2ZNIA

Crystal structure of pyrrolysyl-trna synthetase-trna(pyl) complex from desulfitobacterium hafniense
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
279
Chain Sequence
LSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyrrolysyl-tRNA synthetase-tRNA(Pyl) structure reveals the molecular basis of orthogonality
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase/rna
molecule keywords Pyrrolysyl-tRNA synthetase
total genus 75
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2zniA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2zniA02
4BWAA 1ATIA 2XTIA 3A7UA 3QO5A 1USYC 2CJ9A 1YFTA 4CS2A 3DSQA 5HGQA 1PYSB 1C0AA 3HFVA 4G85A 3LSSA 4HWOA 3HTZA 1BIAA 1L0WA 4P75A 2ZTGA 3IALA 2ALYB 4LNSA 1X2HA 3I7FA 4K86A 3PCOA 3A5YA 4OP0A 3HY1A 2E41A 3V7CA 4KR3A 1IL2A 1Z7NA 2RHQB 2ZZGA 2E64A 4CS4A 2E10A 3G1ZA 2EL9A 3R07A 2YIAA 3HXUA 4P71A 2ZT5A 2DU7A 2J3MA 3V8KA 4YYEA 3QTCA 4YRFA 1E1OA 1SETA 2ARTA 5C53B 4YCVA 3IG2A 2IY5B 3L1AA 2ZXFA 3MEYA 1X54A 4CH5A 2ZNJA 4E51A 4ZIBA 2I4OA 2AKWA 12ASA 5K1PA 4XU0A 1H4VB 2DU5A 2Q5IA 1N9WA 1NYRA 1EFWA 4KR2A 2E5AA 2ZNIA 1J5WA 4XTYA 4YRCA 4H2UA 1BIBA 3TUPA 1KMNA 3P8VA 4YCWA 3W3SA 3VQVA 4UP8A 4EO4A 4TQDA 4YRQA 2ZT6A 3A5ZA 1BBWA 1USYA 2DTIA 3NENA 2DXTA 3IKMB 3HRKA 5C51B 2DTOA 4H2SA 1YFRA 2RJZA 1X01A 3MF2A 1G5HA 3HFZA 4YP0A 2ARUA 1ASZA 1ASYA 4H2YA 2QHTA 1BBUA 2I4MA 4XU2A 2P0LA 3TEGA 1EVLA 3RL6A 2CIMA 2C8MA 4PHCA 4BW9A 1EQRA 1QE0A 1O9HA 3FJPA 2PMEA 3KFUA 4XTWA 2DXUA 4G84A 3M4QA 4YRGA 2PUSA 4J15A 2ARSA 3A7RA 3NELA 1JJCA 4DQ2A 4WF2A 3CMQA 4H2WA 1KMMA 4Q6GA 1WLEA 3MF1A 2RHSA 2Q7EA 3TEHB 2DDZA 2DVEA 2I4NA 2J3LA 2ZGWA 2XGTA 1GGMA 1YGBA 4YPFA 3V8LA 3RF1A 2FYKA 2ZR3A 4YCUA 2QJ1A 1RIQA 1G5IA 1KOGA 4X5OA 4YRRA 1ADYA 3PZCA 4TTVA 3A32A 1G6UA 2DQ0A 1FYFA 4P73C 2AMCB 3EFRA 3L4GA 4YROA 4TVYA 2DZ9A 1HXDA 4YRPA 4XU3A 1HC7A 1WU7A 3HXXA 2ZT7A 3ZEDA 2EJGA 4P75C 4KQEA 4XU1A 1X2GA 4HA8A 4K87A 1X55A 1B70A 11ASA 4P3PA 1NJ1A 4P71C 4HWPA 4RMFA 1E24A 3M4PA 4TVAB 3RKWA 4K88A 1H4TA 3BHPA 3RKYA 1B7YB 4HWSA 2ZT8A 4TVWA 2CJAA 2DJZA 1B8AA 3E9IA 4UPAA 3QO7A 4HWTA 4ZTUB 1G51A 1HTTA 2DEQA 3VQWA 4CH6A 3QNEA 1E22A 3V8JA 4H2TA 3HY0A 2YI9A 4P74A 3REXA 2EAYA 4CH4A 2E3CA 3REUA 2P5IA 3HRIA 2ZZEA 1H4SA 1EIYB 1NYQA 4XTUA 2DZCA 1X56A 1ADJA 3BFMA 4EX5A 3ERRA 4XTXA 4H2XA 3QO8A 2ZINA 2DKGA 3V7RA 3RGLA 1Z7MA 1O9GA 1EVKA 4P74C 3VBBA 1E1TA 3HXWA 4WJ3M 4ZTZB 4XEMA 4TQFA 2C7IA 2PMFA 4CS3A 4XEOA 1LYLA 4YRNA 2ODRC 4YDQA 5F5WA 4DPGA 1PYSA 2E1HA 4YRSA 4TWAA 3NETA 4OLFA 3HXYA 1EOVA 3UGQA 2YIBA 3VQYA 3LSQA 2YI8A 1WQWA 2ALYA 3P8TA 2E65A 3NEMA 3PCOB 3RUXA 1W66A 1JJCB 2HEPA 2ZIOA 2ZR2A 2RHQA 2DQ3A 5ELNA 4UP9A 1SERA 3IKLA 1QF6A 2CJBA 4P72C 4YREA 5C52B 5ELOA 2R70A 3WQZA 2EJFA 3ICAA 2EJ9A 1NJ2A 2IY5A 3L2ZA 1YB3A 2EWNA 3HXZA 3A74A 1H4QA 4YRKA 3UFGA 1NJ5A 2AKWB 2JVDA 4YRIA 4P3NA 5KNNA 3V7SA 4P73A 4Q15A 2AMCA 1VQZA 2PGGA 1WQ7A 1WYDA 4L87A 1SESA 1NJ8A 3L4GB 4HWRA 4WJ4A 1WPYA 1NNHA 4YRMA 2YIBD 3OD1A 5E3IA 3VQXA 3UH0A 3A31A 1B70B 4AH6A 4RQEA 4XTVA 2R72A 2QHSA 2ODRD 2Q7GA 2Q5HA 2DTHA 4TVAA 5K1XA 1SRYA 2ZCEA 4NCXA 1B7YA 1NJ6A 3RACA 2QHUA 3RIRA 3HFZB 3BJUA 2RQ6A 4WI1A 4CH3A 1B76A 2Q7HA 3HXVA 4H02A 4UP7A 4P3OA 4YRJA 4P72A 2CGHA 4XTZA 4RQFA 4H2VA 4YRTA 1WNLA 4O2DA 4PG3A 4RDXA 1YFSA 3P8YA 1EIYA 2G4CA 2QHVA 3UGTA 3A7AA 3RKXA 2ZZFA 3LC0A 2RHSB 2I4LA 3TEHA 4H2XB 4HVCA 3E9HA 2HNIA 3EFSA 2ZIMA 4YRLA
chains in the Genus database with same CATH superfamily
3UO2A 4BWAA 1ATIA 1W59A 1K5QA 3A7UA 2CUGA 1USYC 4PA9A 2F4VO 2CJ9A 2IM9A 2Z3YA 3SYAA 1KBHA 1TUBB 5HGQA 1EBOA 4DV7B 4IIJA 1FS0G 2WWWA 1KD1W 2W0XA 4I4TA 3LSSA 5F2VO 3ZRVA 4ZKIA 4LVKA 4OX9O 3AG2B 5IT9N 2YEVB 1IX9A 2LW7A 1HDJA 4U7OA 3B77A 4LNSA 4NR1A 3I7FA 3A5YA 2IU3A 4KHPO 3FX7A 4IHJA 1MA1A 2WLMA 1Q43A 3ABKC 4GZRB 1FKAO 2RHQB 4LVIA 4CS4A 3G1ZA 4JYYA 4FLVA 2YXYA 1XHZA 1K5SA 2IH3C 1A32A 4YJ3A 4DR5B 4X1KB 1ZWIC 2DU7A 4TV8A 2XAGA 4GKKO 3JATB 4MTOA 4U7NA 1QCEA 2RN9A 2ARTA 5C53B 3IAYA 4YXWG 4YCVA 3IG2A 3L1AA 4I9WA 3GWKC 4CH5A 2QKCA 1L0NH 4PDVA 1HNXB 4E51A 3E86A 1FXKC 5J9PC 2BOBC 3LUTB 2GTAA 1H4VB 3FKSG 4GLXA 1EFWA 4LCUC 1RFYA 1WB7A 1NJIW 3ICXA 1XREA 2CDYA 4J41A 1VP7A 3RBZA 2IJHA 3RYCA 2WLLB 5LYJB 3NR7A 4LFBB 4AQYO 1GN6A 4MTXA 3U10A 1YTFD 3CRCA 1Y66A 4TQDA 2AW9A 4C7UA 1M57C 2HJFC 3P3PA 2IJIA 1USYA 2LGQA 2V4DA 3JYCA 1VF5B 2OTLV 5IWAO 3ETGA 3J81N 3HRKA 4RUFA 3K79A 3RYFB 1G5HA 3HFZA 2CH7B 4JI6O 5C93A 1PL4A 2X0LA 1DF4A 3E89A 2I4MA 2NNUA 3SPIA 2CAZC 3TEGA 4ICGA 5EZYB 4TUYA 2HP8A 4TOIA 1GM9A 3BABA 2EINC 4PHCA 3ASOB 1QE0A 1O9HA 3ZHQA 3BAAA 3FJPA 2HJDA 4GKKB 3K0DA 2HR3A 4G84A 3ZJZA 1M90W 3A7RA 1Q8IA 2L6LA 1H2MA 2ODMA 3CMQA 2DOSA 4Q6GA 4LWSB 3MF1A 2RHSA 2Q7EA 2ZQMA 2X6AA 3F7VC 4X20B 3L70H 5B66Z 3U0ZA 4JI5O 3HKBA 3B2EE 3L72H 4WBNB 4DXWA 2DYSC 4L8JA 2ZGWA 1FPOA 4ZOLB 4JAVA 2LP7A 3MAQA 3SR2C 4KFMA 2FYKA 2IW5A 2QJ1A 2JEUA 1AR5A 1RIQA 4LVJA 1G5IA 4NXMO 4X5OA 4IIJB 3PZCA 4TTVA 4RAIA 3FB5C 1D2DA 4R8CA 3RYHB 2Q6AA 4TVYA 2YEVA 4YRPA 2QM8A 4DR2O 2GUZA 2IJKA 1NT2B 3ZMVA 3ZEDA 1VQKV 5BR8B 1QHTA 4XU1A 3L75H 2A3QA 5CA3A 5DN6G 1IBMB 1SA0B 1B70A 4DK1A 4U3JA 3SJCC 4LF9B 1HWYA 4P71C 4HWPA 4X1KA 4TV8B 4TVAB 3JATA 3RKWA 2EIKB 1H4TA 5JJEB 1XEQA 2A7WA 3BHPA 1B7YB 2B1IA 4UUJC 1R3JC 3E8FA 4H13B 4B3TO 3BVOA 1CXZB 2A0LA 5EBLC 3ZMTA 4J7JA 1GN2A 2BSKA 2P4VA 3QO7A 4UXNA 4H37A 2Q8VA 5EBWC 1AP5A 2LJ2A 3AG3C 1M1KW 1YEWA 4DV1B 1M5IA 4LFCB 5EK0A 1XBLA 3BY6A 3CCJV 2JS5A 2GSMB 2EAYA 4CH4A 1JPXA 3REUA 3RYCB 4LNUA 4X1IA 3C3TA 5LA6B 1DGSA 1AJQA 2R9AA 2DZCA 4HYOA 3H9VA 2A8EA 2QWOB 3I56V 1MZEA 3MD0A 4MS2A 4PJ0Z 2D3OW 4O4IB 3OE7G 2A9HA 3FAVB 3JASB 2YUAA 1Z7MA 3VBBA 4JI2O 1E1TA 3HXWA 2ADQB 4O2AA 2FKXA 2OYQA 1ZUQA 4X88A 3WB0A 4Z1VA 2CH7A 3RVYA 1JMKC 2P90A 1LYLA 3ABMB 3ZIAG 1N32B 1FAFA 4YDQA 4K3AA 2VQEO 1PYSA 2VS0A 2E1HA 5B1AB 4TWAA 4MVRA 4O4JA 5EBMC 1PL0A 1Z2GA 3HXYA 1AILA 4LF7B 2ITCC 1AI7A 1H2SB 3T4DA 4G2KA 4K8XA 2ALYA 2ARHA 4XDLA 1K92A 3RUXA 1W66A 1YVWA 2JGUA 2IJJA 1JFFB 4TSFG 4YJ2B 4CC5A 1QR9A 3UO3A 1S5JA 4FVMA 4DRXB 1B04A 1NKDA 2EIJC 5L3GA 4DV4B 4YY3B 1AR1B 1VQPV 4JI3B 4PDRA 5A9GA 3E83A 2E5LB 1IVSA 3OR6C 4ZOLA 4YREA 1IBKB 2QR4A 3WB1A 1CPYA 4YHHO 1GM7A 2WLIB 3W7TA 3B8MA 2JK5C 1YB3A 4AHCA 1H4QA 4YRKA 2P06A 4JZ2A 4N23A 1NJ5A 2ZE8A 4DV4O 1XNQO 1THZA 1KP2A 5KNNA 5CBHA 4P73A 4LF5O 3DGEA 2UUAB 1WQ7A 4UCOA 2VQEB 3K0GA 3RYHA 3E2EA 3AG2C 1WPBA 4QJFB 2KKWA 1TAEA 3ZHSA 4LF4O 4WJ4A 2GUZB 3NXSA 2Y4UA 4LF9O 1WPYA 4UV8A 3L71H 3F5TA 2AXTZ 5KHGA 1ZX3A 3UH0A 4LFAB 3A31A 1SA0A 4JTCB 1DLBA 1B70B 4U3JB 4XTVA 1QQCA 1YDXA 3OD4A 2CTRA 1KMIZ 3QF7A 1QVGU 4TVAA 1F23A 4B3SO 2ZCEA 3ASNB 1GMGA 3HR0A 3E35A 3CC4V 1B7YA 4IGGA 5J2TA 5KA5A 3ZN0A 2ZT9B 4WI1A 2XUMA 4CH3A 5JWPA 3CB2A 2BSKB 3P30A 4X8AA 3HXVA 1FFXB 4LVLA 2WSSG 4CZZA 4YRJA 3SDLA 3MHSC 2G38A 4QGPA 2YIDA 2QWRB 4HZ3A 1WNLA 4OGQB 1SF9A 1OCRB 3F7YC 2QGNA 4PA6A 1FJGB 4O2DA 1GH6A 1SQGA 2DW4A 4LNUB 4X1IB 4ZHQB 3P8YA 2V1DA 5LA6A 3CCUV 2B1GA 2G4CA 1N33B 2WLHA 3OGIB 2FYUH 2DJVA 4KP4A 3RKXA 2QM7A 1PKXA 1KB9F 2ZZFA 2M7WA 2P5OA 1KU9A 1PM9A 4O4IA 3FAVA 3JASA 4UFZA 1M93A 4UVBA 4HVCA 1BGYH 5FL7G 4O2AB 4BIOA 2LFRA 2ZIMA 3FYIB 4YRLA 4DUZB 1Q6HA 4JTDB 3JAMN 1H8EG 1YFTA 1EFRG 1PYSB 3CS5A 4G85A 3G80A 4MW8A 1YSCA 4O4JB 1PV0A 4GX5A 4DV2O 1L0LH 1K97A 4HWOA 1OCCB 1RSOA 3A0HZ 3HTZA 3B8NA 2HHHB 2ITDC 5B3SB 5KUKA 1AVMA 5KA6A 2ALYB 2Q9LA 1P7GA 5B5EZ 3CMAV 1JA8A 5E79Z 4QE9A 3HY1A 2E41A 1JFFA 1V54B 2QSAA 4YJ2A 1IL2A 1I0HA 1R6NA 4PI2A 5IYZA 3K9SA 4DRXA 1I08A 3ZMUA 4JI7B 3O9OA 5L3BA 3JD4A 4DR2B 3R07A 4AQYB 1R6TA 2HHHO 2D2CB 5KHIA 2J3MA 2LGWA 3V8KA 3E8HA 4FK5C 1IURA 3AG3B 1K3EA 4EEQA 2EULA 3RT3C 1MZFA 4JI0O 3AG4B 2UXBB 1XL4A 1BZKA 2YXLA 3RWRD 4DR6O 2WLIA 2ZXFA 3OFNG 3MEYA 3DXRB 4DW0A 2ZNJA 4GX1A 3TCUA 2N04A 2P67A 1BQZA 2I4OA 4B3TB 2H8PC 12ASA 1NBMG 1F51A 3W7SA 3IC9A 2WLJA 1Y67A 1N9WA 1NYRA 3SPGA 1MMMA 5HFLA 1VIBA 3CCSV 1J5WA 1NTKH 1X59A 5JH7B 2EILC 3W7UA 1R3LC 2JJ2G 3AG7A 3SYCA 1KMNA 1M56B 3P8VA 5FPOA 1AJPA 3JD2A 3W3SA 3JD1A 4HBNA 4X1YB 4UP8A 4EO4A 1I5YA 1SZXA 4YRQA 1XNRO 1XL6A 3GB7C 4DR7B 1F4MA 2F43G 3RN4A 3NENA 2RCVA 3BA9A 1VF7A 3PJSK 4PA3A 2UUAO 1JR9A 2UU9O 4H2SA 1OZ0A 3QVNA 1ROPA 4N21A 4LC1A 1X01A 4G27B 5J2TB 3FD9A 4W4LA 4YP0A 1V55B 4IYHA 4O4HA 1ASZA 1US6A 5CA0A 3K04A 1BBUA 1FFXA 4LF8O 4BIZA 2EZPA 1XQ8A 3EFFK 4D6TH 2P0LA 4XU2A 4B3MO 1EVLA 3LNNA 3ETEA 1EQRA 1WP8A 1H2KA 1V9PA 1PNKA 3STLC 2PMEA 1GK9A 3KFUA 4JI8B 2PUSA 2P7TC 2ZE7A 1ZL8A 4DQ2A 4ZHQA 5JJNB 1LUVA 3SJAC 1WLEA 3FYEB 4LF8B 1X4TA 2K9PA 4QIWF 3UM7A 2DVEA 5BZBA 2I4NA 4WFEA 2UUBO 3ZMZA 5TISZ 4JASA 1NTZH 2YSUB 5CBFA 2YDEA 2F23A 4JYBA 4OPAA 2FB5A 4UCSA 3R65A 3V8LA 1K34A 1ZTEA 3RF1A 5AG2A 4FMTA 1NU1H 2H3OA 1KOGA 4ZI7B 3K03A 1M9NA 1U97A 4OPHA 2OT5A 5B1NA 1DTOA 1RSOB 3HKDB 2FL4A 4NB5A 4DV7O 1ZLZA 3L4GA 4YROA 4YIPA 3OGCC 3ZHTA 1PD3A 2DZ9A 3QG5A 1HXDA 5FLXN 3HXXA 3CE2A 4YHHB 2ZT7A 1Y74A 5LGTA 1ENVA 1AI6A 4FM1A 5IYZB 1M4UA 4I9QA 2JDIG 3EVKA 4KHPB 1WB8A 4RMFA 4WCEV 3T1YO 3M4PA 2PI5A 1KP3A 5LGNA 2FMLA 3T1HO 1GN3A 5IYCO 4HWSA 5LHHA 4X65O 2UXCO 2CGNA 2CJAA 1B8AA 3EHBB 3DXRA 4UPAA 3OR7C 1OV9A 1P49A 2BCCH 5EC1C 3LNMB 3H01A 4P2ZA 3AG1B 1YZBA 1R3KC 3VQWA 4CH6A 1E22A 4P9OA 4H2TA 4P74A 3REXA 2E3CA 5JH7A 1HNWB 1OJHA 2ZD9A 2QM4A 4ASUG 2UXBO 3ZS8C 5JCOC 2EIMC 3DTUB 4JV5B 4XTUA 1UJWB 1ADJA 4X1YA 1COWG 1Y76A 3ERRA 3PN1A 2Q4PA 1YCIA 2BE3A 2R9IA 3B09A 3VOUA 2ZINA 3V7RA 1O9GA 3HKEA 4P74C 1JOYA 4LR3A 3KG2A 2KG7A 1HNWO 4TQFA 1W0JG 3X2QC 2C7IA 5CA1A 4J9ZB 4QPJA 4O4HB 4XEOA 2XAJA 3BRCA 3GWOA 5CA0B 1VQ6V 1QLNA 4JI7O 3UT5A 1VEWA 5KX5B 1MG1A 3WFVA 3LDCA 1NI8A 4JPRA 4W4KA 3TETA 3VQYA 4JV5O 2YI8A 1YF2A 3NEMA 1YXBA 4X64O 3PCOB 4DV6O 2LFSA 5B1BB 1ZL8B 3E8GA 2ZIOA 3M99B 5A2QN 2DQ3A 3K08A 4CBCA 2GBOA 2JEXA 3C3SA 3I55V 2YICA 5LP6A 3KKYA 2CJBA 1I94O 5GONB 5C52B 1BS3A 4HAMA 3JAKA 3M7MX 5ELOA 1YI2V 4JI1O 2Y4TA 2CK3G 2IY5A 2DYRC 4PELA 3L2ZA 1S0VA 3APQA 3UFGA 1SKVA 2Q69A 5H6QA 4ZI7A 2ATKC 1YJWV 2AKWB 4YRIA 3O65A 3SPHA 4LBEC 3V7SA 1M57B 2F93B 2AHYA 1VQZA 3HKDA 3SYQA 1EZVH 3S3WA 5IJ0B 4FLYA 1NJ8A 3L4GB 4G28B 1N4CA 1P7BA 2AHZA 2Z0AA 3OMIB 2OCHA 3B40A 2NR5A 1XMQO 4JI6B 1Y74B 1NNHA 1QVFU 5E3IA 3HKCA 3K06A 5ITZA 1G8MA 4GYCB 2R72A 2ODRD 1WA8B 4MW3A 1AJNA 3IC7A 5K1XA 2QWNB 1SRYA 1XMQB 2W6IG 2MK3A 3SYPA 5H9CA 1PP9H 4UV9A 1NZ6A 1LR1A 3K3WA 2UUCO 4UP7A 4P3OA 1Q86W 2JGDA 4H33A 3RYIB 2UUBB 2CGHA 1AROP 2Q0OC 1K4DC 2QWQB 1ORQC 4JI2B 4XTZA 2A06H 1SQBH 4YRTA 1HNZO 2EILB 4RDXA 2DYRB 1AB3A 1YFSA 2BTQA 5B1OA 3CCLV 2H94A 3JARB 3UGTA 4J10A 1T5EA 4P30A 2F95B 1Y76B 1EN4A 3K59A 2I4LA 4Q20A 2A79B 2QTSA 4LF7O 4B3RB 1HW7A 2GTSA 4DR6B 3HKEB 3BA8A 4LFCO 3E9HA 2KG7B 3LDDA 1TGOA 1NH2D 4DUYO 4JF3A 2KQXA 5CA1B 3CX5F 3QO5A 2ZXWC 1VQ8V 4DR4B 3ZRSA 4UCVA 2OCCB 4CS2A 1E79G 3SPCA 3DSQA 4YIOA 3UT5B 1P84F 4J80A 3CRRA 1C0AA 3ZHVA 5LMNB 3J7AU 5KX5A 5D5PA 3IGAC 1BHBA 4BW5A 2Y69C 4LVMA 4X64B 1Y4MA 1XDCA 2Y69B 4DR5O 5L3FA 1BIAA 1VARA 5GW7A 3K9AA 1IDSA 4MVOA 4DO2A 1X2HA 3PCOA 4K86A 3AK3A 2PYJA 4GX0A 3V7CA 2EIJB 1N0NA 1W2BU 2ZZGA 1P4RA 5IE9A 1TUEB 3MHHC 2E10A 3UCSC 4F6EA 1KC8W 3KCXA 1JX9A 2P6JA 5LP6B 3HXUA 4P71A 1Z5WA 2YXHA 1EZJA 5JJJB 2AZ0A 5GONA 3JAKB 3QTCA 5BXZA 4YRFA 1VMGA 1E1OA 3ZN1A 5DM6V 2VWJA 5JQGA 5JCOA 2IY5B 2DMXA 3U11A 5D5QA 2Q0AA 1X54A 4JYAO 4ZIBA 1TVKB 4OXSA 4B08A 2AKWA 3ZX6A 2IU0A 4XU0A 2NN4A 3D3QA 4JAUA 2Q5IA 1N34O 1U96A 4KR2A 5IJ0A 2E5AA 1I94B 3ETDA 3KZIZ 4XTYA 3L9DA 3CEIA 3OEEG 4YRCA 4H2UA 3C90A 2Q67A 1BIBA 4MVSA 3OW2U 4YCWA 1DF5A 4DR4O 4EFBA 1K9MW 3HKCB 5ITZB 3A5ZA 3CMEV 4ABMA 1S5LZ 3ETQA 2VQFB 1WA8A 4MSWC 4IL6Z 2DTIA 1NTMH 2DXTA 1NR1A 2FTKA 3IKMB 2P4KA 1YFRA 1BCCH 2LO1A 1GKFA 3Q4HA 1PNLA 2Q68A 2ARUA 2L35A 1ASYA 2NS6A 3AK2A 4WF9V 5L3DA 2QHTA 1B3QA 4A5UB 2PTMA 4JGSA 1W0KG 1V54C 2JGDB 4MVUA 2VQFO 2ZKOA 3RYIA 4FFBB 3RL6A 4I7ZB 1YHQV 1WN7A 4BW9A 3ABLC 1BT8A 3CRQA 2EIKC 5LL6Y 1WJZA 3P3NA 3LDEA 4D7SA 4XTWA 3M4QA 1BHAA 1QR8A 1G4YB 3ZHUA 1JJCA 2BTQB 4IT5A 4AILC 3JARA 1E1RG 4BAYA 1F7YA 3CRMA 4X66B 3CWBH 3DC6A 2GV9A 2DDZA 1VF6C 1D5NA 1N33O 3KCYA 1J5EB 1YGBA 3JAWB 3GVMA 4J9YB 4YPFA 3OTOB 2ZR3A 1VQLV 2ZM6B 2AGAA 5IYDO 3F5WC 4YRRA 1IBLO 4DV5B 1FYFA 2X6CA 4P73C 4TWKA 1S3JA 2AMCB 2CGOA 3HB3B 3EFRA 2X6BA 2OWOA 4QPKA 1BQ0A 3ABLB 2UXXA 2XTAA 2XAFA 4CC6A 1QBZA 2O57A 4TT3G 1SQFA 2DWDC 2EJGA 4KQEA 2XAQA 3EXAA 4DK0A 3JCUZ 3IFXA 1BMFG 5EYPA 5LGUA 1X55A 4FFKA 4P3PA 5LMNO 2Y0PA 4J42A 4K35A 3TJTA 2XASA 4R50A 5IYBO 1L1FA 2ZM6O 1EN6A 3RKYA 5JVDB 4X89A 2Y48A 5KAIZ 2ZT8A 5JQGB 3JALB 3G6BA 1OCOB 1IBLB 3E9IA 4XDKA 1SQQH 1TVKA 1LNQA 2MW2B 4I55B 4MTGA 5CN0A 3STZC 3OEHG 2JS3A 1QLEB 4K8ZA 2ZDIA 1YITV 2DEQA 3N2GA 3QNEA 2Q73A 1PNMA 2R9RB 1DK1A 1SS3A 5J2UA 4MT8A 3SYOA 2GDSA 2P5IA 3HRIA 1AI4A 2ZZEA 4EB6B 1SZTA 4F6RA 4DR3B 1H4SA 1EIYB 1NYQA 1YJ9V 3UKMA 1Q3EA 5KLVH 5CBGA 2M6YA 4EX5A 3CYOA 3JSNA 4XTXA 4PDMA 3S3XA 4H2XA 4TV9B 3CCRV 3UQ8A 1EVKA 1R6KA 4I50B 4K0KO 4ZTZB 3B4SA 4B7KA 1NVPD 1MNGA 2OIGA 4XEMA 2ZXWB 1AP6A 4KL1A 3Q4HB 1XMOB 2PMFA 4NTXA 4PV1B 4DV0O 1HNZB 2ODRC 4JI1B 3ZBHA 5LMUO 5F5WA 3SPJA 3BEHA 4YRSA 5IY5B 4FFBA 1H2LA 4JI8O 4BR6A 4OLFA 2K1EA 5CB4A 4RWUA 3UGQA 4HNAA 3FB7C 5B1AC 1H2NA 1AI5A 5H5NA 4BIUA 1JJCB 4X9QA 1B06A 3CXCU 1YJNV 2ZR2A 1F4NA 3OAAG 5ELNA 4FLZA 5HFMA 3OT7A 4UP9A 2E76B 2EINB 1SQXH 1JJ2U 3OTFA 4P9PA 1K4CC 2BTOA 3IKLA 1QF6A 1SQPH 1XOUA 3TXQA 3CXHF 3CCQV 3W7WA 3BCCH 3E22A 3K5OA 1FJGO 2R70A 3JAWA 3WQZA 2EJFA 3WU2Z 4FM2A 3K5MA 1NJ2A 4K0KB 3JD0A 2EWNA 3HXZA 1N0JA 1NVPB 3CJHB 2W0FC 5BMVB 1WAZA 1RPRA 4LF6O 1HR0O 2N74A 1S5HC 2QKSA 4B3RO 1G1XB 4DV0B 5FPRA 3T1YB 4JYAB 5KAFZ 4NXMB 2AMCA 2UXNA 2UXDB 2UU9B 4L87A 1OCRC 1SESA 1Q90D 2F1MA 3A0RA 1AR4A 4KUMA 4HWRA 3H1IH 3K57A 1MOFA 4Z2WA 3X2QB 2YIBD 3THOA 1HR0B 1Y6XA 5IWAB 3CCMV 1YTFB 5FNVB 5EYPB 2IH1C 1K73W 4PI0A 4RQEA 2Q5HA 3TGUH 1TA8A 2QDOA 2YC0A 3ZRWA 1FYJA 5JVDA 1NJ6A 4DR3O 1URFA 2QHUA 3A0BZ 2HG5C 4GX2A 3BJUA 2RQ6A 2EJ7A 2PY5A 3JALA 4DV2B 2Q7HA 4LF5B 2ADPA 4PA4A 5BR8O 4I55A 4P72A 4X65B 2UXCB 1R73A 3ASOC 4ZBMA 3OUSA 1VF6A 2YS8A 5H6RA 3N2GB 2ZE6A 4DYLA 4GKJB 4RQFA 4H44B 3OMNB 5J2UB 3T2MA 2EIMB 3MDSA 3RGBA 3RW0A 2XAHA 4EB6A 5KHHA 2OIEA 4I0XB 4F6RB 1H38A 4JYCA 4DUYB 3CC2V 1EIYA 1FXKB 3A7AA 5LBQA 4JTAB 2WLNA 2ZE5A 1GM8A 4O2BB 4WFBV 4WFGA 2LQTA 3A2FA 3CPWU 3TEHA 4H2XB 1Q5OA 4TV9A 5EIBC 2C2AA 4I50A 3P32A 1D5AA 3LSUA 1RM1C 4RUEA 2HNIA 1RM1B 1WP7A 4JI4B 4JAAA 2XTIA 3SGIA 3FFQA 3G6EV 4PHZA 1J95A 2CE4A 4FLTA 1VQNV 5LXTB 1N36O 1XMOO 3HFVA 1I5XA 4LH6A 3BFRA 1QU7A 1B6QA 4DW1A 5CB4B 4GT1A 1BL8A 1NQTA 1KKDA 4GUNA 3H1JH 4HNAB 1L0WA 4P75A 2ZTGA 3IALA 2EBOA 4OP0A 2JRIA 1XILA 3H1HH 4UVAA 2WA3A 4KR3A 1Z7NA 1N36B 2LW1A 4MTFA 2E64A 2PYLA 3ABMC 2KSDA 2EL9A 1V55C 2YIAA 2ZDIC 4J11A 2X7RB 2ZT5A 5IY5C 4I5SA 4YYEA 2XT9A 2XHBA 1SETA 3E22B 4DV3B 2CTQA 4NTYA 4EKWA 2XNDG 1ZSPA 2E75B 5L3CA 3CJHA 5BMVA 2CTWA 1XHXA 4IYIA 5K1PA 1FD9A 1KYOF 3TXSA 3ZHRA 2DU5A 3D36A 3M8AA 4HT4A 2ZNIA 4B3MB 2HVJC 3D3IA 3G4SV 4UB6Z 4RO2A 2AZ2A 5KUMA 5LOVB 2PF4E 2IBZH 4LFAO 4JI4O 3TUPA 3AK1A 3FB6C 4FM0A 1Q7YW 3VQVA 5B3SC 2ZT6A 5FNVA 1BBWA 4JI0B 3CC7V 1Q6UA 3OMAB 4O4LA 1ZAUA 1GO3F 1JCHA 5LHGA 5C51B 2DTOA 5IJ9B 3ZRWB 2RJZA 4LP8A 1R1BA 3MF2A 4UVCA 5DEDA 4FLUA 4H2YA 2EX3A 3CRAA 4GKJO 4DR7O 1R3IC 2CIMA 2C8MA 2N05A 5E1AC 5GTIZ 3AEIA 1IBKO 1OCZC 1NS1A 5IDJA 2RMKB 4U3FH 4EFEA 3K58A 2DXUA 4YRGA 4J15A 4WFFA 2ARSA 4I0XA 3NELA 4WF2A 4H2WA 1KMMA 5LP6C 2WAMA 1GTOA 1GRJA 1FXKA 2ETNA 5LMUB 4O2BA 1SQVH 3FB8C 4FJCC 3G71V 3TEHB 3MQZA 2J3LA 3W7XA 1IXMA 2DN9A 3RVZA 2XGTA 1GGMA 3A8TA 2QEXV 2QA4V 4PA7A 3R66A 1NH2B 1GAXA 4LH7A 4DV6B 4YCUA 3ZMSA 2PZSA 1BSMA 4DR1O 5C8YB 2QWPB 5LXTA 1ADYA 1FFTB 1Q81W 2OCCC 3A32A 1G6UA 2DQ0A 2F4VB 3CD6V 3T1CA 4LF6B 3IJ4A 1CP9A 1FXHA 4XU3A 1HC7A 1WU7A 5LHIA 3H1KH 4X62B 4P75C 3N2KB 1QNMA 1X2GA 4HA8A 2HLDG 4K87A 3SJQC 3ABKB 3RFRA 4FZ0A 1YIJV 11ASA 1NJ1A 3I5DA 1E24A 2EJRA 4K88A 1OCZB 2XOKG 2CTPA 1KUQA 1IZ3A 2JIZG 2KB1A 1VQ4V 2GHYA 1VQMV 1HP8A 3E8BA 5EC2C 4TVWA 2DJZA 5BY1A 4HWTA 4MVQA 4ZTUB 4J7ZA 1G51A 1M56C 3J80N 1NR7A 4NXNB 2PI4A 4AI8A 1JQ0A 2E5LO 1HTTA 4PD4F 3JCZA 5DECA 2UUCB 2RDCA 1KECA 3V8JA 3HY0A 2YI9A 5KHKA 4H0LB 3G67A 1S77D 3K5NA 5LOVA 1L8DA 1N34B 1IBMO 1WNSA 4YY3O 1UPGA 1IXBA 4FPPA 5CMUA 2QTOA 3SJBC 1X56A 3CCEV 4NXNO 2VRZA 5EIBD 5KMGA 3CP1A 3BFMA 4F4LA 1JVMA 1EN5A 3ABTA 4LFBO 3CCVV 3QO8A 4O4LB 2DKGA 3RGLA 2JJ1G 2HVKC 3WG7B 4WJ3M 1PPJH 3ASNC 2ILMA 5IJ9A 1H8HG 4CS3A 4NYKA 3DC5A 1GN4A 4YRNA 3ZRXA 1VQOV 1TUBA 1OHHG 4DPGA 4Z1MG 5GTHZ 1EM1A 2B9ZA 4NTWA 5L3EA 1XUQA 3NETA 1BE3H 1XNRB 2B5UA 4I4TB 2Y0IA 3HPLC 4R7CA 4QE7A 1H2GA 1EOVA 1KKCA 2YIBA 4XBFA 2QE7G 1K33A 3LSQA 4PDLA 1Q82W 3ZCCA 1WQWA 2E65A 3P8TA 3L74H 4FZ1A 2WA4A 3APOA 2WLKA 2QKAA 1HNXO 2HEPA 4IHJB 4WFHA 2RHQA 2V7QG 4XDJA 1FXVA 2BOCC 3L73H 1MSWD 5B1BC 1SERA 3AG1C 3N27A 1XNQB 4YJ3B 4P72C 4FLXA 3AG4C 4NVPA 1JJOA 3JSLA 3OUFA 4B7EA 1N32O 3WG7C 4OX9B 3ICAA 1J5EO 3K5LA 1LUWA 2EJ9A 3WB2A 4LF4B 3A74A 2Q5ZA 4DV3O 1WPXA 3TK1A 5C8YA 3ML0A 4MVMA 2JVDA 2VWKA 1SC5B 4JI3O 2DE0X 3OM3B 2Z5UA 4P3NA 1OCCC 1MSDA 2HFEC 4Q15A 2EZOA 2PGGA 1WYDA 2RNBA 4J7KA 3T1HB 2HKOA 1K8AW 4D7TA 4UCRA 2WLLA 5LYJA 3CHXA 3OTOO 4WFAV 4YRMA 2OTJV 3OD1A 3N2KA 2W6JG 1Q6IA 3VQXA 4DR1B 4JZGA 1Z5VA 4AH6A 2QHSA 4E4EA 3T4ZA 2Q7GA 4DV5O 4QNHB 2DTHA 1VQ7V 2P22C 1MABG 4NCXA 4UCUA 3RYFA 3RACA 2NLJC 2E74B 5H2FZ 3HFZB 3RIRA 4R6ZA 1KQSU 1B76A 4X66O 4MVZA 1QLEC 3JD3A 1RP3B 4H02A 4X62O 1VQ5V 1N8RW 1OCOC 4UCTA 2DYSB 2F66C 4E2LA 5EZYA 4TUYB 1RPOA 4DUZO 4H2VA 3CSXA 3BPZA 4PG3A 1VQ9V 2UXDO 4UB8Z 3D8CA 1S72V 1UFIA 1XI1A 2QHVA 4LWSA 4NKGB 3LC0A 2DWEC 5KMGB 2RHSB 3H1LH 4X20A 4FIPC 4B3SB 1CEZA 1E1QG 2WPDG 3HKBB 4DV1O 1I7FA 4WBNA 1S76D 4KXRA 4FLWA 5KHJA 3EFSA 4JI5B 3D36C 3ABUA 4GCZA 1K7DA
chains in the Genus database with same CATH topology
4BWAA 4JI4B 1ATIA 5CA1B 2XTIA 3A7UA 3QO5A 1USYC 3SGIA 3FFQA 4DR4B 4DUZB 2IM9A 4PHZA 1YFTA 2CJ9A 4UCVA 4FLTA 4CS2A 1TUBB 3DSQA 3UT5B 5LXTB 5HGQA 4DV7B 1PYSB 1C0AA 4IIJA 3HFVA 4G85A 5LMNB 5KX5A 4O4JB 5D5PA 4LH6A 4I4TA 4LVMA 4X64B 3LSSA 4HWOA 1RSOA 5CB4B 3HTZA 2HHHB 4LVKA 4HNAB 1BIAA 1L0WA 4P75A 2ZTGA 3IALA 2ALYB 4LNSA 1X2HA 3I7FA 3PCOA 4K86A 3A5YA 4OP0A 2PYJA 3HY1A 2E41A 4IHJA 1JFFA 3V7CA 4KR3A 4YJ2A 1IL2A 1Z7NA 1N36B 4P71A 1Q43A 4PI2A 2RHQB 2ZZGA 5IYZA 2E64A 2PYLA 4LVIA 4DRXA 4CS4A 2E10A 3G1ZA 4JI7B 2EL9A 4DR2B 4FLVA 3R07A 2YIAA 1XHZA 5LP6B 4AQYB 4YJ3A 4DR5B 3HXUA 4X1KB 2ZT5A 5KHIA 1Z5WA 5JJJB 2DU7A 2J3MA 4TV8A 3V8KA 3JATB 4YYEA 5GONA 4EEQA 3JAKB 3QTCA 2XHBA 4YRFA 1E1OA 3E22B 4DV3B 1SETA 2ARTA 3IAYA 5C53B 2UXBB 2VWJA 2YXLA 3RWRD 4YCVA 5JQGA 5JCOA 3IG2A 2IY5B 3L1AA 3U11A 5D5QA 2ZXFA 3MEYA 2Q0AA 1X54A 4CH5A 2ZNJA 1HNXB 5BMVA 4E51A 4ZIBA 1TVKB 1XHXA 2I4OA 4B08A 2AKWA 4B3TB 12ASA 5K1PA 4XU0A 1H4VB 2DU5A 2Q5IA 1N9WA 4GLXA 4HT4A 1NYRA 1EFWA 4KR2A 5IJ0A 2E5AA 2ZNIA 4B3MB 1J5WA 1I94B 3ICXA 5LOVB 4XTYA 5JH7B 4YRCA 3RYCA 5LYJB 4H2UA 1BIBA 3TUPA 4LFBB 1KMNA 3P8VA 4FM0A 4YCWA 5FPOA 3W3SA 4EFBA 3U10A 3VQVA 4HBNA 4X1YB 3HKCB 4UP8A 4EO4A 4TQDA 5ITZB 2ZT6A 5FNVA 4YRQA 3A5ZA 1BBWA 4JI0B 1USYA 3ETQA 2VQFB 4DR7B 2V4DA 4O4LA 2DTIA 3NENA 3BA9A 1VF7A 2DXTA 1ZAUA 3IKMB 3HRKA 5C51B 2DTOA 4H2SA 5IJ9B 1YFRA 2RJZA 3RYFB 1X01A 3MF2A 5J2TB 1G5HA 3HFZA 4YP0A 4O4HA 4FLUA 2ARUA 1ASZA 1ASYA 5CA0A 2NS6A 4H2YA 2QHTA 1BBUA 2EX3A 1FFXA 2I4MA 2PTMA 1XQ8A 4XU2A 2P0LA 2CAZC 3TEGA 3RYIA 1EVLA 3LNNA 4FFBB 3RL6A 5EZYB 4TUYA 2CIMA 4TOIA 2C8MA 3BABA 1WN7A 4PHCA 4BW9A 1EQRA 1QE0A 1O9HA 1V9PA 3BAAA 3FJPA 2PMEA 4GKKB 3KFUA 4JI8B 4D7SA 4XTWA 4EFEA 3K58A 2DXUA 3M4QA 4G84A 4YRGA 2PUSA 4J15A 2ARSA 3A7RA 3NELA 1Q8IA 1JJCA 2BTQB 4ZHQA 3CMQA 4H2WA 1KMMA 5LP6C 4WF2A 4DQ2A 5JJNB 3SJAC 4Q6GA 4LF8B 4AILC 3JARA 1WLEA 1X4TA 4X66B 3MF1A 2RHSA 2Q7EA 5LMUB 4O2BA 4X20B 2GV9A 3U0ZA 2DDZA 2DVEA 2I4NA 3HKBA 3MQZA 3TEHB 3B2EE 4WBNB 1J5EB 2J3LA 4L8JA 2ZGWA 4ZOLB 2XGTA 1GGMA 3MAQA 4UCSA 1YGBA 3JAWB 3SR2C 4YPFA 3V8LA 3OTOB 4LH7A 3RF1A 2FYKA 2ZR3A 4DV6B 4YCUA 2QJ1A 2PZSA 4LVJA 1RIQA 2ZM6B 1G5IA 1KOGA 5C8YB 4ZI7B 4X5OA 5LXTA 4YRRA 1ADYA 4IIJB 3PZCA 4TTVA 3A32A 1G6UA 2F4VB 2DQ0A 4DV5B 1FYFA 4P73C 2AMCB 3HKDB 4LF6B 3RYHB 3EFRA 3L4GA 2OWOA 4YROA 4TVYA 2DZ9A 3QG5A 1HXDA 4YRPA 4XU3A 1HC7A 1WU7A 3HXXA 4CC6A 4YHHB 2ZT7A 1SQFA 1NT2B 3ZEDA 4X62B 5BR8B 2EJGA 4P75C 1QHTA 3N2KB 4FM1A 4KQEA 4XU1A 5IYZB 1X2GA 4DK0A 4HA8A 1M4UA 4I9QA 4K87A 5EYPA 1X55A 1IBMB 4KHPB 1SA0B 1B70A 3RFRA 4DK1A 11ASA 4U3JA 3SJCC 4LF9B 1NJ1A 4P3PA 4P71C 4HWPA 4RMFA 4X1KA 1E24A 4TV8B 3M4PA 4TVAB 3JATA 3RKWA 4K88A 1H4TA 5JJEB 3BHPA 3RKYA 5JVDB 1B7YB 4HWSA 2ZT8A 5JQGB 3JALB 4TVWA 2CJAA 1IBLB 2DJZA 1B8AA 3E9IA 4UPAA 3QO7A 4HWTA 4ZTUB 1TVKA 1P49A 4I55B 1G51A 4NXNB 1YEWA 4DV1B 4K8ZA 1HTTA 1M5IA 2DEQA 3N2GA 4LFCB 3VQWA 4CH6A 3QNEA 2UUCB 1E22A 3V8JA 4H2TA 3HY0A 2YI9A 4P74A 5KHKA 5J2UA 2JS5A 3REXA 3K5NA 2EAYA 4CH4A 2E3CA 5LOVA 3REUA 1L8DA 2P5IA 1N34B 5JH7A 1HNWB 2ZZEA 3HRIA 4EB6B 2QM4A 3RYCB 4LNUA 5JCOC 4X1IA 3ZS8C 4F6RA 1WNSA 5LA6B 4DR3B 1H4SA 1EIYB 1DGSA 1NYQA 4JV5B 2R9AA 3SJBC 1Q3EA 1X56A 2DZCA 4XTUA 1ADJA 4X1YA 5EIBD 5KMGA 3BFMA 2A8EA 4EX5A 3ERRA 3PN1A 3JSNA 4XTXA 4H2XA 4O4IB 4O4LB 3QO8A 2ZINA 3JASB 4TV9B 2DKGA 3V7RA 3RGLA 1Z7MA 1O9GA 3HKEA 3UQ8A 1EVKA 4P74C 4I50B 3VBBA 4LR3A 1E1TA 3HXWA 4O2AA 4WJ3M 2OYQA 4ZTZB 5IJ9A 4XEMA 3WB0A 4TQFA 4KL1A 2C7IA 1XMOB 5CA1A 2PMFA 4CS3A 4XEOA 4O4HB 1JMKC 1HNZB 1LYLA 3BRCA 5CA0B 2ODRC 4YRNA 4JI1B 1N32B 1TUBA 3UT5A 4YDQA 5F5WA 4DPGA 1PYSA 2E1HA 4YRSA 4TWAA 5KX5B 4O4JA 4FFBA 3NETA 4OLFA 1XNRB 4I4TB 3HXYA 1EOVA 5CB4A 4LF7B 3UGQA 2YIBA 1H2SB 4HNAA 3VQYA 4K8XA 3LSQA 2YI8A 1WQWA 2ALYA 3P8TA 2E65A 3NEMA 3PCOB 3RUXA 1W66A 1JJCB 2JGUA 2HEPA 1JFFB 2ZIOA 4IHJB 4YJ2B 4CC5A 2ZR2A 2RHQA 2DQ3A 1S5JA 4FVMA 4FLZA 4DRXB 5ELNA 1B04A 4UP9A 4DV4B 3OTFA 4YY3B 2BTOA 1SERA 5LP6A 4JI3B 1XNQB 3IKLA 1QF6A 4YJ3B 2CJBA 4P72C 2E5LB 4FLXA 4ZOLA 4YREA 4NVPA 5GONB 5C52B 3JAKA 3M7MX 1JJOA 3JSLA 1IBKB 5ELOA 3E22A 3K5OA 2R70A 3JAWA 3WB1A 3WQZA 2EJFA 4OX9B 4FM2A 3K5MA 3ICAA 3K5LA 2EJ9A 1NJ2A 2IY5A 3WB2A 4K0KB 4LF4B 3L2ZA 1YB3A 2EWNA 4AHCA 3A74A 3HXZA 1H4QA 4YRKA 3UFGA 1SKVA 5BMVB 5C8YA 4ZI7A 1NJ5A 2AKWB 2JVDA 2VWKA 4YRIA 4DV0B 5FPRA 3T1YB 4P3NA 4JYAB 4P73A 3V7SA 5KNNA 2F93B 4Q15A 4NXMB 1VQZA 2AMCA 2UUAB 3HKDA 2PGGA 2UXDB 4UCOA 2UU9B 1WQ7A 2VQEB 1SESA 1WYDA 3RYHA 4L87A 4FLYA 5IJ0B 2F1MA 1NJ8A 3L4GB 3T1HB 1WPBA 2KKWA 1TAEA 4UCRA 4D7TA 4JI6B 4HWRA 5LYJA 3CHXA 3K57A 4WJ4A 1WPYA 1NNHA 4YRMA 2YIBD 3N2KA 3OD1A 5E3IA 3THOA 1HR0B 5IWAB 3VQXA 5KHGA 3HKCA 4DR1B 5ITZA 5FNVB 5EYPB 3UH0A 1Z5VA 4LFAB 3A31A 1SA0A 4GYCB 4PI0A 1B70B 4AH6A 4RQEA 4U3JB 2R72A 2QHSA 2ODRD 1QQCA 4XTVA 2Q7GA 2Q5HA 1KMIZ 3QF7A 2DTHA 4TVAA 2P22C 5K1XA 1TA8A 1SRYA 2ZCEA 1XMQB 4NCXA 4UCUA 5JVDA 1B7YA 1NJ6A 3RYFA 3RACA 5J2TA 2QHUA 3RIRA 3HFZB 3BJUA 2RQ6A 2PY5A 3JALA 4DV2B 4WI1A 4CH3A 1B76A 2Q7HA 3CB2A 4LF5B 3HXVA 1FFXB 4H02A 4LVLA 4I55A 4UP7A 4P3OA 4UCTA 4P72A 4YRJA 2F66C 4X65B 2UXCB 3RYIB 2UUBB 2CGHA 5EZYA 4TUYB 3N2GB 4JI2B 4XTZA 4GKJB 4RQFA 4H2VA 4YRTA 3CSXA 3BPZA 1WNLA 5J2UB 4O2DA 4PG3A 1FJGB 3RGBA 4EB6A 4RDXA 1SQGA 5KHHA 4LNUB 1YFSA 4X1IB 2BTQA 4F6RB 4ZHQB 5LA6A 3P8YA 4DUYB 1EIYA 2G4CA 1XI1A 3JARB 1N33B 2QHVA 3UGTA 3A7AA 1T5EA 3RKXA 2F95B 5KMGB 2ZZFA 3LC0A 2RHSB 2P5OA 4O2BB 1KU9A 4X20A 4B3SB 3K59A 2I4LA 3A2FA 3TEHA 3HKBB 4H2XB 1I7FA 4O4IA 4WBNA 1Q5OA 3JASA 4TV9A 4UFZA 4B3RB 1HW7A 1M93A 4DR6B 3HKEB 3BA8A 5EIBC 4I50A 4HVCA 4O2AB 1D5AA 4FLWA 3E9HA 5KHJA 2HNIA 3EFSA 2ZIMA 4JI5B 1TGOA 4YRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWA A;  1ATI A;  2XTI A;  3A7U A;  3QO5 A;  1USY C;  2CJ9 A;  1YFT A;  4CS2 A;  3DSQ A;  5HGQ A;  1PYS B;  1C0A A;  3HFV A;  4G85 A;  3LSS A;  4HWO A;  3HTZ A;  1BIA A;  1L0W A;  4P75 A;  2ZTG A;  3IAL A;  2ALY B;  4LNS A;  1X2H A;  3I7F A;  4K86 A;  3PCO A;  3A5Y A;  4OP0 A;  3HY1 A;  2E41 A;  3V7C A;  4KR3 A;  1IL2 A;  1Z7N A;  2RHQ B;  2ZZG A;  2E64 A;  4CS4 A;  2E10 A;  3G1Z A;  2EL9 A;  3R07 A;  2YIA A;  3HXU A;  4P71 A;  2ZT5 A;  2DU7 A;  2J3M A;  3V8K A;  4YYE A;  3QTC A;  4YRF A;  1E1O A;  1SET A;  2ART A;  5C53 B;  4YCV A;  3IG2 A;  2IY5 B;  3L1A A;  2ZXF A;  3MEY A;  1X54 A;  4CH5 A;  2ZNJ A;  4E51 A;  4ZIB A;  2I4O A;  2AKW A;  12AS A;  5K1P A;  4XU0 A;  1H4V B;  2DU5 A;  2Q5I A;  1N9W A;  1NYR A;  1EFW A;  4KR2 A;  2E5A A;  2ZNI A;  1J5W A;  4XTY A;  4YRC A;  4H2U A;  1BIB A;  3TUP A;  1KMN A;  3P8V A;  4YCW A;  3W3S A;  3VQV A;  4UP8 A;  4EO4 A;  4TQD A;  4YRQ A;  2ZT6 A;  3A5Z A;  1BBW A;  1USY A;  2DTI A;  3NEN A;  2DXT A;  3IKM B;  3HRK A;  5C51 B;  2DTO A;  4H2S A;  1YFR A;  2RJZ A;  1X01 A;  3MF2 A;  1G5H A;  3HFZ A;  4YP0 A;  2ARU A;  1ASZ A;  1ASY A;  4H2Y A;  2QHT A;  1BBU A;  2I4M A;  4XU2 A;  2P0L A;  3TEG A;  1EVL A;  3RL6 A;  2CIM A;  2C8M A;  4PHC A;  4BW9 A;  1EQR A;  1QE0 A;  1O9H A;  3FJP A;  2PME A;  3KFU A;  4XTW A;  2DXU A;  4G84 A;  3M4Q A;  4YRG A;  2PUS A;  4J15 A;  2ARS A;  3A7R A;  3NEL A;  1JJC A;  4DQ2 A;  4WF2 A;  3CMQ A;  4H2W A;  1KMM A;  4Q6G A;  1WLE A;  3MF1 A;  2RHS A;  2Q7E A;  3TEH B;  2DDZ A;  2DVE A;  2I4N A;  2J3L A;  2ZGW A;  2XGT A;  1GGM A;  1YGB A;  4YPF A;  3V8L A;  3RF1 A;  2FYK A;  2ZR3 A;  4YCU A;  2QJ1 A;  1RIQ A;  1G5I A;  1KOG A;  4X5O A;  4YRR A;  1ADY A;  3PZC A;  4TTV A;  3A32 A;  1G6U A;  2DQ0 A;  1FYF A;  4P73 C;  2AMC B;  3EFR A;  3L4G A;  4YRO A;  4TVY A;  2DZ9 A;  1HXD A;  4YRP A;  4XU3 A;  1HC7 A;  1WU7 A;  3HXX A;  2ZT7 A;  3ZED A;  2EJG A;  4P75 C;  4KQE A;  4XU1 A;  1X2G A;  4HA8 A;  4K87 A;  1X55 A;  1B70 A;  11AS A;  4P3P A;  1NJ1 A;  4P71 C;  4HWP A;  4RMF A;  1E24 A;  3M4P A;  4TVA B;  3RKW A;  4K88 A;  1H4T A;  3BHP A;  3RKY A;  1B7Y B;  4HWS A;  2ZT8 A;  4TVW A;  2CJA A;  2DJZ A;  1B8A A;  3E9I A;  4UPA A;  3QO7 A;  4HWT A;  4ZTU B;  1G51 A;  1HTT A;  2DEQ A;  3VQW A;  4CH6 A;  3QNE A;  1E22 A;  3V8J A;  4H2T A;  3HY0 A;  2YI9 A;  4P74 A;  3REX A;  2EAY A;  4CH4 A;  2E3C A;  3REU A;  2P5I A;  3HRI A;  2ZZE A;  1H4S A;  1EIY B;  1NYQ A;  4XTU A;  2DZC A;  1X56 A;  1ADJ A;  3BFM A;  4EX5 A;  3ERR A;  4XTX A;  4H2X A;  3QO8 A;  2ZIN A;  2DKG A;  3V7R A;  3RGL A;  1Z7M A;  1O9G A;  1EVK A;  4P74 C;  3VBB A;  1E1T A;  3HXW A;  4WJ3 M;  4ZTZ B;  4XEM A;  4TQF A;  2C7I A;  2PMF A;  4CS3 A;  4XEO A;  1LYL A;  4YRN A;  2ODR C;  4YDQ A;  5F5W A;  4DPG A;  1PYS A;  2E1H A;  4YRS A;  4TWA A;  3NET A;  4OLF A;  3HXY A;  1EOV A;  3UGQ A;  2YIB A;  3VQY A;  3LSQ A;  2YI8 A;  1WQW A;  2ALY A;  3P8T A;  2E65 A;  3NEM A;  3PCO B;  3RUX A;  1W66 A;  1JJC B;  2HEP A;  2ZIO A;  2ZR2 A;  2RHQ A;  2DQ3 A;  5ELN A;  4UP9 A;  1SER A;  3IKL A;  1QF6 A;  2CJB A;  4P72 C;  4YRE A;  5C52 B;  5ELO A;  2R70 A;  3WQZ A;  2EJF A;  3ICA A;  2EJ9 A;  1NJ2 A;  2IY5 A;  3L2Z A;  1YB3 A;  2EWN A;  3HXZ A;  3A74 A;  1H4Q A;  4YRK A;  3UFG A;  1NJ5 A;  2AKW B;  2JVD A;  4YRI A;  4P3N A;  5KNN A;  3V7S A;  4P73 A;  4Q15 A;  2AMC A;  1VQZ A;  2PGG A;  1WQ7 A;  1WYD A;  4L87 A;  1SES A;  1NJ8 A;  3L4G B;  4HWR A;  4WJ4 A;  1WPY A;  1NNH A;  4YRM A;  2YIB D;  3OD1 A;  5E3I A;  3VQX A;  3UH0 A;  3A31 A;  1B70 B;  4AH6 A;  4RQE A;  4XTV A;  2R72 A;  2QHS A;  2ODR D;  2Q7G A;  2Q5H A;  2DTH A;  4TVA A;  5K1X A;  1SRY A;  2ZCE A;  4NCX A;  1B7Y A;  1NJ6 A;  3RAC A;  2QHU A;  3RIR A;  3HFZ B;  3BJU A;  2RQ6 A;  4WI1 A;  4CH3 A;  1B76 A;  2Q7H A;  3HXV A;  4H02 A;  4UP7 A;  4P3O A;  4YRJ A;  4P72 A;  2CGH A;  4XTZ A;  4RQF A;  4H2V A;  4YRT A;  1WNL A;  4O2D A;  4PG3 A;  4RDX A;  1YFS A;  3P8Y A;  1EIY A;  2G4C A;  2QHV A;  3UGT A;  3A7A A;  3RKX A;  2ZZF A;  3LC0 A;  2RHS B;  2I4L A;  3TEH A;  4H2X B;  4HVC A;  3E9H A;  2HNI A;  3EFS A;  2ZIM A;  4YRL A; 
#chains in the Genus database with same CATH topology
 3UO2 A;  4BWA A;  1ATI A;  1W59 A;  1K5Q A;  3A7U A;  2CUG A;  1USY C;  4PA9 A;  2F4V O;  2CJ9 A;  2IM9 A;  2Z3Y A;  3SYA A;  1KBH A;  1TUB B;  5HGQ A;  1EBO A;  4DV7 B;  4IIJ A;  1FS0 G;  2WWW A;  1KD1 W;  2W0X A;  4I4T A;  3LSS A;  5F2V O;  3ZRV A;  4ZKI A;  4LVK A;  4OX9 O;  3AG2 B;  5IT9 N;  2YEV B;  1IX9 A;  2LW7 A;  1HDJ A;  4U7O A;  3B77 A;  4LNS A;  4NR1 A;  3I7F A;  3A5Y A;  2IU3 A;  4KHP O;  3FX7 A;  4IHJ A;  1MA1 A;  2WLM A;  1Q43 A;  3ABK C;  4GZR B;  1FKA O;  2RHQ B;  4LVI A;  4CS4 A;  3G1Z A;  4JYY A;  4FLV A;  2YXY A;  1XHZ A;  1K5S A;  2IH3 C;  1A32 A;  4YJ3 A;  4DR5 B;  4X1K B;  1ZWI C;  2DU7 A;  4TV8 A;  2XAG A;  4GKK O;  3JAT B;  4MTO A;  4U7N A;  1QCE A;  2RN9 A;  2ART A;  5C53 B;  3IAY A;  4YXW G;  4YCV A;  3IG2 A;  3L1A A;  4I9W A;  3GWK C;  4CH5 A;  2QKC A;  1L0N H;  4PDV A;  1HNX B;  4E51 A;  3E86 A;  1FXK C;  5J9P C;  2BOB C;  3LUT B;  2GTA A;  1H4V B;  3FKS G;  4GLX A;  1EFW A;  4LCU C;  1RFY A;  1WB7 A;  1NJI W;  3ICX A;  1XRE A;  2CDY A;  4J41 A;  1VP7 A;  3RBZ A;  2IJH A;  3RYC A;  2WLL B;  5LYJ B;  3NR7 A;  4LFB B;  4AQY O;  1GN6 A;  4MTX A;  3U10 A;  1YTF D;  3CRC A;  1Y66 A;  4TQD A;  2AW9 A;  4C7U A;  1M57 C;  2HJF C;  3P3P A;  2IJI A;  1USY A;  2LGQ A;  2V4D A;  3JYC A;  1VF5 B;  2OTL V;  5IWA O;  3ETG A;  3J81 N;  3HRK A;  4RUF A;  3K79 A;  3RYF B;  1G5H A;  3HFZ A;  2CH7 B;  4JI6 O;  5C93 A;  1PL4 A;  2X0L A;  1DF4 A;  3E89 A;  2I4M A;  2NNU A;  3SPI A;  2CAZ C;  3TEG A;  4ICG A;  5EZY B;  4TUY A;  2HP8 A;  4TOI A;  1GM9 A;  3BAB A;  2EIN C;  4PHC A;  3ASO B;  1QE0 A;  1O9H A;  3ZHQ A;  3BAA A;  3FJP A;  2HJD A;  4GKK B;  3K0D A;  2HR3 A;  4G84 A;  3ZJZ A;  1M90 W;  3A7R A;  1Q8I A;  2L6L A;  1H2M A;  2ODM A;  3CMQ A;  2DOS A;  4Q6G A;  4LWS B;  3MF1 A;  2RHS A;  2Q7E A;  2ZQM A;  2X6A A;  3F7V C;  4X20 B;  3L70 H;  5B66 Z;  3U0Z A;  4JI5 O;  3HKB A;  3B2E E;  3L72 H;  4WBN B;  4DXW A;  2DYS C;  4L8J A;  2ZGW A;  1FPO A;  4ZOL B;  4JAV A;  2LP7 A;  3MAQ A;  3SR2 C;  4KFM A;  2FYK A;  2IW5 A;  2QJ1 A;  2JEU A;  1AR5 A;  1RIQ A;  4LVJ A;  1G5I A;  4NXM O;  4X5O A;  4IIJ B;  3PZC A;  4TTV A;  4RAI A;  3FB5 C;  1D2D A;  4R8C A;  3RYH B;  2Q6A A;  4TVY A;  2YEV A;  4YRP A;  2QM8 A;  4DR2 O;  2GUZ A;  2IJK A;  1NT2 B;  3ZMV A;  3ZED A;  1VQK V;  5BR8 B;  1QHT A;  4XU1 A;  3L75 H;  2A3Q A;  5CA3 A;  5DN6 G;  1IBM B;  1SA0 B;  1B70 A;  4DK1 A;  4U3J A;  3SJC C;  4LF9 B;  1HWY A;  4P71 C;  4HWP A;  4X1K A;  4TV8 B;  4TVA B;  3JAT A;  3RKW A;  2EIK B;  1H4T A;  5JJE B;  1XEQ A;  2A7W A;  3BHP A;  1B7Y B;  2B1I A;  4UUJ C;  1R3J C;  3E8F A;  4H13 B;  4B3T O;  3BVO A;  1CXZ B;  2A0L A;  5EBL C;  3ZMT A;  4J7J A;  1GN2 A;  2BSK A;  2P4V A;  3QO7 A;  4UXN A;  4H37 A;  2Q8V A;  5EBW C;  1AP5 A;  2LJ2 A;  3AG3 C;  1M1K W;  1YEW A;  4DV1 B;  1M5I A;  4LFC B;  5EK0 A;  1XBL A;  3BY6 A;  3CCJ V;  2JS5 A;  2GSM B;  2EAY A;  4CH4 A;  1JPX A;  3REU A;  3RYC B;  4LNU A;  4X1I A;  3C3T A;  5LA6 B;  1DGS A;  1AJQ A;  2R9A A;  2DZC A;  4HYO A;  3H9V A;  2A8E A;  2QWO B;  3I56 V;  1MZE A;  3MD0 A;  4MS2 A;  4PJ0 Z;  2D3O W;  4O4I B;  3OE7 G;  2A9H A;  3FAV B;  3JAS B;  2YUA A;  1Z7M A;  3VBB A;  4JI2 O;  1E1T A;  3HXW A;  2ADQ B;  4O2A A;  2FKX A;  2OYQ A;  1ZUQ A;  4X88 A;  3WB0 A;  4Z1V A;  2CH7 A;  3RVY A;  1JMK C;  2P90 A;  1LYL A;  3ABM B;  3ZIA G;  1N32 B;  1FAF A;  4YDQ A;  4K3A A;  2VQE O;  1PYS A;  2VS0 A;  2E1H A;  5B1A B;  4TWA A;  4MVR A;  4O4J A;  5EBM C;  1PL0 A;  1Z2G A;  3HXY A;  1AIL A;  4LF7 B;  2ITC C;  1AI7 A;  1H2S B;  3T4D A;  4G2K A;  4K8X A;  2ALY A;  2ARH A;  4XDL A;  1K92 A;  3RUX A;  1W66 A;  1YVW A;  2JGU A;  2IJJ A;  1JFF B;  4TSF G;  4YJ2 B;  4CC5 A;  1QR9 A;  3UO3 A;  1S5J A;  4FVM A;  4DRX B;  1B04 A;  1NKD A;  2EIJ C;  5L3G A;  4DV4 B;  4YY3 B;  1AR1 B;  1VQP V;  4JI3 B;  4PDR A;  5A9G A;  3E83 A;  2E5L B;  1IVS A;  3OR6 C;  4ZOL A;  4YRE A;  1IBK B;  2QR4 A;  3WB1 A;  1CPY A;  4YHH O;  1GM7 A;  2WLI B;  3W7T A;  3B8M A;  2JK5 C;  1YB3 A;  4AHC A;  1H4Q A;  4YRK A;  2P06 A;  4JZ2 A;  4N23 A;  1NJ5 A;  2ZE8 A;  4DV4 O;  1XNQ O;  1THZ A;  1KP2 A;  5KNN A;  5CBH A;  4P73 A;  4LF5 O;  3DGE A;  2UUA B;  1WQ7 A;  4UCO A;  2VQE B;  3K0G A;  3RYH A;  3E2E A;  3AG2 C;  1WPB A;  4QJF B;  2KKW A;  1TAE A;  3ZHS A;  4LF4 O;  4WJ4 A;  2GUZ B;  3NXS A;  2Y4U A;  4LF9 O;  1WPY A;  4UV8 A;  3L71 H;  3F5T A;  2AXT Z;  5KHG A;  1ZX3 A;  3UH0 A;  4LFA B;  3A31 A;  1SA0 A;  4JTC B;  1DLB A;  1B70 B;  4U3J B;  4XTV A;  1QQC A;  1YDX A;  3OD4 A;  2CTR A;  1KMI Z;  3QF7 A;  1QVG U;  4TVA A;  1F23 A;  4B3S O;  2ZCE A;  3ASN B;  1GMG A;  3HR0 A;  3E35 A;  3CC4 V;  1B7Y A;  4IGG A;  5J2T A;  5KA5 A;  3ZN0 A;  2ZT9 B;  4WI1 A;  2XUM A;  4CH3 A;  5JWP A;  3CB2 A;  2BSK B;  3P30 A;  4X8A A;  3HXV A;  1FFX B;  4LVL A;  2WSS G;  4CZZ A;  4YRJ A;  3SDL A;  3MHS C;  2G38 A;  4QGP A;  2YID A;  2QWR B;  4HZ3 A;  1WNL A;  4OGQ B;  1SF9 A;  1OCR B;  3F7Y C;  2QGN A;  4PA6 A;  1FJG B;  4O2D A;  1GH6 A;  1SQG A;  2DW4 A;  4LNU B;  4X1I B;  4ZHQ B;  3P8Y A;  2V1D A;  5LA6 A;  3CCU V;  2B1G A;  2G4C A;  1N33 B;  2WLH A;  3OGI B;  2FYU H;  2DJV A;  4KP4 A;  3RKX A;  2QM7 A;  1PKX A;  1KB9 F;  2ZZF A;  2M7W A;  2P5O A;  1KU9 A;  1PM9 A;  4O4I A;  3FAV A;  3JAS A;  4UFZ A;  1M93 A;  4UVB A;  4HVC A;  1BGY H;  5FL7 G;  4O2A B;  4BIO A;  2LFR A;  2ZIM A;  3FYI B;  4YRL A;  4DUZ B;  1Q6H A;  4JTD B;  3JAM N;  1H8E G;  1YFT A;  1EFR G;  1PYS B;  3CS5 A;  4G85 A;  3G80 A;  4MW8 A;  1YSC A;  4O4J B;  1PV0 A;  4GX5 A;  4DV2 O;  1L0L H;  1K97 A;  4HWO A;  1OCC B;  1RSO A;  3A0H Z;  3HTZ A;  3B8N A;  2HHH B;  2ITD C;  5B3S B;  5KUK A;  1AVM A;  5KA6 A;  2ALY B;  2Q9L A;  1P7G A;  5B5E Z;  3CMA V;  1JA8 A;  5E79 Z;  4QE9 A;  3HY1 A;  2E41 A;  1JFF A;  1V54 B;  2QSA A;  4YJ2 A;  1IL2 A;  1I0H A;  1R6N A;  4PI2 A;  5IYZ A;  3K9S A;  4DRX A;  1I08 A;  3ZMU A;  4JI7 B;  3O9O A;  5L3B A;  3JD4 A;  4DR2 B;  3R07 A;  4AQY B;  1R6T A;  2HHH O;  2D2C B;  5KHI A;  2J3M A;  2LGW A;  3V8K A;  3E8H A;  4FK5 C;  1IUR A;  3AG3 B;  1K3E A;  4EEQ A;  2EUL A;  3RT3 C;  1MZF A;  4JI0 O;  3AG4 B;  2UXB B;  1XL4 A;  1BZK A;  2YXL A;  3RWR D;  4DR6 O;  2WLI A;  2ZXF A;  3OFN G;  3MEY A;  3DXR B;  4DW0 A;  2ZNJ A;  4GX1 A;  3TCU A;  2N04 A;  2P67 A;  1BQZ A;  2I4O A;  4B3T B;  2H8P C;  12AS A;  1NBM G;  1F51 A;  3W7S A;  3IC9 A;  2WLJ A;  1Y67 A;  1N9W A;  1NYR A;  3SPG A;  1MMM A;  5HFL A;  1VIB A;  3CCS V;  1J5W A;  1NTK H;  1X59 A;  5JH7 B;  2EIL C;  3W7U A;  1R3L C;  2JJ2 G;  3AG7 A;  3SYC A;  1KMN A;  1M56 B;  3P8V A;  5FPO A;  1AJP A;  3JD2 A;  3W3S A;  3JD1 A;  4HBN A;  4X1Y B;  4UP8 A;  4EO4 A;  1I5Y A;  1SZX A;  4YRQ A;  1XNR O;  1XL6 A;  3GB7 C;  4DR7 B;  1F4M A;  2F43 G;  3RN4 A;  3NEN A;  2RCV A;  3BA9 A;  1VF7 A;  3PJS K;  4PA3 A;  2UUA O;  1JR9 A;  2UU9 O;  4H2S A;  1OZ0 A;  3QVN A;  1ROP A;  4N21 A;  4LC1 A;  1X01 A;  4G27 B;  5J2T B;  3FD9 A;  4W4L A;  4YP0 A;  1V55 B;  4IYH A;  4O4H A;  1ASZ A;  1US6 A;  5CA0 A;  3K04 A;  1BBU A;  1FFX A;  4LF8 O;  4BIZ A;  2EZP A;  1XQ8 A;  3EFF K;  4D6T H;  2P0L A;  4XU2 A;  4B3M O;  1EVL A;  3LNN A;  3ETE A;  1EQR A;  1WP8 A;  1H2K A;  1V9P A;  1PNK A;  3STL C;  2PME A;  1GK9 A;  3KFU A;  4JI8 B;  2PUS A;  2P7T C;  2ZE7 A;  1ZL8 A;  4DQ2 A;  4ZHQ A;  5JJN B;  1LUV A;  3SJA C;  1WLE A;  3FYE B;  4LF8 B;  1X4T A;  2K9P A;  4QIW F;  3UM7 A;  2DVE A;  5BZB A;  2I4N A;  4WFE A;  2UUB O;  3ZMZ A;  5TIS Z;  4JAS A;  1NTZ H;  2YSU B;  5CBF A;  2YDE A;  2F23 A;  4JYB A;  4OPA A;  2FB5 A;  4UCS A;  3R65 A;  3V8L A;  1K34 A;  1ZTE A;  3RF1 A;  5AG2 A;  4FMT A;  1NU1 H;  2H3O A;  1KOG A;  4ZI7 B;  3K03 A;  1M9N A;  1U97 A;  4OPH A;  2OT5 A;  5B1N A;  1DTO A;  1RSO B;  3HKD B;  2FL4 A;  4NB5 A;  4DV7 O;  1ZLZ A;  3L4G A;  4YRO A;  4YIP A;  3OGC C;  3ZHT A;  1PD3 A;  2DZ9 A;  3QG5 A;  1HXD A;  5FLX N;  3HXX A;  3CE2 A;  4YHH B;  2ZT7 A;  1Y74 A;  5LGT A;  1ENV A;  1AI6 A;  4FM1 A;  5IYZ B;  1M4U A;  4I9Q A;  2JDI G;  3EVK A;  4KHP B;  1WB8 A;  4RMF A;  4WCE V;  3T1Y O;  3M4P A;  2PI5 A;  1KP3 A;  5LGN A;  2FML A;  3T1H O;  1GN3 A;  5IYC O;  4HWS A;  5LHH A;  4X65 O;  2UXC O;  2CGN A;  2CJA A;  1B8A A;  3EHB B;  3DXR A;  4UPA A;  3OR7 C;  1OV9 A;  1P49 A;  2BCC H;  5EC1 C;  3LNM B;  3H01 A;  4P2Z A;  3AG1 B;  1YZB A;  1R3K C;  3VQW A;  4CH6 A;  1E22 A;  4P9O A;  4H2T A;  4P74 A;  3REX A;  2E3C A;  5JH7 A;  1HNW B;  1OJH A;  2ZD9 A;  2QM4 A;  4ASU G;  2UXB O;  3ZS8 C;  5JCO C;  2EIM C;  3DTU B;  4JV5 B;  4XTU A;  1UJW B;  1ADJ A;  4X1Y A;  1COW G;  1Y76 A;  3ERR A;  3PN1 A;  2Q4P A;  1YCI A;  2BE3 A;  2R9I A;  3B09 A;  3VOU A;  2ZIN A;  3V7R A;  1O9G A;  3HKE A;  4P74 C;  1JOY A;  4LR3 A;  3KG2 A;  2KG7 A;  1HNW O;  4TQF A;  1W0J G;  3X2Q C;  2C7I A;  5CA1 A;  4J9Z B;  4QPJ A;  4O4H B;  4XEO A;  2XAJ A;  3BRC A;  3GWO A;  5CA0 B;  1VQ6 V;  1QLN A;  4JI7 O;  3UT5 A;  1VEW A;  5KX5 B;  1MG1 A;  3WFV A;  3LDC A;  1NI8 A;  4JPR A;  4W4K A;  3TET A;  3VQY A;  4JV5 O;  2YI8 A;  1YF2 A;  3NEM A;  1YXB A;  4X64 O;  3PCO B;  4DV6 O;  2LFS A;  5B1B B;  1ZL8 B;  3E8G A;  2ZIO A;  3M99 B;  5A2Q N;  2DQ3 A;  3K08 A;  4CBC A;  2GBO A;  2JEX A;  3C3S A;  3I55 V;  2YIC A;  5LP6 A;  3KKY A;  2CJB A;  1I94 O;  5GON B;  5C52 B;  1BS3 A;  4HAM A;  3JAK A;  3M7M X;  5ELO A;  1YI2 V;  4JI1 O;  2Y4T A;  2CK3 G;  2IY5 A;  2DYR C;  4PEL A;  3L2Z A;  1S0V A;  3APQ A;  3UFG A;  1SKV A;  2Q69 A;  5H6Q A;  4ZI7 A;  2ATK C;  1YJW V;  2AKW B;  4YRI A;  3O65 A;  3SPH A;  4LBE C;  3V7S A;  1M57 B;  2F93 B;  2AHY A;  1VQZ A;  3HKD A;  3SYQ A;  1EZV H;  3S3W A;  5IJ0 B;  4FLY A;  1NJ8 A;  3L4G B;  4G28 B;  1N4C A;  1P7B A;  2AHZ A;  2Z0A A;  3OMI B;  2OCH A;  3B40 A;  2NR5 A;  1XMQ O;  4JI6 B;  1Y74 B;  1NNH A;  1QVF U;  5E3I A;  3HKC A;  3K06 A;  5ITZ A;  1G8M A;  4GYC B;  2R72 A;  2ODR D;  1WA8 B;  4MW3 A;  1AJN A;  3IC7 A;  5K1X A;  2QWN B;  1SRY A;  1XMQ B;  2W6I G;  2MK3 A;  3SYP A;  5H9C A;  1PP9 H;  4UV9 A;  1NZ6 A;  1LR1 A;  3K3W A;  2UUC O;  4UP7 A;  4P3O A;  1Q86 W;  2JGD A;  4H33 A;  3RYI B;  2UUB B;  2CGH A;  1ARO P;  2Q0O C;  1K4D C;  2QWQ B;  1ORQ C;  4JI2 B;  4XTZ A;  2A06 H;  1SQB H;  4YRT A;  1HNZ O;  2EIL B;  4RDX A;  2DYR B;  1AB3 A;  1YFS A;  2BTQ A;  5B1O A;  3CCL V;  2H94 A;  3JAR B;  3UGT A;  4J10 A;  1T5E A;  4P30 A;  2F95 B;  1Y76 B;  1EN4 A;  3K59 A;  2I4L A;  4Q20 A;  2A79 B;  2QTS A;  4LF7 O;  4B3R B;  1HW7 A;  2GTS A;  4DR6 B;  3HKE B;  3BA8 A;  4LFC O;  3E9H A;  2KG7 B;  3LDD A;  1TGO A;  1NH2 D;  4DUY O;  4JF3 A;  2KQX A;  5CA1 B;  3CX5 F;  3QO5 A;  2ZXW C;  1VQ8 V;  4DR4 B;  3ZRS A;  4UCV A;  2OCC B;  4CS2 A;  1E79 G;  3SPC A;  3DSQ A;  4YIO A;  3UT5 B;  1P84 F;  4J80 A;  3CRR A;  1C0A A;  3ZHV A;  5LMN B;  3J7A U;  5KX5 A;  5D5P A;  3IGA C;  1BHB A;  4BW5 A;  2Y69 C;  4LVM A;  4X64 B;  1Y4M A;  1XDC A;  2Y69 B;  4DR5 O;  5L3F A;  1BIA A;  1VAR A;  5GW7 A;  3K9A A;  1IDS A;  4MVO A;  4DO2 A;  1X2H A;  3PCO A;  4K86 A;  3AK3 A;  2PYJ A;  4GX0 A;  3V7C A;  2EIJ B;  1N0N A;  1W2B U;  2ZZG A;  1P4R A;  5IE9 A;  1TUE B;  3MHH C;  2E10 A;  3UCS C;  4F6E A;  1KC8 W;  3KCX A;  1JX9 A;  2P6J A;  5LP6 B;  3HXU A;  4P71 A;  1Z5W A;  2YXH A;  1EZJ A;  5JJJ B;  2AZ0 A;  5GON A;  3JAK B;  3QTC A;  5BXZ A;  4YRF A;  1VMG A;  1E1O A;  3ZN1 A;  5DM6 V;  2VWJ A;  5JQG A;  5JCO A;  2IY5 B;  2DMX A;  3U11 A;  5D5Q A;  2Q0A A;  1X54 A;  4JYA O;  4ZIB A;  1TVK B;  4OXS A;  4B08 A;  2AKW A;  3ZX6 A;  2IU0 A;  4XU0 A;  2NN4 A;  3D3Q A;  4JAU A;  2Q5I A;  1N34 O;  1U96 A;  4KR2 A;  5IJ0 A;  2E5A A;  1I94 B;  3ETD A;  3KZI Z;  4XTY A;  3L9D A;  3CEI A;  3OEE G;  4YRC A;  4H2U A;  3C90 A;  2Q67 A;  1BIB A;  4MVS A;  3OW2 U;  4YCW A;  1DF5 A;  4DR4 O;  4EFB A;  1K9M W;  3HKC B;  5ITZ B;  3A5Z A;  3CME V;  4ABM A;  1S5L Z;  3ETQ A;  2VQF B;  1WA8 A;  4MSW C;  4IL6 Z;  2DTI A;  1NTM H;  2DXT A;  1NR1 A;  2FTK A;  3IKM B;  2P4K A;  1YFR A;  1BCC H;  2LO1 A;  1GKF A;  3Q4H A;  1PNL A;  2Q68 A;  2ARU A;  2L35 A;  1ASY A;  2NS6 A;  3AK2 A;  4WF9 V;  5L3D A;  2QHT A;  1B3Q A;  4A5U B;  2PTM A;  4JGS A;  1W0K G;  1V54 C;  2JGD B;  4MVU A;  2VQF O;  2ZKO A;  3RYI A;  4FFB B;  3RL6 A;  4I7Z B;  1YHQ V;  1WN7 A;  4BW9 A;  3ABL C;  1BT8 A;  3CRQ A;  2EIK C;  5LL6 Y;  1WJZ A;  3P3N A;  3LDE A;  4D7S A;  4XTW A;  3M4Q A;  1BHA A;  1QR8 A;  1G4Y B;  3ZHU A;  1JJC A;  2BTQ B;  4IT5 A;  4AIL C;  3JAR A;  1E1R G;  4BAY A;  1F7Y A;  3CRM A;  4X66 B;  3CWB H;  3DC6 A;  2GV9 A;  2DDZ A;  1VF6 C;  1D5N A;  1N33 O;  3KCY A;  1J5E B;  1YGB A;  3JAW B;  3GVM A;  4J9Y B;  4YPF A;  3OTO B;  2ZR3 A;  1VQL V;  2ZM6 B;  2AGA A;  5IYD O;  3F5W C;  4YRR A;  1IBL O;  4DV5 B;  1FYF A;  2X6C A;  4P73 C;  4TWK A;  1S3J A;  2AMC B;  2CGO A;  3HB3 B;  3EFR A;  2X6B A;  2OWO A;  4QPK A;  1BQ0 A;  3ABL B;  2UXX A;  2XTA A;  2XAF A;  4CC6 A;  1QBZ A;  2O57 A;  4TT3 G;  1SQF A;  2DWD C;  2EJG A;  4KQE A;  2XAQ A;  3EXA A;  4DK0 A;  3JCU Z;  3IFX A;  1BMF G;  5EYP A;  5LGU A;  1X55 A;  4FFK A;  4P3P A;  5LMN O;  2Y0P A;  4J42 A;  4K35 A;  3TJT A;  2XAS A;  4R50 A;  5IYB O;  1L1F A;  2ZM6 O;  1EN6 A;  3RKY A;  5JVD B;  4X89 A;  2Y48 A;  5KAI Z;  2ZT8 A;  5JQG B;  3JAL B;  3G6B A;  1OCO B;  1IBL B;  3E9I A;  4XDK A;  1SQQ H;  1TVK A;  1LNQ A;  2MW2 B;  4I55 B;  4MTG A;  5CN0 A;  3STZ C;  3OEH G;  2JS3 A;  1QLE B;  4K8Z A;  2ZDI A;  1YIT V;  2DEQ A;  3N2G A;  3QNE A;  2Q73 A;  1PNM A;  2R9R B;  1DK1 A;  1SS3 A;  5J2U A;  4MT8 A;  3SYO A;  2GDS A;  2P5I A;  3HRI A;  1AI4 A;  2ZZE A;  4EB6 B;  1SZT A;  4F6R A;  4DR3 B;  1H4S A;  1EIY B;  1NYQ A;  1YJ9 V;  3UKM A;  1Q3E A;  5KLV H;  5CBG A;  2M6Y A;  4EX5 A;  3CYO A;  3JSN A;  4XTX A;  4PDM A;  3S3X A;  4H2X A;  4TV9 B;  3CCR V;  3UQ8 A;  1EVK A;  1R6K A;  4I50 B;  4K0K O;  4ZTZ B;  3B4S A;  4B7K A;  1NVP D;  1MNG A;  2OIG A;  4XEM A;  2ZXW B;  1AP6 A;  4KL1 A;  3Q4H B;  1XMO B;  2PMF A;  4NTX A;  4PV1 B;  4DV0 O;  1HNZ B;  2ODR C;  4JI1 B;  3ZBH A;  5LMU O;  5F5W A;  3SPJ A;  3BEH A;  4YRS A;  5IY5 B;  4FFB A;  1H2L A;  4JI8 O;  4BR6 A;  4OLF A;  2K1E A;  5CB4 A;  4RWU A;  3UGQ A;  4HNA A;  3FB7 C;  5B1A C;  1H2N A;  1AI5 A;  5H5N A;  4BIU A;  1JJC B;  4X9Q A;  1B06 A;  3CXC U;  1YJN V;  2ZR2 A;  1F4N A;  3OAA G;  5ELN A;  4FLZ A;  5HFM A;  3OT7 A;  4UP9 A;  2E76 B;  2EIN B;  1SQX H;  1JJ2 U;  3OTF A;  4P9P A;  1K4C C;  2BTO A;  3IKL A;  1QF6 A;  1SQP H;  1XOU A;  3TXQ A;  3CXH F;  3CCQ V;  3W7W A;  3BCC H;  3E22 A;  3K5O A;  1FJG O;  2R70 A;  3JAW A;  3WQZ A;  2EJF A;  3WU2 Z;  4FM2 A;  3K5M A;  1NJ2 A;  4K0K B;  3JD0 A;  2EWN A;  3HXZ A;  1N0J A;  1NVP B;  3CJH B;  2W0F C;  5BMV B;  1WAZ A;  1RPR A;  4LF6 O;  1HR0 O;  2N74 A;  1S5H C;  2QKS A;  4B3R O;  1G1X B;  4DV0 B;  5FPR A;  3T1Y B;  4JYA B;  5KAF Z;  4NXM B;  2AMC A;  2UXN A;  2UXD B;  2UU9 B;  4L87 A;  1OCR C;  1SES A;  1Q90 D;  2F1M A;  3A0R A;  1AR4 A;  4KUM A;  4HWR A;  3H1I H;  3K57 A;  1MOF A;  4Z2W A;  3X2Q B;  2YIB D;  3THO A;  1HR0 B;  1Y6X A;  5IWA B;  3CCM V;  1YTF B;  5FNV B;  5EYP B;  2IH1 C;  1K73 W;  4PI0 A;  4RQE A;  2Q5H A;  3TGU H;  1TA8 A;  2QDO A;  2YC0 A;  3ZRW A;  1FYJ A;  5JVD A;  1NJ6 A;  4DR3 O;  1URF A;  2QHU A;  3A0B Z;  2HG5 C;  4GX2 A;  3BJU A;  2RQ6 A;  2EJ7 A;  2PY5 A;  3JAL A;  4DV2 B;  2Q7H A;  4LF5 B;  2ADP A;  4PA4 A;  5BR8 O;  4I55 A;  4P72 A;  4X65 B;  2UXC B;  1R73 A;  3ASO C;  4ZBM A;  3OUS A;  1VF6 A;  2YS8 A;  5H6R A;  3N2G B;  2ZE6 A;  4DYL A;  4GKJ B;  4RQF A;  4H44 B;  3OMN B;  5J2U B;  3T2M A;  2EIM B;  3MDS A;  3RGB A;  3RW0 A;  2XAH A;  4EB6 A;  5KHH A;  2OIE A;  4I0X B;  4F6R B;  1H38 A;  4JYC A;  4DUY B;  3CC2 V;  1EIY A;  1FXK B;  3A7A A;  5LBQ A;  4JTA B;  2WLN A;  2ZE5 A;  1GM8 A;  4O2B B;  4WFB V;  4WFG A;  2LQT A;  3A2F A;  3CPW U;  3TEH A;  4H2X B;  1Q5O A;  4TV9 A;  5EIB C;  2C2A A;  4I50 A;  3P32 A;  1D5A A;  3LSU A;  1RM1 C;  4RUE A;  2HNI A;  1RM1 B;  1WP7 A;  4JI4 B;  4JAA A;  2XTI A;  3SGI A;  3FFQ A;  3G6E V;  4PHZ A;  1J95 A;  2CE4 A;  4FLT A;  1VQN V;  5LXT B;  1N36 O;  1XMO O;  3HFV A;  1I5X A;  4LH6 A;  3BFR A;  1QU7 A;  1B6Q A;  4DW1 A;  5CB4 B;  4GT1 A;  1BL8 A;  1NQT A;  1KKD A;  4GUN A;  3H1J H;  4HNA B;  1L0W A;  4P75 A;  2ZTG A;  3IAL A;  2EBO A;  4OP0 A;  2JRI A;  1XIL A;  3H1H H;  4UVA A;  2WA3 A;  4KR3 A;  1Z7N A;  1N36 B;  2LW1 A;  4MTF A;  2E64 A;  2PYL A;  3ABM C;  2KSD A;  2EL9 A;  1V55 C;  2YIA A;  2ZDI C;  4J11 A;  2X7R B;  2ZT5 A;  5IY5 C;  4I5S A;  4YYE A;  2XT9 A;  2XHB A;  1SET A;  3E22 B;  4DV3 B;  2CTQ A;  4NTY A;  4EKW A;  2XND G;  1ZSP A;  2E75 B;  5L3C A;  3CJH A;  5BMV A;  2CTW A;  1XHX A;  4IYI A;  5K1P A;  1FD9 A;  1KYO F;  3TXS A;  3ZHR A;  2DU5 A;  3D36 A;  3M8A A;  4HT4 A;  2ZNI A;  4B3M B;  2HVJ C;  3D3I A;  3G4S V;  4UB6 Z;  4RO2 A;  2AZ2 A;  5KUM A;  5LOV B;  2PF4 E;  2IBZ H;  4LFA O;  4JI4 O;  3TUP A;  3AK1 A;  3FB6 C;  4FM0 A;  1Q7Y W;  3VQV A;  5B3S C;  2ZT6 A;  5FNV A;  1BBW A;  4JI0 B;  3CC7 V;  1Q6U A;  3OMA B;  4O4L A;  1ZAU A;  1GO3 F;  1JCH A;  5LHG A;  5C51 B;  2DTO A;  5IJ9 B;  3ZRW B;  2RJZ A;  4LP8 A;  1R1B A;  3MF2 A;  4UVC A;  5DED A;  4FLU A;  4H2Y A;  2EX3 A;  3CRA A;  4GKJ O;  4DR7 O;  1R3I C;  2CIM A;  2C8M A;  2N05 A;  5E1A C;  5GTI Z;  3AEI A;  1IBK O;  1OCZ C;  1NS1 A;  5IDJ A;  2RMK B;  4U3F H;  4EFE A;  3K58 A;  2DXU A;  4YRG A;  4J15 A;  4WFF A;  2ARS A;  4I0X A;  3NEL A;  4WF2 A;  4H2W A;  1KMM A;  5LP6 C;  2WAM A;  1GTO A;  1GRJ A;  1FXK A;  2ETN A;  5LMU B;  4O2B A;  1SQV H;  3FB8 C;  4FJC C;  3G71 V;  3TEH B;  3MQZ A;  2J3L A;  3W7X A;  1IXM A;  2DN9 A;  3RVZ A;  2XGT A;  1GGM A;  3A8T A;  2QEX V;  2QA4 V;  4PA7 A;  3R66 A;  1NH2 B;  1GAX A;  4LH7 A;  4DV6 B;  4YCU A;  3ZMS A;  2PZS A;  1BSM A;  4DR1 O;  5C8Y B;  2QWP B;  5LXT A;  1ADY A;  1FFT B;  1Q81 W;  2OCC C;  3A32 A;  1G6U A;  2DQ0 A;  2F4V B;  3CD6 V;  3T1C A;  4LF6 B;  3IJ4 A;  1CP9 A;  1FXH A;  4XU3 A;  1HC7 A;  1WU7 A;  5LHI A;  3H1K H;  4X62 B;  4P75 C;  3N2K B;  1QNM A;  1X2G A;  4HA8 A;  2HLD G;  4K87 A;  3SJQ C;  3ABK B;  3RFR A;  4FZ0 A;  1YIJ V;  11AS A;  1NJ1 A;  3I5D A;  1E24 A;  2EJR A;  4K88 A;  1OCZ B;  2XOK G;  2CTP A;  1KUQ A;  1IZ3 A;  2JIZ G;  2KB1 A;  1VQ4 V;  2GHY A;  1VQM V;  1HP8 A;  3E8B A;  5EC2 C;  4TVW A;  2DJZ A;  5BY1 A;  4HWT A;  4MVQ A;  4ZTU B;  4J7Z A;  1G51 A;  1M56 C;  3J80 N;  1NR7 A;  4NXN B;  2PI4 A;  4AI8 A;  1JQ0 A;  2E5L O;  1HTT A;  4PD4 F;  3JCZ A;  5DEC A;  2UUC B;  2RDC A;  1KEC A;  3V8J A;  3HY0 A;  2YI9 A;  5KHK A;  4H0L B;  3G67 A;  1S77 D;  3K5N A;  5LOV A;  1L8D A;  1N34 B;  1IBM O;  1WNS A;  4YY3 O;  1UPG A;  1IXB A;  4FPP A;  5CMU A;  2QTO A;  3SJB C;  1X56 A;  3CCE V;  4NXN O;  2VRZ A;  5EIB D;  5KMG A;  3CP1 A;  3BFM A;  4F4L A;  1JVM A;  1EN5 A;  3ABT A;  4LFB O;  3CCV V;  3QO8 A;  4O4L B;  2DKG A;  3RGL A;  2JJ1 G;  2HVK C;  3WG7 B;  4WJ3 M;  1PPJ H;  3ASN C;  2ILM A;  5IJ9 A;  1H8H G;  4CS3 A;  4NYK A;  3DC5 A;  1GN4 A;  4YRN A;  3ZRX A;  1VQO V;  1TUB A;  1OHH G;  4DPG A;  4Z1M G;  5GTH Z;  1EM1 A;  2B9Z A;  4NTW A;  5L3E A;  1XUQ A;  3NET A;  1BE3 H;  1XNR B;  2B5U A;  4I4T B;  2Y0I A;  3HPL C;  4R7C A;  4QE7 A;  1H2G A;  1EOV A;  1KKC A;  2YIB A;  4XBF A;  2QE7 G;  1K33 A;  3LSQ A;  4PDL A;  1Q82 W;  3ZCC A;  1WQW A;  2E65 A;  3P8T A;  3L74 H;  4FZ1 A;  2WA4 A;  3APO A;  2WLK A;  2QKA A;  1HNX O;  2HEP A;  4IHJ B;  4WFH A;  2RHQ A;  2V7Q G;  4XDJ A;  1FXV A;  2BOC C;  3L73 H;  1MSW D;  5B1B C;  1SER A;  3AG1 C;  3N27 A;  1XNQ B;  4YJ3 B;  4P72 C;  4FLX A;  3AG4 C;  4NVP A;  1JJO A;  3JSL A;  3OUF A;  4B7E A;  1N32 O;  3WG7 C;  4OX9 B;  3ICA A;  1J5E O;  3K5L A;  1LUW A;  2EJ9 A;  3WB2 A;  4LF4 B;  3A74 A;  2Q5Z A;  4DV3 O;  1WPX A;  3TK1 A;  5C8Y A;  3ML0 A;  4MVM A;  2JVD A;  2VWK A;  1SC5 B;  4JI3 O;  2DE0 X;  3OM3 B;  2Z5U A;  4P3N A;  1OCC C;  1MSD A;  2HFE C;  4Q15 A;  2EZO A;  2PGG A;  1WYD A;  2RNB A;  4J7K A;  3T1H B;  2HKO A;  1K8A W;  4D7T A;  4UCR A;  2WLL A;  5LYJ A;  3CHX A;  3OTO O;  4WFA V;  4YRM A;  2OTJ V;  3OD1 A;  3N2K A;  2W6J G;  1Q6I A;  3VQX A;  4DR1 B;  4JZG A;  1Z5V A;  4AH6 A;  2QHS A;  4E4E A;  3T4Z A;  2Q7G A;  4DV5 O;  4QNH B;  2DTH A;  1VQ7 V;  2P22 C;  1MAB G;  4NCX A;  4UCU A;  3RYF A;  3RAC A;  2NLJ C;  2E74 B;  5H2F Z;  3HFZ B;  3RIR A;  4R6Z A;  1KQS U;  1B76 A;  4X66 O;  4MVZ A;  1QLE C;  3JD3 A;  1RP3 B;  4H02 A;  4X62 O;  1VQ5 V;  1N8R W;  1OCO C;  4UCT A;  2DYS B;  2F66 C;  4E2L A;  5EZY A;  4TUY B;  1RPO A;  4DUZ O;  4H2V A;  3CSX A;  3BPZ A;  4PG3 A;  1VQ9 V;  2UXD O;  4UB8 Z;  3D8C A;  1S72 V;  1UFI A;  1XI1 A;  2QHV A;  4LWS A;  4NKG B;  3LC0 A;  2DWE C;  5KMG B;  2RHS B;  3H1L H;  4X20 A;  4FIP C;  4B3S B;  1CEZ A;  1E1Q G;  2WPD G;  3HKB B;  4DV1 O;  1I7F A;  4WBN A;  1S76 D;  4KXR A;  4FLW A;  5KHJ A;  3EFS A;  4JI5 B;  3D36 C;  3ABU A;  4GCZ A;  1K7D A; 
#chains in the Genus database with same CATH homology
 4BWA A;  4JI4 B;  1ATI A;  5CA1 B;  2XTI A;  3A7U A;  3QO5 A;  1USY C;  3SGI A;  3FFQ A;  4DR4 B;  4DUZ B;  2IM9 A;  4PHZ A;  1YFT A;  2CJ9 A;  4UCV A;  4FLT A;  4CS2 A;  1TUB B;  3DSQ A;  3UT5 B;  5LXT B;  5HGQ A;  4DV7 B;  1PYS B;  1C0A A;  4IIJ A;  3HFV A;  4G85 A;  5LMN B;  5KX5 A;  4O4J B;  5D5P A;  4LH6 A;  4I4T A;  4LVM A;  4X64 B;  3LSS A;  4HWO A;  1RSO A;  5CB4 B;  3HTZ A;  2HHH B;  4LVK A;  4HNA B;  1BIA A;  1L0W A;  4P75 A;  2ZTG A;  3IAL A;  2ALY B;  4LNS A;  1X2H A;  3I7F A;  3PCO A;  4K86 A;  3A5Y A;  4OP0 A;  2PYJ A;  3HY1 A;  2E41 A;  4IHJ A;  1JFF A;  3V7C A;  4KR3 A;  4YJ2 A;  1IL2 A;  1Z7N A;  1N36 B;  4P71 A;  1Q43 A;  4PI2 A;  2RHQ B;  2ZZG A;  5IYZ A;  2E64 A;  2PYL A;  4LVI A;  4DRX A;  4CS4 A;  2E10 A;  3G1Z A;  4JI7 B;  2EL9 A;  4DR2 B;  4FLV A;  3R07 A;  2YIA A;  1XHZ A;  5LP6 B;  4AQY B;  4YJ3 A;  4DR5 B;  3HXU A;  4X1K B;  2ZT5 A;  5KHI A;  1Z5W A;  5JJJ B;  2DU7 A;  2J3M A;  4TV8 A;  3V8K A;  3JAT B;  4YYE A;  5GON A;  4EEQ A;  3JAK B;  3QTC A;  2XHB A;  4YRF A;  1E1O A;  3E22 B;  4DV3 B;  1SET A;  2ART A;  3IAY A;  5C53 B;  2UXB B;  2VWJ A;  2YXL A;  3RWR D;  4YCV A;  5JQG A;  5JCO A;  3IG2 A;  2IY5 B;  3L1A A;  3U11 A;  5D5Q A;  2ZXF A;  3MEY A;  2Q0A A;  1X54 A;  4CH5 A;  2ZNJ A;  1HNX B;  5BMV A;  4E51 A;  4ZIB A;  1TVK B;  1XHX A;  2I4O A;  4B08 A;  2AKW A;  4B3T B;  12AS A;  5K1P A;  4XU0 A;  1H4V B;  2DU5 A;  2Q5I A;  1N9W A;  4GLX A;  4HT4 A;  1NYR A;  1EFW A;  4KR2 A;  5IJ0 A;  2E5A A;  2ZNI A;  4B3M B;  1J5W A;  1I94 B;  3ICX A;  5LOV B;  4XTY A;  5JH7 B;  4YRC A;  3RYC A;  5LYJ B;  4H2U A;  1BIB A;  3TUP A;  4LFB B;  1KMN A;  3P8V A;  4FM0 A;  4YCW A;  5FPO A;  3W3S A;  4EFB A;  3U10 A;  3VQV A;  4HBN A;  4X1Y B;  3HKC B;  4UP8 A;  4EO4 A;  4TQD A;  5ITZ B;  2ZT6 A;  5FNV A;  4YRQ A;  3A5Z A;  1BBW A;  4JI0 B;  1USY A;  3ETQ A;  2VQF B;  4DR7 B;  2V4D A;  4O4L A;  2DTI A;  3NEN A;  3BA9 A;  1VF7 A;  2DXT A;  1ZAU A;  3IKM B;  3HRK A;  5C51 B;  2DTO A;  4H2S A;  5IJ9 B;  1YFR A;  2RJZ A;  3RYF B;  1X01 A;  3MF2 A;  5J2T B;  1G5H A;  3HFZ A;  4YP0 A;  4O4H A;  4FLU A;  2ARU A;  1ASZ A;  1ASY A;  5CA0 A;  2NS6 A;  4H2Y A;  2QHT A;  1BBU A;  2EX3 A;  1FFX A;  2I4M A;  2PTM A;  1XQ8 A;  4XU2 A;  2P0L A;  2CAZ C;  3TEG A;  3RYI A;  1EVL A;  3LNN A;  4FFB B;  3RL6 A;  5EZY B;  4TUY A;  2CIM A;  4TOI A;  2C8M A;  3BAB A;  1WN7 A;  4PHC A;  4BW9 A;  1EQR A;  1QE0 A;  1O9H A;  1V9P A;  3BAA A;  3FJP A;  2PME A;  4GKK B;  3KFU A;  4JI8 B;  4D7S A;  4XTW A;  4EFE A;  3K58 A;  2DXU A;  3M4Q A;  4G84 A;  4YRG A;  2PUS A;  4J15 A;  2ARS A;  3A7R A;  3NEL A;  1Q8I A;  1JJC A;  2BTQ B;  4ZHQ A;  3CMQ A;  4H2W A;  1KMM A;  5LP6 C;  4WF2 A;  4DQ2 A;  5JJN B;  3SJA C;  4Q6G A;  4LF8 B;  4AIL C;  3JAR A;  1WLE A;  1X4T A;  4X66 B;  3MF1 A;  2RHS A;  2Q7E A;  5LMU B;  4O2B A;  4X20 B;  2GV9 A;  3U0Z A;  2DDZ A;  2DVE A;  2I4N A;  3HKB A;  3MQZ A;  3TEH B;  3B2E E;  4WBN B;  1J5E B;  2J3L A;  4L8J A;  2ZGW A;  4ZOL B;  2XGT A;  1GGM A;  3MAQ A;  4UCS A;  1YGB A;  3JAW B;  3SR2 C;  4YPF A;  3V8L A;  3OTO B;  4LH7 A;  3RF1 A;  2FYK A;  2ZR3 A;  4DV6 B;  4YCU A;  2QJ1 A;  2PZS A;  4LVJ A;  1RIQ A;  2ZM6 B;  1G5I A;  1KOG A;  5C8Y B;  4ZI7 B;  4X5O A;  5LXT A;  4YRR A;  1ADY A;  4IIJ B;  3PZC A;  4TTV A;  3A32 A;  1G6U A;  2F4V B;  2DQ0 A;  4DV5 B;  1FYF A;  4P73 C;  2AMC B;  3HKD B;  4LF6 B;  3RYH B;  3EFR A;  3L4G A;  2OWO A;  4YRO A;  4TVY A;  2DZ9 A;  3QG5 A;  1HXD A;  4YRP A;  4XU3 A;  1HC7 A;  1WU7 A;  3HXX A;  4CC6 A;  4YHH B;  2ZT7 A;  1SQF A;  1NT2 B;  3ZED A;  4X62 B;  5BR8 B;  2EJG A;  4P75 C;  1QHT A;  3N2K B;  4FM1 A;  4KQE A;  4XU1 A;  5IYZ B;  1X2G A;  4DK0 A;  4HA8 A;  1M4U A;  4I9Q A;  4K87 A;  5EYP A;  1X55 A;  1IBM B;  4KHP B;  1SA0 B;  1B70 A;  3RFR A;  4DK1 A;  11AS A;  4U3J A;  3SJC C;  4LF9 B;  1NJ1 A;  4P3P A;  4P71 C;  4HWP A;  4RMF A;  4X1K A;  1E24 A;  4TV8 B;  3M4P A;  4TVA B;  3JAT A;  3RKW A;  4K88 A;  1H4T A;  5JJE B;  3BHP A;  3RKY A;  5JVD B;  1B7Y B;  4HWS A;  2ZT8 A;  5JQG B;  3JAL B;  4TVW A;  2CJA A;  1IBL B;  2DJZ A;  1B8A A;  3E9I A;  4UPA A;  3QO7 A;  4HWT A;  4ZTU B;  1TVK A;  1P49 A;  4I55 B;  1G51 A;  4NXN B;  1YEW A;  4DV1 B;  4K8Z A;  1HTT A;  1M5I A;  2DEQ A;  3N2G A;  4LFC B;  3VQW A;  4CH6 A;  3QNE A;  2UUC B;  1E22 A;  3V8J A;  4H2T A;  3HY0 A;  2YI9 A;  4P74 A;  5KHK A;  5J2U A;  2JS5 A;  3REX A;  3K5N A;  2EAY A;  4CH4 A;  2E3C A;  5LOV A;  3REU A;  1L8D A;  2P5I A;  1N34 B;  5JH7 A;  1HNW B;  2ZZE A;  3HRI A;  4EB6 B;  2QM4 A;  3RYC B;  4LNU A;  5JCO C;  4X1I A;  3ZS8 C;  4F6R A;  1WNS A;  5LA6 B;  4DR3 B;  1H4S A;  1EIY B;  1DGS A;  1NYQ A;  4JV5 B;  2R9A A;  3SJB C;  1Q3E A;  1X56 A;  2DZC A;  4XTU A;  1ADJ A;  4X1Y A;  5EIB D;  5KMG A;  3BFM A;  2A8E A;  4EX5 A;  3ERR A;  3PN1 A;  3JSN A;  4XTX A;  4H2X A;  4O4I B;  4O4L B;  3QO8 A;  2ZIN A;  3JAS B;  4TV9 B;  2DKG A;  3V7R A;  3RGL A;  1Z7M A;  1O9G A;  3HKE A;  3UQ8 A;  1EVK A;  4P74 C;  4I50 B;  3VBB A;  4LR3 A;  1E1T A;  3HXW A;  4O2A A;  4WJ3 M;  2OYQ A;  4ZTZ B;  5IJ9 A;  4XEM A;  3WB0 A;  4TQF A;  4KL1 A;  2C7I A;  1XMO B;  5CA1 A;  2PMF A;  4CS3 A;  4XEO A;  4O4H B;  1JMK C;  1HNZ B;  1LYL A;  3BRC A;  5CA0 B;  2ODR C;  4YRN A;  4JI1 B;  1N32 B;  1TUB A;  3UT5 A;  4YDQ A;  5F5W A;  4DPG A;  1PYS A;  2E1H A;  4YRS A;  4TWA A;  5KX5 B;  4O4J A;  4FFB A;  3NET A;  4OLF A;  1XNR B;  4I4T B;  3HXY A;  1EOV A;  5CB4 A;  4LF7 B;  3UGQ A;  2YIB A;  1H2S B;  4HNA A;  3VQY A;  4K8X A;  3LSQ A;  2YI8 A;  1WQW A;  2ALY A;  3P8T A;  2E65 A;  3NEM A;  3PCO B;  3RUX A;  1W66 A;  1JJC B;  2JGU A;  2HEP A;  1JFF B;  2ZIO A;  4IHJ B;  4YJ2 B;  4CC5 A;  2ZR2 A;  2RHQ A;  2DQ3 A;  1S5J A;  4FVM A;  4FLZ A;  4DRX B;  5ELN A;  1B04 A;  4UP9 A;  4DV4 B;  3OTF A;  4YY3 B;  2BTO A;  1SER A;  5LP6 A;  4JI3 B;  1XNQ B;  3IKL A;  1QF6 A;  4YJ3 B;  2CJB A;  4P72 C;  2E5L B;  4FLX A;  4ZOL A;  4YRE A;  4NVP A;  5GON B;  5C52 B;  3JAK A;  3M7M X;  1JJO A;  3JSL A;  1IBK B;  5ELO A;  3E22 A;  3K5O A;  2R70 A;  3JAW A;  3WB1 A;  3WQZ A;  2EJF A;  4OX9 B;  4FM2 A;  3K5M A;  3ICA A;  3K5L A;  2EJ9 A;  1NJ2 A;  2IY5 A;  3WB2 A;  4K0K B;  4LF4 B;  3L2Z A;  1YB3 A;  2EWN A;  4AHC A;  3A74 A;  3HXZ A;  1H4Q A;  4YRK A;  3UFG A;  1SKV A;  5BMV B;  5C8Y A;  4ZI7 A;  1NJ5 A;  2AKW B;  2JVD A;  2VWK A;  4YRI A;  4DV0 B;  5FPR A;  3T1Y B;  4P3N A;  4JYA B;  4P73 A;  3V7S A;  5KNN A;  2F93 B;  4Q15 A;  4NXM B;  1VQZ A;  2AMC A;  2UUA B;  3HKD A;  2PGG A;  2UXD B;  4UCO A;  2UU9 B;  1WQ7 A;  2VQE B;  1SES A;  1WYD A;  3RYH A;  4L87 A;  4FLY A;  5IJ0 B;  2F1M A;  1NJ8 A;  3L4G B;  3T1H B;  1WPB A;  2KKW A;  1TAE A;  4UCR A;  4D7T A;  4JI6 B;  4HWR A;  5LYJ A;  3CHX A;  3K57 A;  4WJ4 A;  1WPY A;  1NNH A;  4YRM A;  2YIB D;  3N2K A;  3OD1 A;  5E3I A;  3THO A;  1HR0 B;  5IWA B;  3VQX A;  5KHG A;  3HKC A;  4DR1 B;  5ITZ A;  5FNV B;  5EYP B;  3UH0 A;  1Z5V A;  4LFA B;  3A31 A;  1SA0 A;  4GYC B;  4PI0 A;  1B70 B;  4AH6 A;  4RQE A;  4U3J B;  2R72 A;  2QHS A;  2ODR D;  1QQC A;  4XTV A;  2Q7G A;  2Q5H A;  1KMI Z;  3QF7 A;  2DTH A;  4TVA A;  2P22 C;  5K1X A;  1TA8 A;  1SRY A;  2ZCE A;  1XMQ B;  4NCX A;  4UCU A;  5JVD A;  1B7Y A;  1NJ6 A;  3RYF A;  3RAC A;  5J2T A;  2QHU A;  3RIR A;  3HFZ B;  3BJU A;  2RQ6 A;  2PY5 A;  3JAL A;  4DV2 B;  4WI1 A;  4CH3 A;  1B76 A;  2Q7H A;  3CB2 A;  4LF5 B;  3HXV A;  1FFX B;  4H02 A;  4LVL A;  4I55 A;  4UP7 A;  4P3O A;  4UCT A;  4P72 A;  4YRJ A;  2F66 C;  4X65 B;  2UXC B;  3RYI B;  2UUB B;  2CGH A;  5EZY A;  4TUY B;  3N2G B;  4JI2 B;  4XTZ A;  4GKJ B;  4RQF A;  4H2V A;  4YRT A;  3CSX A;  3BPZ A;  1WNL A;  5J2U B;  4O2D A;  4PG3 A;  1FJG B;  3RGB A;  4EB6 A;  4RDX A;  1SQG A;  5KHH A;  4LNU B;  1YFS A;  4X1I B;  2BTQ A;  4F6R B;  4ZHQ B;  5LA6 A;  3P8Y A;  4DUY B;  1EIY A;  2G4C A;  1XI1 A;  3JAR B;  1N33 B;  2QHV A;  3UGT A;  3A7A A;  1T5E A;  3RKX A;  2F95 B;  5KMG B;  2ZZF A;  3LC0 A;  2RHS B;  2P5O A;  4O2B B;  1KU9 A;  4X20 A;  4B3S B;  3K59 A;  2I4L A;  3A2F A;  3TEH A;  3HKB B;  4H2X B;  1I7F A;  4O4I A;  4WBN A;  1Q5O A;  3JAS A;  4TV9 A;  4UFZ A;  4B3R B;  1HW7 A;  1M93 A;  4DR6 B;  3HKE B;  3BA8 A;  5EIB C;  4I50 A;  4HVC A;  4O2A B;  1D5A A;  4FLW A;  3E9H A;  5KHJ A;  2HNI A;  3EFS A;  2ZIM A;  4JI5 B;  1TGO A;  4YRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...