2ZNIA

Crystal structure of pyrrolysyl-trna synthetase-trna(pyl) complex from desulfitobacterium hafniense
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
279
structure length
279
Chain Sequence
LSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEDHPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolysyl-tRNA synthetase
publication title Pyrrolysyl-tRNA synthetase-tRNA(Pyl) structure reveals the molecular basis of orthogonality
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase/rna
total genus 75
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2zniA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2zniA02
2G4CA 1L0WA 3UGTA 3TEHA 1G5IA 3RKWA 2DU5A 3RKYA 4P3NA 1H4TA 4XTZA 3M4PA 1NJ2A 4XTWA 1X01A 1EFWA 2YIBA 12ASA 2ODRD 1EVKA 1WQWA 1ASZA 1YFRA 4YRTA 1KMNA 2Q7GA 3IKLA 4P73C 4H2TA 3HXUA 3FJPA 1B70B 2Q7HA 1G51A 4HWSA 4XTYA 2PMFA 1J5WA 4OLFA 1EQRA 4TVAB 4YRNA 4DQ2A 3E9HA 4Q15A 2RJZA 5C53B 4YRKA 2CIMA 4YYEA 3REUA 4H2YA 3L2ZA 2YIAA 4P71A 2E10A 4LNSA 3LSQA 1SRYA 1HC7A 2E5AA 2JVDA 1E22A 3ICAA 3RIRA 1E24A 4P74C 2I4NA 4YP0A 2ZZEA 2AMCB 3BJUA 5K1PA 4HWTA 2DXUA 4KQEA 3BFMA 5KNNA 1SERA 4E51A 1SESA 3MF1A 2P0LA 4YDQA 3NETA 3RF1A 4RQFA 4YRJA 4TVYA 1NJ8A 4HWOA 3QTCA 2DDZA 4HA8A 3TUPA 1WPYA 1GGMA 1H4SA 4TQDA 2E3CA 4RMFA 3NENA 2ZNIA 3LC0A 2QJ1A 1YGBA 1B8AA 3A7UA 3NEMA 3HXVA 4XU0A 1USYA 2I4MA 2ZIOA 3UGQA 4UP8A 4YPFA 3CMQA 2DU7A 1WYDA 1EOVA 2DXTA 1B7YA 5E3IA 2AKWA 1PYSA 1YFSA 4YROA 3RGLA 1WQ7A 3V7CA 3A5YA 4L87A 2IY5B 3V8JA 2ZZGA 4P3OA 4P75C 3VQYA 4XTXA 4H02A 3NELA 2J3MA 1B76A 4YCWA 1WU7A 2I4OA 3HFZA 4PG3A 1E1TA 4TQFA 3PCOA 2ZZFA 1ASYA 4EX5A 4UP9A 3EFSA 3W3SA 4CH5A 4P72C 3VQWA 4RQEA 3TEGA 4DPGA 4TVWA 1BBWA 2CGHA 3LSSA 2ZNJA 1Z7NA 2C8MA 1C0AA 2ZT7A 3EFRA 2DTOA 4H2XB 2CJ9A 1HXDA 1SETA 4EO4A 1EIYB 1X2HA 2DZ9A 2RHQB 1ADYA 1NJ6A 3VQXA 2ZTGA 4XU3A 2EJGA 3PZCA 2PMEA 3A32A 4G84A 1E1OA 1Z7MA 4CS4A 2C7IA 2CJAA 4KR3A 1B70A 2YI9A 4H2SA 4XEOA 4YRRA 1JJCB 4TWAA 4TVAA 5C51B 3HTZA 1WNLA 3RUXA 3A7RA 2XGTA 3HRKA 2ALYB 2J3LA 1X56A 2E65A 3HXYA 3MF2A 2ZCEA 4P71C 4X5OA 3KFUA 2ARSA 4HWPA 3L4GB 1NJ5A 2ZT5A 1KMMA 2DQ0A 3QO7A 4K88A 4XTVA 3HY0A 4K86A 3V7SA 3RL6A 1ADJA 1NYQA 2I4LA 2AMCA 1BIBA 2ZT6A 4YCVA 3A31A 3MEYA 3UH0A 5ELNA 2RQ6A 3ZEDA 2ZXFA 1IL2A 1G5HA 2DTHA 1O9GA 3P8VA 4K87A 4O2DA 1NYRA 3RKXA 4WJ3M 3IG2A 4YRPA 1USYC 2PUSA 4HVCA 4YRSA 4WI1A 4NCXA 4AH6A 4H2VA 4KR2A 3V8LA 3R07A 1KOGA 4WJ4A 3QNEA 4HWRA 2Q5HA 4CS3A 4BW9A 2DVEA 2YIBD 1VQZA 2RHSB 3A5ZA 3WQZA 4YRFA 3E9IA 3RACA 3P8TA 4H2WA 4ZTUB 3IKMB 3VQVA 4CS2A 2IY5A 3TEHB 2PGGA 1NJ1A 3DSQA 4P72A 2DQ3A 4P3PA 3QO8A 2CJBA 1X55A 1LYLA 4YRCA 3HXZA 4UP7A 1FYFA 1WLEA 2ARUA 11ASA 4XU2A 2ZR3A 4Q6GA 3VBBA 4OP0A 2QHUA 1W66A 2P5IA 2Q5IA 4P73A 4YRMA 2QHVA 4H2XA 1EIYA 2ZT8A 2RHQA 4CH6A 2Q7EA 2QHTA 2ARTA 3G1ZA 4PHCA 1QF6A 2ZINA 2DEQA 1BIAA 1H4VB 2QHSA 3A74A 2ODRC 1JJCA 4ZTZB 5HGQA 2R70A 1EVLA 3REXA 2E1HA 3V7RA 4YRLA 4P74A 4YREA 2ALYA 1QE0A 2EAYA 3HXXA 4YRIA 1YB3A 4XTUA 3L4GA 1ATIA 2DTIA 4RDXA 3ERRA 2ZIMA 4UPAA 1X2GA 3HFVA 4WF2A 1NNHA 4XEMA 1BBUA 4YCUA 4YRQA 5C52B 4J15A 4H2UA 3HRIA 2HEPA 5F5WA 3BHPA 3OD1A 2EJFA 2HNIA 5K1XA 2E41A 1B7YB 1X54A 2AKWB 1PYSB 3QO5A 1RIQA 3L1AA 4ZIBA 2FYKA 3V8KA 2DKGA 2EL9A 3HXWA 3M4QA 2R72A 3UFGA 3IALA 2XTIA 3P8YA 4YRGA 2E64A 2ZR2A 3A7AA 4CH3A 2DJZA 5ELOA 1O9HA 3HFZB 4P75A 3PCOB 2EWNA 2EJ9A 1YFTA 4CH4A 1HTTA 1N9WA 3HY1A 2ZGWA 2DZCA 1H4QA 4G85A 4BWAA 2RHSA 2YI8A 1G6UA 4XU1A 4TTVA 3I7FA
chains in the Genus database with same CATH superfamily
4JI3O 3TEHA 3HKEA 3SPCA 1J5EO 1DF4A 1XOUA 4DV6O 3L9DA 3WB2A 1QR8A 1NJ2A 2Y48A 4JYBA 3GB7C 1Q6HA 4PJ0Z 4GLXA 2DYRC 3STLC 1Q5OA 3N2GA 2HJFC 1XEQA 1YFRA 3T1HO 1KMNA 1NVPD 1H8EG 3JSNA 4FMTA 4ZOLB 4EFBA 4KHPB 5L3CA 1B70B 4Z1VA 4JYAO 2DYSB 4XTYA 1EM1A 4JAVA 4OLFA 4I0XB 4GZRB 4YRNA 1B6QA 1OCCC 4Q15A 5FPRA 1CEZA 4ZI7A 4DO2A 3K04A 2CIMA 4ASUG 5CBGA 4MVZA 5LXTB 4YYEA 4H2YA 4QJFB 4MVUA 1G8MA 1SQFA 2E5AA 2P90A 5KAFZ 2JVDA 5IDJA 4LVIA 3ICAA 3LSUA 2EIKC 1YIJV 1WP8A 4GYCB 2AMCB 2DXUA 1OJHA 4DV4B 1XNQB 1SESA 1V54C 1IBMO 3MF1A 3ZCCA 1LUWA 5IE9A 4YDQA 1BHAA 4W4KA 4JI1B 1OZ0A 2CTQA 4TVYA 5H9CA 1EZJA 2W0XA 3H01A 3OTFA 4HA8A 1WPYA 3EHBB 1GGMA 1K34A 1SQPH 1HR0B 1PL0A 3NENA 3GWKC 4DR5O 4DR2O 5EC2C 3MAQA 4X65O 1MZEA 1M1KW 2QSAA 2WLJA 1L0LH 1USYA 2F93B 1L1FA 1XNRB 1HNZB 1U97A 1NU1H 3N2KA 3HKDB 5CB4B 3NXSA 3AG2C 2VQEO 5E3IA 1AVMA 1IBKO 2AKWA 1PYSA 1KP3A 4RUEA 3U10A 4LF6O 2LGQA 5EBLC 4WFBV 1KU9A 1BS3A 1PD3A 4EEQA 1W59A 5C93A 3LNMB 3K59A 4LF5B 3BAAA 2QR4A 1B3QA 3V8JA 1MZFA 4P3OA 4P75C 3VQYA 4U7OA 4O4JA 2ZE7A 2QTSA 2Q0AA 2EIMC 1VQ9V 4EX5A 2UUCO 1TA8A 1Q3EA 3VQWA 1FJGB 2P5OA 1MA1A 2Z0AA 2DYRB 3G4SV 3K03A 1BBWA 3RGBA 2ZNJA 2JEXA 1C0AA 3SPGA 1QNMA 1K7DA 1N4CA 3EFRA 4DR5B 1SZXA 2LJ2A 3JD3A 3CS5A 4X65B 1X2HA 3WB0A 3B40A 1ROPA 1IX9A 2PY5A 4JI5B 3DC5A 4XU3A 2UXDO 1OCCB 2EJGA 3BPZA 1OCOB 4P9OA 4U3JB 2GV9A 4HBNA 3CPWU 1Q90D 4LFBO 4X89A 2IU3A 4ZOLA 3SYQA 2WAMA 2LGWA 4KR3A 1B70A 5KA5A 2WLMA 3BCCH 4I0XA 3BA8A 2EX3A 1WNLA 1Z5VA 4UXNA 5HFLA 2ALYB 3CC7V 1FS0G 1NBMG 2Q68A 3SYPA 1DGSA 1PKXA 1PNLA 1VEWA 4P71C 5LXTA 2ARSA 4LF9B 3E86A 1TUBB 4MVRA 5LMUB 4MSWC 2DQ0A 1V54B 3S3WA 4WFHA 4PA7A 3RW0A 4XTVA 3W7WA 3TGUH 1WPXA 3BFRA 5CA0B 2Q6AA 4B3RO 2AMCA 2Y0IA 2X0LA 3ZS8C 2ZT6A 1YJNV 2N05A 2IJKA 3UH0A 2H94A 2FL4A 1NH2D 5KHKA 3ZEDA 1IL2A 3AG2B 1G5HA 1HNXO 3E35A 1O9GA 5LL6Y 4LFBB 4HNAB 4LH6A 3E8GA 3IG2A 4DV2B 2DOSA 4YRPA 1SS3A 2YSUB 3TCUA 3AG7A 4JI2O 4J9YB 3ZBHA 4H2VA 1SZTA 3HKDA 5CB4A 1M90W 2GTSA 3ZN0A 1GH6A 1SKVA 1KOGA 4YY3O 2EIMB 5JCOA 2Q5HA 4CS3A 2F1MA 1L8DA 2H8PC 1VQZA 1H2KA 4DV1B 3A5ZA 4FVMA 2FTKA 3W7UA 5LOVB 3CRMA 2QKSA 1FXVA 2OIGA 1FXKC 2L6LA 1JQ0A 3CMAV 4J41A 1T5EA 1S76D 1IDSA 2UU9O 2WA3A 4YRCA 2GSMB 11ASA 4XU2A 2ZR3A 1I5YA 2ZE8A 4GCZA 3E22B 4Q6GA 2NR5A 4LF8O 5B1NA 2QHUA 4O2AB 2P5IA 3LUTB 4N21A 4UCUA 2ZM6B 1JPXA 4YRMA 2CGNA 1K92A 2UXBO 2QHVA 4DV7B 4FK5C 2RN9A 2ZT8A 3CEIA 4WFFA 3ETDA 3JAWB 3CRAA 4EFEA 1GN4A 1H38A 2Q7EA 2CH7B 1S0VA 2ARTA 1R6TA 4DV5B 4X66O 3ABMC 4PHCA 5LHHA 3FB7C 1QF6A 5EC1C 2KKWA 4U3JA 4YY3B 4G2KA 2DE0X 3DXRB 1JMKC 2N74A 3APQA 3A74A 2F95B 1FAFA 2ODRC 2GHYA 1G4YB 4ZTZB 5HGQA 3T4ZA 4LVLA 1EVLA 3SJQC 2ALYA 1V55C 1QE0A 3EXAA 4BIOA 2PZSA 2YICA 4DUYB 2QWRB 5KHHA 1TUEB 1TUBA 3R65A 1I08A 3ZHRA 3KCYA 1Q8IA 4I5SA 1BT8A 1AI6A 2LQTA 2ZIMA 1UJWB 4UPAA 3B2EE 3FB5C 3CCLV 1NNHA 3ZMVA 1TGOA 4YRQA 4UVBA 5C52B 5CA0A 4MS2A 1H2NA 3ZHSA 4LVKA 1I0HA 5IY5C 3SJAC 1KQSU 4JV5B 1WA8B 4AHCA 2GTAA 4LF4B 3B8NA 4X64O 2XT9A 1V9PA 1B7YB 3T2MA 3E2EA 4QGPA 2CE4A 3OW2U 1G1XB 4HAMA 1QLNA 2XAJA 4K3AA 4LBEC 3HXWA 4HNAA 3K58A 4J42A 2V7QG 3JCUZ 3UFGA 4RUFA 2QWQB 3IALA 5DEDA 3PJSK 4UCTA 2UUBB 3FFQA 3I5DA 1Y74B 2F4VO 1O9HA 4X8AA 4P75A 3PCOB 1FXKB 1GMGA 3H1HH 2FB5A 3E8FA 1Q81W 3ETEA 1N9WA 3HY1A 1AP6A 4JI7O 2VWJA 3CXCU 1WNSA 2HLDG 2OTJV 1YTFB 4OX9B 2ODMA 5LOVA 1L0WA 4PD4F 3RKWA 2DU5A 4DR4B 1XMOO 1GRJA 4Z2WA 1H2MA 1HNWB 3HKCB 3QF7A 5B5EZ 4DR6O 3A0RA 4XTWA 4DRXB 2E75B 1NR1A 12ASA 2PI4A 4X64B 4YRTA 2JS3A 1GM9A 1XL6A 2Q7GA 3ABMB 4FFKA 3F7YC 3E22A 4O2AA 3UO3A 1W0JG 1H2GA 2A8EA 1Q6UA 1B04A 2ITDC 3CB2A 3K0DA 4JTAB 2XAHA 4HWSA 2PMFA 2B1GA 1EQRA 4DK0A 4TVAB 4WCEV 3MDSA 3E9HA 1IBLB 2DYSC 3JAWA 2UUAB 2RJZA 5C53B 2CH7A 3D36C 1V55B 2DWDC 1SC5B 3L2ZA 1U96A 2QEXV 2YIAA 3O65A 4NTXA 3DXRA 4P71A 1MMMA 1PPJH 1R6NA 3CHXA 4QE7A 3MD0A 1VARA 1E24A 3ASOC 1VQOV 2I4NA 1XMQO 1HDJA 5IWAO 5GTHZ 4UVAA 1GO3F 4BAYA 5KNNA 4IGGA 1WPBA 2ZT9B 4YRJA 1BSMA 2EIJB 3A8TA 2AW9A 2P4VA 1NT2B 4HWOA 3QTCA 3G67A 4QE9A 4TQDA 4E4EA 2W6JG 4I9WA 2LFRA 1B8AA 3NEMA 4KHPO 1QLEC 4XU0A 1Z5WA 3K79A 2UXCB 1JCHA 1WA8A 2CGOA 4EB6B 1OCRC 2HVKC 3B8MA 4YPFA 2DU7A 1WYDA 5IYBO 1COWG 4JAAA 2DXTA 5F2VO 1B7YA 4PI2A 4K8ZA 1XBLA 1YF2A 2HR3A 3SYCA 5H6RA 1IXBA 1RFYA 3AK1A 1AROP 3V7CA 4ICGA 3A5YA 2QE7G 3RYIB 4DR3O 2PI5A 1Y74A 2LO1A 4YCWA 1WJZA 1WU7A 3SJBC 4DXWA 1E1TA 3PCOA 3CX5F 1FXKA 2ZZFA 4LH7A 4CH5A 1GN2A 1N32B 3P32A 3TEGA 3TXQA 5FPOA 4YJ2B 3ZRWB 2P67A 3UM7A 3OGCC 4DV4O 3SR2C 1XNQO 2CGHA 3CRCA 2C8MA 3X2QC 4FLTA 5LGTA 4PA4A 4JI1O 4MTFA 1MABG 1HXDA 4EO4A 4PELA 3SJCC 3FB6C 1HR0O 3HKCA 2RHQB 3KKYA 4DRXA 3H9VA 3F5WC 3PZCA 4U7NA 2PMEA 2Q8VA 3A32A 4G84A 1ZWIC 1E1OA 1VQ6V 1XNRO 1HNZO 1KKCA 1JJOA 4UFZA 4O4HB 3IC7A 2CJAA 4WF9V 1OCOC 4FLXA 3PN1A 1Q82W 5KUMA 2QM8A 5KHIA 4P2ZA 1ZUQA 2YI9A 4H2SA 4YRRA 1JJCB 3SYAA 3LDDA 2YEVB 4GX5A 4LFAB 2QWNB 4TVAA 1WB7A 1Z2GA 2PTMA 4IL6Z 3RUXA 4DR3B 3ASOB 4WBNB 4LF5O 5IYDO 1AI5A 2WLNA 4J11A 3OEEG 5BMVB 3MF2A 2YXYA 1QCEA 3T1YB 1NS1A 4K88A 1FJGO 2QKAA 3V7SA 3SDLA 1VF7A 1NYQA 2I4LA 3H1IH 2A79B 1XI1A 5JWPA 3BRCA 4DW0A 1QLEB 4ZBMA 3HB3B 1YHQV 5ELNA 3P3PA 2QM7A 2Y4TA 1H8HG 1OCRB 3KCXA 4JI5O 3T1CA 4CBCA 2YIDA 3CCVV 2DTHA 4H44B 1Q7YW 4KL1A 3K0GA 5LP6C 3RKXA 1S3JA 3LDCA 2PYJA 4WJ3M 2WWWA 4JI4B 3BVOA 4LFCB 3UQ8A 4X9QA 4O2BB 3RYHB 4NR1A 4EB6A 4AH6A 3A2FA 4D7TA 4MTGA 4E2LA 2AHYA 2EJ7A 1NI8A 4DV0B 2VQFB 5KAIZ 4BW9A 3CCQV 2A3QA 2RHSB 2QGNA 3ZHUA 3FX7A 2YDEA 3EVKA 1RSOB 4LF9O 4YRFA 3RACA 4FLVA 5LMUO 3G80A 4ZTUB 3IKMB 3VQVA 4CS2A 3X2QB 3RYIA 5B1OA 3DSQA 2AZ2A 4P72A 4LVJA 2AXTZ 1XDCA 1R3IC 1LYLA 2E5LB 3RN4A 3HXZA 4UP7A 5LGNA 4YJ2A 3ZRWA 2ARUA 1SQGA 1OCZB 3ETGA 4O4IB 3IAYA 1KKDA 4FLZA 4F4LA 2Z5UA 4NXMB 3DGEA 4FPPA 3M7MX 1SQQH 5D5QA 3H1KH 4H33A 2VRZA 3OGIB 1EFRG 1F4NA 3SGIA 3L71H 4DV2O 2RHQA 4UUJC 3HKBB 1OHHG 3G1ZA 3JASB 4O4LB 1HWYA 3K5OA 4X1IB 4AI8A 2DEQA 4K8XA 3ML0A 3D36A 4O4HA 4DR1B 5JJEB 1THZA 4PI0A 2P6JA 4YJ3B 5J2UB 3TJTA 3JATB 2ZE6A 1JJCA 3ZN1A 2WLHA 2YEVA 4NTYA 2ZXWC 1Q86W 4GX2A 3CWBH 5HFMA 4DV1O 2E1HA 4XDLA 1E1RG 2QWPB 4F6RB 4YRLA 3N27A 4YREA 3ZIAG 5L3GA 2RMKB 2EAYA 3F5TA 5BMVA 4UCSA 2G38A 1K8AW 3FAVB 1BQZA 4FM1A 4RDXA 4H0LB 2YC0A 4UV9A 3AK3A 2OCHA 4FLUA 1KYOF 2XOKG 1KBHA 3HRIA 2HEPA 5LP6B 4B3SB 4DR7B 2ATKC 4IIJB 3BHPA 1N33B 4OXSA 5F5WA 2QKCA 4JI8B 3OD1A 2ZM6O 2EJFA 2HNIA 2P7TC 4DV7O 2HJDA 3ZRVA 3RFRA 2JJ1G 1M57C 5ITZB 2QM4A 3AG4C 1JVMA 2CAZC 1RIQA 3CCMV 2FYKA 2O57A 2Q0OC 4DV5O 1SQBH 4B3MB 1KC8W 3JD2A 4JPRA 3STZC 2XTIA 1KP2A 2E76B 3CSXA 4CH3A 4D6TH 3RT3C 1F7YA 5BXZA 3K3WA 4O2BA 1YTFD 3RYHA 3ZRSA 1D5AA 3JAKB 5D5PA 2IU0A 2JIZG 4QPKA 1N36B 4JI6B 4CH4A 2HFEC 5L3BA 4DUYO 2RHSA 4NTWA 3K06A 4XU1A 4TV8B 1RSOA 4TTVA 4J7ZA 1XHXA 2X6AA 3J7AU 2G4CA 2WLIB 3UGTA 2XNDG 1G5IA 4FJCC 1SQVH 2OWOA 1K97A 1TAEA 3W7SA 4XTZA 4BIUA 5JJJB 1RPRA 4GX1A 1X01A 2KB1A 1EFWA 2YIBA 3FB8C 4OGQB 1AJNA 2W0FC 5H5NA 1EVKA 2ODRD 5GW7A 1ASZA 2XAGA 4JV5O 4D7SA 2ZQMA 3IKLA 4LF4O 4O4IA 4P73C 4ZKIA 5KMGB 3RYCB 2UXNA 1VF6C 2LFSA 5FLXN 3CCSV 4PA9A 3ASNC 1J95A 2A06H 1WN7A 1J5WA 4JTCB 1NJIW 3VOUA 2WLLB 2OTLV 3DTUB 4DQ2A 5LGUA 3K5NA 1PNKA 4JYCA 2ZXWB 4YRKA 3HKBA 4DYLA 4XDKA 3NR7A 2UUBO 2NS6A 3JASA 4O4LA 3E8BA 4X1IA 3BABA 2JGUA 5KHJA 3ABUA 4LNSA 2AGAA 5GONB 2VS0A 1SRYA 1HC7A 3WB1A 2Q9LA 4YJ3A 5J2UA 1IURA 3AEIA 3ABKC 3JATA 4X20B 2IM9A 1L0NH 3RIRA 1K3EA 3C3SA 3C90A 4XBFA 4F6RA 3OAAG 4OX9O 4HWTA 1QVGU 3OR7C 4KQEA 1XUQA 4PDRA 3SPHA 3JD4A 4E51A 4DR4O 3ZX6A 3WU2Z 1HNWO 3FAVA 4K0KB 3OM3B 4MTOA 3D3IA 1NJ8A 1M57B 5A2QN 3AG4B 2EIJC 1NZ6A 3E89A 2XAQA 1FPOA 3LNNA 3SPJA 1H4SA 3TUPA 1XL4A 2E3CA 2QTOA 3LC0A 1YGBA 5LP6A 4IIJA 2HG5C 5CBFA 5CA3A 4JASA 4RWUA 2OIEA 2BSKB 2F66C 1R6KA 2JGDB 1EOVA 1EZVH 5ITZA 1IBLO 2JS5A 2UUAO 4I50B 3ABLB 1YFSA 3ABTA 2HHHB 3RGLA 4HT4A 5IJ0B 4X1KB 5LYJB 2JJ2G 2HP8A 4AQYB 2DWEC 4RO2A 1GN6A 2ETNA 2HVJC 4JYYA 2ZZGA 4XTXA 1YJWV 4DK1A 4H02A 3NELA 2J3MA 3ZHQA 2ADQB 4YHHB 4PG3A 1MOFA 3JAKA 1E79G 1Y76B 2CTRA 2E74B 1B06A 1S77D 2B1IA 2Q69A 4P72C 4UCOA 3CD6V 1N34B 4JGSA 4DPGA 3P3NA 3K08A 4LF7B 3D3QA 4TV8A 1Z7NA 4DW1A 5LBQA 2AHZA 2XAFA 2MK3A 4NYKA 3AG1B 2WLIA 2BOBC 1FFXB 1Q43A 3CRRA 1EIYB 4H37A 1K9MW 4CZZA 3L70H 1R1BA 1UFIA 2Y0PA 1VQKV 3ASNB 5CMUA 1H2LA 3ZRXA 2DZ9A 2K1EA 1NJ6A 3K5MA 1N0JA 2ZTGA 1K33A 1EN5A 1AI7A 2UXCO 3ETQA 1R73A 2LP7A 2OT5A 2RCVA 5KMGA 4MVQA 5DM6V 3L72H 4PV1B 4WFGA 1VQ7V 4B7EA 4J9ZB 2ZDIC 4TWAA 3SPIA 5J2TB 5FL7G 5C51B 2WLLA 3ABKB 1S72V 4Z1MG 3CXHF 5B66Z 1QBZA 2EBOA 3L74H 3HRKA 5GTIZ 1IZ3A 2J3LA 2E65A 4JTDB 3HXYA 2GDSA 1D5NA 5KX5B 3KFUA 3BEHA 4HWPA 1NJ5A 2ZT5A 1K73W 3JSLA 4FLWA 2QA4V 5GONA 1CPYA 1AR5A 1GK9A 4X62B 4PA3A 1N32O 3UO2A 3HY0A 1XHZA 4X20A 5IT9N 4K86A 3OMIB 3RL6A 1WAZA 5EZYB 1ADJA 3RBZA 1GN3A 2R9RB 4NKGB 1BIBA 4JI0B 2NNUA 2EZPA 4BIZA 1YSCA 4CC5A 2XHBA 2ZKOA 1FYJA 3QG5A 3MEYA 1I7FA 1VQ5V 3I55V 5EIBC 1VF5B 2QWOB 4MVOA 5BR8B 3P8VA 4O2DA 1NYRA 1Y6XA 3I56V 3ICXA 1P49A 2IBZH 4HVCA 5J9PC 2XASA 4GKKB 5LA6B 3CCJV 4KXRA 4LFAO 2BSKA 3V8LA 2JGDA 3R07A 4I50A 1VIBA 5CBHA 5JQGB 4HWRA 2DVEA 2YIBD 1ENVA 5IJ0A 5IJ9B 4X1KA 4FFBB 1M5IA 3APOA 5LYJA 5BZBA 1VQMV 1WB8A 4GX0A 4LR3A 2IW5A 3T1YO 1P7GA 1R3JC 4MVMA 3KG2A 2PGGA 1NJ1A 5LMNB 1D2DA 1YCIA 3JALB 2DQ3A 3W7XA 4P3PA 3QO8A 2CJBA 1BGYH 1Y76A 3JCZA 1X55A 4NXNB 4GKJB 4BW5A 2LW7A 1WLEA 3G71V 3C3TA 2Y69B 4OP0A 1E1QG 2YXHA 3JD1A 1QR9A 1TVKB 1OCZC 4UV8A 2Q5IA 4P73A 5EBWC 1VF6A 4B3TB 5IYCO 2X6BA 5EYPB 1FFXA 1GKFA 1EIYA 2CK3G 1US6A 2JEUA 3ZMZA 4JI4O 1VQPV 4CH6A 3CC4V 1X59A 4LFCO 3FYIB 1F23A 4Q20A 4DV3O 5L3FA 2BTOA 2X7RB 2ZINA 4TUYB 1SA0B 4X1YB 1BIAA 4CC6A 3L73H 2EILC 2ARHA 5L3DA 1X4TA 4DV0O 3OTOB 2VQFO 5J2TA 3REXA 4YIPA 1BHBA 3V7RA 3ZMSA 1VMGA 4KFMA 2L35A 5EBMC 3RWRD 1QU7A 3HXXA 4G28B 4YRIA 2GUZB 5KX5A 3TETA 1AB3A 4NVPA 1PM9A 1ATIA 2DTIA 3K9SA 2YUAA 4LNUB 3OD4A 4IT5A 4JI3B 2E5LO 1J5EB 1X2GA 1LR1A 3ERRA 1KECA 4U3FH 3G6BA 4WF2A 1HP8A 4DV6B 4XEMA 1VQ8V 5EZYA 4NB5A 2UXXA 4B08A 4H2UA 1F4MA 4R7CA 4F6EA 3OMNB 4NXMO 4FIPC 2A7WA 3T1HB 5K1XA 3K5LA 1W2BU 1JR9A 3CP1A 3OMAB 2NN4A 3JD0A 4P30A 4DV3B 5C8YB 5LHIA 3L1AA 4JYAB 2RDCA 3IJ4A 1M56B 2LW1A 3OFNG 1P84F 3UKMA 1XREA 2EL9A 4IHJB 3M4QA 4DR1O 4YRGA 2E64A 2ZR2A 2WA4A 2KSDA 1AP5A 2N04A 4ZHQB 5ELOA 1HW7A 5LA6A 2JRIA 1BQ0A 1QQCA 2A0LA 3HFZB 3MHSC 5FNVB 4KP4A 3U0ZA 2EZOA 1GTOA 4FZ0A 5JQGA 1HTTA 2ZGWA 1H4QA 3OR6C 4BWAA 4EKWA 4FFBA 5IJ9A 1G6UA 4MVSA 1MSWD 2F23A 2C2AA 4PDLA 1NTZH 4TSFG 3DC6A 3RKYA 3E8HA 4P3NA 1IBMB 1H4TA 2DW4A 3JALA 3M4PA 3A0BZ 1MSDA 1VQNV 2WLKA 4KUMA 4B3SO 4DR7O 2JK5C 1GAXA 1N33O 1XQ8A 4FM2A 4JI8O 1WQWA 2DJVA 2H3OA 1QHTA 1AJQA 5JVDB 4DR2B 2EJRA 1KB9F 4H2TA 1YJ9V 3HXUA 1OV9A 3FJPA 3Q4HB 1TVKA 3CJHB 2OYQA 2Q7HA 1CP9A 2X6CA 1G51A 2EILB 5EYPA 1EN6A 4B3MO 2VQEB 2BTQB 2P06A 2ZDIA 1IBKB 1DLBA 1NVPB 3U11A 2M7WA 3CE2A 1JJ2U 4LF6B 3ZJZA 2KG7B 4TUYA 5DN6G 5EK0A 3REUA 1SA0A 5H2FZ 4X1YA 5KHGA 2V4DA 3CCUV 2E10A 4WBNA 3LSQA 2IJJA 3K57A 2Q5ZA 2EIKB 1N36O 4JI6O 5TISZ 1SF9A 1E22A 4BR6A 4P74C 1FFTB 4R6ZA 2UUCB 1UPGA 4YP0A 2ZZEA 3BJUA 1ZTEA 1M9NA 5K1PA 1VQLV 3K9AA 3BFMA 2GUZA 1SERA 1JOYA 1JA8A 3RVYA 4PHZA 2P0LA 3NETA 4RQFA 3RF1A 2M6YA 1P7BA 1NTKH 4AILC 1URFA 5B1AC 2A9HA 2CTWA 4LNUA 2DDZA 3B4SA 1AR4A 4RMFA 1IVSA 2ZNIA 4QPJA 2P4KA 2QJ1A 1H2SB 5B1BC 2FYUH 2JDIG 1EBOA 3B77A 3M99B 2UXDB 4LCUC 3A7UA 3HXVA 2I4MA 2ZIOA 1Y4MA 3IFXA 3UGQA 1K5QA 4UP8A 4IYIA 2HKOA 2IH1C 2IJHA 1ORQC 2YS8A 5KUKA 3CMQA 1ZSPA 1YDXA 4J80A 1AJPA 2ILMA 5C8YA 4J7JA 4YROA 4YIOA 2Q4PA 3OE7G 1WQ7A 4GUNA 3ABLC 3O9OA 4IHJA 3R66A 1AILA 4I4TB 3RYFB 5JH7B 3THOA 3JYCA 2B5UA 4TV9B 2F43G 2PF4E 4L87A 1YI2V 4OPAA 2IY5B 4G27B 4ZHQA 2B9ZA 5E1AC 3OEHG 1NQTA 1BMFG 1B76A 2I4OA 2OCCC 3HFZA 5FNVA 4TQFA 2CUGA 1P4RA 1ASYA 1EN4A 4HYOA 4TOIA 3EFSA 4UP9A 3W3SA 1IXMA 4RQEA 3OUSA 1R3LC 1M93A 4UB8Z 4TVWA 1BZKA 2R9IA 2BOCC 4B3RB 3P30A 3LSSA 2GBOA 3BA9A 3TXSA 4K0KO 2ZT7A 2WSSG 2DTOA 4MW3A 4H2XB 4I7ZB 2CJ9A 1SETA 3M8AA 1JFFB 4P9PA 4J7KA 3AG1C 3UT5B 1KMIZ 2YXLA 1ADYA 2VWKA 3VQXA 1DF5A 1HNXB 4B7KA 4RAIA 4YXWG 3JARB 1PP9H 4FZ1A 5JVDA 1Z7MA 3OUFA 4CS4A 2C7IA 4LC1A 1WP7A 4JI2B 1DK1A 5CA1B 3Q4HA 1XILA 1NTMH 4JAUA 4I55B 3CJHA 1RPOA 3CC2V 4XEOA 2HHHO 3WFVA 1S5JA 1YZBA 4K35A 3E83A 3HTZA 2BTQA 4C7UA 3A7RA 3W7TA 2XGTA 4AQYO 1X56A 4LVMA 1MNGA 2KG7A 2ZCEA 2K9PA 4X5OA 4WFEA 4PA6A 3L4GB 4YHHO 1I94O 1RP3B 1YEWA 1KMMA 3GWOA 3QO7A 5B3SC 1YVWA 5IWAB 3ZMTA 3SYOA 5B1AB 1N34O 5BY1A 3JAMN 3ZMUA 2NLJC 4ABMA 4LF7O 2UU9B 2FMLA 5B1BB 1VP7A 1QVFU 4YCVA 1ZX3A 3A31A 2D2CB 2PYLA 4LF8B 1MG1A 4W4LA 5IYZB 1JX9A 2RQ6A 4UCRA 2ITCC 3F7VC 2ZXFA 3J81N 3FD9A 3H1JH 2UXBB 3CRQA 4K87A 2EINC 4HZ3A 4LWSB 5DECA 1S5LZ 4IYHA 1AR1B 1USYC 2PUSA 4YRSA 2MW2B 3WG7C 4X66B 4WI1A 1NH2B 1FKAO 1K4DC 3J80N 2ADPA 4NCXA 1W0KG 4MW8A 1PNMA 4KR2A 5CN0A 3ZHTA 4TT3G 2QDOA 2OCCB 4WJ4A 4TWKA 4XDJA 1BE3H 2BCCH 3QNEA 2RNBA 2EULA 2IH3C 1I94B 4GT1A 4I4TA 3RYFA 3WQZA 3EFFK 5JH7A 3CCRV 1ZL8B 3E9IA 3P8TA 4H2WA 4R50A 2Z3YA 4TV9A 3MQZA 2IY5A 3TEHB 3HKEB 4X62O 5LHGA 4J10A 3AG3C 1N8RW 1YITV 1A32A 2Y4UA 1SQXH 2BE3A 1LNQA 1Q6IA 3N2GB 4JI0O 4DUZO 1FYFA 3GVMA 3CYOA 1RM1C 1I5XA 3ZHVA 3T4DA 3VBBA 2KQXA 3B09A 1W66A 2DN9A 4FM0A 2Y69C 1ZLZA 3TK1A 3CMEV 1R3KC 4R8CA 4H2XA 5BR8O 1JFFA 3RYCA 4WFAV 1KUQA 4JZGA 3UT5A 1K5SA 4ZI7B 5H6QA 2QHTA 2XUMA 2CTPA 3CCEV 1M4UA 1VQ4V 1FXHA 4H13B 4GKKO 1GM8A 3FKSG 2ZE5A 3IGAC 3JARA 1H4VB 2IJIA 1K4CC 5CA1A 2QHSA 4I55A 2F4VB 3MHHC 1NKDA 5B3SB 2R70A 4PDVA 1Y66A 2FKXA 5EIBD 3KZIZ 5L3EA 4P74A 4OPHA 4JF3A 3QVNA 4A5UB 1YB3A 5LMNO 1AI4A 3HPLC 4FLYA 4XTUA 4PDMA 4JI7B 2Q73A 3L4GA 4MT8A 3OT7A 4DUZB 1NR7A 4NXNO 2W6IG 2P22C 4GKJO 5KA6A 3HFVA 3G6EV 1BL8A 4JZ2A 1XMOB 1GM7A 1BBUA 4YCUA 5IY5B 4DR6B 4J15A 2EINB 3UCSC 2R9AA 5AG2A 3LDEA 4L8JA 1BCCH 3RVZA 3WG7B 4B3TO 2E41A 3N2KB 1Y67A 2ZD9A 4MTXA 5IYZA 1X54A 2AKWB 4N23A 1PYSB 3QO5A 2XTAA 4X88A 4ZIBA 3FYEB 3V8KA 4UB6Z 2DKGA 2Q67A 1ZAUA 1PL4A 2AZ0A 4LWSA 2R72A 4LP8A 5KLVH 1M56C 3P8YA 4UCVA 3A7AA 2DJZA 4I9QA 4O4JB 3AK2A 3OTOO 1KD1W 1LUVA 3HR0A 3D8CA 4QIWF 3BY6A 1DTOA 1F51A 5A9GA 1N0NA 2EWNA 3AG3B 5JCOC 2EJ9A 2D3OW 1PV0A 2WPDG 1YFTA 5JJNB 1CXZB 1S5HC 1YXBA 2DZCA 4QNHB 4G85A 1FD9A 2YI8A 3H1LH 3A0HZ 3S3XA 1ZL8A 1XMQB 1RM1B 2CDYA 4UVCA 3I7FA 3L75H 2V1DA 2DMXA 5E79Z 3IC9A
chains in the Genus database with same CATH topology
2G4CA 5LOVA 1L0WA 3UGTA 3TEHA 1G5IA 3HKEA 3RKWA 2DU5A 2OWOA 4DR4B 3RKYA 4P3NA 1TAEA 1IBMB 1H4TA 1HNWB 3WB2A 4XTZA 3HKCB 3JALA 3QF7A 3M4PA 1NJ2A 5JJJB 4XTWA 1X01A 4DRXB 1EFWA 2YIBA 4GLXA 12ASA 1XQ8A 2ODRD 1EVKA 1Q5OA 3N2GA 4FM2A 4X64B 1WQWA 1ASZA 1YFRA 4YRTA 1QHTA 1KMNA 4D7SA 2Q7GA 5JVDB 4DR2B 3JSNA 3E22A 3IKLA 4O4IA 4P73C 4ZOLB 5KMGB 3RYCB 4EFBA 4O2AA 4H2TA 3HXUA 3FJPA 4KHPB 1TVKA 2A8EA 1B70B 2OYQA 2Q7HA 1B04A 3CB2A 1G51A 5EYPA 4HWSA 4XTYA 1WN7A 2PMFA 1J5WA 4OLFA 1EQRA 4DK0A 4TVAB 4YRNA 4DQ2A 3E9HA 2VQEB 2BTQB 3K5NA 1IBLB 4Q15A 5FPRA 3JAWA 1IBKB 2UUAB 2RJZA 4ZI7A 5C53B 4YRKA 3HKBA 2CIMA 3U11A 3JASA 2NS6A 4O4LA 4LF6B 4X1IA 5LXTB 4TUYA 4YYEA 3REUA 4H2YA 3L2ZA 1SA0A 3BABA 4X1YA 5KHGA 2JGUA 2YIAA 5KHJA 4P71A 2V4DA 2E10A 4LNSA 4WBNA 5GONB 3LSQA 1SRYA 1SQFA 3K57A 1HC7A 2E5AA 3WB1A 4YJ3A 5J2UA 2JVDA 4LVIA 3JATA 3CHXA 4X20B 2IM9A 1E22A 3ICAA 3RIRA 1E24A 4P74C 2UUCB 4GYCB 2I4NA 4YP0A 2ZZEA 2AMCB 4F6RA 3BJUA 5K1PA 4HWTA 2DXUA 4KQEA 3BFMA 5KNNA 1SERA 4E51A 4DV4B 1XNQB 1SESA 1WPBA 4PHZA 3MF1A 2P0LA 4YDQA 3NETA 3RF1A 4RQFA 4YRJA 4K0KB 4AILC 4JI1B 4TVYA 1NJ8A 1NT2B 4HWOA 4LNUA 3QTCA 2DDZA 3OTFA 4HA8A 3LNNA 3TUPA 1WPYA 1GGMA 1H4SA 4TQDA 2E3CA 1HR0B 4RMFA 3NENA 2ZNIA 3LC0A 2QJ1A 3MAQA 1H2SB 1YGBA 5LP6A 2UXDB 1B8AA 4IIJA 3A7UA 3NEMA 3HXVA 4XU0A 1Z5WA 1USYA 2I4MA 2ZIOA 2UXCB 2F93B 1XNRB 3UGQA 1HNZB 4UP8A 4EB6B 3HKDB 3N2KA 5CB4B 4YPFA 3CMQA 2DU7A 2F66C 1WYDA 1EOVA 5ITZA 2DXTA 1B7YA 5E3IA 4PI2A 2JS5A 2AKWA 4I50B 5C8YA 1PYSA 3U10A 1YFSA 4K8ZA 2HHHB 4YROA 3RGLA 4HT4A 1WQ7A 5IJ0B 4X1KB 4IHJA 4I4TB 3RYFB 1KU9A 5LYJB 5JH7B 4EEQA 3THOA 3V7CA 4TV9B 4AQYB 3K59A 4LF5B 3BAAA 3A5YA 4L87A 2IY5B 3V8JA 2ZZGA 3RYIB 4ZHQA 3VQYA 4P3OA 4P75C 4XTXA 4DK1A 4O4JA 4H02A 3NELA 2J3MA 1B76A 4YCWA 1WU7A 2Q0AA 4YHHB 2I4OA 3SJBC 3HFZA 5FNVA 1E1TA 4PG3A 4TQFA 3JAKA 3PCOA 2ZZFA 1ASYA 4EX5A 4TOIA 3EFSA 4UP9A 3W3SA 1TA8A 1Q3EA 4LH7A 4CH5A 4UCOA 3VQWA 4P72C 1N32B 1FJGB 4RQEA 2P5OA 3TEGA 5FPOA 4YJ2B 1N34B 4DPGA 1M93A 4TVWA 3SR2C 3RGBA 4LF7B 1BBWA 4B3RB 2CGHA 3LSSA 2ZNJA 4TV8A 3BA9A 1Z7NA 2C8MA 1C0AA 4FLTA 2ZT7A 3EFRA 2DTOA 4H2XB 2CJ9A 1FFXB 1Q43A 4DR5B 1HXDA 1SETA 4EO4A 1EIYB 1JFFB 3SJCC 4X65B 1X2HA 3WB0A 3HKCA 2DZ9A 3UT5B 1KMIZ 2YXLA 1ADYA 2RHQB 2VWKA 4DRXA 2PY5A 1NJ6A 4JI5B 3VQXA 3K5MA 2ZTGA 4XU3A 1HNXB 2EJGA 3PZCA 2PMEA 3A32A 4G84A 3ETQA 1E1OA 3BPZA 3JARB 4U3JB 2GV9A 4HBNA 5JVDA 1Z7MA 4CS4A 1JJOA 4UFZA 4O4HB 2C7IA 2CJAA 4ZOLA 5KMGA 4JI2B 4FLXA 3PN1A 5CA1B 4KR3A 4I55B 1B70A 5KHIA 2YI9A 4H2SA 4XEOA 4YRRA 1JJCB 4TWAA 1S5JA 4LFAB 5J2TB 4TVAA 5C51B 2PTMA 3BA8A 3HTZA 2EX3A 1WNLA 3RUXA 2BTQA 1Z5VA 3A7RA 2XGTA 4DR3B 3HRKA 2ALYB 4WBNB 2J3LA 1X56A 4LVMA 1DGSA 2E65A 5BMVB 3HXYA 3MF2A 2ZCEA 4P71C 4X5OA 5KX5B 3KFUA 5LXTA 2ARSA 4LF9B 1TUBB 4HWPA 3L4GB 1NJ5A 2ZT5A 5LMUB 1YEWA 3JSLA 4FLWA 3T1YB 1KMMA 2DQ0A 5GONA 3QO7A 4X62B 4K88A 4XTVA 3HY0A 1XHZA 4X20A 4K86A 3V7SA 3RL6A 5EZYB 1VF7A 1ADJA 1NYQA 2I4LA 5CA0B 2UU9B 1XI1A 2AMCA 3ZS8C 1BIBA 4JI0B 2ZT6A 4CC5A 2XHBA 3BRCA 4YCVA 3A31A 3QG5A 3MEYA 2PYLA 4LF8B 3UH0A 1I7FA 5ELNA 5IYZB 5EIBC 2RQ6A 4UCRA 3ZEDA 5KHKA 2ZXFA 1IL2A 2UXBB 1G5HA 2DTHA 5BR8B 1O9GA 3P8VA 4LFBB 4K87A 4HNAB 4O2DA 4KL1A 4LH6A 1NYRA 5LP6C 3RKXA 2PYJA 3IG2A 4WJ3M 4DV2B 4YRPA 3ICXA 1P49A 2PUSA 4JI4B 1USYC 4HVCA 4YRSA 4LFCB 4X66B 4WI1A 3UQ8A 4GKKB 4O2BB 5LA6B 3RYHB 4NCXA 4EB6A 4H2VA 4AH6A 4KR2A 3HKDA 5CB4A 3A2FA 4D7TA 3V8LA 3R07A 1SKVA 1KOGA 4WJ4A 4I50A 5JQGB 4DV0B 5JCOA 3QNEA 4HWRA 2Q5HA 4CS3A 2VQFB 4BW9A 2F1MA 1I94B 2DVEA 1L8DA 2YIBD 5IJ0A 5IJ9B 4X1KA 4FFBB 1VQZA 1M5IA 4DV1B 4I4TA 3RYFA 2RHSB 4FVMA 3A5ZA 4YRFA 5LYJA 5JH7A 3E9IA 3WQZA 3RACA 3P8TA 4FLVA 4H2WA 4TV9A 3MQZA 4LR3A 5LOVB 4ZTUB 3IKMB 3VQVA 4CS2A 2IY5A 3TEHB 3HKEB 2PGGA 3RYIA 1NJ1A 5LMNB 3DSQA 3JALB 4P72A 2DQ3A 4LVJA 4P3PA 1T5EA 2CJBA 3QO8A 1X55A 4NXNB 1LYLA 2E5LB 4GKJB 4YRCA 3N2GB 3HXZA 4UP7A 1FYFA 1WLEA 4YJ2A 2ARUA 11ASA 4XU2A 2ZR3A 1SQGA 3E22B 3IAYA 4O4IB 4Q6GA 3VBBA 4OP0A 2QHUA 1W66A 4O2AB 4FLZA 4FM0A 4NXMB 2P5IA 1TVKB 2Q5IA 4UCUA 2ZM6B 4P73A 3M7MX 4YRMA 5D5QA 2QHVA 4DV7B 4B3TB 4H2XA 5EYPB 1FFXA 1EIYA 1JFFA 2ZT8A 3SGIA 3RYCA 3UT5A 3JAWB 4EFEA 2RHQA 4ZI7B 4CH6A 2Q7EA 2QHTA 2ARTA 3HKBB 3G1ZA 4DV5B 4PHCA 3JASB 4O4LB 1M4UA 3K5OA 4X1IB 2BTOA 1QF6A 2ZINA 4TUYB 2KKWA 1SA0B 2DEQA 3JARA 4U3JA 4K8XA 4YY3B 4X1YB 1BIAA 4O4HA 4DR1B 1JMKC 4CC6A 1H4VB 5JJEB 4PI0A 5CA1A 2QHSA 4YJ3B 3A74A 4I55A 2F95B 5J2UB 1X4TA 3JATB 2ODRC 3OTOB 2F4VB 1JJCA 4ZTZB 5HGQA 2R70A 5J2TA 4LVLA 1EVLA 3REXA 5EIBD 2E1HA 3V7RA 4YRLA 4F6RB 4P74A 4YREA 2ALYA 1QE0A 2EAYA 3RWRD 2PZSA 3HXXA 4YRIA 5BMVA 1YB3A 4DUYB 4XTUA 5KHHA 5KX5A 4FLYA 4JI7B 4NVPA 4UCSA 1TUBA 3L4GA 4DUZB 1ATIA 1Q8IA 2DTIA 4FM1A 2P22C 4RDXA 4LNUB 2ZIMA 3ERRA 4JI3B 3B2EE 1X2GA 1J5EB 3HFVA 4UPAA 4WF2A 1NNHA 4DV6B 1XMOB 4XEMA 1BBUA 1TGOA 4YCUA 4YRQA 5C52B 5EZYA 4DR6B 4B08A 4FLUA 5CA0A 4J15A 4H2UA 3HRIA 2HEPA 5LP6B 4B3SB 4DR7B 4IIJB 5F5WA 3BHPA 1N33B 4LVKA 3SJAC 2R9AA 4JI8B 3OD1A 2EJFA 4L8JA 2HNIA 3T1HB 4JV5B 4AHCA 5K1XA 2E41A 3N2KB 4LF4B 3K5LA 3RFRA 5ITZB 2QM4A 1V9PA 5IYZA 1B7YB 1X54A 2AKWB 4DV3B 1PYSB 5C8YB 3QO5A 2CAZC 1RIQA 3L1AA 4ZIBA 2FYKA 3V8KA 4JYAB 2DKGA 1ZAUA 2EL9A 3HXWA 4HNAA 4IHJB 3K58A 4B3MB 3M4QA 2R72A 3UFGA 3IALA 2XTIA 3P8YA 4YRGA 4UCVA 4UCTA 2E64A 2ZR2A 3A7AA 3CSXA 2UUBB 3FFQA 4CH3A 2DJZA 4ZHQB 4I9QA 4O4JB 5ELOA 4O2BA 1HW7A 5LA6A 1O9HA 3RYHA 1QQCA 3HFZB 4P75A 1D5AA 5FNVB 3PCOB 3JAKB 5D5PA 3U0ZA 2EWNA 5JCOC 2EJ9A 1YFTA 1N36B 5JJNB 4JI6B 5JQGA 4CH4A 1HTTA 1N9WA 3HY1A 2ZGWA 2DZCA 1H4QA 4G85A 4BWAA 5IJ9A 2YI8A 4FFBA 2RHSA 1G6UA 4XU1A 4TV8B 1RSOA 2VWJA 1WNSA 1XMQB 4TTVA 1XHXA 3I7FA 5IWAB 4OX9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G4C A;  1L0W A;  3UGT A;  3TEH A;  1G5I A;  3RKW A;  2DU5 A;  3RKY A;  4P3N A;  1H4T A;  4XTZ A;  3M4P A;  1NJ2 A;  4XTW A;  1X01 A;  1EFW A;  2YIB A;  12AS A;  2ODR D;  1EVK A;  1WQW A;  1ASZ A;  1YFR A;  4YRT A;  1KMN A;  2Q7G A;  3IKL A;  4P73 C;  4H2T A;  3HXU A;  3FJP A;  1B70 B;  2Q7H A;  1G51 A;  4HWS A;  4XTY A;  2PMF A;  1J5W A;  4OLF A;  1EQR A;  4TVA B;  4YRN A;  4DQ2 A;  3E9H A;  4Q15 A;  2RJZ A;  5C53 B;  4YRK A;  2CIM A;  4YYE A;  3REU A;  4H2Y A;  3L2Z A;  2YIA A;  4P71 A;  2E10 A;  4LNS A;  3LSQ A;  1SRY A;  1HC7 A;  2E5A A;  2JVD A;  1E22 A;  3ICA A;  3RIR A;  1E24 A;  4P74 C;  2I4N A;  4YP0 A;  2ZZE A;  2AMC B;  3BJU A;  5K1P A;  4HWT A;  2DXU A;  4KQE A;  3BFM A;  5KNN A;  1SER A;  4E51 A;  1SES A;  3MF1 A;  2P0L A;  4YDQ A;  3NET A;  3RF1 A;  4RQF A;  4YRJ A;  4TVY A;  1NJ8 A;  4HWO A;  3QTC A;  2DDZ A;  4HA8 A;  3TUP A;  1WPY A;  1GGM A;  1H4S A;  4TQD A;  2E3C A;  4RMF A;  3NEN A;  2ZNI A;  3LC0 A;  2QJ1 A;  1YGB A;  1B8A A;  3A7U A;  3NEM A;  3HXV A;  4XU0 A;  1USY A;  2I4M A;  2ZIO A;  3UGQ A;  4UP8 A;  4YPF A;  3CMQ A;  2DU7 A;  1WYD A;  1EOV A;  2DXT A;  1B7Y A;  5E3I A;  2AKW A;  1PYS A;  1YFS A;  4YRO A;  3RGL A;  1WQ7 A;  3V7C A;  3A5Y A;  4L87 A;  2IY5 B;  3V8J A;  2ZZG A;  4P3O A;  4P75 C;  3VQY A;  4XTX A;  4H02 A;  3NEL A;  2J3M A;  1B76 A;  4YCW A;  1WU7 A;  2I4O A;  3HFZ A;  4PG3 A;  1E1T A;  4TQF A;  3PCO A;  2ZZF A;  1ASY A;  4EX5 A;  4UP9 A;  3EFS A;  3W3S A;  4CH5 A;  4P72 C;  3VQW A;  4RQE A;  3TEG A;  4DPG A;  4TVW A;  1BBW A;  2CGH A;  3LSS A;  2ZNJ A;  1Z7N A;  2C8M A;  1C0A A;  2ZT7 A;  3EFR A;  2DTO A;  4H2X B;  2CJ9 A;  1HXD A;  1SET A;  4EO4 A;  1EIY B;  1X2H A;  2DZ9 A;  2RHQ B;  1ADY A;  1NJ6 A;  3VQX A;  2ZTG A;  4XU3 A;  2EJG A;  3PZC A;  2PME A;  3A32 A;  4G84 A;  1E1O A;  1Z7M A;  4CS4 A;  2C7I A;  2CJA A;  4KR3 A;  1B70 A;  2YI9 A;  4H2S A;  4XEO A;  4YRR A;  1JJC B;  4TWA A;  4TVA A;  5C51 B;  3HTZ A;  1WNL A;  3RUX A;  3A7R A;  2XGT A;  3HRK A;  2ALY B;  2J3L A;  1X56 A;  2E65 A;  3HXY A;  3MF2 A;  2ZCE A;  4P71 C;  4X5O A;  3KFU A;  2ARS A;  4HWP A;  3L4G B;  1NJ5 A;  2ZT5 A;  1KMM A;  2DQ0 A;  3QO7 A;  4K88 A;  4XTV A;  3HY0 A;  4K86 A;  3V7S A;  3RL6 A;  1ADJ A;  1NYQ A;  2I4L A;  2AMC A;  1BIB A;  2ZT6 A;  4YCV A;  3A31 A;  3MEY A;  3UH0 A;  5ELN A;  2RQ6 A;  3ZED A;  2ZXF A;  1IL2 A;  1G5H A;  2DTH A;  1O9G A;  3P8V A;  4K87 A;  4O2D A;  1NYR A;  3RKX A;  4WJ3 M;  3IG2 A;  4YRP A;  1USY C;  2PUS A;  4HVC A;  4YRS A;  4WI1 A;  4NCX A;  4AH6 A;  4H2V A;  4KR2 A;  3V8L A;  3R07 A;  1KOG A;  4WJ4 A;  3QNE A;  4HWR A;  2Q5H A;  4CS3 A;  4BW9 A;  2DVE A;  2YIB D;  1VQZ A;  2RHS B;  3A5Z A;  3WQZ A;  4YRF A;  3E9I A;  3RAC A;  3P8T A;  4H2W A;  4ZTU B;  3IKM B;  3VQV A;  4CS2 A;  2IY5 A;  3TEH B;  2PGG A;  1NJ1 A;  3DSQ A;  4P72 A;  2DQ3 A;  4P3P A;  3QO8 A;  2CJB A;  1X55 A;  1LYL A;  4YRC A;  3HXZ A;  4UP7 A;  1FYF A;  1WLE A;  2ARU A;  11AS A;  4XU2 A;  2ZR3 A;  4Q6G A;  3VBB A;  4OP0 A;  2QHU A;  1W66 A;  2P5I A;  2Q5I A;  4P73 A;  4YRM A;  2QHV A;  4H2X A;  1EIY A;  2ZT8 A;  2RHQ A;  4CH6 A;  2Q7E A;  2QHT A;  2ART A;  3G1Z A;  4PHC A;  1QF6 A;  2ZIN A;  2DEQ A;  1BIA A;  1H4V B;  2QHS A;  3A74 A;  2ODR C;  1JJC A;  4ZTZ B;  5HGQ A;  2R70 A;  1EVL A;  3REX A;  2E1H A;  3V7R A;  4YRL A;  4P74 A;  4YRE A;  2ALY A;  1QE0 A;  2EAY A;  3HXX A;  4YRI A;  1YB3 A;  4XTU A;  3L4G A;  1ATI A;  2DTI A;  4RDX A;  3ERR A;  2ZIM A;  4UPA A;  1X2G A;  3HFV A;  4WF2 A;  1NNH A;  4XEM A;  1BBU A;  4YCU A;  4YRQ A;  5C52 B;  4J15 A;  4H2U A;  3HRI A;  2HEP A;  5F5W A;  3BHP A;  3OD1 A;  2EJF A;  2HNI A;  5K1X A;  2E41 A;  1B7Y B;  1X54 A;  2AKW B;  1PYS B;  3QO5 A;  1RIQ A;  3L1A A;  4ZIB A;  2FYK A;  3V8K A;  2DKG A;  2EL9 A;  3HXW A;  3M4Q A;  2R72 A;  3UFG A;  3IAL A;  2XTI A;  3P8Y A;  4YRG A;  2E64 A;  2ZR2 A;  3A7A A;  4CH3 A;  2DJZ A;  5ELO A;  1O9H A;  3HFZ B;  4P75 A;  3PCO B;  2EWN A;  2EJ9 A;  1YFT A;  4CH4 A;  1HTT A;  1N9W A;  3HY1 A;  2ZGW A;  2DZC A;  1H4Q A;  4G85 A;  4BWA A;  2RHS A;  2YI8 A;  1G6U A;  4XU1 A;  4TTV A;  3I7F A; 
#chains in the Genus database with same CATH topology
 4JI3 O;  3TEH A;  3HKE A;  3SPC A;  1J5E O;  1DF4 A;  1XOU A;  4DV6 O;  3L9D A;  3WB2 A;  1QR8 A;  1NJ2 A;  2Y48 A;  4JYB A;  3GB7 C;  1Q6H A;  4PJ0 Z;  4GLX A;  2DYR C;  3STL C;  1Q5O A;  3N2G A;  2HJF C;  1XEQ A;  1YFR A;  3T1H O;  1KMN A;  1NVP D;  1H8E G;  3JSN A;  4FMT A;  4ZOL B;  4EFB A;  4KHP B;  5L3C A;  1B70 B;  4Z1V A;  4JYA O;  2DYS B;  4XTY A;  1EM1 A;  4JAV A;  4OLF A;  4I0X B;  4GZR B;  4YRN A;  1B6Q A;  1OCC C;  4Q15 A;  5FPR A;  1CEZ A;  4ZI7 A;  4DO2 A;  3K04 A;  2CIM A;  4ASU G;  5CBG A;  4MVZ A;  5LXT B;  4YYE A;  4H2Y A;  4QJF B;  4MVU A;  1G8M A;  1SQF A;  2E5A A;  2P90 A;  5KAF Z;  2JVD A;  5IDJ A;  4LVI A;  3ICA A;  3LSU A;  2EIK C;  1YIJ V;  1WP8 A;  4GYC B;  2AMC B;  2DXU A;  1OJH A;  4DV4 B;  1XNQ B;  1SES A;  1V54 C;  1IBM O;  3MF1 A;  3ZCC A;  1LUW A;  5IE9 A;  4YDQ A;  1BHA A;  4W4K A;  4JI1 B;  1OZ0 A;  2CTQ A;  4TVY A;  5H9C A;  1EZJ A;  2W0X A;  3H01 A;  3OTF A;  4HA8 A;  1WPY A;  3EHB B;  1GGM A;  1K34 A;  1SQP H;  1HR0 B;  1PL0 A;  3NEN A;  3GWK C;  4DR5 O;  4DR2 O;  5EC2 C;  3MAQ A;  4X65 O;  1MZE A;  1M1K W;  2QSA A;  2WLJ A;  1L0L H;  1USY A;  2F93 B;  1L1F A;  1XNR B;  1HNZ B;  1U97 A;  1NU1 H;  3N2K A;  3HKD B;  5CB4 B;  3NXS A;  3AG2 C;  2VQE O;  5E3I A;  1AVM A;  1IBK O;  2AKW A;  1PYS A;  1KP3 A;  4RUE A;  3U10 A;  4LF6 O;  2LGQ A;  5EBL C;  4WFB V;  1KU9 A;  1BS3 A;  1PD3 A;  4EEQ A;  1W59 A;  5C93 A;  3LNM B;  3K59 A;  4LF5 B;  3BAA A;  2QR4 A;  1B3Q A;  3V8J A;  1MZF A;  4P3O A;  4P75 C;  3VQY A;  4U7O A;  4O4J A;  2ZE7 A;  2QTS A;  2Q0A A;  2EIM C;  1VQ9 V;  4EX5 A;  2UUC O;  1TA8 A;  1Q3E A;  3VQW A;  1FJG B;  2P5O A;  1MA1 A;  2Z0A A;  2DYR B;  3G4S V;  3K03 A;  1BBW A;  3RGB A;  2ZNJ A;  2JEX A;  1C0A A;  3SPG A;  1QNM A;  1K7D A;  1N4C A;  3EFR A;  4DR5 B;  1SZX A;  2LJ2 A;  3JD3 A;  3CS5 A;  4X65 B;  1X2H A;  3WB0 A;  3B40 A;  1ROP A;  1IX9 A;  2PY5 A;  4JI5 B;  3DC5 A;  4XU3 A;  2UXD O;  1OCC B;  2EJG A;  3BPZ A;  1OCO B;  4P9O A;  4U3J B;  2GV9 A;  4HBN A;  3CPW U;  1Q90 D;  4LFB O;  4X89 A;  2IU3 A;  4ZOL A;  3SYQ A;  2WAM A;  2LGW A;  4KR3 A;  1B70 A;  5KA5 A;  2WLM A;  3BCC H;  4I0X A;  3BA8 A;  2EX3 A;  1WNL A;  1Z5V A;  4UXN A;  5HFL A;  2ALY B;  3CC7 V;  1FS0 G;  1NBM G;  2Q68 A;  3SYP A;  1DGS A;  1PKX A;  1PNL A;  1VEW A;  4P71 C;  5LXT A;  2ARS A;  4LF9 B;  3E86 A;  1TUB B;  4MVR A;  5LMU B;  4MSW C;  2DQ0 A;  1V54 B;  3S3W A;  4WFH A;  4PA7 A;  3RW0 A;  4XTV A;  3W7W A;  3TGU H;  1WPX A;  3BFR A;  5CA0 B;  2Q6A A;  4B3R O;  2AMC A;  2Y0I A;  2X0L A;  3ZS8 C;  2ZT6 A;  1YJN V;  2N05 A;  2IJK A;  3UH0 A;  2H94 A;  2FL4 A;  1NH2 D;  5KHK A;  3ZED A;  1IL2 A;  3AG2 B;  1G5H A;  1HNX O;  3E35 A;  1O9G A;  5LL6 Y;  4LFB B;  4HNA B;  4LH6 A;  3E8G A;  3IG2 A;  4DV2 B;  2DOS A;  4YRP A;  1SS3 A;  2YSU B;  3TCU A;  3AG7 A;  4JI2 O;  4J9Y B;  3ZBH A;  4H2V A;  1SZT A;  3HKD A;  5CB4 A;  1M90 W;  2GTS A;  3ZN0 A;  1GH6 A;  1SKV A;  1KOG A;  4YY3 O;  2EIM B;  5JCO A;  2Q5H A;  4CS3 A;  2F1M A;  1L8D A;  2H8P C;  1VQZ A;  1H2K A;  4DV1 B;  3A5Z A;  4FVM A;  2FTK A;  3W7U A;  5LOV B;  3CRM A;  2QKS A;  1FXV A;  2OIG A;  1FXK C;  2L6L A;  1JQ0 A;  3CMA V;  4J41 A;  1T5E A;  1S76 D;  1IDS A;  2UU9 O;  2WA3 A;  4YRC A;  2GSM B;  11AS A;  4XU2 A;  2ZR3 A;  1I5Y A;  2ZE8 A;  4GCZ A;  3E22 B;  4Q6G A;  2NR5 A;  4LF8 O;  5B1N A;  2QHU A;  4O2A B;  2P5I A;  3LUT B;  4N21 A;  4UCU A;  2ZM6 B;  1JPX A;  4YRM A;  2CGN A;  1K92 A;  2UXB O;  2QHV A;  4DV7 B;  4FK5 C;  2RN9 A;  2ZT8 A;  3CEI A;  4WFF A;  3ETD A;  3JAW B;  3CRA A;  4EFE A;  1GN4 A;  1H38 A;  2Q7E A;  2CH7 B;  1S0V A;  2ART A;  1R6T A;  4DV5 B;  4X66 O;  3ABM C;  4PHC A;  5LHH A;  3FB7 C;  1QF6 A;  5EC1 C;  2KKW A;  4U3J A;  4YY3 B;  4G2K A;  2DE0 X;  3DXR B;  1JMK C;  2N74 A;  3APQ A;  3A74 A;  2F95 B;  1FAF A;  2ODR C;  2GHY A;  1G4Y B;  4ZTZ B;  5HGQ A;  3T4Z A;  4LVL A;  1EVL A;  3SJQ C;  2ALY A;  1V55 C;  1QE0 A;  3EXA A;  4BIO A;  2PZS A;  2YIC A;  4DUY B;  2QWR B;  5KHH A;  1TUE B;  1TUB A;  3R65 A;  1I08 A;  3ZHR A;  3KCY A;  1Q8I A;  4I5S A;  1BT8 A;  1AI6 A;  2LQT A;  2ZIM A;  1UJW B;  4UPA A;  3B2E E;  3FB5 C;  3CCL V;  1NNH A;  3ZMV A;  1TGO A;  4YRQ A;  4UVB A;  5C52 B;  5CA0 A;  4MS2 A;  1H2N A;  3ZHS A;  4LVK A;  1I0H A;  5IY5 C;  3SJA C;  1KQS U;  4JV5 B;  1WA8 B;  4AHC A;  2GTA A;  4LF4 B;  3B8N A;  4X64 O;  2XT9 A;  1V9P A;  1B7Y B;  3T2M A;  3E2E A;  4QGP A;  2CE4 A;  3OW2 U;  1G1X B;  4HAM A;  1QLN A;  2XAJ A;  4K3A A;  4LBE C;  3HXW A;  4HNA A;  3K58 A;  4J42 A;  2V7Q G;  3JCU Z;  3UFG A;  4RUF A;  2QWQ B;  3IAL A;  5DED A;  3PJS K;  4UCT A;  2UUB B;  3FFQ A;  3I5D A;  1Y74 B;  2F4V O;  1O9H A;  4X8A A;  4P75 A;  3PCO B;  1FXK B;  1GMG A;  3H1H H;  2FB5 A;  3E8F A;  1Q81 W;  3ETE A;  1N9W A;  3HY1 A;  1AP6 A;  4JI7 O;  2VWJ A;  3CXC U;  1WNS A;  2HLD G;  2OTJ V;  1YTF B;  4OX9 B;  2ODM A;  5LOV A;  1L0W A;  4PD4 F;  3RKW A;  2DU5 A;  4DR4 B;  1XMO O;  1GRJ A;  4Z2W A;  1H2M A;  1HNW B;  3HKC B;  3QF7 A;  5B5E Z;  4DR6 O;  3A0R A;  4XTW A;  4DRX B;  2E75 B;  1NR1 A;  12AS A;  2PI4 A;  4X64 B;  4YRT A;  2JS3 A;  1GM9 A;  1XL6 A;  2Q7G A;  3ABM B;  4FFK A;  3F7Y C;  3E22 A;  4O2A A;  3UO3 A;  1W0J G;  1H2G A;  2A8E A;  1Q6U A;  1B04 A;  2ITD C;  3CB2 A;  3K0D A;  4JTA B;  2XAH A;  4HWS A;  2PMF A;  2B1G A;  1EQR A;  4DK0 A;  4TVA B;  4WCE V;  3MDS A;  3E9H A;  1IBL B;  2DYS C;  3JAW A;  2UUA B;  2RJZ A;  5C53 B;  2CH7 A;  3D36 C;  1V55 B;  2DWD C;  1SC5 B;  3L2Z A;  1U96 A;  2QEX V;  2YIA A;  3O65 A;  4NTX A;  3DXR A;  4P71 A;  1MMM A;  1PPJ H;  1R6N A;  3CHX A;  4QE7 A;  3MD0 A;  1VAR A;  1E24 A;  3ASO C;  1VQO V;  2I4N A;  1XMQ O;  1HDJ A;  5IWA O;  5GTH Z;  4UVA A;  1GO3 F;  4BAY A;  5KNN A;  4IGG A;  1WPB A;  2ZT9 B;  4YRJ A;  1BSM A;  2EIJ B;  3A8T A;  2AW9 A;  2P4V A;  1NT2 B;  4HWO A;  3QTC A;  3G67 A;  4QE9 A;  4TQD A;  4E4E A;  2W6J G;  4I9W A;  2LFR A;  1B8A A;  3NEM A;  4KHP O;  1QLE C;  4XU0 A;  1Z5W A;  3K79 A;  2UXC B;  1JCH A;  1WA8 A;  2CGO A;  4EB6 B;  1OCR C;  2HVK C;  3B8M A;  4YPF A;  2DU7 A;  1WYD A;  5IYB O;  1COW G;  4JAA A;  2DXT A;  5F2V O;  1B7Y A;  4PI2 A;  4K8Z A;  1XBL A;  1YF2 A;  2HR3 A;  3SYC A;  5H6R A;  1IXB A;  1RFY A;  3AK1 A;  1ARO P;  3V7C A;  4ICG A;  3A5Y A;  2QE7 G;  3RYI B;  4DR3 O;  2PI5 A;  1Y74 A;  2LO1 A;  4YCW A;  1WJZ A;  1WU7 A;  3SJB C;  4DXW A;  1E1T A;  3PCO A;  3CX5 F;  1FXK A;  2ZZF A;  4LH7 A;  4CH5 A;  1GN2 A;  1N32 B;  3P32 A;  3TEG A;  3TXQ A;  5FPO A;  4YJ2 B;  3ZRW B;  2P67 A;  3UM7 A;  3OGC C;  4DV4 O;  3SR2 C;  1XNQ O;  2CGH A;  3CRC A;  2C8M A;  3X2Q C;  4FLT A;  5LGT A;  4PA4 A;  4JI1 O;  4MTF A;  1MAB G;  1HXD A;  4EO4 A;  4PEL A;  3SJC C;  3FB6 C;  1HR0 O;  3HKC A;  2RHQ B;  3KKY A;  4DRX A;  3H9V A;  3F5W C;  3PZC A;  4U7N A;  2PME A;  2Q8V A;  3A32 A;  4G84 A;  1ZWI C;  1E1O A;  1VQ6 V;  1XNR O;  1HNZ O;  1KKC A;  1JJO A;  4UFZ A;  4O4H B;  3IC7 A;  2CJA A;  4WF9 V;  1OCO C;  4FLX A;  3PN1 A;  1Q82 W;  5KUM A;  2QM8 A;  5KHI A;  4P2Z A;  1ZUQ A;  2YI9 A;  4H2S A;  4YRR A;  1JJC B;  3SYA A;  3LDD A;  2YEV B;  4GX5 A;  4LFA B;  2QWN B;  4TVA A;  1WB7 A;  1Z2G A;  2PTM A;  4IL6 Z;  3RUX A;  4DR3 B;  3ASO B;  4WBN B;  4LF5 O;  5IYD O;  1AI5 A;  2WLN A;  4J11 A;  3OEE G;  5BMV B;  3MF2 A;  2YXY A;  1QCE A;  3T1Y B;  1NS1 A;  4K88 A;  1FJG O;  2QKA A;  3V7S A;  3SDL A;  1VF7 A;  1NYQ A;  2I4L A;  3H1I H;  2A79 B;  1XI1 A;  5JWP A;  3BRC A;  4DW0 A;  1QLE B;  4ZBM A;  3HB3 B;  1YHQ V;  5ELN A;  3P3P A;  2QM7 A;  2Y4T A;  1H8H G;  1OCR B;  3KCX A;  4JI5 O;  3T1C A;  4CBC A;  2YID A;  3CCV V;  2DTH A;  4H44 B;  1Q7Y W;  4KL1 A;  3K0G A;  5LP6 C;  3RKX A;  1S3J A;  3LDC A;  2PYJ A;  4WJ3 M;  2WWW A;  4JI4 B;  3BVO A;  4LFC B;  3UQ8 A;  4X9Q A;  4O2B B;  3RYH B;  4NR1 A;  4EB6 A;  4AH6 A;  3A2F A;  4D7T A;  4MTG A;  4E2L A;  2AHY A;  2EJ7 A;  1NI8 A;  4DV0 B;  2VQF B;  5KAI Z;  4BW9 A;  3CCQ V;  2A3Q A;  2RHS B;  2QGN A;  3ZHU A;  3FX7 A;  2YDE A;  3EVK A;  1RSO B;  4LF9 O;  4YRF A;  3RAC A;  4FLV A;  5LMU O;  3G80 A;  4ZTU B;  3IKM B;  3VQV A;  4CS2 A;  3X2Q B;  3RYI A;  5B1O A;  3DSQ A;  2AZ2 A;  4P72 A;  4LVJ A;  2AXT Z;  1XDC A;  1R3I C;  1LYL A;  2E5L B;  3RN4 A;  3HXZ A;  4UP7 A;  5LGN A;  4YJ2 A;  3ZRW A;  2ARU A;  1SQG A;  1OCZ B;  3ETG A;  4O4I B;  3IAY A;  1KKD A;  4FLZ A;  4F4L A;  2Z5U A;  4NXM B;  3DGE A;  4FPP A;  3M7M X;  1SQQ H;  5D5Q A;  3H1K H;  4H33 A;  2VRZ A;  3OGI B;  1EFR G;  1F4N A;  3SGI A;  3L71 H;  4DV2 O;  2RHQ A;  4UUJ C;  3HKB B;  1OHH G;  3G1Z A;  3JAS B;  4O4L B;  1HWY A;  3K5O A;  4X1I B;  4AI8 A;  2DEQ A;  4K8X A;  3ML0 A;  3D36 A;  4O4H A;  4DR1 B;  5JJE B;  1THZ A;  4PI0 A;  2P6J A;  4YJ3 B;  5J2U B;  3TJT A;  3JAT B;  2ZE6 A;  1JJC A;  3ZN1 A;  2WLH A;  2YEV A;  4NTY A;  2ZXW C;  1Q86 W;  4GX2 A;  3CWB H;  5HFM A;  4DV1 O;  2E1H A;  4XDL A;  1E1R G;  2QWP B;  4F6R B;  4YRL A;  3N27 A;  4YRE A;  3ZIA G;  5L3G A;  2RMK B;  2EAY A;  3F5T A;  5BMV A;  4UCS A;  2G38 A;  1K8A W;  3FAV B;  1BQZ A;  4FM1 A;  4RDX A;  4H0L B;  2YC0 A;  4UV9 A;  3AK3 A;  2OCH A;  4FLU A;  1KYO F;  2XOK G;  1KBH A;  3HRI A;  2HEP A;  5LP6 B;  4B3S B;  4DR7 B;  2ATK C;  4IIJ B;  3BHP A;  1N33 B;  4OXS A;  5F5W A;  2QKC A;  4JI8 B;  3OD1 A;  2ZM6 O;  2EJF A;  2HNI A;  2P7T C;  4DV7 O;  2HJD A;  3ZRV A;  3RFR A;  2JJ1 G;  1M57 C;  5ITZ B;  2QM4 A;  3AG4 C;  1JVM A;  2CAZ C;  1RIQ A;  3CCM V;  2FYK A;  2O57 A;  2Q0O C;  4DV5 O;  1SQB H;  4B3M B;  1KC8 W;  3JD2 A;  4JPR A;  3STZ C;  2XTI A;  1KP2 A;  2E76 B;  3CSX A;  4CH3 A;  4D6T H;  3RT3 C;  1F7Y A;  5BXZ A;  3K3W A;  4O2B A;  1YTF D;  3RYH A;  3ZRS A;  1D5A A;  3JAK B;  5D5P A;  2IU0 A;  2JIZ G;  4QPK A;  1N36 B;  4JI6 B;  4CH4 A;  2HFE C;  5L3B A;  4DUY O;  2RHS A;  4NTW A;  3K06 A;  4XU1 A;  4TV8 B;  1RSO A;  4TTV A;  4J7Z A;  1XHX A;  2X6A A;  3J7A U;  2G4C A;  2WLI B;  3UGT A;  2XND G;  1G5I A;  4FJC C;  1SQV H;  2OWO A;  1K97 A;  1TAE A;  3W7S A;  4XTZ A;  4BIU A;  5JJJ B;  1RPR A;  4GX1 A;  1X01 A;  2KB1 A;  1EFW A;  2YIB A;  3FB8 C;  4OGQ B;  1AJN A;  2W0F C;  5H5N A;  1EVK A;  2ODR D;  5GW7 A;  1ASZ A;  2XAG A;  4JV5 O;  4D7S A;  2ZQM A;  3IKL A;  4LF4 O;  4O4I A;  4P73 C;  4ZKI A;  5KMG B;  3RYC B;  2UXN A;  1VF6 C;  2LFS A;  5FLX N;  3CCS V;  4PA9 A;  3ASN C;  1J95 A;  2A06 H;  1WN7 A;  1J5W A;  4JTC B;  1NJI W;  3VOU A;  2WLL B;  2OTL V;  3DTU B;  4DQ2 A;  5LGU A;  3K5N A;  1PNK A;  4JYC A;  2ZXW B;  4YRK A;  3HKB A;  4DYL A;  4XDK A;  3NR7 A;  2UUB O;  2NS6 A;  3JAS A;  4O4L A;  3E8B A;  4X1I A;  3BAB A;  2JGU A;  5KHJ A;  3ABU A;  4LNS A;  2AGA A;  5GON B;  2VS0 A;  1SRY A;  1HC7 A;  3WB1 A;  2Q9L A;  4YJ3 A;  5J2U A;  1IUR A;  3AEI A;  3ABK C;  3JAT A;  4X20 B;  2IM9 A;  1L0N H;  3RIR A;  1K3E A;  3C3S A;  3C90 A;  4XBF A;  4F6R A;  3OAA G;  4OX9 O;  4HWT A;  1QVG U;  3OR7 C;  4KQE A;  1XUQ A;  4PDR A;  3SPH A;  3JD4 A;  4E51 A;  4DR4 O;  3ZX6 A;  3WU2 Z;  1HNW O;  3FAV A;  4K0K B;  3OM3 B;  4MTO A;  3D3I A;  1NJ8 A;  1M57 B;  5A2Q N;  3AG4 B;  2EIJ C;  1NZ6 A;  3E89 A;  2XAQ A;  1FPO A;  3LNN A;  3SPJ A;  1H4S A;  3TUP A;  1XL4 A;  2E3C A;  2QTO A;  3LC0 A;  1YGB A;  5LP6 A;  4IIJ A;  2HG5 C;  5CBF A;  5CA3 A;  4JAS A;  4RWU A;  2OIE A;  2BSK B;  2F66 C;  1R6K A;  2JGD B;  1EOV A;  1EZV H;  5ITZ A;  1IBL O;  2JS5 A;  2UUA O;  4I50 B;  3ABL B;  1YFS A;  3ABT A;  2HHH B;  3RGL A;  4HT4 A;  5IJ0 B;  4X1K B;  5LYJ B;  2JJ2 G;  2HP8 A;  4AQY B;  2DWE C;  4RO2 A;  1GN6 A;  2ETN A;  2HVJ C;  4JYY A;  2ZZG A;  4XTX A;  1YJW V;  4DK1 A;  4H02 A;  3NEL A;  2J3M A;  3ZHQ A;  2ADQ B;  4YHH B;  4PG3 A;  1MOF A;  3JAK A;  1E79 G;  1Y76 B;  2CTR A;  2E74 B;  1B06 A;  1S77 D;  2B1I A;  2Q69 A;  4P72 C;  4UCO A;  3CD6 V;  1N34 B;  4JGS A;  4DPG A;  3P3N A;  3K08 A;  4LF7 B;  3D3Q A;  4TV8 A;  1Z7N A;  4DW1 A;  5LBQ A;  2AHZ A;  2XAF A;  2MK3 A;  4NYK A;  3AG1 B;  2WLI A;  2BOB C;  1FFX B;  1Q43 A;  3CRR A;  1EIY B;  4H37 A;  1K9M W;  4CZZ A;  3L70 H;  1R1B A;  1UFI A;  2Y0P A;  1VQK V;  3ASN B;  5CMU A;  1H2L A;  3ZRX A;  2DZ9 A;  2K1E A;  1NJ6 A;  3K5M A;  1N0J A;  2ZTG A;  1K33 A;  1EN5 A;  1AI7 A;  2UXC O;  3ETQ A;  1R73 A;  2LP7 A;  2OT5 A;  2RCV A;  5KMG A;  4MVQ A;  5DM6 V;  3L72 H;  4PV1 B;  4WFG A;  1VQ7 V;  4B7E A;  4J9Z B;  2ZDI C;  4TWA A;  3SPI A;  5J2T B;  5FL7 G;  5C51 B;  2WLL A;  3ABK B;  1S72 V;  4Z1M G;  3CXH F;  5B66 Z;  1QBZ A;  2EBO A;  3L74 H;  3HRK A;  5GTI Z;  1IZ3 A;  2J3L A;  2E65 A;  4JTD B;  3HXY A;  2GDS A;  1D5N A;  5KX5 B;  3KFU A;  3BEH A;  4HWP A;  1NJ5 A;  2ZT5 A;  1K73 W;  3JSL A;  4FLW A;  2QA4 V;  5GON A;  1CPY A;  1AR5 A;  1GK9 A;  4X62 B;  4PA3 A;  1N32 O;  3UO2 A;  3HY0 A;  1XHZ A;  4X20 A;  5IT9 N;  4K86 A;  3OMI B;  3RL6 A;  1WAZ A;  5EZY B;  1ADJ A;  3RBZ A;  1GN3 A;  2R9R B;  4NKG B;  1BIB A;  4JI0 B;  2NNU A;  2EZP A;  4BIZ A;  1YSC A;  4CC5 A;  2XHB A;  2ZKO A;  1FYJ A;  3QG5 A;  3MEY A;  1I7F A;  1VQ5 V;  3I55 V;  5EIB C;  1VF5 B;  2QWO B;  4MVO A;  5BR8 B;  3P8V A;  4O2D A;  1NYR A;  1Y6X A;  3I56 V;  3ICX A;  1P49 A;  2IBZ H;  4HVC A;  5J9P C;  2XAS A;  4GKK B;  5LA6 B;  3CCJ V;  4KXR A;  4LFA O;  2BSK A;  3V8L A;  2JGD A;  3R07 A;  4I50 A;  1VIB A;  5CBH A;  5JQG B;  4HWR A;  2DVE A;  2YIB D;  1ENV A;  5IJ0 A;  5IJ9 B;  4X1K A;  4FFB B;  1M5I A;  3APO A;  5LYJ A;  5BZB A;  1VQM V;  1WB8 A;  4GX0 A;  4LR3 A;  2IW5 A;  3T1Y O;  1P7G A;  1R3J C;  4MVM A;  3KG2 A;  2PGG A;  1NJ1 A;  5LMN B;  1D2D A;  1YCI A;  3JAL B;  2DQ3 A;  3W7X A;  4P3P A;  3QO8 A;  2CJB A;  1BGY H;  1Y76 A;  3JCZ A;  1X55 A;  4NXN B;  4GKJ B;  4BW5 A;  2LW7 A;  1WLE A;  3G71 V;  3C3T A;  2Y69 B;  4OP0 A;  1E1Q G;  2YXH A;  3JD1 A;  1QR9 A;  1TVK B;  1OCZ C;  4UV8 A;  2Q5I A;  4P73 A;  5EBW C;  1VF6 A;  4B3T B;  5IYC O;  2X6B A;  5EYP B;  1FFX A;  1GKF A;  1EIY A;  2CK3 G;  1US6 A;  2JEU A;  3ZMZ A;  4JI4 O;  1VQP V;  4CH6 A;  3CC4 V;  1X59 A;  4LFC O;  3FYI B;  1F23 A;  4Q20 A;  4DV3 O;  5L3F A;  2BTO A;  2X7R B;  2ZIN A;  4TUY B;  1SA0 B;  4X1Y B;  1BIA A;  4CC6 A;  3L73 H;  2EIL C;  2ARH A;  5L3D A;  1X4T A;  4DV0 O;  3OTO B;  2VQF O;  5J2T A;  3REX A;  4YIP A;  1BHB A;  3V7R A;  3ZMS A;  1VMG A;  4KFM A;  2L35 A;  5EBM C;  3RWR D;  1QU7 A;  3HXX A;  4G28 B;  4YRI A;  2GUZ B;  5KX5 A;  3TET A;  1AB3 A;  4NVP A;  1PM9 A;  1ATI A;  2DTI A;  3K9S A;  2YUA A;  4LNU B;  3OD4 A;  4IT5 A;  4JI3 B;  2E5L O;  1J5E B;  1X2G A;  1LR1 A;  3ERR A;  1KEC A;  4U3F H;  3G6B A;  4WF2 A;  1HP8 A;  4DV6 B;  4XEM A;  1VQ8 V;  5EZY A;  4NB5 A;  2UXX A;  4B08 A;  4H2U A;  1F4M A;  4R7C A;  4F6E A;  3OMN B;  4NXM O;  4FIP C;  2A7W A;  3T1H B;  5K1X A;  3K5L A;  1W2B U;  1JR9 A;  3CP1 A;  3OMA B;  2NN4 A;  3JD0 A;  4P30 A;  4DV3 B;  5C8Y B;  5LHI A;  3L1A A;  4JYA B;  2RDC A;  3IJ4 A;  1M56 B;  2LW1 A;  3OFN G;  1P84 F;  3UKM A;  1XRE A;  2EL9 A;  4IHJ B;  3M4Q A;  4DR1 O;  4YRG A;  2E64 A;  2ZR2 A;  2WA4 A;  2KSD A;  1AP5 A;  2N04 A;  4ZHQ B;  5ELO A;  1HW7 A;  5LA6 A;  2JRI A;  1BQ0 A;  1QQC A;  2A0L A;  3HFZ B;  3MHS C;  5FNV B;  4KP4 A;  3U0Z A;  2EZO A;  1GTO A;  4FZ0 A;  5JQG A;  1HTT A;  2ZGW A;  1H4Q A;  3OR6 C;  4BWA A;  4EKW A;  4FFB A;  5IJ9 A;  1G6U A;  4MVS A;  1MSW D;  2F23 A;  2C2A A;  4PDL A;  1NTZ H;  4TSF G;  3DC6 A;  3RKY A;  3E8H A;  4P3N A;  1IBM B;  1H4T A;  2DW4 A;  3JAL A;  3M4P A;  3A0B Z;  1MSD A;  1VQN V;  2WLK A;  4KUM A;  4B3S O;  4DR7 O;  2JK5 C;  1GAX A;  1N33 O;  1XQ8 A;  4FM2 A;  4JI8 O;  1WQW A;  2DJV A;  2H3O A;  1QHT A;  1AJQ A;  5JVD B;  4DR2 B;  2EJR A;  1KB9 F;  4H2T A;  1YJ9 V;  3HXU A;  1OV9 A;  3FJP A;  3Q4H B;  1TVK A;  3CJH B;  2OYQ A;  2Q7H A;  1CP9 A;  2X6C A;  1G51 A;  2EIL B;  5EYP A;  1EN6 A;  4B3M O;  2VQE B;  2BTQ B;  2P06 A;  2ZDI A;  1IBK B;  1DLB A;  1NVP B;  3U11 A;  2M7W A;  3CE2 A;  1JJ2 U;  4LF6 B;  3ZJZ A;  2KG7 B;  4TUY A;  5DN6 G;  5EK0 A;  3REU A;  1SA0 A;  5H2F Z;  4X1Y A;  5KHG A;  2V4D A;  3CCU V;  2E10 A;  4WBN A;  3LSQ A;  2IJJ A;  3K57 A;  2Q5Z A;  2EIK B;  1N36 O;  4JI6 O;  5TIS Z;  1SF9 A;  1E22 A;  4BR6 A;  4P74 C;  1FFT B;  4R6Z A;  2UUC B;  1UPG A;  4YP0 A;  2ZZE A;  3BJU A;  1ZTE A;  1M9N A;  5K1P A;  1VQL V;  3K9A A;  3BFM A;  2GUZ A;  1SER A;  1JOY A;  1JA8 A;  3RVY A;  4PHZ A;  2P0L A;  3NET A;  4RQF A;  3RF1 A;  2M6Y A;  1P7B A;  1NTK H;  4AIL C;  1URF A;  5B1A C;  2A9H A;  2CTW A;  4LNU A;  2DDZ A;  3B4S A;  1AR4 A;  4RMF A;  1IVS A;  2ZNI A;  4QPJ A;  2P4K A;  2QJ1 A;  1H2S B;  5B1B C;  2FYU H;  2JDI G;  1EBO A;  3B77 A;  3M99 B;  2UXD B;  4LCU C;  3A7U A;  3HXV A;  2I4M A;  2ZIO A;  1Y4M A;  3IFX A;  3UGQ A;  1K5Q A;  4UP8 A;  4IYI A;  2HKO A;  2IH1 C;  2IJH A;  1ORQ C;  2YS8 A;  5KUK A;  3CMQ A;  1ZSP A;  1YDX A;  4J80 A;  1AJP A;  2ILM A;  5C8Y A;  4J7J A;  4YRO A;  4YIO A;  2Q4P A;  3OE7 G;  1WQ7 A;  4GUN A;  3ABL C;  3O9O A;  4IHJ A;  3R66 A;  1AIL A;  4I4T B;  3RYF B;  5JH7 B;  3THO A;  3JYC A;  2B5U A;  4TV9 B;  2F43 G;  2PF4 E;  4L87 A;  1YI2 V;  4OPA A;  2IY5 B;  4G27 B;  4ZHQ A;  2B9Z A;  5E1A C;  3OEH G;  1NQT A;  1BMF G;  1B76 A;  2I4O A;  2OCC C;  3HFZ A;  5FNV A;  4TQF A;  2CUG A;  1P4R A;  1ASY A;  1EN4 A;  4HYO A;  4TOI A;  3EFS A;  4UP9 A;  3W3S A;  1IXM A;  4RQE A;  3OUS A;  1R3L C;  1M93 A;  4UB8 Z;  4TVW A;  1BZK A;  2R9I A;  2BOC C;  4B3R B;  3P30 A;  3LSS A;  2GBO A;  3BA9 A;  3TXS A;  4K0K O;  2ZT7 A;  2WSS G;  2DTO A;  4MW3 A;  4H2X B;  4I7Z B;  2CJ9 A;  1SET A;  3M8A A;  1JFF B;  4P9P A;  4J7K A;  3AG1 C;  3UT5 B;  1KMI Z;  2YXL A;  1ADY A;  2VWK A;  3VQX A;  1DF5 A;  1HNX B;  4B7K A;  4RAI A;  4YXW G;  3JAR B;  1PP9 H;  4FZ1 A;  5JVD A;  1Z7M A;  3OUF A;  4CS4 A;  2C7I A;  4LC1 A;  1WP7 A;  4JI2 B;  1DK1 A;  5CA1 B;  3Q4H A;  1XIL A;  1NTM H;  4JAU A;  4I55 B;  3CJH A;  1RPO A;  3CC2 V;  4XEO A;  2HHH O;  3WFV A;  1S5J A;  1YZB A;  4K35 A;  3E83 A;  3HTZ A;  2BTQ A;  4C7U A;  3A7R A;  3W7T A;  2XGT A;  4AQY O;  1X56 A;  4LVM A;  1MNG A;  2KG7 A;  2ZCE A;  2K9P A;  4X5O A;  4WFE A;  4PA6 A;  3L4G B;  4YHH O;  1I94 O;  1RP3 B;  1YEW A;  1KMM A;  3GWO A;  3QO7 A;  5B3S C;  1YVW A;  5IWA B;  3ZMT A;  3SYO A;  5B1A B;  1N34 O;  5BY1 A;  3JAM N;  3ZMU A;  2NLJ C;  4ABM A;  4LF7 O;  2UU9 B;  2FML A;  5B1B B;  1VP7 A;  1QVF U;  4YCV A;  1ZX3 A;  3A31 A;  2D2C B;  2PYL A;  4LF8 B;  1MG1 A;  4W4L A;  5IYZ B;  1JX9 A;  2RQ6 A;  4UCR A;  2ITC C;  3F7V C;  2ZXF A;  3J81 N;  3FD9 A;  3H1J H;  2UXB B;  3CRQ A;  4K87 A;  2EIN C;  4HZ3 A;  4LWS B;  5DEC A;  1S5L Z;  4IYH A;  1AR1 B;  1USY C;  2PUS A;  4YRS A;  2MW2 B;  3WG7 C;  4X66 B;  4WI1 A;  1NH2 B;  1FKA O;  1K4D C;  3J80 N;  2ADP A;  4NCX A;  1W0K G;  4MW8 A;  1PNM A;  4KR2 A;  5CN0 A;  3ZHT A;  4TT3 G;  2QDO A;  2OCC B;  4WJ4 A;  4TWK A;  4XDJ A;  1BE3 H;  2BCC H;  3QNE A;  2RNB A;  2EUL A;  2IH3 C;  1I94 B;  4GT1 A;  4I4T A;  3RYF A;  3WQZ A;  3EFF K;  5JH7 A;  3CCR V;  1ZL8 B;  3E9I A;  3P8T A;  4H2W A;  4R50 A;  2Z3Y A;  4TV9 A;  3MQZ A;  2IY5 A;  3TEH B;  3HKE B;  4X62 O;  5LHG A;  4J10 A;  3AG3 C;  1N8R W;  1YIT V;  1A32 A;  2Y4U A;  1SQX H;  2BE3 A;  1LNQ A;  1Q6I A;  3N2G B;  4JI0 O;  4DUZ O;  1FYF A;  3GVM A;  3CYO A;  1RM1 C;  1I5X A;  3ZHV A;  3T4D A;  3VBB A;  2KQX A;  3B09 A;  1W66 A;  2DN9 A;  4FM0 A;  2Y69 C;  1ZLZ A;  3TK1 A;  3CME V;  1R3K C;  4R8C A;  4H2X A;  5BR8 O;  1JFF A;  3RYC A;  4WFA V;  1KUQ A;  4JZG A;  3UT5 A;  1K5S A;  4ZI7 B;  5H6Q A;  2QHT A;  2XUM A;  2CTP A;  3CCE V;  1M4U A;  1VQ4 V;  1FXH A;  4H13 B;  4GKK O;  1GM8 A;  3FKS G;  2ZE5 A;  3IGA C;  3JAR A;  1H4V B;  2IJI A;  1K4C C;  5CA1 A;  2QHS A;  4I55 A;  2F4V B;  3MHH C;  1NKD A;  5B3S B;  2R70 A;  4PDV A;  1Y66 A;  2FKX A;  5EIB D;  3KZI Z;  5L3E A;  4P74 A;  4OPH A;  4JF3 A;  3QVN A;  4A5U B;  1YB3 A;  5LMN O;  1AI4 A;  3HPL C;  4FLY A;  4XTU A;  4PDM A;  4JI7 B;  2Q73 A;  3L4G A;  4MT8 A;  3OT7 A;  4DUZ B;  1NR7 A;  4NXN O;  2W6I G;  2P22 C;  4GKJ O;  5KA6 A;  3HFV A;  3G6E V;  1BL8 A;  4JZ2 A;  1XMO B;  1GM7 A;  1BBU A;  4YCU A;  5IY5 B;  4DR6 B;  4J15 A;  2EIN B;  3UCS C;  2R9A A;  5AG2 A;  3LDE A;  4L8J A;  1BCC H;  3RVZ A;  3WG7 B;  4B3T O;  2E41 A;  3N2K B;  1Y67 A;  2ZD9 A;  4MTX A;  5IYZ A;  1X54 A;  2AKW B;  4N23 A;  1PYS B;  3QO5 A;  2XTA A;  4X88 A;  4ZIB A;  3FYE B;  3V8K A;  4UB6 Z;  2DKG A;  2Q67 A;  1ZAU A;  1PL4 A;  2AZ0 A;  4LWS A;  2R72 A;  4LP8 A;  5KLV H;  1M56 C;  3P8Y A;  4UCV A;  3A7A A;  2DJZ A;  4I9Q A;  4O4J B;  3AK2 A;  3OTO O;  1KD1 W;  1LUV A;  3HR0 A;  3D8C A;  4QIW F;  3BY6 A;  1DTO A;  1F51 A;  5A9G A;  1N0N A;  2EWN A;  3AG3 B;  5JCO C;  2EJ9 A;  2D3O W;  1PV0 A;  2WPD G;  1YFT A;  5JJN B;  1CXZ B;  1S5H C;  1YXB A;  2DZC A;  4QNH B;  4G85 A;  1FD9 A;  2YI8 A;  3H1L H;  3A0H Z;  3S3X A;  1ZL8 A;  1XMQ B;  1RM1 B;  2CDY A;  4UVC A;  3I7F A;  3L75 H;  2V1D A;  2DMX A;  5E79 Z;  3IC9 A; 
#chains in the Genus database with same CATH homology
 2G4C A;  5LOV A;  1L0W A;  3UGT A;  3TEH A;  1G5I A;  3HKE A;  3RKW A;  2DU5 A;  2OWO A;  4DR4 B;  3RKY A;  4P3N A;  1TAE A;  1IBM B;  1H4T A;  1HNW B;  3WB2 A;  4XTZ A;  3HKC B;  3JAL A;  3QF7 A;  3M4P A;  1NJ2 A;  5JJJ B;  4XTW A;  1X01 A;  4DRX B;  1EFW A;  2YIB A;  4GLX A;  12AS A;  1XQ8 A;  2ODR D;  1EVK A;  1Q5O A;  3N2G A;  4FM2 A;  4X64 B;  1WQW A;  1ASZ A;  1YFR A;  4YRT A;  1QHT A;  1KMN A;  4D7S A;  2Q7G A;  5JVD B;  4DR2 B;  3JSN A;  3E22 A;  3IKL A;  4O4I A;  4P73 C;  4ZOL B;  5KMG B;  3RYC B;  4EFB A;  4O2A A;  4H2T A;  3HXU A;  3FJP A;  4KHP B;  1TVK A;  2A8E A;  1B70 B;  2OYQ A;  2Q7H A;  1B04 A;  3CB2 A;  1G51 A;  5EYP A;  4HWS A;  4XTY A;  1WN7 A;  2PMF A;  1J5W A;  4OLF A;  1EQR A;  4DK0 A;  4TVA B;  4YRN A;  4DQ2 A;  3E9H A;  2VQE B;  2BTQ B;  3K5N A;  1IBL B;  4Q15 A;  5FPR A;  3JAW A;  1IBK B;  2UUA B;  2RJZ A;  4ZI7 A;  5C53 B;  4YRK A;  3HKB A;  2CIM A;  3U11 A;  3JAS A;  2NS6 A;  4O4L A;  4LF6 B;  4X1I A;  5LXT B;  4TUY A;  4YYE A;  3REU A;  4H2Y A;  3L2Z A;  1SA0 A;  3BAB A;  4X1Y A;  5KHG A;  2JGU A;  2YIA A;  5KHJ A;  4P71 A;  2V4D A;  2E10 A;  4LNS A;  4WBN A;  5GON B;  3LSQ A;  1SRY A;  1SQF A;  3K57 A;  1HC7 A;  2E5A A;  3WB1 A;  4YJ3 A;  5J2U A;  2JVD A;  4LVI A;  3JAT A;  3CHX A;  4X20 B;  2IM9 A;  1E22 A;  3ICA A;  3RIR A;  1E24 A;  4P74 C;  2UUC B;  4GYC B;  2I4N A;  4YP0 A;  2ZZE A;  2AMC B;  4F6R A;  3BJU A;  5K1P A;  4HWT A;  2DXU A;  4KQE A;  3BFM A;  5KNN A;  1SER A;  4E51 A;  4DV4 B;  1XNQ B;  1SES A;  1WPB A;  4PHZ A;  3MF1 A;  2P0L A;  4YDQ A;  3NET A;  3RF1 A;  4RQF A;  4YRJ A;  4K0K B;  4AIL C;  4JI1 B;  4TVY A;  1NJ8 A;  1NT2 B;  4HWO A;  4LNU A;  3QTC A;  2DDZ A;  3OTF A;  4HA8 A;  3LNN A;  3TUP A;  1WPY A;  1GGM A;  1H4S A;  4TQD A;  2E3C A;  1HR0 B;  4RMF A;  3NEN A;  2ZNI A;  3LC0 A;  2QJ1 A;  3MAQ A;  1H2S B;  1YGB A;  5LP6 A;  2UXD B;  1B8A A;  4IIJ A;  3A7U A;  3NEM A;  3HXV A;  4XU0 A;  1Z5W A;  1USY A;  2I4M A;  2ZIO A;  2UXC B;  2F93 B;  1XNR B;  3UGQ A;  1HNZ B;  4UP8 A;  4EB6 B;  3HKD B;  3N2K A;  5CB4 B;  4YPF A;  3CMQ A;  2DU7 A;  2F66 C;  1WYD A;  1EOV A;  5ITZ A;  2DXT A;  1B7Y A;  5E3I A;  4PI2 A;  2JS5 A;  2AKW A;  4I50 B;  5C8Y A;  1PYS A;  3U10 A;  1YFS A;  4K8Z A;  2HHH B;  4YRO A;  3RGL A;  4HT4 A;  1WQ7 A;  5IJ0 B;  4X1K B;  4IHJ A;  4I4T B;  3RYF B;  1KU9 A;  5LYJ B;  5JH7 B;  4EEQ A;  3THO A;  3V7C A;  4TV9 B;  4AQY B;  3K59 A;  4LF5 B;  3BAA A;  3A5Y A;  4L87 A;  2IY5 B;  3V8J A;  2ZZG A;  3RYI B;  4ZHQ A;  3VQY A;  4P3O A;  4P75 C;  4XTX A;  4DK1 A;  4O4J A;  4H02 A;  3NEL A;  2J3M A;  1B76 A;  4YCW A;  1WU7 A;  2Q0A A;  4YHH B;  2I4O A;  3SJB C;  3HFZ A;  5FNV A;  1E1T A;  4PG3 A;  4TQF A;  3JAK A;  3PCO A;  2ZZF A;  1ASY A;  4EX5 A;  4TOI A;  3EFS A;  4UP9 A;  3W3S A;  1TA8 A;  1Q3E A;  4LH7 A;  4CH5 A;  4UCO A;  3VQW A;  4P72 C;  1N32 B;  1FJG B;  4RQE A;  2P5O A;  3TEG A;  5FPO A;  4YJ2 B;  1N34 B;  4DPG A;  1M93 A;  4TVW A;  3SR2 C;  3RGB A;  4LF7 B;  1BBW A;  4B3R B;  2CGH A;  3LSS A;  2ZNJ A;  4TV8 A;  3BA9 A;  1Z7N A;  2C8M A;  1C0A A;  4FLT A;  2ZT7 A;  3EFR A;  2DTO A;  4H2X B;  2CJ9 A;  1FFX B;  1Q43 A;  4DR5 B;  1HXD A;  1SET A;  4EO4 A;  1EIY B;  1JFF B;  3SJC C;  4X65 B;  1X2H A;  3WB0 A;  3HKC A;  2DZ9 A;  3UT5 B;  1KMI Z;  2YXL A;  1ADY A;  2RHQ B;  2VWK A;  4DRX A;  2PY5 A;  1NJ6 A;  4JI5 B;  3VQX A;  3K5M A;  2ZTG A;  4XU3 A;  1HNX B;  2EJG A;  3PZC A;  2PME A;  3A32 A;  4G84 A;  3ETQ A;  1E1O A;  3BPZ A;  3JAR B;  4U3J B;  2GV9 A;  4HBN A;  5JVD A;  1Z7M A;  4CS4 A;  1JJO A;  4UFZ A;  4O4H B;  2C7I A;  2CJA A;  4ZOL A;  5KMG A;  4JI2 B;  4FLX A;  3PN1 A;  5CA1 B;  4KR3 A;  4I55 B;  1B70 A;  5KHI A;  2YI9 A;  4H2S A;  4XEO A;  4YRR A;  1JJC B;  4TWA A;  1S5J A;  4LFA B;  5J2T B;  4TVA A;  5C51 B;  2PTM A;  3BA8 A;  3HTZ A;  2EX3 A;  1WNL A;  3RUX A;  2BTQ A;  1Z5V A;  3A7R A;  2XGT A;  4DR3 B;  3HRK A;  2ALY B;  4WBN B;  2J3L A;  1X56 A;  4LVM A;  1DGS A;  2E65 A;  5BMV B;  3HXY A;  3MF2 A;  2ZCE A;  4P71 C;  4X5O A;  5KX5 B;  3KFU A;  5LXT A;  2ARS A;  4LF9 B;  1TUB B;  4HWP A;  3L4G B;  1NJ5 A;  2ZT5 A;  5LMU B;  1YEW A;  3JSL A;  4FLW A;  3T1Y B;  1KMM A;  2DQ0 A;  5GON A;  3QO7 A;  4X62 B;  4K88 A;  4XTV A;  3HY0 A;  1XHZ A;  4X20 A;  4K86 A;  3V7S A;  3RL6 A;  5EZY B;  1VF7 A;  1ADJ A;  1NYQ A;  2I4L A;  5CA0 B;  2UU9 B;  1XI1 A;  2AMC A;  3ZS8 C;  1BIB A;  4JI0 B;  2ZT6 A;  4CC5 A;  2XHB A;  3BRC A;  4YCV A;  3A31 A;  3QG5 A;  3MEY A;  2PYL A;  4LF8 B;  3UH0 A;  1I7F A;  5ELN A;  5IYZ B;  5EIB C;  2RQ6 A;  4UCR A;  3ZED A;  5KHK A;  2ZXF A;  1IL2 A;  2UXB B;  1G5H A;  2DTH A;  5BR8 B;  1O9G A;  3P8V A;  4LFB B;  4K87 A;  4HNA B;  4O2D A;  4KL1 A;  4LH6 A;  1NYR A;  5LP6 C;  3RKX A;  2PYJ A;  3IG2 A;  4WJ3 M;  4DV2 B;  4YRP A;  3ICX A;  1P49 A;  2PUS A;  4JI4 B;  1USY C;  4HVC A;  4YRS A;  4LFC B;  4X66 B;  4WI1 A;  3UQ8 A;  4GKK B;  4O2B B;  5LA6 B;  3RYH B;  4NCX A;  4EB6 A;  4H2V A;  4AH6 A;  4KR2 A;  3HKD A;  5CB4 A;  3A2F A;  4D7T A;  3V8L A;  3R07 A;  1SKV A;  1KOG A;  4WJ4 A;  4I50 A;  5JQG B;  4DV0 B;  5JCO A;  3QNE A;  4HWR A;  2Q5H A;  4CS3 A;  2VQF B;  4BW9 A;  2F1M A;  1I94 B;  2DVE A;  1L8D A;  2YIB D;  5IJ0 A;  5IJ9 B;  4X1K A;  4FFB B;  1VQZ A;  1M5I A;  4DV1 B;  4I4T A;  3RYF A;  2RHS B;  4FVM A;  3A5Z A;  4YRF A;  5LYJ A;  5JH7 A;  3E9I A;  3WQZ A;  3RAC A;  3P8T A;  4FLV A;  4H2W A;  4TV9 A;  3MQZ A;  4LR3 A;  5LOV B;  4ZTU B;  3IKM B;  3VQV A;  4CS2 A;  2IY5 A;  3TEH B;  3HKE B;  2PGG A;  3RYI A;  1NJ1 A;  5LMN B;  3DSQ A;  3JAL B;  4P72 A;  2DQ3 A;  4LVJ A;  4P3P A;  1T5E A;  2CJB A;  3QO8 A;  1X55 A;  4NXN B;  1LYL A;  2E5L B;  4GKJ B;  4YRC A;  3N2G B;  3HXZ A;  4UP7 A;  1FYF A;  1WLE A;  4YJ2 A;  2ARU A;  11AS A;  4XU2 A;  2ZR3 A;  1SQG A;  3E22 B;  3IAY A;  4O4I B;  4Q6G A;  3VBB A;  4OP0 A;  2QHU A;  1W66 A;  4O2A B;  4FLZ A;  4FM0 A;  4NXM B;  2P5I A;  1TVK B;  2Q5I A;  4UCU A;  2ZM6 B;  4P73 A;  3M7M X;  4YRM A;  5D5Q A;  2QHV A;  4DV7 B;  4B3T B;  4H2X A;  5EYP B;  1FFX A;  1EIY A;  1JFF A;  2ZT8 A;  3SGI A;  3RYC A;  3UT5 A;  3JAW B;  4EFE A;  2RHQ A;  4ZI7 B;  4CH6 A;  2Q7E A;  2QHT A;  2ART A;  3HKB B;  3G1Z A;  4DV5 B;  4PHC A;  3JAS B;  4O4L B;  1M4U A;  3K5O A;  4X1I B;  2BTO A;  1QF6 A;  2ZIN A;  4TUY B;  2KKW A;  1SA0 B;  2DEQ A;  3JAR A;  4U3J A;  4K8X A;  4YY3 B;  4X1Y B;  1BIA A;  4O4H A;  4DR1 B;  1JMK C;  4CC6 A;  1H4V B;  5JJE B;  4PI0 A;  5CA1 A;  2QHS A;  4YJ3 B;  3A74 A;  4I55 A;  2F95 B;  5J2U B;  1X4T A;  3JAT B;  2ODR C;  3OTO B;  2F4V B;  1JJC A;  4ZTZ B;  5HGQ A;  2R70 A;  5J2T A;  4LVL A;  1EVL A;  3REX A;  5EIB D;  2E1H A;  3V7R A;  4YRL A;  4F6R B;  4P74 A;  4YRE A;  2ALY A;  1QE0 A;  2EAY A;  3RWR D;  2PZS A;  3HXX A;  4YRI A;  5BMV A;  1YB3 A;  4DUY B;  4XTU A;  5KHH A;  5KX5 A;  4FLY A;  4JI7 B;  4NVP A;  4UCS A;  1TUB A;  3L4G A;  4DUZ B;  1ATI A;  1Q8I A;  2DTI A;  4FM1 A;  2P22 C;  4RDX A;  4LNU B;  2ZIM A;  3ERR A;  4JI3 B;  3B2E E;  1X2G A;  1J5E B;  3HFV A;  4UPA A;  4WF2 A;  1NNH A;  4DV6 B;  1XMO B;  4XEM A;  1BBU A;  1TGO A;  4YCU A;  4YRQ A;  5C52 B;  5EZY A;  4DR6 B;  4B08 A;  4FLU A;  5CA0 A;  4J15 A;  4H2U A;  3HRI A;  2HEP A;  5LP6 B;  4B3S B;  4DR7 B;  4IIJ B;  5F5W A;  3BHP A;  1N33 B;  4LVK A;  3SJA C;  2R9A A;  4JI8 B;  3OD1 A;  2EJF A;  4L8J A;  2HNI A;  3T1H B;  4JV5 B;  4AHC A;  5K1X A;  2E41 A;  3N2K B;  4LF4 B;  3K5L A;  3RFR A;  5ITZ B;  2QM4 A;  1V9P A;  5IYZ A;  1B7Y B;  1X54 A;  2AKW B;  4DV3 B;  1PYS B;  5C8Y B;  3QO5 A;  2CAZ C;  1RIQ A;  3L1A A;  4ZIB A;  2FYK A;  3V8K A;  4JYA B;  2DKG A;  1ZAU A;  2EL9 A;  3HXW A;  4HNA A;  4IHJ B;  3K58 A;  4B3M B;  3M4Q A;  2R72 A;  3UFG A;  3IAL A;  2XTI A;  3P8Y A;  4YRG A;  4UCV A;  4UCT A;  2E64 A;  2ZR2 A;  3A7A A;  3CSX A;  2UUB B;  3FFQ A;  4CH3 A;  2DJZ A;  4ZHQ B;  4I9Q A;  4O4J B;  5ELO A;  4O2B A;  1HW7 A;  5LA6 A;  1O9H A;  3RYH A;  1QQC A;  3HFZ B;  4P75 A;  1D5A A;  5FNV B;  3PCO B;  3JAK B;  5D5P A;  3U0Z A;  2EWN A;  5JCO C;  2EJ9 A;  1YFT A;  1N36 B;  5JJN B;  4JI6 B;  5JQG A;  4CH4 A;  1HTT A;  1N9W A;  3HY1 A;  2ZGW A;  2DZC A;  1H4Q A;  4G85 A;  4BWA A;  5IJ9 A;  2YI8 A;  4FFB A;  2RHS A;  1G6U A;  4XU1 A;  4TV8 B;  1RSO A;  2VWJ A;  1WNS A;  1XMQ B;  4TTV A;  1XHX A;  3I7F A;  5IWA B;  4OX9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...