAT A;  4GYC B;  4KHP B;  3LSS A;  4TV8 B;  4UP9 A;  5EYP A;  4DQ2 A;  3SJA C;  2DKG A;  2PME A;  2ZZF A;  3HKE B;  2ZZE A;  4IHJ B;  2VWJ A;  4H2X A;  4P73 C;  4TOI A;  4X1I A;  4E51 A;  5CA0 A;  4X1K A;  4RMF A;  5K1P A;  4LF8 B;  1WPB A;  4EB6 A;  3HFZ A;  1KMN A;  5IWA B;  3V8J A;  3RYC B;  2DDZ A;  1N33 B;  5EZY B;  2ZTG A;  5KX5 B;  1L0W A;  4LVI A;  1NT2 B;  4D7T A;  1BBW A;  5LOV B;  1XMO B;  4YRF A;  2RHQ A;  3HXV A;  2DU5 A;  4K0K B;  4CH3 A;  1YGB A;  3HKD A;  4YRJ A;  2P5O A;  4YY3 B;  4DR3 B;  3QNE A;  2CJ9 A;  2EWN A;  4O2D A;  4XTV A;  3JAL A;  1X56 A;  4LNU A;  1B7Y B;  1SES A;  3WB2 A;  2RHS B;  2E3C A;  4DR6 B;  2EL9 A;  3L1A A;  1JJC A;  3A5Z A;  3MEY A;  4UPA A;  5JQG B;  4HVC A;  1X2G A;  4LVL A;  5GON B;  4NVP A;  1YFT A;  4O4I B;  4YRM A;  4KL1 A;  4UCR A;  4UCS A;  4LF4 B;  2DEQ A;  3VBB A;  4P3N A;  5JCO A;  4HNA A;  2VWK A;  4UCV A;  3N2G A;  1E1O A;  4O2B B;  2F95 B;  3V7C A;  3OTF A;  3HKC A;  4LF9 B;  3RGL A;  4DPG A;  3P8V A;  2R9A A;  3JSL A;  3BA8 A;  3K59 A;  1H4V B;  4DV2 B;  3FFQ A;  1KU9 A;  4TVW A;  2JGU A;  4LR3 A;  2ZR2 A;  4XU1 A;  2J3L A;  4TV8 A;  3ERR A;  3R07 A;  1H4T A;  2C7I A;  3OTO B;  1SET A;  3IG2 A;  3PZC A;  2QHT A;  4O4H B;  3HKE A;  4IHJ A;  1QE0 A;  3IKM B;  3P8T A;  3K57 A;  1X2H A;  2JVD A;  5D5P A;  3HRI A;  3JAS B;  5IJ0 B;  3QO7 A;  2QHU A;  4UP7 A;  5ELN A;  3RYC A;  4YRQ A;  4L8J A;  2DQ0 A;  5IYZ B;  5EZY A;  5JJE B;  5KX5 A;  3V8K A;  4B3R B;  4HA8 A;  3A5Y A;  3ZS8 C;  1SQG A;  5LOV A;  1HNZ B;  4DR4 B;  4X1Y B;  2KKW A;  4K88 A;  2OWO A;  2E1H A;  1SA0 B;  5FNV A;  5LYJ A;  2XHB A;  4B3M B;  4EFE A;  5EIB D;  1X01 A;  5JVD A;  2RHS A;  1PYS B;  3HTZ A;  3HXZ A;  4NXM B;  4P75 C;  2IM9 A;  1TUB A;  4FLZ A;  4HWS A;  4GLX A;  1ASZ A;  1IL2 A;  5JQG A;  2BTQ B;  2YI9 A;  3EFR A;  3RGB A;  3WB0 A;  5GON A;  5CB4 B;  2PTM A;  3N2K A;  4IIJ B;  4OX9 B;  2AKW B;  4PHC A;  1N36 B;  4FM2 A;  2PYJ A;  4LVM A;  2R72 A;  3MF1 A;  5KHI A;  4XTW A;  2I4O A;  4RQF A;  2EX3 A;  1H4S A;  1NJ5 A;  4X5O A;  4CS4 A;  3THO A;  3M4P A;  1NJ1 A;  4O2B A;  2DXT A;  2NS6 A;  1B76 A;  1FFX A;  3JAL B;  4HT4 A;  3A32 A;  3UT5 B;  3VQV A;  5C53 B;  2QJ1 A;  1XI1 A;  4JI7 B;  2DJZ A;  1SER A;  1JJC B;  1M5I A;  3JAK B;  4JI2 B;  1G51 A;  4P74 A;  3HXU A;  4K8Z A;  1GGM A;  2V4D A;  4O4H A;  3BHP A;  4JI3 B;  1FJG B;  2EJF A;  2ZGW A;  3A74 A;  3NET A;  2ZNJ A;  1X4T A;  2JS5 A;  1USY A;  4J15 A;  3JAS A;  5IJ0 A;  2UU9 B;  1N9W A;  1RIQ A;  3ZED A;  1WN7 A;  1EIY B;  4I9Q A;  2CJB A;  1DGS A;  3ETQ A;  5KHH A;  3BA9 A;  4LF7 B;  4BWA A;  1WU7 A;  4YRS A;  1S5J A;  4H2U A;  3HXY A;  3SJC C;  4JI8 B;  4ZHQ B;  3M4Q A;  1SA0 A;  3K5M A;  4B08 A;  3U11 A;  1O9G A;  2PGG A;  1EVK A;  1G5I A;  3A7R A;  3HFV A;  1PYS A;  2F1M A;  3LSQ A;  3T1Y B;  1JFF B;  4O4L B;  3A2F A;  1TA8 A;  2BTQ A;  5CB4 A;  4IIJ A;  4DV3 B;  2AKW A;  1Q43 A;  1EVL A;  5C8Y B;  4XU0 A;  2ZT6 A;  5ELO A;  4P74 C;  3E22 B;  3TEH B;  4LFB B;  4AIL C;  4FM0 A;  2ZIO A;  1IBM B;  1WQW A;  1QF6 A;  3L2Z A;  2ZT5 A;  4LFC B;  5FNV B;  5LYJ B;  4LH6 A;  1USY C;  4TTV A;  3RAC A;  4RQE A;  3UT5 A;  1ADY A;  5JVD B;  1YEW A;  3K58 A;  2ZIN A;  3MF2 A;  2PYL A;  1N34 B;  2UXD B;  1XNQ B;  1TUB B;  1EOV A;  2F4V B;  3SR2 C;  3JAK A;  5KMG B;  4YRT A;  3N2K B;  3HY0 A;  4YCV A;  4AH6 A;  1EFW A;  4YP0 A;  2Q5I A;  1FYF A;  4H02 A;  3FJP A;  2AMC B;  2VQE B;  2YIB A;  3VQY A;  5BMV B;  4YRN A;  4TUY B;  2XTI A;  4XTZ A;  1KMM A;  2CIM A;  3CHX A;  1EIY A;  4FLT A;  1FFX B;  3HRK A;  1I94 B;  4FLW A;  4UCT A;  4P71 A;  4JI0 B;  3QO8 A;  4DV1 B;  2DQ3 A;  4PI0 A;  1W66 A;  4DUZ B;  4LH7 A;  2Q5H A;  4ZHQ A;  1WNS A;  2ODR C;  2F93 B;  4HWP A;  4XU2 A;  1Q3E A;  4YCU A;  4CH5 A;  3UGT A;  1XNR B;  2UUA B;  3BPZ A;  4DR1 B;  1BIA A;  4H2V A;  3L4G B;  4YYE A;  2HNI A;  1JFF A;  4O4L A;  2ARS A;  4EX5 A;  4RDX A;  5FPR A;  4CC5 A;  4ZI7 B;  3E9I A;  2I4M A;  4YPF A;  4AHC A;  1NYQ A;  2EJG A;  5C8Y A;  4X66 B;  4YRE A;  1VQZ A;  1SQF A;  2CAZ C;  3E22 A;  3TEH A;  11AS A;  4AQY B;  4K8X A;  4YCW A;  1Q5O A;  4YRP A;  4WJ4 A;  3SJB C;  4O4J B;  5JCO C;  1HW7 A;  2ODR D;  4X20 B;  4DK0 A;  3MQZ A;  3RF1 A;  4PG3 A;  1QQC A;  5BR8 B;  4CC6 A;  1B8A A;  1B04 A;  3JAR A;  4Q6G A;  4P71 C;  4P3P A;  3RL6 A;  1IBL B;  4YDQ A;  2BTO A;  4UFZ A;  5KMG A;  2DU7 A;  3RWR D;  3K5O A;  2DTO A;  2DZ9 A;  4TV9 B;  5LP6 A;  2AMC A;  5BMV A;  4LVK A;  3B2E E;  3QG5 A;  4TUY A;  4UCO A;  1YB3 A;  4LF5 B;  4WF2 A;  2ZXF A;  4G85 A;  2Q0A A;  2Q7E A;  2EJ9 A;  3IAL A;  2UXB B;  4TWA A;  3REX A;  4WBN B;  4FLU A;  1WQ7 A;  1HR0 B;  1Q8I A;  4B3T B;  5ITZ A;  2YIB D;  4X62 B;  2OYQ A;  4EEQ A;  3BRC A;  4YRL A;  4I55 B;  1XQ8 A;  2E5L B;  4NCX A;  1BIB A;  2EAY A;  1KMI Z;  4YJ2 B;  2ZZG A;  4XU3 A;  2C8M A;  1V9P A;  1TGO A;  4U3J B;  4F6R A;  4FLY A;  1D5A A;  4YRG A;  1E1T A;  3HXX A;  1HNX B;  3L4G A;  1Z5V A;  2IY5 B;  1G5H A;  4HWO A;  4EO4 A;  3PCO B;  4ZI7 A;  4UCU A;  3TUP A;  1BBU A;  3RYH B;  1IBK B;  4TVA B;  2HEP A;  4YRO A;  3HXW A;  3QO5 A;  5KHK A;  1L8D A;  5JH7 A;  4XTU A;  3JAW B;  3RYI B;  1NJ6 A;  4H2S A;  4O4J A;  1RSO A;  4Q15 A;  4DV7 B;  4X20 A;  5LMN B;  3T1H B;  2CJA A;  4KR2 A;  1XHX A;  4CH6 A;  2G4C A;  2ZM6 B;  4DV0 B;  2GV9 A;  5IJ9 B;  5D5Q A;  1WYD A;  3UGQ A;  4ZTU B;  1M4U A;  3SGI A;  4CH4 A;  4FM1 A;  3A7A A;  4TV9 A;  4ZOL B;  5JJJ B;  3NEL A;  4H2W A;  5KNN A;  1SRY A;  3WB1 A;  3RFR A;  2ARU A;  2DZC A;  4XEO A;  4I50 B;  1E22 A;  4LVJ A;  2QHS A;  3HY1 A;  2YXL A;  4WBN A;  1HNW B;  4HWR A;  4HWT A;  12AS A;  4DR7 B;  4I4T B;  5LA6 B;  1B70 B;  4YJ3 B;  3K5N A;  5LXT A;  1TAE A;  4I55 A;  3BAA A;  3JAR B;  1I7F A;  2YIA A;  4WJ3 M;  2E41 A;  5J2U A;  3UFG A;  4YJ2 A;  5CA1 B;  4U3J A;  2J3M A;  1HXD A;  3ICA A;  4X64 B;  1ADJ A;  5LP6 B;  5E3I A;  3RIR A;  4WI1 A;  4O2A B;  4YRK A;  3BFM A;  2IY5 A;  2E65 A;  2UUB B;  4PHZ A;  1TVK B;  2RJZ A;  3PCO A;  1YFR A;  1P49 A;  4XTY A;  4YRI A;  4KQE A;  3OD1 A;  3PN1 A;  3RYH A;  2FYK A;  4L87 A;  1HTT A;  2A8E A;  4TVA A;  3A31 A;  4P3O A;  4DUY B;  5ITZ B;  4CS2 A;  3VQW A;  3LNN A;  5C52 B;  1Z7M A;  2I4N A;  1ZAU A;  2R70 A;  3JAW A;  3RYI A;  3K5L A;  3CB2 A;  3BJU A;  3NEM A;  4OLF A;  2P5I A;  2UXC B;  4F6R B;  4FLV A;  2E10 A;  2E5A A;  2PUS A;  4ZIB A;  4JI4 B;  3IKL A;  4G84 A;  1J5E B;  2ALY A;  2Q7G A;  3REU A;  3MAQ A;  5KHJ A;  1ATI A;  4UP8 A;  3VQX A;  1NYR A;  5IJ9 A;  2DTI A;  2DVE A;  5HGQ A;  4JI5 B;  4DV4 B;  5C51 B;  1X54 A;  1WNL A;  3RKY A;  4P75 A;  1QHT A;  4HBN A;  1JJO A;  1Z7N A;  2CGH A;  4ZOL A;  1LYL A;  2F66 C;  4EFB A;  4TVY A;  1NJ2 A;  1SKV A;  3LC0 A;  4I50 A;  5EIB C;  5JH7 B;  2HHH B;  3RYF B;  1X55 A;  3M7M X;  4BW9 A;  1ASY A;  2VQF B;  2PZS A;  2DTH A;  2ART A;  4NXN B;  4I4T A;  5LA6 A;  3G1Z A;  3BAB A;  1B70 A;  4YJ3 A;  4DV6 B;  4XTX A;  5F5W A;  2UUC B;  3V7S A;  3IAY A;  3HKB B;  1XHZ A;  3RKX A;  3U10 A;  4YHH B;  3JSN A;  5J2T B;  1YFS A;  3P8Y A;  3WQZ A;  4KR3 A;  4FFB B;  2QM4 A;  5CA1 A;  4DRX B;  2PY5 A;  4FVM A;  4D7S A;  4CS3 A;  2I4L A;  4H2T A;  3W3S A;  4O2A A;  5LMU B;  4GKJ B;  1TVK A;  4P72 A;  3JAT B;  1EQR A;  3QTC A;  4JI1 B;  3V7R A;  1KOG A;  5EYP B;  4X65 B;  4DV5 B;  1B7Y A;  1HC7 A;  2ZR3 A;  4FLX A;  4K87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...