2ZNMA

Oxidoreductase nmdsba3 from neisseria meningitidis
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
185
structure length
185
Chain Sequence
LTEGEDYLVLDKPIPQEQSGKIEVLEFFGYFCVHCHHFDPLLLKLGKALPSDAYLRTEHVVWQPEMLGLARMAAAVNLSGLKYQANPAVFKAVYEQKIRLENRSVAGKWALSQKGFDGKKLMRAYDSPEAAAAALKMQKLTEQYRIDSTPTVIVGGKYRVIFNNGFDGGVHTIKELVAKVREERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Structural and Biochemical Characterization of the Oxidoreductase NmDsbA3 from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Oxidoreductase
total genus 56
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2znmA00
2PMTA 3BCIA 1ZL9A 2R5GA 1TI1A 4O92A 4Q5FA 2IL3A 1CQHA 2HZEB 5DDLA 3IHQA 4D73A 2AJQB 5CP1A 3J7Yk 2M46A 3KM6A 3H93A 5AIXA 4KCEA 3KTBA 1B8XA 2L4QA 5GZZB 1M9AA 2I1UA 2LSTA 2HE3A 4MJAA 4WETA 3M9JA 4WBRD 5C00A 1TDIA 4Z7XA 3Q18A 9GSSA 2O89A 1SJIA 4MH2A 1TRUA 5D9WA 2OE3A 1TP9A 4ZL8A 4ZBDA 4K0NA 1FHEA 3KP8A 3M8NA 2OADA 1ZYEA 2LQQA 4POLA 3ED3A 2I9HA 4BA7A 2E2GA 1SKSB 1HQOA 3QAWA 1K0NA 1EWXA 11GSA 4WEYA 1GWCA 3FEUA 2O7KA 3APQA 5JCWA 4TR1B 1M7TA 3F3QA 3DKSA 3GFKA 4HJMA 2HFDA 5F07A 3DMLA 3QFAC 3LG6A 3TDGA 3OR5A 1WMJA 3PR8A 5CRGA 2GVPA 5ECNB 1O8WA 2L4CA 1U3AA 2H30A 5JCUA 1WP0A 4MF7A 1F37A 3GIXA 2OACA 5IMDA 2REMA 2BMXA 2HRFA 3GA4A 4L0WA 4K9ZA 4TN8A 1M9BA 2H6ZA 1GTBA 2L59A 4NMUA 3F4TA 1JZRA 1Q4JA 2HZFA 1FVJA 1GULA 1XWGA 2JADA 2H1AA 2VD0A 4BPYA 1M2AA 4K7IA 1Z7PA 2C0FA 4NWYA 5IOWA 4ZILA 2VCZA 4EE0A 1FB6A 3DRNA 4KB3A 2F8AA 2P5QA 2VIMA 4O5RA 5D9VA 4QL7A 3I9V2 2R3XA 2C0GA 2VLTA 5JWOB 2YANA 4CDOA 1XXUA 3F9UA 3IK9A 4KUNA 2KP1A 3TJKA 4KSMA 1B4QA 2PN8A 3IPZA 3P8WA 7GSSA 2YV9A 4ECIA 4F2IA 4D73B 2AAWA 2P0GA 4MPGA 3VWXA 2GSTA 2LS5A 2CV4A 3IA1A 1ERWA 2ON5A 5EL8A 4NHWA 3QAVA 4JEDA 5IM9A 3TOUA 2CVDA 3GSTA 3C1RA 1XWKA 3G9BA 3QD9A 1G6WA 2O85A 2NBSA 4LA1A 5G1KA 1O73A 1PGTA 3GN3A 2LJAA 2JZSA 4MCUA 4IW9A 4YQUA 3ERGA 2V6OA 1O6JA 1O81A 5G30A 3HCZA 5IMVA 3D6IA 4LL4B 2F51A 2FD3A 4TOPA 3M3MA 4XS4A 1Z9HA 3HDCA 3H4KA 1WWJA 1PKWA 2FWHA 1V40A 2MYGA 4PGTA 3FYGA 2OBKA 2WDUA 4K2DA 3HVSA 4KSOA 1X9SB 3ME7A 2KUCA 3QFBC 2ZCTA 5DJMA 2TRCP 4MH3A 4IKHA 3LQ7A 5A4UA 3TJJA 1SD8A 2QKEA 2DJ2A 4H86A 5IMAA 1USBA 1PN9A 4IN0A 3CSHA 2HRNA 1X9MB 1TKDB 1B9XC 1X5CA 3VURA 2LV3A 2RUEA 2IFQA 1PL2A 4AJ6A 1SYRA 1OC9A 2H19A 2GQMA 4TR3A 1WIKA 3VFIA 3KH7A 6GSTA 1JFUA 1PRXA 1UVZA 2NPBA 3UIWA 2C3QA 2C0EA 2YWNA 1S3CA 3A2VA 2IMDA 3L78A 5CREA 3P2AA 3GKNA 3O3TA 3M1GA 4ZXGA 3DIEA 2FCHA 2PU9C 2BJXA 3IAM2 2QC7A 3CMIA 3DVXA 1GUHA 4CHSA 4GSNA 3HY2A 2ES7A 2IN3A 2WS2A 2GT5A 3K8NA 5G1LA 3FR6A 3ZMKA 2RM5A 1GSUA 3GX0A 2HI7A 2QGVA 2FA4A 1SKWB 2DJKA 4YQMA 2FGXA 3LGCA 1SK0A 3GURA 3BD2A 5A5KA 3F6FA 4ECCA 5COHA 1PL1A 3F4SA 3IOSA 4IGJA 2DC5A 4GTUA 3ZFBA 3NOFA 4RI6A 1OVNA 2CZ3A 4HU7A 2WULA 1B9YC 2EC4A 2B6MA 2JZTA 1DUGA 4WF4A 1Y6EA 5HR2A 5JWQB 1W4VA 1IYIA 1GTIA 2ZNMA 4PNGA 1EV9A 1UN2A 2GQKA 2MMZA 2AYTA 5HR0A 3TGZA 4KGIA 2V41A 5LNKe 5B8BA 5FT3A 1A2JA 5AGYA 4I2UA 4G10A 1JZDA 4ZBBA 4MLYA 3L0HA 4HUAA 5H5QA 1SU9A 1SL1B 1AQWA 4MJEA 3U6VA 1JLWA 4F0CA 4XS4B 2HYXA 3EURA 1ZYQB 3BCKA 2LKUA 1RQMA 3GL3A 5D73A 4NHZA 3G7JA 1N2AA 4WR5A 2RLIA 4GSTA 1R7HA 2MMNA 1XWCA 3GRXA 5D93A 2PPTA 3KEBA 1WOUA 4PX1A 4E8EA 1OC8A 4OD7A 1YY7A 4MF6A 2LEGA 3HKRA 5HQPA 1OAZA 3M9KA 3C8EA 4BWQA 4LMWA 2IFQB 2EIRA 5HFGA 5KN3A 3ZRDA 3D4TA 3IAS2 1OC9B 2IWTA 1PX6A 4JR6A 1XBSA 3IC4A 4KA0A 2DIYA 2H01A 1J08A 1TK0B 5A4WA 3RAZA 5AIVA 3HVXA 1XW5A 1AAZA 1DBYA 3CYNA 5D9XA 4IBPA 3FZ5A 5B6MA 2GSRA 3UVHA 5GSSA 4L8EA 3L9UA 3WGEA 4Q5QA 2IJYA 2H1DA 2CAQA 2O8VB 4N10A 3EE2A 1X5EA 3M0FA 2VL3A 1FO5A 4HZ2A 4V1Ag 4TVEA 1A23A 22GSA 4JU5A 1XOBA 2FWEA 1N8JA 1OKTA 2XHFA 3F8UA 2EIQA 3N5OA 4OFTA 2GTUA 3GTUB 3PH9A 1O8XA 4OO4A 1S3DA 2AUVA 4ZL9A 4RQRA 1TJDA 3VLNA 5ECQB 2K9FA 2N5BA 4XTSA 5G2ZA 3ZL5A 1VGLA 18GSA 1K0OA 5LD0A 4P3YB 3ZYWA 4HEA2 1A2LA 1Y25A 4I5QA 4PUFC 5ECOB 2MMOA 3TRXA 1M2BA 2VUPA 2L5LA 1AW9A 2LTKA 3HJOA 3VK9A 1BX9A 4HDEA 5E59A 1T1VA 2VLVA 2VM2A 1BYEA 2B7JA 5HR3A 2H0IA 2C8UA 4O32A 2VL9A 2CQ9A 4XCSA 4L0UA 1YDKA 1PQNA 5J9CA 4AJ7A 1R4WA 3FK8A 2G2QA 4DSQA 1VF3A 3LYKA 3PGTA 4LMVA 1TU7A 2AV4A 3ZVJA 1C72A 1V2AA 1ERUA 4EXJA 2R6KA 3D21A 1K0BA 4QL9A 4F82A 1DE2A 1ZZYA 4Q5RA 4AJ8A 2VCWA 2MBTA 4NPBA 3ZZXA 5AISA 2HSHA 4MK3A 1YJ6A 3F4RA 1VF4A 3GKKA 3F63A 1GL8A 3Q6OA 5J3RA 1Z7RA 5GAPD 1MD3A 1TRSA 3DD3A 1BG5A 2IMEA 4YH2A 3KXOA 2CA8A 3RPPA 4GSSA 4K0GA 1F3AA 16GSA 1GSSA 1QUWA 4XHMA 3KGKA 2GS3A 3CRUA 3AY8A 2DJ3A 4BL7A 2H74A 3HVVA 2OE1A 2VO4A 2LUSA 3KMNA 2L6DA 1T8EB 4TXOB 2X99A 2FLSA 1K0DA 1CQGA 3RHBA 2B1LA 4POKA 3C71A 3H79A 1U3IA 4MZBA 4KX4A 2VCVA 1OE8A 4X43A 4MPFA 5AN1A 3D0ZA 4ZBAA 2XBQA 5D8IA 3FZ9A 2DJJA 4DVCA 1RK4A 2KHPA 4PNFA 2C80A 4NV2A 2GLRA 1SENA 13GSA 3KMOA 1LBKA 2PBJA 1V57A 4J57E 5LCZA 3S9FA 3SWLA 1YKAA 3EU4A 5F06A 3ZITA 2H70A 4MZCA 3FHKA 4HQSA 1DSBA 3EC3A 2MBSA 3ZFLA 2IMIA 2IIYA 3LXTA 3FRCA 3IR4A 3ZMLA 3RHCA 1XWBA 4X0XA 3FZAA 4IS0A 2MZCA 5IMFA 2V6KA 2YWIA 2YWOA 1S3AA 3D4MA 2F9SA 2KOKA 5J4UA 3MDKA 4BVXA 2E7PA 3ISOA 3BJ5A 4V1Ap 4WBJA 3C1SA 4K7NA 4OMVA 1MDKA 2FHEA 1SJZA 2FUG2 1QXHA 5DQYA 4POMA 3SBCA 2LRTA 2K6VA 2B7KA 4JE1A 1ZGNA 2R2JA 3EU3A 2H0GA 3TKRA 4G9HA 1NSWA 3A3TA 2LQOA 1SD9A 4ECBA 5G5EA 2AB6A 2CX3A 4XRDA 3TJGA 1R5AA 1K3LA 3ZVJD 1EP7A 3IV4A 2VD1A 4MDCA 5FWGA 1F2EA 1GLPA 2EIOA 5CRWA 2LRNA 4KE3A 1SJ6A 4J2FA 4JR4A 3ZLPA 5F05A 3FY7A 4TR4A 1A2MA 1K3OA 2NTOA 4FYCA 1ERVA 4PQIA 3TB2A 1TTZA 4FYBA 1THXA 3TKPA 2E0QA 1H75A 2FNOA 2OJLA 4ZB9A 2LJRA 1YEXA 3ERWA 3WT2A 4HQZA 3VI5A 1XVWA 4AGSA 1A0RP 5ECKB 4HS1A 2DSAA 2KLXA 1F3BA 1ON4A 4JZQA 2H75A 4HJ2A 1EV4A 17GSA 1TOFA 4AF2A 4LLRA 5KN1A 2A2RA 1PA3A 2V32A 3MWHA 1Q98A 4KCAA 4MA9A 4IP6A 1WE0A 3LFLA 4RI7A 3APSA 3RBTA 4KAEA 2M80A 4F0BA 4XS1A 3JCML 3U5RE 1WJKA 5G31A 1HD2A 1BEDA 5EY6A 1GH2A 5CRHA 1TU8A 1FAAA 4TXVA 2WCIA 3GTUA 1AQXA 3KH9A 1R5PA 5A4VA 1AC1A 1VRSD 5CO3A 1U87A 2N5FA 5CNWA 3KZQA 1FW1A 1MDJA 2VAFA 1O7UA 1ZOFA 1R26A 2DJ1A 4ML1A 4ZIJA 3IK7A 4QQ7A 3TJFA 3IDVA 1TXXA 1ZCPA 6GSWA 2PVOC 4ZL7A 3FZ4A 1T4YA 3US3A 5DCHA 4EL1A 1QQ2A 3F0IA 4EKZA 1Z6NA 3EINA 3FW2A 2VOCA 3QCPA 5D96A 3HZ4A 3TKSC 1SK2A 4G19A 5ECRB 2YJ7A 1TRVA 1I5GA 1GSYA 1X5DA 2FA8A 1SK1A 1T7PB 4X1UA 2M72A 3D22A 3VWWA 2OE0A 3GX8A 4IELA 3DEXA 2PVQA 3CXGA 2HSYA 3G7YA 3APOA 3WT1A 4GQFA 1IYHA 5J5NA 3DGQA 2L5OA 1EGRA 3CSJA 4IHUA 3A2WA 3FR3A 5CAXA 1GSEA 2OA7A 3TJBA 2RIIA 2GQLA 2YJHA 4MP4A 1X9WB 2VCTA 1XZOA 4F9ZA 2CZ2A 1F9MA 1TRWA 2YP6A 3EVIA 2QSIA 4F03A 2DIZA 6GSVA 4ILFA 3TUEA 3TRPA 3UMAA 2HXKA 1YF1A 1G7EA 3FKFA 4J56E 2JZRA 2OBIA 2C3NA 1AIUA 3DYRA 5F0GA 10GSA 1ST9A 1ML6A 2GGTA 1PD21 1NM3A 4EVMA 3KIJA 1EEJA 3ZTLA 1XFLA 3HD5A 3WYWA 2V2GA 3HA9A 4TRXA 4ACSA 3CTFA 2YCDA 3TKSA 4OCEA 2DJ0A 4ZB6A 1AXDA 5KN2A 2XC2A 3UL3A 2YNXA 3I69A 3Q19A 4NV5A 3UVTA 5INYA 12GSA 2H8LA 1EP8A 4TXOA 5J9BA 2O87A 3F6DA 4ZB8A 2WGRA 1J9BA 1A24A 3BBYA 3KCMA 3TRQA 1K0MA 1TI3A 1GSDA 4GXZA 8GSSA 2K18A 4PQ1A 3ZIVA 4FIWA 4KDYA 4IQ1A 2CVBA 3GV1A 4IJIA 5IQYA 2H66A 4KW6A 3GKXA 4KDUA 3LORA 1NHOA 3GNJA 2H76A 3MNGA 1DE1A 2WRTA 2YZHA 3WD6A 1OKDA 4ULXA 3NZNA 5IPGA 1U88A 4EDZA 2ALBA 3LJRA 3KD0A 1KNGA 1NW2A 1KTEA 4XRAA 1GSQA 1EOHA 3GMFA 2D2ZA 3O6TA 2C4JA 3WGXA 4TKYA 1SL2B 5EVOA 1BJXA 4N11A 5HR1A 3FR9A 5KEJA 2H6YA 1QFNA 4TW5A 4K6XA 2LRCA 1JZWA 1MEKA 3D5JA 3DXBA 5ECPB 3E3EA 3EMXA 1SYXA 5D9TA 5ENUA 1QK8A 3GUSA 1PSQA 5L71A 3A2XA 4FO5A 1THOA 3QPMA 4FYUA 1GTUA 1Z3EA 5JWRB 1JHBA 1MD4A 4NAXA 3W8JA 1FB0A 1B4PA 5H5SA 3LSZA 3IE3A 5J41A 3VWUA 2C0DA 2VL2C 1V98A 3EWLA 3LYPA 2LNTA 3IXRA 2VLUA 3GSSA 5FHIA 1YKCA 5IMZA 5DALB 2NDOA 1SKRB 4K7OA 4I8BA 3BOAA 5DJLA 3H8QA 3TKSE 3L9VA 4IJ3A 2JSZA 1K0AA 4MJBA 2TIRA 2LNSA 5G5FA 4ISDA 4GCIA 1XWAA 4GF0A 1VF1A 3G7IA 4MF5A 3MSZA 2K8SA 3IRAA 4FH8A 1M99A 3HJMA 2WFCA 2A2SA 2F3MA 4V2NA 4RUVA 2R37A 4N0VA 2XPDA 1GUMA 2H72A 1PX7A 1NHYA 5DAKB 1X0RA 5ELGA 4HU9A 2VM1A 4JBBA 1EEMA 2C1YA 2YPMA 1MTCA 2RM6A 3W8SA 1YEPA 1YF0A 1A8YA 1J0FA 2H73A 4ML6A 4MZWA 3CTGA 6GSYA 2VCQA 2YV7A 4WF5A 3NIVA 1YQ1A 4E8HA 2H6XA 2WB9A 3UBLA 1JZOA 4NXIA 2YN1A 5F8BA 4WXTA 2VL2A 3LEFA 3VWVA 4EO3A 2DBCA 4GWRA 4GRFA 5IMCA 5ID2A 2L6CA 2IPAA 4HOJA 1WPIA 2BTOT 1ZMAA 2I81A 3VI7A 4PURA 4JRRA 4OFMA 1T00A 3UEMA 1GUKA 2WZ9A 1JLVA 2H1BA 1XW9A 5ECSA 4OFNA 1G6YA 3R2QA 6GSXA 2HNLA 5ECIB 2CVKA 4TR0A 4GLTA 3KJYA 5CRDA 1H4OA 4KDXA 4V2LA 1GLQA 4YAVA 4MMMA 1EGOA 4GQCA 1GRXA 2FWGA 2PUKC 2A4VA 1F6MC 3VPQA 4ID0A 14GSA 4EUYA 1TK8B 5GSTA 1XPVA 5B7CA 2K8VA 2XBIA 1ACVA 2C3TA 3GH9A 2IMKA 2GZPA 1Z6MA 1OE7A 2PWJA 4K1FA 3P7XA 1MDIA 1WRYA 4XIHA 5ECMB 3TKQA 3DWVA 2L57A 3KTLA 1BQ7A 3O76A 3TOTA 4XS6A 1VF2A 3QR6A 2G0FA 2HT9A 3WGDA 1QMVA 2WJUA 3ME8A 5C04A 3VPTA 4L5OA 2H0HA 5ECLB 4L5LA 3UOMA 3L4NA 4POBA 5GAND 3L9SA 1GSFA 2X8GA 4KNDA 1AUCA 1OC3A 1ABAA 4WR4A 4V2MA 4O7HA 3C7MA 1XCCA 4DSSA 3ZIJA 4PXOA 5DVBA 1XW6A 2FY6A 3PINA 20GSA 1G0TA 2YOIA 3N9JA 1K0CA 3GH6A 2NVLA 2MMAA 5DQSA 5H5RA 3E0UA 2YZUA 1HNAA 4OO5A 2DMLA 1URMA 3C73A 2I3YA 3KP9A 1OYJA 1E2YA 2X8HA 5ID2B 2VCXA 2JSYA 5ABRA 5IIZA 1GNWA 3HHVA 2YWMA 4LL1B 1PKZA 4OCFA 1HYUA 1Z5YE 2CAIA 2J23A 3I6AA 2HLSA 1QGVA 2X64A 1AQVA 3CSIA 4MABA 2DMMA 4IVFA 2H71A 4DEJA 1B48A 1A0FA 1EZKA 2Z9SA 3F3RA 3UBKA 1XVQA 1E6BA 3P90A 4BVYA 2J9HA 4Q5NA 5IPHA 3E9JB 4EDYA 4MJCA 2B5XA 5EPFA 2ZUPA 19GSA 2RUFA 2X8CA 5E4WA 5IO0A 1BAYA 5DCGA 1LJRA 1RW1A 1HNBA 1KBNA 4CW9A 3QDNA 1TK5B 3QMXA 4EC0A 5DBQA 2HZEA 1EOGA 5B8AA 4PQHA 2B1KA 3W6GA 4G2EA 3RDWA 4KH7A 4HI7A 1PMTA 1XOAA 3UJ1A 3RPNA 3EMPA 2GZYA 3MAKA 3GKMA 2GSQA 2TRXA 4DSRA 1GNEA 4OWYA 2B5YA 3CBUA 2B3SA 4IP1A 3QAGA 5DALA 6GSUA 4I97A 5JCGA 2JL4A 1FVKA 1KEBA 1T3BA 1K3YA 1G7OA 2FWFA 2V1MA 3GYKA 1U6TA 2XPEA 2JACA 2P5RA 4I2TA 2R4VA 4YAPA 3GHAA 2E2MA 4DSSB 2GDRA 5HFKA 1FOVA 1YZXA 2DLXA 1LU4A 2CT6A 1V58A 4YQVA 1GP1A 3ZREA 4TR1A 1M0UA 3EYTA 5KN0A 5IO2A 5DAKA 3LWAA 3H1NA 1O85A 2LJKA 2P31A 3HYPA 2GSSA 3QOUA 1T4ZA 1TW9A 1ERTA 4BWSA 1M2DA 2GT6A 3A5WA 3V1WA 2KP2A 4ECJA 3DVWA 4N30A 2JU5A 5HFIA 2CX4A 1I9DA 2N5AA 5ECHB 1FG4A 2PERA 2IMFA 3GL5A 5ELAA 4WKWA 1V9WA 2AHEA 3I43A 1SL0B 3UAPA 2B5EA 4PUAA 2F8FA 2I4AA 3CRTA 3Q74A 4RQXA 3IBHA 3TCOA 4IQAA 5CYYA 1ILOA 3HJPA 1W89A 1UA5A 4K8MA 6GSSA 1GTAA 4EF0A 4I6XA 2ON7A 3HXSA 3J7Yb 2GZZA 4HZ4A 2OKAA 5IOXA 5B6NA 1A8LA 2PGTA 3ERFA 2H1GA 1XIYA 3HZ8A 4N0ZA 3LXZA 1HNCA 3UARA 1UC7A
chains in the Genus database with same CATH superfamily
2PMTA 4FQUA 3BCIA 1ZL9A 2R5GA 1TI1A 4O92A 4Q5FA 2IL3A 1CQHA 2HZEB 5DDLA 3IHQA 4D73A 2AJQB 5CP1A 3J7Yk 2M46A 3KM6A 3H93A 5AIXA 4KCEA 3KTBA 1B8XA 2L4QA 5GZZB 1M9AA 2I1UA 2LSTA 2HE3A 4MJAA 4WETA 3M9JA 4WBRD 5C00A 1TDIA 4Z7XA 3Q18A 9GSSA 2O89A 1SJIA 4MH2A 3LW9A 2A4HA 1TRUA 5D9WA 2OE3A 1TP9A 4ZL8A 4ZBDA 4K0NA 1FHEA 3KP8A 3M8NA 2OADA 1ZYEA 2LQQA 4POLA 3ED3A 2I9HA 4BA7A 2E2GA 1SKSB 1HQOA 4Z2UA 3QAWA 1K0NA 1EWXA 11GSA 4WEYA 1GWCA 3FEUA 2O7KA 3APQA 5JCWA 4TR1B 1M7TA 3F3QA 3DKSA 3GFKA 4HJMA 2HFDA 5F07A 3DMLA 3QFAC 3LG6A 3TDGA 3OR5A 1WMJA 3PR8A 5CRGA 2GVPA 5ECNB 1O8WA 2L4CA 1U3AA 2H30A 5JCUA 1WP0A 4MF7A 1F37A 3GIXA 2OACA 5IMDA 4CY8A 2REMA 2BMXA 2HRFA 3GA4A 4L0WA 5KOXA 4K9ZA 4TN8A 1M9BA 2H6ZA 1GTBA 4K5SA 2L59A 4NMUA 3F4TA 1JZRA 1Q4JA 2HZFA 1FVJA 1GULA 1XWGA 2JADA 2H1AA 2VD0A 4BPYA 1M2AA 3CQFA 4K7IA 1Z7PA 2C0FA 4NWYA 5IOWA 4O5UA 4ZILA 2VCZA 4EE0A 1FB6A 3DRNA 4KB3A 2F8AA 2P5QA 2VIMA 4O5RA 5D9VA 4QL7A 3I9V2 2R3XA 2C0GA 2VLTA 5JWOB 2YANA 4CDOA 1XXUA 3F9UA 3IK9A 4KUNA 2KP1A 3TJKA 4KSMA 1B4QA 2PN8A 3IPZA 3P8WA 7GSSA 2YV9A 4ECIA 4F2IA 4D73B 2R0CA 2AAWA 2P0GA 4MPGA 3VWXA 2GSTA 2LS5A 2CV4A 2QA1A 3IA1A 1ERWA 2ON5A 5EL8A 4NHWA 3QAVA 4JEDA 5IM9A 3TOUA 2CVDA 3GSTA 3C1RA 1XWKA 3G9BA 3QD9A 1G6WA 2O85A 2NBSA 4LA1A 5G1KA 1O73A 1PGTA 3GN3A 2LJAA 2JZSA 4MCUA 4IW9A 4YQUA 3ERGA 2V6OA 1O6JA 1O81A 5G30A 3HCZA 5IMVA 3D6IA 4LL4B 2F51A 2FD3A 4TOPA 3M3MA 4XS4A 1Z9HA 3HDCA 3H4KA 1WWJA 1PKWA 2FWHA 1V40A 2MYGA 4PGTA 3FYGA 2OBKA 2WDUA 4K2DA 3HVSA 4KSOA 1X9SB 3ME7A 2KUCA 3QFBC 1M3JA 2ZCTA 5DJMA 2TRCP 4MH3A 4IKHA 3LQ7A 5A4UA 3TJJA 1SD8A 2QKEA 2DJ2A 4H86A 5IMAA 4EIQA 1USBA 1PN9A 4IN0A 3CSHA 2HRNA 2UZ8A 1X9MB 1B9XC 1TKDB 1X5CA 3VURA 2LV3A 4CY6A 2RUEA 2IFQA 1PL2A 4AJ6A 1SYRA 1OC9A 2H19A 2GQMA 4TR3A 1WIKA 3VFIA 3KH7A 6GSTA 1JFUA 1PRXA 1UVZA 2NPBA 3UIWA 2C3QA 2C0EA 2YWNA 1S3CA 3A2VA 2IMDA 3L78A 5CREA 3P2AA 3GKNA 3O3TA 3M1GA 4ZXGA 3DIEA 2FCHA 2PU9C 2BJXA 3IAM2 2QC7A 3CMIA 3DVXA 1GUHA 4CHSA 4GSNA 3HY2A 2ES7A 4USSA 2IN3A 2WS2A 2GT5A 3K8NA 5G1LA 3FR6A 3ZMKA 2RM5A 1GSUA 3GX0A 2HI7A 2QGVA 2FA4A 1SKWB 2DJKA 4YQMA 2FGXA 3LGCA 1SK0A 3GURA 3BD2A 5A5KA 3F6FA 4ECCA 5COHA 1PL1A 3F4SA 3IOSA 4IGJA 2DC5A 4GTUA 3ZFBA 3NOFA 4RI6A 1OVNA 2CZ3A 4HU7A 2WULA 1B9YC 2EC4A 2B6MA 2JZTA 1DUGA 4WF4A 1Y6EA 5HR2A 5JWQB 1W4VA 1IYIA 1GTIA 2ZNMA 4PNGA 1EV9A 1UN2A 2GQKA 2MMZA 2AYTA 5HR0A 3TGZA 4KGIA 2V41A 5LNKe 5B8BA 5FT3A 1A2JA 5AGYA 4I2UA 4G10A 1JZDA 3R3EA 4ZBBA 4MLYA 3L0HA 4HUAA 5H5QA 1SU9A 1SL1B 1AQWA 4HSCX 4MJEA 3U6VA 1JLWA 4F0CA 4XS4B 2HYXA 3EURA 1ZYQB 3BCKA 2LKUA 2R0GA 1RQMA 3GL3A 5D73A 4NHZA 4G0LA 3G7JA 1N2AA 4WR5A 2RLIA 4GSTA 1R7HA 2MMNA 3FMWA 1XWCA 3GRXA 5D93A 2PPTA 3KEBA 1WOUA 4PX1A 4E8EA 1OC8A 4OD7A 1YY7A 4MF6A 2LEGA 3HKRA 2A2PA 5HQPA 1OAZA 3M9KA 3C8EA 4BWQA 4LMWA 2IFQB 2EIRA 5HFGA 5KN3A 3ZRDA 3D4TA 3IAS2 1OC9B 1S3RA 2IWTA 1PX6A 4JR6A 1XBSA 3IC4A 4KA0A 5BRTA 2DIYA 2H01A 1J08A 1TK0B 5A4WA 3RAZA 4YKGA 5AIVA 3HVXA 1XW5A 1AAZA 1DBYA 3CYNA 5D9XA 4IBPA 3FZ5A 5B6MA 2GSRA 3UVHA 5GSSA 4L8EA 3L9UA 3WGEA 1PN0A 4Q5QA 2IJYA 2H1DA 2CAQA 2O8VB 4N10A 3EE2A 1X5EA 3M0FA 2VL3A 1FO5A 4HZ2A 4V1Ag 4TVEA 1A23A 22GSA 4JU5A 1XOBA 2FWEA 1N8JA 1OKTA 2XHFA 3F8UA 2EIQA 2X4AA 3N5OA 4OFTA 2GTUA 3GTUB 3PH9A 4ICYA 1O8XA 4OO4A 1S3DA 2AUVA 4ZL9A 4RQRA 1TJDA 3VLNA 5ECQB 2K9FA 2N5BA 4XTSA 5G2ZA 3ZL5A 1VGLA 18GSA 1K0OA 5LD0A 4P3YB 3ZYWA 4HEA2 1A2LA 1Y25A 4I5QA 4PUFC 5ECOB 2MMOA 3TRXA 1ZYNA 1M2BA 3MYDA 2VUPA 2L5LA 1AW9A 1XG8A 2LTKA 3HJOA 3VK9A 1BX9A 4HDEA 5E59A 1T1VA 2VLVA 2VM2A 1BYEA 2B7JA 5HR3A 2H0IA 2C8UA 4O32A 2VL9A 4PTSA 2CQ9A 4XCSA 4L0UA 1YDKA 1PQNA 3A5IA 5J9CA 4AJ7A 1R4WA 3FK8A 2G2QA 4DSQA 1VF3A 3LYKA 3PGTA 4LMVA 1TU7A 2AV4A 3ZVJA 1C72A 1V2AA 1ERUA 4EXJA 2R6KA 3D21A 1K0BA 4QL9A 4F82A 1DE2A 1ZZYA 4Q5RA 4AJ8A 2VCWA 2MBTA 4NPBA 3ZZXA 5AISA 2HSHA 4MK3A 1YJ6A 3F4RA 1VF4A 3GKKA 3F63A 1GL8A 3Q6OA 5J3RA 1Z7RA 5GAPD 1MD3A 1TRSA 3DD3A 1PFOA 1BG5A 2IMEA 4YH2A 3KXOA 2CA8A 3RPPA 4GSSA 4K0GA 1F3AA 16GSA 1GSSA 1QUWA 4XHMA 3KGKA 2GS3A 3CRUA 3AY8A 2DJ3A 4BL7A 2H74A 3HVVA 2OE1A 2VO4A 2LUSA 3KMNA 2L6DA 1T8EB 4TXOB 2X99A 2FLSA 1K0DA 1CQGA 3RHBA 2B1LA 4POKA 3C71A 3H79A 1U3IA 4MZBA 4KX4A 2VCVA 1OE8A 4X43A 4MPFA 5AN1A 3D0ZA 4ZBAA 2XBQA 5D8IA 3FZ9A 1M3IA 2DJJA 4DVCA 1RK4A 2KHPA 4PNFA 2C80A 4NV2A 2GLRA 1SENA 13GSA 3KMOA 1LBKA 2PBJA 1V57A 4J57E 5LCZA 3S9FA 3SWLA 1YKAA 3EU4A 5F06A 3ZITA 2H70A 4MZCA 3FHKA 4HQSA 1DSBA 3EC3A 2MBSA 3ZFLA 2IMIA 2IIYA 3LXTA 3FRCA 3IR4A 3ZMLA 3RHCA 1XWBA 4X0XA 3FZAA 4IS0A 2MZCA 5IMFA 2V6KA 2YWIA 2YWOA 1S3AA 3D4MA 2F9SA 2KOKA 2HSMA 5J4UA 3MDKA 4BVXA 2E7PA 3ISOA 3BJ5A 4V1Ap 4WBJA 3C1SA 4K7NA 4OMVA 1MDKA 2FHEA 1SJZA 2FUG2 1QXHA 5DQYA 4POMA 3SBCA 2LRTA 2K6VA 2B7KA 5KOWA 4JE1A 1ZGNA 2R2JA 3EU3A 2H0GA 3TKRA 4G9HA 1NSWA 3A3TA 2LQOA 1SD9A 4ECBA 5G5EA 2AB6A 2CX3A 4XRDA 3TJGA 1R5AA 1K3LA 3ZVJD 1EP7A 3IV4A 2VD1A 4MDCA 5FWGA 1F2EA 1GLPA 2EIOA 5CRWA 2LRNA 4KE3A 1SJ6A 4J2FA 4JR4A 4YKFA 3ZLPA 5F05A 3FY7A 4TR4A 1A2MA 1K3OA 2NTOA 4FYCA 1ERVA 4PQIA 3TB2A 1TTZA 4FYBA 1THXA 3TKPA 2E0QA 1H75A 2FNOA 4KF9A 2OJLA 4ZB9A 2LJRA 1YEXA 3ERWA 3WT2A 4HQZA 3VI5A 1XVWA 4AGSA 1A0RP 5ECKB 4HS1A 2DSAA 4MNNA 2KLXA 1F3BA 1ON4A 4JZQA 2H75A 4HJ2A 1EV4A 17GSA 1TOFA 4AF2A 4BL7B 4LLRA 5KN1A 4Z2RA 2A2RA 1PA3A 2V32A 3MWHA 1Q98A 4KCAA 4MA9A 4IP6A 1WE0A 3LFLA 4RI7A 3APSA 3RBTA 4KAEA 2M80A 4F0BA 4XS1A 3JCML 3U5RE 1WJKA 5G31A 1HD2A 1BEDA 5EY6A 1GH2A 5CRHA 1TU8A 1FAAA 4TXVA 2WCIA 3GTUA 1AQXA 3KH9A 1R5PA 5A4VA 1AC1A 1VRSD 5CO3A 1U87A 2N5FA 5CNWA 3KZQA 1FW1A 1MDJA 2VAFA 1O7UA 1ZOFA 1R26A 4BVXB 2DJ1A 4ML1A 4ZIJA 3IK7A 4QQ7A 3TJFA 3IDVA 1TXXA 1ZCPA 6GSWA 2PVOC 4ZL7A 3FZ4A 1T4YA 3US3A 4K5RA 5DCHA 4EL1A 1QQ2A 3F0IA 2DKIA 4EKZA 1Z6NA 3EINA 3FW2A 2VOCA 3QCPA 5D96A 3HZ4A 3TKSC 1SK2A 4G19A 5ECRB 2YJ7A 1TRVA 1I5GA 1GSYA 1X5DA 2FA8A 1SK1A 1T7PB 4X1UA 2M72A 3D22A 3VWWA 2OE0A 3GX8A 4IELA 3DEXA 2PVQA 3CXGA 2HSYA 3G7YA 3APOA 3WT1A 4GQFA 3PPUA 1IYHA 5J5NA 3DGQA 2L5OA 1EGRA 3CSJA 4IHUA 3A2WA 3FR3A 5CAXA 1GSEA 2OA7A 3TJBA 2RIIA 2GQLA 2YJHA 4MP4A 1ZYPA 1X9WB 2VCTA 1XZOA 4F9ZA 2CZ2A 1F9MA 1TRWA 2YP6A 4K2XA 3EVIA 2QSIA 4F03A 2DIZA 6GSVA 4ILFA 3TUEA 3TRPA 3UMAA 2HXKA 4BIKA 1YF1A 1G7EA 3FKFA 4J56E 2JZRA 2OBIA 2C3NA 1AIUA 3DYRA 5F0GA 10GSA 1ST9A 1ML6A 2GGTA 1PD21 1NM3A 4EVMA 3KIJA 1EEJA 3ZTLA 1XFLA 3HD5A 3HVNA 3WYWA 2V2GA 3HA9A 4TRXA 4ACSA 3CTFA 2YCDA 3TKSA 4OCEA 2DJ0A 4ZB6A 1AXDA 5KN2A 2XC2A 3UL3A 2YNXA 3I69A 3Q19A 4NV5A 3UVTA 5INYA 12GSA 2H8LA 1EP8A 4TXOA 5J9BA 2O87A 3F6DA 4ZB8A 2WGRA 1J9BA 1A24A 3BBYA 3KCMA 3TRQA 1K0MA 1TI3A 1GSDA 4GXZA 8GSSA 2K18A 4PQ1A 3ZIVA 4FIWA 4KDYA 4IQ1A 2CVBA 3GV1A 4IJIA 5IQYA 2H66A 4KW6A 3GKXA 4KDUA 3LORA 1NHOA 3GNJA 2H76A 3MNGA 1DE1A 3EPTA 2WRTA 2YZHA 4EIPA 3WD6A 1OKDA 4ULXA 3NZNA 2QA2A 5IPGA 1U88A 4EDZA 2ALBA 3LJRA 3KD0A 1KNGA 1NW2A 1KTEA 4XRAA 1GSQA 1EOHA 4BVYB 3GMFA 2D2ZA 3O6TA 2C4JA 3WGXA 4TKYA 1SL2B 5EVOA 1BJXA 4N11A 5HR1A 3FR9A 5KEJA 2H6YA 1QFNA 4TW5A 4K6XA 2LRCA 1JZWA 1MEKA 3D5JA 2HRAA 3DXBA 5ECPB 3E3EA 3EMXA 1SYXA 5D9TA 5ENUA 1QK8A 3GUSA 1PSQA 5L71A 3A2XA 4FO5A 1THOA 3QPMA 4O5QA 4FYUA 1GTUA 1Z3EA 5JWRB 1JHBA 1MD4A 4NAXA 3W8JA 1FB0A 1B4PA 5H5SA 3LSZA 3IE3A 5J41A 3VWUA 2C0DA 2VL2C 1V98A 3EWLA 3LYPA 2LNTA 3IXRA 2VLUA 3GSSA 5FHIA 1YKCA 5IMZA 5DALB 2NDOA 1SKRB 4K7OA 4I8BA 3BOAA 5DJLA 3H8QA 3TKSE 3L9VA 4IJ3A 2JSZA 1K0AA 4MJBA 2TIRA 2LNSA 5G5FA 4ISDA 4GCIA 1XWAA 4GF0A 1VF1A 3G7IA 4MF5A 3MSZA 2K8SA 3IRAA 4FH8A 1M99A 3HJMA 2WFCA 2A2SA 2F3MA 4V2NA 4RUVA 2R37A 4N0VA 2XPDA 1GUMA 2H72A 1PX7A 1NHYA 5DAKB 1X0RA 5ELGA 4HU9A 2VM1A 4JBBA 1EEMA 2C1YA 2YPMA 1MTCA 2RM6A 3W8SA 1YEPA 1YF0A 1A8YA 1J0FA 2H73A 4ML6A 4MZWA 3CTGA 6GSYA 2VCQA 2YV7A 4WF5A 3NIVA 1YQ1A 4E8HA 2H6XA 2WB9A 3UBLA 1JZOA 4NXIA 2YN1A 5F8BA 4WXTA 2VL2A 2R0PA 3LEFA 3VWVA 4EO3A 2DBCA 4GWRA 4GRFA 5IMCA 5ID2A 2L6CA 2IPAA 4HOJA 1WPIA 2BTOT 1ZMAA 2I81A 3VI7A 4PURA 4JRRA 4OFMA 1T00A 2DKHA 3UEMA 1GUKA 2WZ9A 1JLVA 2H1BA 1XW9A 5ECSA 4OFNA 1G6YA 3R2QA 6GSXA 2HNLA 5ECIB 2CVKA 4TR0A 4GLTA 3IHGA 3KJYA 5CRDA 1H4OA 4KDXA 4V2LA 1GLQA 4YAVA 4MMMA 1EGOA 4GQCA 1GRXA 2FWGA 4G0IA 2PUKC 2A4VA 1F6MC 3VPQA 4ID0A 14GSA 4EUYA 1TK8B 5GSTA 1XPVA 5B7CA 2K8VA 2XBIA 1ACVA 2C3TA 3GH9A 2IMKA 2GZPA 1Z6MA 1OE7A 2PWJA 4K1FA 3P7XA 1MDIA 1WRYA 4XIHA 5ECMB 3TKQA 3DWVA 2L57A 3KTLA 1BQ7A 3O76A 3TOTA 4XS6A 1VF2A 3QR6A 2G0FA 2HT9A 3WGDA 1QMVA 2WJUA 3ME8A 5C04A 3VPTA 4L5OA 2H0HA 3IC8A 5ECLB 4L5LA 3UOMA 3L4NA 4POBA 5GAND 3L9SA 1GSFA 2X8GA 4KNDA 1AUCA 1OC3A 1ABAA 4WR4A 4V2MA 4O7HA 3C7MA 1XCCA 4DSSA 3ZIJA 4PXOA 5DVBA 1XW6A 2FY6A 4A5PA 3PINA 20GSA 1G0TA 2YOIA 3N9JA 1K0CA 3GH6A 2NVLA 2MMAA 5DQSA 5H5RA 3E0UA 2YZUA 1HNAA 4OO5A 2DMLA 1URMA 2HRKA 3C73A 2I3YA 3KP9A 1OYJA 1E2YA 2X8HA 5ID2B 2VCXA 2JSYA 5ABRA 5IIZA 1GNWA 3HHVA 2YWMA 4LL1B 1PKZA 4OCFA 1HYUA 1Z5YE 2CAIA 2J23A 3I6AA 2HLSA 1QGVA 2X64A 1AQVA 3CSIA 4MABA 2DMMA 4IVFA 2H71A 4DEJA 1B48A 1A0FA 1EZKA 2Z9SA 3F3RA 3UBKA 1XVQA 1E6BA 3P90A 4BVYA 2J9HA 4Q5NA 5IPHA 3E9JB 4G0KA 4EDYA 4MJCA 2B5XA 5EPFA 2ZUPA 19GSA 2RUFA 2X8CA 5E4WA 5IO0A 1BAYA 5DCGA 1LJRA 1RW1A 1HNBA 1KBNA 4CW9A 3QDNA 1TK5B 3QMXA 4EC0A 5DBQA 2HZEA 1EOGA 5B8AA 4PQHA 2B1KA 3W6GA 4G2EA 3RDWA 4KH7A 4HI7A 1PMTA 4Z2TA 1XOAA 3UJ1A 3RPNA 2X49A 3EMPA 2GZYA 3MAKA 3GKMA 2GSQA 2TRXA 4DSRA 1GNEA 4OWYA 2B5YA 3CBUA 2B3SA 4IP1A 3QAGA 5DALA 6GSUA 4I97A 5JCGA 2JL4A 1FVKA 1KEBA 1T3BA 1K3YA 1G7OA 2FWFA 2V1MA 3GYKA 1U6TA 2XPEA 2JACA 2P5RA 4I2TA 2R4VA 4YAPA 3GHAA 2E2MA 4DSSB 2GDRA 5HFKA 1FOVA 1YZXA 2DLXA 1LU4A 1FOHA 2CT6A 1V58A 4YQVA 1GP1A 3ZREA 4TR1A 1M0UA 3EYTA 5KN0A 5IO2A 5DAKA 3LWAA 3H1NA 1O85A 2LJKA 2P31A 3HYPA 2GSSA 3QOUA 1T4ZA 1TW9A 4X4JA 1ERTA 4BWSA 1M2DA 2GT6A 3A5WA 3V1WA 2KP2A 4ECJA 3DVWA 4N30A 2JU5A 5HFIA 2CX4A 1I9DA 2N5AA 5ECHB 1FG4A 2PERA 2IMFA 3GL5A 5ELAA 4WKWA 1V9WA 2AHEA 3I43A 1SL0B 3UAPA 2B5EA 4PUAA 2F8FA 2I4AA 3CRTA 3Q74A 4RQXA 3IBHA 3TCOA 4IQAA 5CYYA 1ILOA 3HJPA 1W89A 1UA5A 4K8MA 6GSSA 1GTAA 4EF0A 5BMUA 4I6XA 2ON7A 3HXSA 3J7Yb 2GZZA 4HZ4A 2OKAA 5IOXA 5B6NA 1A8LA 2PGTA 3MIXA 3ERFA 2H1GA 1XIYA 3HZ8A 4N0ZA 3LXZA 1HNCA 3UARA 1UC7A
chains in the Genus database with same CATH topology
2PMTA 4FQUA 3BCIA 1ZL9A 2R5GA 1TI1A 4O92A 4Q5FA 2IL3A 1CQHA 2HZEB 5DDLA 3IHQA 4D73A 2AJQB 5CP1A 3J7Yk 2M46A 3KM6A 3H93A 5AIXA 4KCEA 3KTBA 1B8XA 2L4QA 5GZZB 1M9AA 2I1UA 2LSTA 2HE3A 4MJAA 4WETA 3M9JA 4WBRD 5C00A 1TDIA 4Z7XA 3Q18A 9GSSA 2O89A 1SJIA 4MH2A 3LW9A 2A4HA 1TRUA 5D9WA 2OE3A 1TP9A 4ZL8A 4ZBDA 4K0NA 1FHEA 3KP8A 3M8NA 2OADA 1ZYEA 2LQQA 4POLA 3ED3A 2I9HA 4BA7A 2E2GA 1SKSB 1HQOA 4Z2UA 3QAWA 1K0NA 1EWXA 11GSA 4WEYA 1GWCA 3FEUA 2O7KA 3APQA 5JCWA 4TR1B 1M7TA 3F3QA 3DKSA 3GFKA 4HJMA 2HFDA 5F07A 3DMLA 3QFAC 3LG6A 3TDGA 3OR5A 1WMJA 3PR8A 5CRGA 2GVPA 5ECNB 1O8WA 2L4CA 1U3AA 2H30A 5JCUA 1WP0A 4MF7A 1F37A 3GIXA 2OACA 5IMDA 4CY8A 2REMA 2BMXA 2HRFA 3GA4A 4L0WA 5KOXA 4K9ZA 4TN8A 1M9BA 2H6ZA 1GTBA 4K5SA 2L59A 4NMUA 3F4TA 1JZRA 1Q4JA 2HZFA 1FVJA 1GULA 1XWGA 2JADA 2H1AA 2VD0A 4BPYA 1M2AA 4K7IA 1Z7PA 2C0FA 4NWYA 5IOWA 4O5UA 4ZILA 2VCZA 4EE0A 1FB6A 3DRNA 4KB3A 2F8AA 2P5QA 2VIMA 4O5RA 5D9VA 4QL7A 3I9V2 2R3XA 2C0GA 2VLTA 5JWOB 2YANA 4CDOA 1XXUA 3F9UA 3IK9A 4KUNA 2KP1A 3TJKA 4KSMA 1B4QA 2PN8A 3IPZA 3P8WA 7GSSA 2YV9A 4ECIA 4F2IA 4D73B 2R0CA 2AAWA 2P0GA 4MPGA 3VWXA 2GSTA 2LS5A 2CV4A 2QA1A 3IA1A 1ERWA 2ON5A 5EL8A 4NHWA 3QAVA 4JEDA 5IM9A 3TOUA 2CVDA 3GSTA 3C1RA 1XWKA 3G9BA 3QD9A 1G6WA 2O85A 2NBSA 4LA1A 5G1KA 1O73A 1PGTA 3GN3A 2LJAA 2JZSA 4MCUA 4IW9A 4YQUA 3ERGA 2V6OA 1O6JA 1O81A 5G30A 3HCZA 5IMVA 3D6IA 4LL4B 2F51A 2FD3A 4TOPA 3M3MA 4XS4A 1Z9HA 3HDCA 3H4KA 1WWJA 1PKWA 2FWHA 1V40A 2MYGA 4PGTA 3FYGA 2OBKA 2WDUA 4K2DA 3HVSA 4KSOA 1X9SB 3ME7A 2KUCA 3QFBC 2ZCTA 5DJMA 2TRCP 4MH3A 4IKHA 3LQ7A 5A4UA 3TJJA 1SD8A 2QKEA 2DJ2A 4H86A 5IMAA 4EIQA 1USBA 1PN9A 4IN0A 3CSHA 2HRNA 2UZ8A 1X9MB 1B9XC 1TKDB 1X5CA 3VURA 2LV3A 4CY6A 2RUEA 2IFQA 1PL2A 4AJ6A 1SYRA 1OC9A 2H19A 2GQMA 4TR3A 1WIKA 3VFIA 3KH7A 6GSTA 1JFUA 1PRXA 1UVZA 2NPBA 3UIWA 2C3QA 2C0EA 2YWNA 1S3CA 3A2VA 2IMDA 3L78A 5CREA 3P2AA 3GKNA 3O3TA 3M1GA 4ZXGA 3DIEA 2FCHA 2PU9C 2BJXA 3IAM2 2QC7A 3CMIA 3DVXA 1GUHA 4CHSA 4GSNA 3HY2A 2ES7A 4USSA 2IN3A 2WS2A 2GT5A 3K8NA 5G1LA 3FR6A 3ZMKA 2RM5A 1GSUA 3GX0A 2HI7A 2QGVA 2FA4A 1SKWB 2DJKA 4YQMA 2FGXA 3LGCA 1SK0A 3GURA 3BD2A 5A5KA 3F6FA 4ECCA 5COHA 1PL1A 3F4SA 3IOSA 4IGJA 2DC5A 4GTUA 3ZFBA 3NOFA 4RI6A 1OVNA 2CZ3A 4HU7A 2WULA 1B9YC 2EC4A 2B6MA 2JZTA 1DUGA 4WF4A 1Y6EA 5HR2A 5JWQB 1W4VA 1IYIA 1GTIA 2ZNMA 4PNGA 1EV9A 1UN2A 2GQKA 2MMZA 2AYTA 5HR0A 3TGZA 4KGIA 2V41A 5LNKe 5B8BA 5FT3A 1A2JA 5AGYA 4I2UA 4G10A 1JZDA 3R3EA 4ZBBA 4MLYA 3L0HA 4HUAA 5H5QA 1SU9A 1SL1B 1AQWA 4MJEA 3U6VA 1JLWA 4F0CA 4XS4B 2HYXA 3EURA 1ZYQB 3BCKA 2LKUA 2R0GA 1RQMA 3GL3A 5D73A 4NHZA 4G0LA 3G7JA 1N2AA 4WR5A 2RLIA 4GSTA 1R7HA 2MMNA 3FMWA 1XWCA 3GRXA 5D93A 2PPTA 3KEBA 1WOUA 4PX1A 4E8EA 1OC8A 4OD7A 1YY7A 4MF6A 2LEGA 3HKRA 2A2PA 5HQPA 1OAZA 3M9KA 3C8EA 4BWQA 4LMWA 2IFQB 2EIRA 5HFGA 5KN3A 3ZRDA 3D4TA 3IAS2 1OC9B 2IWTA 1PX6A 4JR6A 1XBSA 3IC4A 4KA0A 5BRTA 2DIYA 2H01A 1J08A 1TK0B 5A4WA 3RAZA 4YKGA 5AIVA 3HVXA 1XW5A 1AAZA 1DBYA 3CYNA 5D9XA 4IBPA 3FZ5A 5B6MA 2GSRA 3UVHA 5GSSA 4L8EA 3L9UA 3WGEA 1PN0A 4Q5QA 2IJYA 2H1DA 2CAQA 2O8VB 4N10A 3EE2A 1X5EA 3M0FA 2VL3A 1FO5A 4HZ2A 4V1Ag 4TVEA 1A23A 22GSA 4JU5A 1XOBA 2FWEA 1N8JA 1OKTA 2XHFA 3F8UA 2EIQA 2X4AA 3N5OA 4OFTA 2GTUA 3GTUB 3PH9A 4ICYA 1O8XA 4OO4A 1S3DA 2AUVA 4ZL9A 4RQRA 1TJDA 3VLNA 5ECQB 2K9FA 2N5BA 4XTSA 5G2ZA 3ZL5A 1VGLA 18GSA 1K0OA 5LD0A 4P3YB 3ZYWA 4HEA2 1A2LA 1Y25A 4I5QA 4PUFC 5ECOB 2MMOA 3TRXA 1ZYNA 1M2BA 3MYDA 2VUPA 2L5LA 1AW9A 2LTKA 3HJOA 3VK9A 1BX9A 4HDEA 5E59A 1T1VA 2VLVA 2VM2A 1BYEA 2B7JA 5HR3A 2H0IA 2C8UA 4O32A 2VL9A 4PTSA 2CQ9A 4XCSA 4L0UA 1YDKA 1PQNA 3A5IA 5J9CA 4AJ7A 1R4WA 3FK8A 2G2QA 4DSQA 1VF3A 3LYKA 3PGTA 4LMVA 1TU7A 2AV4A 3ZVJA 1C72A 1V2AA 1ERUA 4EXJA 2R6KA 3D21A 1K0BA 4QL9A 4F82A 1DE2A 1ZZYA 4Q5RA 4AJ8A 2VCWA 2MBTA 4NPBA 3ZZXA 5AISA 2HSHA 4MK3A 1YJ6A 3F4RA 1VF4A 3GKKA 3F63A 1GL8A 3Q6OA 5J3RA 1Z7RA 5GAPD 1MD3A 1TRSA 3DD3A 1BG5A 2IMEA 4YH2A 3KXOA 2CA8A 3RPPA 4GSSA 4K0GA 1F3AA 16GSA 1GSSA 1QUWA 4XHMA 3KGKA 2GS3A 3CRUA 3AY8A 2DJ3A 4BL7A 2H74A 3HVVA 2OE1A 2VO4A 2LUSA 3KMNA 2L6DA 1T8EB 4TXOB 2X99A 2FLSA 1K0DA 1CQGA 3RHBA 2B1LA 4POKA 3C71A 3H79A 1U3IA 4MZBA 4KX4A 2VCVA 1OE8A 4X43A 4MPFA 5AN1A 3D0ZA 4ZBAA 2XBQA 5D8IA 3FZ9A 2DJJA 4DVCA 1RK4A 2KHPA 4PNFA 2C80A 4NV2A 2GLRA 1SENA 13GSA 3KMOA 1LBKA 2PBJA 1V57A 4J57E 5LCZA 3S9FA 3SWLA 1YKAA 3EU4A 5F06A 3ZITA 2H70A 4MZCA 3FHKA 4HQSA 1DSBA 3EC3A 2MBSA 3ZFLA 2IMIA 2IIYA 3LXTA 3FRCA 3IR4A 3ZMLA 3RHCA 1XWBA 4X0XA 3FZAA 4IS0A 2MZCA 5IMFA 2V6KA 2YWIA 2YWOA 1S3AA 3D4MA 2F9SA 2KOKA 2HSMA 5J4UA 3MDKA 4BVXA 2E7PA 3ISOA 3BJ5A 4V1Ap 4WBJA 3C1SA 4K7NA 4OMVA 1MDKA 2FHEA 1SJZA 2FUG2 1QXHA 5DQYA 4POMA 3SBCA 2LRTA 2K6VA 2B7KA 5KOWA 4JE1A 1ZGNA 2R2JA 3EU3A 2H0GA 3TKRA 4G9HA 1NSWA 3A3TA 2LQOA 1SD9A 4ECBA 5G5EA 2AB6A 2CX3A 4XRDA 3TJGA 1R5AA 1K3LA 3ZVJD 1EP7A 3IV4A 2VD1A 4MDCA 5FWGA 1F2EA 1GLPA 2EIOA 5CRWA 2LRNA 4KE3A 1SJ6A 4J2FA 4JR4A 4YKFA 3ZLPA 5F05A 3FY7A 4TR4A 1A2MA 1K3OA 2NTOA 4FYCA 1ERVA 4PQIA 3TB2A 1TTZA 4FYBA 1THXA 3TKPA 2E0QA 1H75A 2FNOA 4KF9A 2OJLA 4ZB9A 2LJRA 1YEXA 3ERWA 3WT2A 4HQZA 3VI5A 1XVWA 4AGSA 1A0RP 5ECKB 4HS1A 2DSAA 4MNNA 2KLXA 1F3BA 1ON4A 4JZQA 2H75A 4HJ2A 1EV4A 17GSA 1TOFA 4AF2A 4BL7B 4LLRA 5KN1A 4Z2RA 2A2RA 1PA3A 2V32A 3MWHA 1Q98A 4KCAA 4MA9A 4IP6A 1WE0A 3LFLA 4RI7A 3APSA 3RBTA 4KAEA 2M80A 4F0BA 4XS1A 3JCML 3U5RE 1WJKA 5G31A 1HD2A 1BEDA 5EY6A 1GH2A 5CRHA 1TU8A 1FAAA 4TXVA 2WCIA 3GTUA 1AQXA 3KH9A 1R5PA 5A4VA 1AC1A 1VRSD 5CO3A 1U87A 2N5FA 5CNWA 3KZQA 1FW1A 1MDJA 2VAFA 1O7UA 1ZOFA 1R26A 4BVXB 2DJ1A 4ML1A 4ZIJA 3IK7A 4QQ7A 3TJFA 3IDVA 1TXXA 1ZCPA 6GSWA 2PVOC 4ZL7A 3FZ4A 1T4YA 3US3A 4K5RA 5DCHA 4EL1A 1QQ2A 3F0IA 2DKIA 4EKZA 1Z6NA 3EINA 3FW2A 2VOCA 3QCPA 5D96A 3HZ4A 3TKSC 1SK2A 4G19A 5ECRB 2YJ7A 1TRVA 1I5GA 1GSYA 1X5DA 2FA8A 1SK1A 1T7PB 4X1UA 2M72A 3D22A 3VWWA 2OE0A 3GX8A 4IELA 3DEXA 2PVQA 3CXGA 2HSYA 3G7YA 3APOA 3WT1A 4GQFA 3PPUA 1IYHA 5J5NA 3DGQA 2L5OA 1EGRA 3CSJA 4IHUA 3A2WA 3FR3A 5CAXA 1GSEA 2OA7A 3TJBA 2RIIA 2GQLA 2YJHA 4MP4A 1ZYPA 1X9WB 2VCTA 1XZOA 4F9ZA 2CZ2A 1F9MA 1TRWA 2YP6A 4K2XA 3EVIA 2QSIA 4F03A 2DIZA 6GSVA 4ILFA 3TUEA 3TRPA 3UMAA 2HXKA 1YF1A 1G7EA 3FKFA 4J56E 2JZRA 2OBIA 2C3NA 1AIUA 3DYRA 5F0GA 10GSA 1ST9A 1ML6A 2GGTA 1PD21 1NM3A 4EVMA 3KIJA 1EEJA 3ZTLA 1XFLA 3HD5A 3WYWA 2V2GA 3HA9A 4TRXA 4ACSA 3CTFA 2YCDA 3TKSA 4OCEA 2DJ0A 4ZB6A 1AXDA 5KN2A 2XC2A 3UL3A 2YNXA 3I69A 3Q19A 4NV5A 3UVTA 5INYA 12GSA 2H8LA 1EP8A 4TXOA 5J9BA 2O87A 3F6DA 4ZB8A 2WGRA 1J9BA 1A24A 3BBYA 3KCMA 3TRQA 1K0MA 1TI3A 1GSDA 4GXZA 8GSSA 2K18A 4PQ1A 3ZIVA 4FIWA 4KDYA 4IQ1A 2CVBA 3GV1A 4IJIA 5IQYA 2H66A 4KW6A 3GKXA 4KDUA 3LORA 1NHOA 3GNJA 2H76A 3MNGA 1DE1A 3EPTA 2WRTA 2YZHA 4EIPA 3WD6A 1OKDA 4ULXA 3NZNA 2QA2A 5IPGA 1U88A 4EDZA 2ALBA 3LJRA 3KD0A 1KNGA 1NW2A 1KTEA 4XRAA 1GSQA 1EOHA 4BVYB 3GMFA 2D2ZA 3O6TA 2C4JA 3WGXA 4TKYA 1SL2B 5EVOA 1BJXA 4N11A 5HR1A 3FR9A 5KEJA 2H6YA 1QFNA 4TW5A 4K6XA 2LRCA 1JZWA 1MEKA 3D5JA 2HRAA 3DXBA 5ECPB 3E3EA 3EMXA 1SYXA 5D9TA 5ENUA 1QK8A 3GUSA 1PSQA 5L71A 3A2XA 4FO5A 1THOA 3QPMA 4O5QA 4FYUA 1GTUA 1Z3EA 5JWRB 1JHBA 1MD4A 4NAXA 3W8JA 1FB0A 1B4PA 5H5SA 3LSZA 3IE3A 5J41A 3VWUA 2C0DA 2VL2C 1V98A 3EWLA 3LYPA 2LNTA 3IXRA 2VLUA 3GSSA 5FHIA 1YKCA 5IMZA 5DALB 2NDOA 1SKRB 4K7OA 4I8BA 3BOAA 5DJLA 3H8QA 3TKSE 3L9VA 4IJ3A 2JSZA 1K0AA 4MJBA 2TIRA 2LNSA 5G5FA 4ISDA 4GCIA 1XWAA 4GF0A 1VF1A 3G7IA 4MF5A 3MSZA 2K8SA 3IRAA 4FH8A 1M99A 3HJMA 2WFCA 2A2SA 2F3MA 4V2NA 4RUVA 2R37A 4N0VA 2XPDA 1GUMA 2H72A 1PX7A 1NHYA 5DAKB 1X0RA 5ELGA 4HU9A 2VM1A 4JBBA 1EEMA 2C1YA 2YPMA 1MTCA 2RM6A 3W8SA 1YEPA 1YF0A 1A8YA 1J0FA 2H73A 4ML6A 4MZWA 3CTGA 6GSYA 2VCQA 2YV7A 4WF5A 3NIVA 1YQ1A 4E8HA 2H6XA 2WB9A 3UBLA 1JZOA 4NXIA 2YN1A 5F8BA 4WXTA 2VL2A 2R0PA 3LEFA 3VWVA 4EO3A 2DBCA 4GWRA 4GRFA 5IMCA 5ID2A 2L6CA 2IPAA 4HOJA 1WPIA 2BTOT 1ZMAA 2I81A 3VI7A 4PURA 4JRRA 4OFMA 1T00A 2DKHA 3UEMA 1GUKA 2WZ9A 1JLVA 2H1BA 1XW9A 5ECSA 4OFNA 1G6YA 3R2QA 6GSXA 2HNLA 5ECIB 2CVKA 4TR0A 4GLTA 3IHGA 3KJYA 5CRDA 1H4OA 4KDXA 4V2LA 1GLQA 4YAVA 4MMMA 1EGOA 4GQCA 1GRXA 2FWGA 4G0IA 2PUKC 2A4VA 1F6MC 3VPQA 4ID0A 14GSA 4EUYA 1TK8B 5GSTA 1XPVA 5B7CA 2K8VA 2XBIA 1ACVA 2C3TA 3GH9A 2IMKA 2GZPA 1Z6MA 1OE7A 2PWJA 4K1FA 3P7XA 1MDIA 1WRYA 4XIHA 5ECMB 3TKQA 3DWVA 2L57A 3KTLA 1BQ7A 3O76A 3TOTA 4XS6A 1VF2A 3QR6A 2G0FA 2HT9A 3WGDA 1QMVA 2WJUA 3ME8A 5C04A 3VPTA 4L5OA 2H0HA 3IC8A 5ECLB 4L5LA 3UOMA 3L4NA 4POBA 5GAND 3L9SA 1GSFA 2X8GA 4KNDA 1AUCA 1OC3A 1ABAA 4WR4A 4V2MA 4O7HA 3C7MA 1XCCA 4DSSA 3ZIJA 4PXOA 5DVBA 1XW6A 2FY6A 4A5PA 3PINA 20GSA 1G0TA 2YOIA 3N9JA 1K0CA 3GH6A 2NVLA 2MMAA 5DQSA 5H5RA 3E0UA 2YZUA 1HNAA 4OO5A 2DMLA 1URMA 2HRKA 3C73A 2I3YA 3KP9A 1OYJA 1E2YA 2X8HA 5ID2B 2VCXA 2JSYA 5ABRA 5IIZA 1GNWA 3HHVA 2YWMA 4LL1B 1PKZA 4OCFA 1HYUA 1Z5YE 2CAIA 2J23A 3I6AA 2HLSA 1QGVA 2X64A 1AQVA 3CSIA 4MABA 2DMMA 4IVFA 2H71A 4DEJA 1B48A 1A0FA 1EZKA 2Z9SA 3F3RA 3UBKA 1XVQA 1E6BA 3P90A 4BVYA 2J9HA 4Q5NA 5IPHA 3E9JB 4G0KA 4EDYA 4MJCA 2B5XA 5EPFA 2ZUPA 19GSA 2RUFA 2X8CA 5E4WA 5IO0A 1BAYA 5DCGA 1LJRA 1RW1A 1HNBA 1KBNA 4CW9A 3QDNA 1TK5B 3QMXA 4EC0A 5DBQA 2HZEA 1EOGA 5B8AA 4PQHA 2B1KA 3W6GA 4G2EA 3RDWA 4KH7A 4HI7A 1PMTA 4Z2TA 1XOAA 3UJ1A 3RPNA 2X49A 3EMPA 2GZYA 3MAKA 3GKMA 2GSQA 2TRXA 4DSRA 1GNEA 4OWYA 2B5YA 3CBUA 2B3SA 4IP1A 3QAGA 5DALA 6GSUA 4I97A 5JCGA 2JL4A 1FVKA 1KEBA 1T3BA 1K3YA 1G7OA 2FWFA 2V1MA 3GYKA 1U6TA 2XPEA 2JACA 2P5RA 4I2TA 2R4VA 4YAPA 3GHAA 2E2MA 4DSSB 2GDRA 5HFKA 1FOVA 1YZXA 2DLXA 1LU4A 1FOHA 2CT6A 1V58A 4YQVA 1GP1A 3ZREA 4TR1A 1M0UA 3EYTA 5KN0A 5IO2A 5DAKA 3LWAA 3H1NA 1O85A 2LJKA 2P31A 3HYPA 2GSSA 3QOUA 1T4ZA 1TW9A 4X4JA 1ERTA 4BWSA 1M2DA 2GT6A 3A5WA 3V1WA 2KP2A 4ECJA 3DVWA 4N30A 2JU5A 5HFIA 2CX4A 1I9DA 2N5AA 5ECHB 1FG4A 2PERA 2IMFA 3GL5A 5ELAA 4WKWA 1V9WA 2AHEA 3I43A 1SL0B 3UAPA 2B5EA 4PUAA 2F8FA 2I4AA 3CRTA 3Q74A 4RQXA 3IBHA 3TCOA 4IQAA 5CYYA 1ILOA 3HJPA 1W89A 1UA5A 4K8MA 6GSSA 1GTAA 4EF0A 5BMUA 4I6XA 2ON7A 3HXSA 3J7Yb 2GZZA 4HZ4A 2OKAA 5IOXA 5B6NA 1A8LA 2PGTA 3MIXA 3ERFA 2H1GA 1XIYA 3HZ8A 4N0ZA 3LXZA 1HNCA 3UARA 1UC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMT A;  3BCI A;  1ZL9 A;  2R5G A;  1TI1 A;  4O92 A;  4Q5F A;  2IL3 A;  1CQH A;  2HZE B;  5DDL A;  3IHQ A;  4D73 A;  2AJQ B;  5CP1 A;  3J7Y k;  2M46 A;  3KM6 A;  3H93 A;  5AIX A;  4KCE A;  3KTB A;  1B8X A;  2L4Q A;  5GZZ B;  1M9A A;  2I1U A;  2LST A;  2HE3 A;  4MJA A;  4WET A;  3M9J A;  4WBR D;  5C00 A;  1TDI A;  4Z7X A;  3Q18 A;  9GSS A;  2O89 A;  1SJI A;  4MH2 A;  1TRU A;  5D9W A;  2OE3 A;  1TP9 A;  4ZL8 A;  4ZBD A;  4K0N A;  1FHE A;  3KP8 A;  3M8N A;  2OAD A;  1ZYE A;  2LQQ A;  4POL A;  3ED3 A;  2I9H A;  4BA7 A;  2E2G A;  1SKS B;  1HQO A;  3QAW A;  1K0N A;  1EWX A;  11GS A;  4WEY A;  1GWC A;  3FEU A;  2O7K A;  3APQ A;  5JCW A;  4TR1 B;  1M7T A;  3F3Q A;  3DKS A;  3GFK A;  4HJM A;  2HFD A;  5F07 A;  3DML A;  3QFA C;  3LG6 A;  3TDG A;  3OR5 A;  1WMJ A;  3PR8 A;  5CRG A;  2GVP A;  5ECN B;  1O8W A;  2L4C A;  1U3A A;  2H30 A;  5JCU A;  1WP0 A;  4MF7 A;  1F37 A;  3GIX A;  2OAC A;  5IMD A;  2REM A;  2BMX A;  2HRF A;  3GA4 A;  4L0W A;  4K9Z A;  4TN8 A;  1M9B A;  2H6Z A;  1GTB A;  2L59 A;  4NMU A;  3F4T A;  1JZR A;  1Q4J A;  2HZF A;  1FVJ A;  1GUL A;  1XWG A;  2JAD A;  2H1A A;  2VD0 A;  4BPY A;  1M2A A;  4K7I A;  1Z7P A;  2C0F A;  4NWY A;  5IOW A;  4ZIL A;  2VCZ A;  4EE0 A;  1FB6 A;  3DRN A;  4KB3 A;  2F8A A;  2P5Q A;  2VIM A;  4O5R A;  5D9V A;  4QL7 A;  3I9V 2;  2R3X A;  2C0G A;  2VLT A;  5JWO B;  2YAN A;  4CDO A;  1XXU A;  3F9U A;  3IK9 A;  4KUN A;  2KP1 A;  3TJK A;  4KSM A;  1B4Q A;  2PN8 A;  3IPZ A;  3P8W A;  7GSS A;  2YV9 A;  4ECI A;  4F2I A;  4D73 B;  2AAW A;  2P0G A;  4MPG A;  3VWX A;  2GST A;  2LS5 A;  2CV4 A;  3IA1 A;  1ERW A;  2ON5 A;  5EL8 A;  4NHW A;  3QAV A;  4JED A;  5IM9 A;  3TOU A;  2CVD A;  3GST A;  3C1R A;  1XWK A;  3G9B A;  3QD9 A;  1G6W A;  2O85 A;  2NBS A;  4LA1 A;  5G1K A;  1O73 A;  1PGT A;  3GN3 A;  2LJA A;  2JZS A;  4MCU A;  4IW9 A;  4YQU A;  3ERG A;  2V6O A;  1O6J A;  1O81 A;  5G30 A;  3HCZ A;  5IMV A;  3D6I A;  4LL4 B;  2F51 A;  2FD3 A;  4TOP A;  3M3M A;  4XS4 A;  1Z9H A;  3HDC A;  3H4K A;  1WWJ A;  1PKW A;  2FWH A;  1V40 A;  2MYG A;  4PGT A;  3FYG A;  2OBK A;  2WDU A;  4K2D A;  3HVS A;  4KSO A;  1X9S B;  3ME7 A;  2KUC A;  3QFB C;  2ZCT A;  5DJM A;  2TRC P;  4MH3 A;  4IKH A;  3LQ7 A;  5A4U A;  3TJJ A;  1SD8 A;  2QKE A;  2DJ2 A;  4H86 A;  5IMA A;  1USB A;  1PN9 A;  4IN0 A;  3CSH A;  2HRN A;  1X9M B;  1TKD B;  1B9X C;  1X5C A;  3VUR A;  2LV3 A;  2RUE A;  2IFQ A;  1PL2 A;  4AJ6 A;  1SYR A;  1OC9 A;  2H19 A;  2GQM A;  4TR3 A;  1WIK A;  3VFI A;  3KH7 A;  6GST A;  1JFU A;  1PRX A;  1UVZ A;  2NPB A;  3UIW A;  2C3Q A;  2C0E A;  2YWN A;  1S3C A;  3A2V A;  2IMD A;  3L78 A;  5CRE A;  3P2A A;  3GKN A;  3O3T A;  3M1G A;  4ZXG A;  3DIE A;  2FCH A;  2PU9 C;  2BJX A;  3IAM 2;  2QC7 A;  3CMI A;  3DVX A;  1GUH A;  4CHS A;  4GSN A;  3HY2 A;  2ES7 A;  2IN3 A;  2WS2 A;  2GT5 A;  3K8N A;  5G1L A;  3FR6 A;  3ZMK A;  2RM5 A;  1GSU A;  3GX0 A;  2HI7 A;  2QGV A;  2FA4 A;  1SKW B;  2DJK A;  4YQM A;  2FGX A;  3LGC A;  1SK0 A;  3GUR A;  3BD2 A;  5A5K A;  3F6F A;  4ECC A;  5COH A;  1PL1 A;  3F4S A;  3IOS A;  4IGJ A;  2DC5 A;  4GTU A;  3ZFB A;  3NOF A;  4RI6 A;  1OVN A;  2CZ3 A;  4HU7 A;  2WUL A;  1B9Y C;  2EC4 A;  2B6M A;  2JZT A;  1DUG A;  4WF4 A;  1Y6E A;  5HR2 A;  5JWQ B;  1W4V A;  1IYI A;  1GTI A;  2ZNM A;  4PNG A;  1EV9 A;  1UN2 A;  2GQK A;  2MMZ A;  2AYT A;  5HR0 A;  3TGZ A;  4KGI A;  2V41 A;  5LNK e;  5B8B A;  5FT3 A;  1A2J A;  5AGY A;  4I2U A;  4G10 A;  1JZD A;  4ZBB A;  4MLY A;  3L0H A;  4HUA A;  5H5Q A;  1SU9 A;  1SL1 B;  1AQW A;  4MJE A;  3U6V A;  1JLW A;  4F0C A;  4XS4 B;  2HYX A;  3EUR A;  1ZYQ B;  3BCK A;  2LKU A;  1RQM A;  3GL3 A;  5D73 A;  4NHZ A;  3G7J A;  1N2A A;  4WR5 A;  2RLI A;  4GST A;  1R7H A;  2MMN A;  1XWC A;  3GRX A;  5D93 A;  2PPT A;  3KEB A;  1WOU A;  4PX1 A;  4E8E A;  1OC8 A;  4OD7 A;  1YY7 A;  4MF6 A;  2LEG A;  3HKR A;  5HQP A;  1OAZ A;  3M9K A;  3C8E A;  4BWQ A;  4LMW A;  2IFQ B;  2EIR A;  5HFG A;  5KN3 A;  3ZRD A;  3D4T A;  3IAS 2;  1OC9 B;  2IWT A;  1PX6 A;  4JR6 A;  1XBS A;  3IC4 A;  4KA0 A;  2DIY A;  2H01 A;  1J08 A;  1TK0 B;  5A4W A;  3RAZ A;  5AIV A;  3HVX A;  1XW5 A;  1AAZ A;  1DBY A;  3CYN A;  5D9X A;  4IBP A;  3FZ5 A;  5B6M A;  2GSR A;  3UVH A;  5GSS A;  4L8E A;  3L9U A;  3WGE A;  4Q5Q A;  2IJY A;  2H1D A;  2CAQ A;  2O8V B;  4N10 A;  3EE2 A;  1X5E A;  3M0F A;  2VL3 A;  1FO5 A;  4HZ2 A;  4V1A g;  4TVE A;  1A23 A;  22GS A;  4JU5 A;  1XOB A;  2FWE A;  1N8J A;  1OKT A;  2XHF A;  3F8U A;  2EIQ A;  3N5O A;  4OFT A;  2GTU A;  3GTU B;  3PH9 A;  1O8X A;  4OO4 A;  1S3D A;  2AUV A;  4ZL9 A;  4RQR A;  1TJD A;  3VLN A;  5ECQ B;  2K9F A;  2N5B A;  4XTS A;  5G2Z A;  3ZL5 A;  1VGL A;  18GS A;  1K0O A;  5LD0 A;  4P3Y B;  3ZYW A;  4HEA 2;  1A2L A;  1Y25 A;  4I5Q A;  4PUF C;  5ECO B;  2MMO A;  3TRX A;  1M2B A;  2VUP A;  2L5L A;  1AW9 A;  2LTK A;  3HJO A;  3VK9 A;  1BX9 A;  4HDE A;  5E59 A;  1T1V A;  2VLV A;  2VM2 A;  1BYE A;  2B7J A;  5HR3 A;  2H0I A;  2C8U A;  4O32 A;  2VL9 A;  2CQ9 A;  4XCS A;  4L0U A;  1YDK A;  1PQN A;  5J9C A;  4AJ7 A;  1R4W A;  3FK8 A;  2G2Q A;  4DSQ A;  1VF3 A;  3LYK A;  3PGT A;  4LMV A;  1TU7 A;  2AV4 A;  3ZVJ A;  1C72 A;  1V2A A;  1ERU A;  4EXJ A;  2R6K A;  3D21 A;  1K0B A;  4QL9 A;  4F82 A;  1DE2 A;  1ZZY A;  4Q5R A;  4AJ8 A;  2VCW A;  2MBT A;  4NPB A;  3ZZX A;  5AIS A;  2HSH A;  4MK3 A;  1YJ6 A;  3F4R A;  1VF4 A;  3GKK A;  3F63 A;  1GL8 A;  3Q6O A;  5J3R A;  1Z7R A;  5GAP D;  1MD3 A;  1TRS A;  3DD3 A;  1BG5 A;  2IME A;  4YH2 A;  3KXO A;  2CA8 A;  3RPP A;  4GSS A;  4K0G A;  1F3A A;  16GS A;  1GSS A;  1QUW A;  4XHM A;  3KGK A;  2GS3 A;  3CRU A;  3AY8 A;  2DJ3 A;  4BL7 A;  2H74 A;  3HVV A;  2OE1 A;  2VO4 A;  2LUS A;  3KMN A;  2L6D A;  1T8E B;  4TXO B;  2X99 A;  2FLS A;  1K0D A;  1CQG A;  3RHB A;  2B1L A;  4POK A;  3C71 A;  3H79 A;  1U3I A;  4MZB A;  4KX4 A;  2VCV A;  1OE8 A;  4X43 A;  4MPF A;  5AN1 A;  3D0Z A;  4ZBA A;  2XBQ A;  5D8I A;  3FZ9 A;  2DJJ A;  4DVC A;  1RK4 A;  2KHP A;  4PNF A;  2C80 A;  4NV2 A;  2GLR A;  1SEN A;  13GS A;  3KMO A;  1LBK A;  2PBJ A;  1V57 A;  4J57 E;  5LCZ A;  3S9F A;  3SWL A;  1YKA A;  3EU4 A;  5F06 A;  3ZIT A;  2H70 A;  4MZC A;  3FHK A;  4HQS A;  1DSB A;  3EC3 A;  2MBS A;  3ZFL A;  2IMI A;  2IIY A;  3LXT A;  3FRC A;  3IR4 A;  3ZML A;  3RHC A;  1XWB A;  4X0X A;  3FZA A;  4IS0 A;  2MZC A;  5IMF A;  2V6K A;  2YWI A;  2YWO A;  1S3A A;  3D4M A;  2F9S A;  2KOK A;  5J4U A;  3MDK A;  4BVX A;  2E7P A;  3ISO A;  3BJ5 A;  4V1A p;  4WBJ A;  3C1S A;  4K7N A;  4OMV A;  1MDK A;  2FHE A;  1SJZ A;  2FUG 2;  1QXH A;  5DQY A;  4POM A;  3SBC A;  2LRT A;  2K6V A;  2B7K A;  4JE1 A;  1ZGN A;  2R2J A;  3EU3 A;  2H0G A;  3TKR A;  4G9H A;  1NSW A;  3A3T A;  2LQO A;  1SD9 A;  4ECB A;  5G5E A;  2AB6 A;  2CX3 A;  4XRD A;  3TJG A;  1R5A A;  1K3L A;  3ZVJ D;  1EP7 A;  3IV4 A;  2VD1 A;  4MDC A;  5FWG A;  1F2E A;  1GLP A;  2EIO A;  5CRW A;  2LRN A;  4KE3 A;  1SJ6 A;  4J2F A;  4JR4 A;  3ZLP A;  5F05 A;  3FY7 A;  4TR4 A;  1A2M A;  1K3O A;  2NTO A;  4FYC A;  1ERV A;  4PQI A;  3TB2 A;  1TTZ A;  4FYB A;  1THX A;  3TKP A;  2E0Q A;  1H75 A;  2FNO A;  2OJL A;  4ZB9 A;  2LJR A;  1YEX A;  3ERW A;  3WT2 A;  4HQZ A;  3VI5 A;  1XVW A;  4AGS A;  1A0R P;  5ECK B;  4HS1 A;  2DSA A;  2KLX A;  1F3B A;  1ON4 A;  4JZQ A;  2H75 A;  4HJ2 A;  1EV4 A;  17GS A;  1TOF A;  4AF2 A;  4LLR A;  5KN1 A;  2A2R A;  1PA3 A;  2V32 A;  3MWH A;  1Q98 A;  4KCA A;  4MA9 A;  4IP6 A;  1WE0 A;  3LFL A;  4RI7 A;  3APS A;  3RBT A;  4KAE A;  2M80 A;  4F0B A;  4XS1 A;  3JCM L;  3U5R E;  1WJK A;  5G31 A;  1HD2 A;  1BED A;  5EY6 A;  1GH2 A;  5CRH A;  1TU8 A;  1FAA A;  4TXV A;  2WCI A;  3GTU A;  1AQX A;  3KH9 A;  1R5P A;  5A4V A;  1AC1 A;  1VRS D;  5CO3 A;  1U87 A;  2N5F A;  5CNW A;  3KZQ A;  1FW1 A;  1MDJ A;  2VAF A;  1O7U A;  1ZOF A;  1R26 A;  2DJ1 A;  4ML1 A;  4ZIJ A;  3IK7 A;  4QQ7 A;  3TJF A;  3IDV A;  1TXX A;  1ZCP A;  6GSW A;  2PVO C;  4ZL7 A;  3FZ4 A;  1T4Y A;  3US3 A;  5DCH A;  4EL1 A;  1QQ2 A;  3F0I A;  4EKZ A;  1Z6N A;  3EIN A;  3FW2 A;  2VOC A;  3QCP A;  5D96 A;  3HZ4 A;  3TKS C;  1SK2 A;  4G19 A;  5ECR B;  2YJ7 A;  1TRV A;  1I5G A;  1GSY A;  1X5D A;  2FA8 A;  1SK1 A;  1T7P B;  4X1U A;  2M72 A;  3D22 A;  3VWW A;  2OE0 A;  3GX8 A;  4IEL A;  3DEX A;  2PVQ A;  3CXG A;  2HSY A;  3G7Y A;  3APO A;  3WT1 A;  4GQF A;  1IYH A;  5J5N A;  3DGQ A;  2L5O A;  1EGR A;  3CSJ A;  4IHU A;  3A2W A;  3FR3 A;  5CAX A;  1GSE A;  2OA7 A;  3TJB A;  2RII A;  2GQL A;  2YJH A;  4MP4 A;  1X9W B;  2VCT A;  1XZO A;  4F9Z A;  2CZ2 A;  1F9M A;  1TRW A;  2YP6 A;  3EVI A;  2QSI A;  4F03 A;  2DIZ A;  6GSV A;  4ILF A;  3TUE A;  3TRP A;  3UMA A;  2HXK A;  1YF1 A;  1G7E A;  3FKF A;  4J56 E;  2JZR A;  2OBI A;  2C3N A;  1AIU A;  3DYR A;  5F0G A;  10GS A;  1ST9 A;  1ML6 A;  2GGT A;  1PD2 1;  1NM3 A;  4EVM A;  3KIJ A;  1EEJ A;  3ZTL A;  1XFL A;  3HD5 A;  3WYW A;  2V2G A;  3HA9 A;  4TRX A;  4ACS A;  3CTF A;  2YCD A;  3TKS A;  4OCE A;  2DJ0 A;  4ZB6 A;  1AXD A;  5KN2 A;  2XC2 A;  3UL3 A;  2YNX A;  3I69 A;  3Q19 A;  4NV5 A;  3UVT A;  5INY A;  12GS A;  2H8L A;  1EP8 A;  4TXO A;  5J9B A;  2O87 A;  3F6D A;  4ZB8 A;  2WGR A;  1J9B A;  1A24 A;  3BBY A;  3KCM A;  3TRQ A;  1K0M A;  1TI3 A;  1GSD A;  4GXZ A;  8GSS A;  2K18 A;  4PQ1 A;  3ZIV A;  4FIW A;  4KDY A;  4IQ1 A;  2CVB A;  3GV1 A;  4IJI A;  5IQY A;  2H66 A;  4KW6 A;  3GKX A;  4KDU A;  3LOR A;  1NHO A;  3GNJ A;  2H76 A;  3MNG A;  1DE1 A;  2WRT A;  2YZH A;  3WD6 A;  1OKD A;  4ULX A;  3NZN A;  5IPG A;  1U88 A;  4EDZ A;  2ALB A;  3LJR A;  3KD0 A;  1KNG A;  1NW2 A;  1KTE A;  4XRA A;  1GSQ A;  1EOH A;  3GMF A;  2D2Z A;  3O6T A;  2C4J A;  3WGX A;  4TKY A;  1SL2 B;  5EVO A;  1BJX A;  4N11 A;  5HR1 A;  3FR9 A;  5KEJ A;  2H6Y A;  1QFN A;  4TW5 A;  4K6X A;  2LRC A;  1JZW A;  1MEK A;  3D5J A;  3DXB A;  5ECP B;  3E3E A;  3EMX A;  1SYX A;  5D9T A;  5ENU A;  1QK8 A;  3GUS A;  1PSQ A;  5L71 A;  3A2X A;  4FO5 A;  1THO A;  3QPM A;  4FYU A;  1GTU A;  1Z3E A;  5JWR B;  1JHB A;  1MD4 A;  4NAX A;  3W8J A;  1FB0 A;  1B4P A;  5H5S A;  3LSZ A;  3IE3 A;  5J41 A;  3VWU A;  2C0D A;  2VL2 C;  1V98 A;  3EWL A;  3LYP A;  2LNT A;  3IXR A;  2VLU A;  3GSS A;  5FHI A;  1YKC A;  5IMZ A;  5DAL B;  2NDO A;  1SKR B;  4K7O A;  4I8B A;  3BOA A;  5DJL A;  3H8Q A;  3TKS E;  3L9V A;  4IJ3 A;  2JSZ A;  1K0A A;  4MJB A;  2TIR A;  2LNS A;  5G5F A;  4ISD A;  4GCI A;  1XWA A;  4GF0 A;  1VF1 A;  3G7I A;  4MF5 A;  3MSZ A;  2K8S A;  3IRA A;  4FH8 A;  1M99 A;  3HJM A;  2WFC A;  2A2S A;  2F3M A;  4V2N A;  4RUV A;  2R37 A;  4N0V A;  2XPD A;  1GUM A;  2H72 A;  1PX7 A;  1NHY A;  5DAK B;  1X0R A;  5ELG A;  4HU9 A;  2VM1 A;  4JBB A;  1EEM A;  2C1Y A;  2YPM A;  1MTC A;  2RM6 A;  3W8S A;  1YEP A;  1YF0 A;  1A8Y A;  1J0F A;  2H73 A;  4ML6 A;  4MZW A;  3CTG A;  6GSY A;  2VCQ A;  2YV7 A;  4WF5 A;  3NIV A;  1YQ1 A;  4E8H A;  2H6X A;  2WB9 A;  3UBL A;  1JZO A;  4NXI A;  2YN1 A;  5F8B A;  4WXT A;  2VL2 A;  3LEF A;  3VWV A;  4EO3 A;  2DBC A;  4GWR A;  4GRF A;  5IMC A;  5ID2 A;  2L6C A;  2IPA A;  4HOJ A;  1WPI A;  2BTO T;  1ZMA A;  2I81 A;  3VI7 A;  4PUR A;  4JRR A;  4OFM A;  1T00 A;  3UEM A;  1GUK A;  2WZ9 A;  1JLV A;  2H1B A;  1XW9 A;  5ECS A;  4OFN A;  1G6Y A;  3R2Q A;  6GSX A;  2HNL A;  5ECI B;  2CVK A;  4TR0 A;  4GLT A;  3KJY A;  5CRD A;  1H4O A;  4KDX A;  4V2L A;  1GLQ A;  4YAV A;  4MMM A;  1EGO A;  4GQC A;  1GRX A;  2FWG A;  2PUK C;  2A4V A;  1F6M C;  3VPQ A;  4ID0 A;  14GS A;  4EUY A;  1TK8 B;  5GST A;  1XPV A;  5B7C A;  2K8V A;  2XBI A;  1ACV A;  2C3T A;  3GH9 A;  2IMK A;  2GZP A;  1Z6M A;  1OE7 A;  2PWJ A;  4K1F A;  3P7X A;  1MDI A;  1WRY A;  4XIH A;  5ECM B;  3TKQ A;  3DWV A;  2L57 A;  3KTL A;  1BQ7 A;  3O76 A;  3TOT A;  4XS6 A;  1VF2 A;  3QR6 A;  2G0F A;  2HT9 A;  3WGD A;  1QMV A;  2WJU A;  3ME8 A;  5C04 A;  3VPT A;  4L5O A;  2H0H A;  5ECL B;  4L5L A;  3UOM A;  3L4N A;  4POB A;  5GAN D;  3L9S A;  1GSF A;  2X8G A;  4KND A;  1AUC A;  1OC3 A;  1ABA A;  4WR4 A;  4V2M A;  4O7H A;  3C7M A;  1XCC A;  4DSS A;  3ZIJ A;  4PXO A;  5DVB A;  1XW6 A;  2FY6 A;  3PIN A;  20GS A;  1G0T A;  2YOI A;  3N9J A;  1K0C A;  3GH6 A;  2NVL A;  2MMA A;  5DQS A;  5H5R A;  3E0U A;  2YZU A;  1HNA A;  4OO5 A;  2DML A;  1URM A;  3C73 A;  2I3Y A;  3KP9 A;  1OYJ A;  1E2Y A;  2X8H A;  5ID2 B;  2VCX A;  2JSY A;  5ABR A;  5IIZ A;  1GNW A;  3HHV A;  2YWM A;  4LL1 B;  1PKZ A;  4OCF A;  1HYU A;  1Z5Y E;  2CAI A;  2J23 A;  3I6A A;  2HLS A;  1QGV A;  2X64 A;  1AQV A;  3CSI A;  4MAB A;  2DMM A;  4IVF A;  2H71 A;  4DEJ A;  1B48 A;  1A0F A;  1EZK A;  2Z9S A;  3F3R A;  3UBK A;  1XVQ A;  1E6B A;  3P90 A;  4BVY A;  2J9H A;  4Q5N A;  5IPH A;  3E9J B;  4EDY A;  4MJC A;  2B5X A;  5EPF A;  2ZUP A;  19GS A;  2RUF A;  2X8C A;  5E4W A;  5IO0 A;  1BAY A;  5DCG A;  1LJR A;  1RW1 A;  1HNB A;  1KBN A;  4CW9 A;  3QDN A;  1TK5 B;  3QMX A;  4EC0 A;  5DBQ A;  2HZE A;  1EOG A;  5B8A A;  4PQH A;  2B1K A;  3W6G A;  4G2E A;  3RDW A;  4KH7 A;  4HI7 A;  1PMT A;  1XOA A;  3UJ1 A;  3RPN A;  3EMP A;  2GZY A;  3MAK A;  3GKM A;  2GSQ A;  2TRX A;  4DSR A;  1GNE A;  4OWY A;  2B5Y A;  3CBU A;  2B3S A;  4IP1 A;  3QAG A;  5DAL A;  6GSU A;  4I97 A;  5JCG A;  2JL4 A;  1FVK A;  1KEB A;  1T3B A;  1K3Y A;  1G7O A;  2FWF A;  2V1M A;  3GYK A;  1U6T A;  2XPE A;  2JAC A;  2P5R A;  4I2T A;  2R4V A;  4YAP A;  3GHA A;  2E2M A;  4DSS B;  2GDR A;  5HFK A;  1FOV A;  1YZX A;  2DLX A;  1LU4 A;  2CT6 A;  1V58 A;  4YQV A;  1GP1 A;  3ZRE A;  4TR1 A;  1M0U A;  3EYT A;  5KN0 A;  5IO2 A;  5DAK A;  3LWA A;  3H1N A;  1O85 A;  2LJK A;  2P31 A;  3HYP A;  2GSS A;  3QOU A;  1T4Z A;  1TW9 A;  1ERT A;  4BWS A;  1M2D A;  2GT6 A;  3A5W A;  3V1W A;  2KP2 A;  4ECJ A;  3DVW A;  4N30 A;  2JU5 A;  5HFI A;  2CX4 A;  1I9D A;  2N5A A;  5ECH B;  1FG4 A;  2PER A;  2IMF A;  3GL5 A;  5ELA A;  4WKW A;  1V9W A;  2AHE A;  3I43 A;  1SL0 B;  3UAP A;  2B5E A;  4PUA A;  2F8F A;  2I4A A;  3CRT A;  3Q74 A;  4RQX A;  3IBH A;  3TCO A;  4IQA A;  5CYY A;  1ILO A;  3HJP A;  1W89 A;  1UA5 A;  4K8M A;  6GSS A;  1GTA A;  4EF0 A;  4I6X A;  2ON7 A;  3HXS A;  3J7Y b;  2GZZ A;  4HZ4 A;  2OKA A;  5IOX A;  5B6N A;  1A8L A;  2PGT A;  3ERF A;  2H1G A;  1XIY A;  3HZ8 A;  4N0Z A;  3LXZ A;  1HNC A;  3UAR A;  1UC7 A; 
#chains in the Genus database with same CATH topology
 2PMT A;  4FQU A;  3BCI A;  1ZL9 A;  2R5G A;  1TI1 A;  4O92 A;  4Q5F A;  2IL3 A;  1CQH A;  2HZE B;  5DDL A;  3IHQ A;  4D73 A;  2AJQ B;  5CP1 A;  3J7Y k;  2M46 A;  3KM6 A;  3H93 A;  5AIX A;  4KCE A;  3KTB A;  1B8X A;  2L4Q A;  5GZZ B;  1M9A A;  2I1U A;  2LST A;  2HE3 A;  4MJA A;  4WET A;  3M9J A;  4WBR D;  5C00 A;  1TDI A;  4Z7X A;  3Q18 A;  9GSS A;  2O89 A;  1SJI A;  4MH2 A;  3LW9 A;  2A4H A;  1TRU A;  5D9W A;  2OE3 A;  1TP9 A;  4ZL8 A;  4ZBD A;  4K0N A;  1FHE A;  3KP8 A;  3M8N A;  2OAD A;  1ZYE A;  2LQQ A;  4POL A;  3ED3 A;  2I9H A;  4BA7 A;  2E2G A;  1SKS B;  1HQO A;  4Z2U A;  3QAW A;  1K0N A;  1EWX A;  11GS A;  4WEY A;  1GWC A;  3FEU A;  2O7K A;  3APQ A;  5JCW A;  4TR1 B;  1M7T A;  3F3Q A;  3DKS A;  3GFK A;  4HJM A;  2HFD A;  5F07 A;  3DML A;  3QFA C;  3LG6 A;  3TDG A;  3OR5 A;  1WMJ A;  3PR8 A;  5CRG A;  2GVP A;  5ECN B;  1O8W A;  2L4C A;  1U3A A;  2H30 A;  5JCU A;  1WP0 A;  4MF7 A;  1F37 A;  3GIX A;  2OAC A;  5IMD A;  4CY8 A;  2REM A;  2BMX A;  2HRF A;  3GA4 A;  4L0W A;  5KOX A;  4K9Z A;  4TN8 A;  1M9B A;  2H6Z A;  1GTB A;  4K5S A;  2L59 A;  4NMU A;  3F4T A;  1JZR A;  1Q4J A;  2HZF A;  1FVJ A;  1GUL A;  1XWG A;  2JAD A;  2H1A A;  2VD0 A;  4BPY A;  1M2A A;  3CQF A;  4K7I A;  1Z7P A;  2C0F A;  4NWY A;  5IOW A;  4O5U A;  4ZIL A;  2VCZ A;  4EE0 A;  1FB6 A;  3DRN A;  4KB3 A;  2F8A A;  2P5Q A;  2VIM A;  4O5R A;  5D9V A;  4QL7 A;  3I9V 2;  2R3X A;  2C0G A;  2VLT A;  5JWO B;  2YAN A;  4CDO A;  1XXU A;  3F9U A;  3IK9 A;  4KUN A;  2KP1 A;  3TJK A;  4KSM A;  1B4Q A;  2PN8 A;  3IPZ A;  3P8W A;  7GSS A;  2YV9 A;  4ECI A;  4F2I A;  4D73 B;  2R0C A;  2AAW A;  2P0G A;  4MPG A;  3VWX A;  2GST A;  2LS5 A;  2CV4 A;  2QA1 A;  3IA1 A;  1ERW A;  2ON5 A;  5EL8 A;  4NHW A;  3QAV A;  4JED A;  5IM9 A;  3TOU A;  2CVD A;  3GST A;  3C1R A;  1XWK A;  3G9B A;  3QD9 A;  1G6W A;  2O85 A;  2NBS A;  4LA1 A;  5G1K A;  1O73 A;  1PGT A;  3GN3 A;  2LJA A;  2JZS A;  4MCU A;  4IW9 A;  4YQU A;  3ERG A;  2V6O A;  1O6J A;  1O81 A;  5G30 A;  3HCZ A;  5IMV A;  3D6I A;  4LL4 B;  2F51 A;  2FD3 A;  4TOP A;  3M3M A;  4XS4 A;  1Z9H A;  3HDC A;  3H4K A;  1WWJ A;  1PKW A;  2FWH A;  1V40 A;  2MYG A;  4PGT A;  3FYG A;  2OBK A;  2WDU A;  4K2D A;  3HVS A;  4KSO A;  1X9S B;  3ME7 A;  2KUC A;  3QFB C;  1M3J A;  2ZCT A;  5DJM A;  2TRC P;  4MH3 A;  4IKH A;  3LQ7 A;  5A4U A;  3TJJ A;  1SD8 A;  2QKE A;  2DJ2 A;  4H86 A;  5IMA A;  4EIQ A;  1USB A;  1PN9 A;  4IN0 A;  3CSH A;  2HRN A;  2UZ8 A;  1X9M B;  1B9X C;  1TKD B;  1X5C A;  3VUR A;  2LV3 A;  4CY6 A;  2RUE A;  2IFQ A;  1PL2 A;  4AJ6 A;  1SYR A;  1OC9 A;  2H19 A;  2GQM A;  4TR3 A;  1WIK A;  3VFI A;  3KH7 A;  6GST A;  1JFU A;  1PRX A;  1UVZ A;  2NPB A;  3UIW A;  2C3Q A;  2C0E A;  2YWN A;  1S3C A;  3A2V A;  2IMD A;  3L78 A;  5CRE A;  3P2A A;  3GKN A;  3O3T A;  3M1G A;  4ZXG A;  3DIE A;  2FCH A;  2PU9 C;  2BJX A;  3IAM 2;  2QC7 A;  3CMI A;  3DVX A;  1GUH A;  4CHS A;  4GSN A;  3HY2 A;  2ES7 A;  4USS A;  2IN3 A;  2WS2 A;  2GT5 A;  3K8N A;  5G1L A;  3FR6 A;  3ZMK A;  2RM5 A;  1GSU A;  3GX0 A;  2HI7 A;  2QGV A;  2FA4 A;  1SKW B;  2DJK A;  4YQM A;  2FGX A;  3LGC A;  1SK0 A;  3GUR A;  3BD2 A;  5A5K A;  3F6F A;  4ECC A;  5COH A;  1PL1 A;  3F4S A;  3IOS A;  4IGJ A;  2DC5 A;  4GTU A;  3ZFB A;  3NOF A;  4RI6 A;  1OVN A;  2CZ3 A;  4HU7 A;  2WUL A;  1B9Y C;  2EC4 A;  2B6M A;  2JZT A;  1DUG A;  4WF4 A;  1Y6E A;  5HR2 A;  5JWQ B;  1W4V A;  1IYI A;  1GTI A;  2ZNM A;  4PNG A;  1EV9 A;  1UN2 A;  2GQK A;  2MMZ A;  2AYT A;  5HR0 A;  3TGZ A;  4KGI A;  2V41 A;  5LNK e;  5B8B A;  5FT3 A;  1A2J A;  5AGY A;  4I2U A;  4G10 A;  1JZD A;  3R3E A;  4ZBB A;  4MLY A;  3L0H A;  4HUA A;  5H5Q A;  1SU9 A;  1SL1 B;  1AQW A;  4HSC X;  4MJE A;  3U6V A;  1JLW A;  4F0C A;  4XS4 B;  2HYX A;  3EUR A;  1ZYQ B;  3BCK A;  2LKU A;  2R0G A;  1RQM A;  3GL3 A;  5D73 A;  4NHZ A;  4G0L A;  3G7J A;  1N2A A;  4WR5 A;  2RLI A;  4GST A;  1R7H A;  2MMN A;  3FMW A;  1XWC A;  3GRX A;  5D93 A;  2PPT A;  3KEB A;  1WOU A;  4PX1 A;  4E8E A;  1OC8 A;  4OD7 A;  1YY7 A;  4MF6 A;  2LEG A;  3HKR A;  2A2P A;  5HQP A;  1OAZ A;  3M9K A;  3C8E A;  4BWQ A;  4LMW A;  2IFQ B;  2EIR A;  5HFG A;  5KN3 A;  3ZRD A;  3D4T A;  3IAS 2;  1OC9 B;  1S3R A;  2IWT A;  1PX6 A;  4JR6 A;  1XBS A;  3IC4 A;  4KA0 A;  5BRT A;  2DIY A;  2H01 A;  1J08 A;  1TK0 B;  5A4W A;  3RAZ A;  4YKG A;  5AIV A;  3HVX A;  1XW5 A;  1AAZ A;  1DBY A;  3CYN A;  5D9X A;  4IBP A;  3FZ5 A;  5B6M A;  2GSR A;  3UVH A;  5GSS A;  4L8E A;  3L9U A;  3WGE A;  1PN0 A;  4Q5Q A;  2IJY A;  2H1D A;  2CAQ A;  2O8V B;  4N10 A;  3EE2 A;  1X5E A;  3M0F A;  2VL3 A;  1FO5 A;  4HZ2 A;  4V1A g;  4TVE A;  1A23 A;  22GS A;  4JU5 A;  1XOB A;  2FWE A;  1N8J A;  1OKT A;  2XHF A;  3F8U A;  2EIQ A;  2X4A A;  3N5O A;  4OFT A;  2GTU A;  3GTU B;  3PH9 A;  4ICY A;  1O8X A;  4OO4 A;  1S3D A;  2AUV A;  4ZL9 A;  4RQR A;  1TJD A;  3VLN A;  5ECQ B;  2K9F A;  2N5B A;  4XTS A;  5G2Z A;  3ZL5 A;  1VGL A;  18GS A;  1K0O A;  5LD0 A;  4P3Y B;  3ZYW A;  4HEA 2;  1A2L A;  1Y25 A;  4I5Q A;  4PUF C;  5ECO B;  2MMO A;  3TRX A;  1ZYN A;  1M2B A;  3MYD A;  2VUP A;  2L5L A;  1AW9 A;  1XG8 A;  2LTK A;  3HJO A;  3VK9 A;  1BX9 A;  4HDE A;  5E59 A;  1T1V A;  2VLV A;  2VM2 A;  1BYE A;  2B7J A;  5HR3 A;  2H0I A;  2C8U A;  4O32 A;  2VL9 A;  4PTS A;  2CQ9 A;  4XCS A;  4L0U A;  1YDK A;  1PQN A;  3A5I A;  5J9C A;  4AJ7 A;  1R4W A;  3FK8 A;  2G2Q A;  4DSQ A;  1VF3 A;  3LYK A;  3PGT A;  4LMV A;  1TU7 A;  2AV4 A;  3ZVJ A;  1C72 A;  1V2A A;  1ERU A;  4EXJ A;  2R6K A;  3D21 A;  1K0B A;  4QL9 A;  4F82 A;  1DE2 A;  1ZZY A;  4Q5R A;  4AJ8 A;  2VCW A;  2MBT A;  4NPB A;  3ZZX A;  5AIS A;  2HSH A;  4MK3 A;  1YJ6 A;  3F4R A;  1VF4 A;  3GKK A;  3F63 A;  1GL8 A;  3Q6O A;  5J3R A;  1Z7R A;  5GAP D;  1MD3 A;  1TRS A;  3DD3 A;  1PFO A;  1BG5 A;  2IME A;  4YH2 A;  3KXO A;  2CA8 A;  3RPP A;  4GSS A;  4K0G A;  1F3A A;  16GS A;  1GSS A;  1QUW A;  4XHM A;  3KGK A;  2GS3 A;  3CRU A;  3AY8 A;  2DJ3 A;  4BL7 A;  2H74 A;  3HVV A;  2OE1 A;  2VO4 A;  2LUS A;  3KMN A;  2L6D A;  1T8E B;  4TXO B;  2X99 A;  2FLS A;  1K0D A;  1CQG A;  3RHB A;  2B1L A;  4POK A;  3C71 A;  3H79 A;  1U3I A;  4MZB A;  4KX4 A;  2VCV A;  1OE8 A;  4X43 A;  4MPF A;  5AN1 A;  3D0Z A;  4ZBA A;  2XBQ A;  5D8I A;  3FZ9 A;  1M3I A;  2DJJ A;  4DVC A;  1RK4 A;  2KHP A;  4PNF A;  2C80 A;  4NV2 A;  2GLR A;  1SEN A;  13GS A;  3KMO A;  1LBK A;  2PBJ A;  1V57 A;  4J57 E;  5LCZ A;  3S9F A;  3SWL A;  1YKA A;  3EU4 A;  5F06 A;  3ZIT A;  2H70 A;  4MZC A;  3FHK A;  4HQS A;  1DSB A;  3EC3 A;  2MBS A;  3ZFL A;  2IMI A;  2IIY A;  3LXT A;  3FRC A;  3IR4 A;  3ZML A;  3RHC A;  1XWB A;  4X0X A;  3FZA A;  4IS0 A;  2MZC A;  5IMF A;  2V6K A;  2YWI A;  2YWO A;  1S3A A;  3D4M A;  2F9S A;  2KOK A;  2HSM A;  5J4U A;  3MDK A;  4BVX A;  2E7P A;  3ISO A;  3BJ5 A;  4V1A p;  4WBJ A;  3C1S A;  4K7N A;  4OMV A;  1MDK A;  2FHE A;  1SJZ A;  2FUG 2;  1QXH A;  5DQY A;  4POM A;  3SBC A;  2LRT A;  2K6V A;  2B7K A;  5KOW A;  4JE1 A;  1ZGN A;  2R2J A;  3EU3 A;  2H0G A;  3TKR A;  4G9H A;  1NSW A;  3A3T A;  2LQO A;  1SD9 A;  4ECB A;  5G5E A;  2AB6 A;  2CX3 A;  4XRD A;  3TJG A;  1R5A A;  1K3L A;  3ZVJ D;  1EP7 A;  3IV4 A;  2VD1 A;  4MDC A;  5FWG A;  1F2E A;  1GLP A;  2EIO A;  5CRW A;  2LRN A;  4KE3 A;  1SJ6 A;  4J2F A;  4JR4 A;  4YKF A;  3ZLP A;  5F05 A;  3FY7 A;  4TR4 A;  1A2M A;  1K3O A;  2NTO A;  4FYC A;  1ERV A;  4PQI A;  3TB2 A;  1TTZ A;  4FYB A;  1THX A;  3TKP A;  2E0Q A;  1H75 A;  2FNO A;  4KF9 A;  2OJL A;  4ZB9 A;  2LJR A;  1YEX A;  3ERW A;  3WT2 A;  4HQZ A;  3VI5 A;  1XVW A;  4AGS A;  1A0R P;  5ECK B;  4HS1 A;  2DSA A;  4MNN A;  2KLX A;  1F3B A;  1ON4 A;  4JZQ A;  2H75 A;  4HJ2 A;  1EV4 A;  17GS A;  1TOF A;  4AF2 A;  4BL7 B;  4LLR A;  5KN1 A;  4Z2R A;  2A2R A;  1PA3 A;  2V32 A;  3MWH A;  1Q98 A;  4KCA A;  4MA9 A;  4IP6 A;  1WE0 A;  3LFL A;  4RI7 A;  3APS A;  3RBT A;  4KAE A;  2M80 A;  4F0B A;  4XS1 A;  3JCM L;  3U5R E;  1WJK A;  5G31 A;  1HD2 A;  1BED A;  5EY6 A;  1GH2 A;  5CRH A;  1TU8 A;  1FAA A;  4TXV A;  2WCI A;  3GTU A;  1AQX A;  3KH9 A;  1R5P A;  5A4V A;  1AC1 A;  1VRS D;  5CO3 A;  1U87 A;  2N5F A;  5CNW A;  3KZQ A;  1FW1 A;  1MDJ A;  2VAF A;  1O7U A;  1ZOF A;  1R26 A;  4BVX B;  2DJ1 A;  4ML1 A;  4ZIJ A;  3IK7 A;  4QQ7 A;  3TJF A;  3IDV A;  1TXX A;  1ZCP A;  6GSW A;  2PVO C;  4ZL7 A;  3FZ4 A;  1T4Y A;  3US3 A;  4K5R A;  5DCH A;  4EL1 A;  1QQ2 A;  3F0I A;  2DKI A;  4EKZ A;  1Z6N A;  3EIN A;  3FW2 A;  2VOC A;  3QCP A;  5D96 A;  3HZ4 A;  3TKS C;  1SK2 A;  4G19 A;  5ECR B;  2YJ7 A;  1TRV A;  1I5G A;  1GSY A;  1X5D A;  2FA8 A;  1SK1 A;  1T7P B;  4X1U A;  2M72 A;  3D22 A;  3VWW A;  2OE0 A;  3GX8 A;  4IEL A;  3DEX A;  2PVQ A;  3CXG A;  2HSY A;  3G7Y A;  3APO A;  3WT1 A;  4GQF A;  3PPU A;  1IYH A;  5J5N A;  3DGQ A;  2L5O A;  1EGR A;  3CSJ A;  4IHU A;  3A2W A;  3FR3 A;  5CAX A;  1GSE A;  2OA7 A;  3TJB A;  2RII A;  2GQL A;  2YJH A;  4MP4 A;  1ZYP A;  1X9W B;  2VCT A;  1XZO A;  4F9Z A;  2CZ2 A;  1F9M A;  1TRW A;  2YP6 A;  4K2X A;  3EVI A;  2QSI A;  4F03 A;  2DIZ A;  6GSV A;  4ILF A;  3TUE A;  3TRP A;  3UMA A;  2HXK A;  4BIK A;  1YF1 A;  1G7E A;  3FKF A;  4J56 E;  2JZR A;  2OBI A;  2C3N A;  1AIU A;  3DYR A;  5F0G A;  10GS A;  1ST9 A;  1ML6 A;  2GGT A;  1PD2 1;  1NM3 A;  4EVM A;  3KIJ A;  1EEJ A;  3ZTL A;  1XFL A;  3HD5 A;  3HVN A;  3WYW A;  2V2G A;  3HA9 A;  4TRX A;  4ACS A;  3CTF A;  2YCD A;  3TKS A;  4OCE A;  2DJ0 A;  4ZB6 A;  1AXD A;  5KN2 A;  2XC2 A;  3UL3 A;  2YNX A;  3I69 A;  3Q19 A;  4NV5 A;  3UVT A;  5INY A;  12GS A;  2H8L A;  1EP8 A;  4TXO A;  5J9B A;  2O87 A;  3F6D A;  4ZB8 A;  2WGR A;  1J9B A;  1A24 A;  3BBY A;  3KCM A;  3TRQ A;  1K0M A;  1TI3 A;  1GSD A;  4GXZ A;  8GSS A;  2K18 A;  4PQ1 A;  3ZIV A;  4FIW A;  4KDY A;  4IQ1 A;  2CVB A;  3GV1 A;  4IJI A;  5IQY A;  2H66 A;  4KW6 A;  3GKX A;  4KDU A;  3LOR A;  1NHO A;  3GNJ A;  2H76 A;  3MNG A;  1DE1 A;  3EPT A;  2WRT A;  2YZH A;  4EIP A;  3WD6 A;  1OKD A;  4ULX A;  3NZN A;  2QA2 A;  5IPG A;  1U88 A;  4EDZ A;  2ALB A;  3LJR A;  3KD0 A;  1KNG A;  1NW2 A;  1KTE A;  4XRA A;  1GSQ A;  1EOH A;  4BVY B;  3GMF A;  2D2Z A;  3O6T A;  2C4J A;  3WGX A;  4TKY A;  1SL2 B;  5EVO A;  1BJX A;  4N11 A;  5HR1 A;  3FR9 A;  5KEJ A;  2H6Y A;  1QFN A;  4TW5 A;  4K6X A;  2LRC A;  1JZW A;  1MEK A;  3D5J A;  2HRA A;  3DXB A;  5ECP B;  3E3E A;  3EMX A;  1SYX A;  5D9T A;  5ENU A;  1QK8 A;  3GUS A;  1PSQ A;  5L71 A;  3A2X A;  4FO5 A;  1THO A;  3QPM A;  4O5Q A;  4FYU A;  1GTU A;  1Z3E A;  5JWR B;  1JHB A;  1MD4 A;  4NAX A;  3W8J A;  1FB0 A;  1B4P A;  5H5S A;  3LSZ A;  3IE3 A;  5J41 A;  3VWU A;  2C0D A;  2VL2 C;  1V98 A;  3EWL A;  3LYP A;  2LNT A;  3IXR A;  2VLU A;  3GSS A;  5FHI A;  1YKC A;  5IMZ A;  5DAL B;  2NDO A;  1SKR B;  4K7O A;  4I8B A;  3BOA A;  5DJL A;  3H8Q A;  3TKS E;  3L9V A;  4IJ3 A;  2JSZ A;  1K0A A;  4MJB A;  2TIR A;  2LNS A;  5G5F A;  4ISD A;  4GCI A;  1XWA A;  4GF0 A;  1VF1 A;  3G7I A;  4MF5 A;  3MSZ A;  2K8S A;  3IRA A;  4FH8 A;  1M99 A;  3HJM A;  2WFC A;  2A2S A;  2F3M A;  4V2N A;  4RUV A;  2R37 A;  4N0V A;  2XPD A;  1GUM A;  2H72 A;  1PX7 A;  1NHY A;  5DAK B;  1X0R A;  5ELG A;  4HU9 A;  2VM1 A;  4JBB A;  1EEM A;  2C1Y A;  2YPM A;  1MTC A;  2RM6 A;  3W8S A;  1YEP A;  1YF0 A;  1A8Y A;  1J0F A;  2H73 A;  4ML6 A;  4MZW A;  3CTG A;  6GSY A;  2VCQ A;  2YV7 A;  4WF5 A;  3NIV A;  1YQ1 A;  4E8H A;  2H6X A;  2WB9 A;  3UBL A;  1JZO A;  4NXI A;  2YN1 A;  5F8B A;  4WXT A;  2VL2 A;  2R0P A;  3LEF A;  3VWV A;  4EO3 A;  2DBC A;  4GWR A;  4GRF A;  5IMC A;  5ID2 A;  2L6C A;  2IPA A;  4HOJ A;  1WPI A;  2BTO T;  1ZMA A;  2I81 A;  3VI7 A;  4PUR A;  4JRR A;  4OFM A;  1T00 A;  2DKH A;  3UEM A;  1GUK A;  2WZ9 A;  1JLV A;  2H1B A;  1XW9 A;  5ECS A;  4OFN A;  1G6Y A;  3R2Q A;  6GSX A;  2HNL A;  5ECI B;  2CVK A;  4TR0 A;  4GLT A;  3IHG A;  3KJY A;  5CRD A;  1H4O A;  4KDX A;  4V2L A;  1GLQ A;  4YAV A;  4MMM A;  1EGO A;  4GQC A;  1GRX A;  2FWG A;  4G0I A;  2PUK C;  2A4V A;  1F6M C;  3VPQ A;  4ID0 A;  14GS A;  4EUY A;  1TK8 B;  5GST A;  1XPV A;  5B7C A;  2K8V A;  2XBI A;  1ACV A;  2C3T A;  3GH9 A;  2IMK A;  2GZP A;  1Z6M A;  1OE7 A;  2PWJ A;  4K1F A;  3P7X A;  1MDI A;  1WRY A;  4XIH A;  5ECM B;  3TKQ A;  3DWV A;  2L57 A;  3KTL A;  1BQ7 A;  3O76 A;  3TOT A;  4XS6 A;  1VF2 A;  3QR6 A;  2G0F A;  2HT9 A;  3WGD A;  1QMV A;  2WJU A;  3ME8 A;  5C04 A;  3VPT A;  4L5O A;  2H0H A;  3IC8 A;  5ECL B;  4L5L A;  3UOM A;  3L4N A;  4POB A;  5GAN D;  3L9S A;  1GSF A;  2X8G A;  4KND A;  1AUC A;  1OC3 A;  1ABA A;  4WR4 A;  4V2M A;  4O7H A;  3C7M A;  1XCC A;  4DSS A;  3ZIJ A;  4PXO A;  5DVB A;  1XW6 A;  2FY6 A;  4A5P A;  3PIN A;  20GS A;  1G0T A;  2YOI A;  3N9J A;  1K0C A;  3GH6 A;  2NVL A;  2MMA A;  5DQS A;  5H5R A;  3E0U A;  2YZU A;  1HNA A;  4OO5 A;  2DML A;  1URM A;  2HRK A;  3C73 A;  2I3Y A;  3KP9 A;  1OYJ A;  1E2Y A;  2X8H A;  5ID2 B;  2VCX A;  2JSY A;  5ABR A;  5IIZ A;  1GNW A;  3HHV A;  2YWM A;  4LL1 B;  1PKZ A;  4OCF A;  1HYU A;  1Z5Y E;  2CAI A;  2J23 A;  3I6A A;  2HLS A;  1QGV A;  2X64 A;  1AQV A;  3CSI A;  4MAB A;  2DMM A;  4IVF A;  2H71 A;  4DEJ A;  1B48 A;  1A0F A;  1EZK A;  2Z9S A;  3F3R A;  3UBK A;  1XVQ A;  1E6B A;  3P90 A;  4BVY A;  2J9H A;  4Q5N A;  5IPH A;  3E9J B;  4G0K A;  4EDY A;  4MJC A;  2B5X A;  5EPF A;  2ZUP A;  19GS A;  2RUF A;  2X8C A;  5E4W A;  5IO0 A;  1BAY A;  5DCG A;  1LJR A;  1RW1 A;  1HNB A;  1KBN A;  4CW9 A;  3QDN A;  1TK5 B;  3QMX A;  4EC0 A;  5DBQ A;  2HZE A;  1EOG A;  5B8A A;  4PQH A;  2B1K A;  3W6G A;  4G2E A;  3RDW A;  4KH7 A;  4HI7 A;  1PMT A;  4Z2T A;  1XOA A;  3UJ1 A;  3RPN A;  2X49 A;  3EMP A;  2GZY A;  3MAK A;  3GKM A;  2GSQ A;  2TRX A;  4DSR A;  1GNE A;  4OWY A;  2B5Y A;  3CBU A;  2B3S A;  4IP1 A;  3QAG A;  5DAL A;  6GSU A;  4I97 A;  5JCG A;  2JL4 A;  1FVK A;  1KEB A;  1T3B A;  1K3Y A;  1G7O A;  2FWF A;  2V1M A;  3GYK A;  1U6T A;  2XPE A;  2JAC A;  2P5R A;  4I2T A;  2R4V A;  4YAP A;  3GHA A;  2E2M A;  4DSS B;  2GDR A;  5HFK A;  1FOV A;  1YZX A;  2DLX A;  1LU4 A;  1FOH A;  2CT6 A;  1V58 A;  4YQV A;  1GP1 A;  3ZRE A;  4TR1 A;  1M0U A;  3EYT A;  5KN0 A;  5IO2 A;  5DAK A;  3LWA A;  3H1N A;  1O85 A;  2LJK A;  2P31 A;  3HYP A;  2GSS A;  3QOU A;  1T4Z A;  1TW9 A;  4X4J A;  1ERT A;  4BWS A;  1M2D A;  2GT6 A;  3A5W A;  3V1W A;  2KP2 A;  4ECJ A;  3DVW A;  4N30 A;  2JU5 A;  5HFI A;  2CX4 A;  1I9D A;  2N5A A;  5ECH B;  1FG4 A;  2PER A;  2IMF A;  3GL5 A;  5ELA A;  4WKW A;  1V9W A;  2AHE A;  3I43 A;  1SL0 B;  3UAP A;  2B5E A;  4PUA A;  2F8F A;  2I4A A;  3CRT A;  3Q74 A;  4RQX A;  3IBH A;  3TCO A;  4IQA A;  5CYY A;  1ILO A;  3HJP A;  1W89 A;  1UA5 A;  4K8M A;  6GSS A;  1GTA A;  4EF0 A;  5BMU A;  4I6X A;  2ON7 A;  3HXS A;  3J7Y b;  2GZZ A;  4HZ4 A;  2OKA A;  5IOX A;  5B6N A;  1A8L A;  2PGT A;  3MIX A;  3ERF A;  2H1G A;  1XIY A;  3HZ8 A;  4N0Z A;  3LXZ A;  1HNC A;  3UAR A;  1UC7 A; 
#chains in the Genus database with same CATH homology
 2PMT A;  4FQU A;  3BCI A;  1ZL9 A;  2R5G A;  1TI1 A;  4O92 A;  4Q5F A;  2IL3 A;  1CQH A;  2HZE B;  5DDL A;  3IHQ A;  4D73 A;  2AJQ B;  5CP1 A;  3J7Y k;  2M46 A;  3KM6 A;  3H93 A;  5AIX A;  4KCE A;  3KTB A;  1B8X A;  2L4Q A;  5GZZ B;  1M9A A;  2I1U A;  2LST A;  2HE3 A;  4MJA A;  4WET A;  3M9J A;  4WBR D;  5C00 A;  1TDI A;  4Z7X A;  3Q18 A;  9GSS A;  2O89 A;  1SJI A;  4MH2 A;  3LW9 A;  2A4H A;  1TRU A;  5D9W A;  2OE3 A;  1TP9 A;  4ZL8 A;  4ZBD A;  4K0N A;  1FHE A;  3KP8 A;  3M8N A;  2OAD A;  1ZYE A;  2LQQ A;  4POL A;  3ED3 A;  2I9H A;  4BA7 A;  2E2G A;  1SKS B;  1HQO A;  4Z2U A;  3QAW A;  1K0N A;  1EWX A;  11GS A;  4WEY A;  1GWC A;  3FEU A;  2O7K A;  3APQ A;  5JCW A;  4TR1 B;  1M7T A;  3F3Q A;  3DKS A;  3GFK A;  4HJM A;  2HFD A;  5F07 A;  3DML A;  3QFA C;  3LG6 A;  3TDG A;  3OR5 A;  1WMJ A;  3PR8 A;  5CRG A;  2GVP A;  5ECN B;  1O8W A;  2L4C A;  1U3A A;  2H30 A;  5JCU A;  1WP0 A;  4MF7 A;  1F37 A;  3GIX A;  2OAC A;  5IMD A;  4CY8 A;  2REM A;  2BMX A;  2HRF A;  3GA4 A;  4L0W A;  5KOX A;  4K9Z A;  4TN8 A;  1M9B A;  2H6Z A;  1GTB A;  4K5S A;  2L59 A;  4NMU A;  3F4T A;  1JZR A;  1Q4J A;  2HZF A;  1FVJ A;  1GUL A;  1XWG A;  2JAD A;  2H1A A;  2VD0 A;  4BPY A;  1M2A A;  4K7I A;  1Z7P A;  2C0F A;  4NWY A;  5IOW A;  4O5U A;  4ZIL A;  2VCZ A;  4EE0 A;  1FB6 A;  3DRN A;  4KB3 A;  2F8A A;  2P5Q A;  2VIM A;  4O5R A;  5D9V A;  4QL7 A;  3I9V 2;  2R3X A;  2C0G A;  2VLT A;  5JWO B;  2YAN A;  4CDO A;  1XXU A;  3F9U A;  3IK9 A;  4KUN A;  2KP1 A;  3TJK A;  4KSM A;  1B4Q A;  2PN8 A;  3IPZ A;  3P8W A;  7GSS A;  2YV9 A;  4ECI A;  4F2I A;  4D73 B;  2R0C A;  2AAW A;  2P0G A;  4MPG A;  3VWX A;  2GST A;  2LS5 A;  2CV4 A;  2QA1 A;  3IA1 A;  1ERW A;  2ON5 A;  5EL8 A;  4NHW A;  3QAV A;  4JED A;  5IM9 A;  3TOU A;  2CVD A;  3GST A;  3C1R A;  1XWK A;  3G9B A;  3QD9 A;  1G6W A;  2O85 A;  2NBS A;  4LA1 A;  5G1K A;  1O73 A;  1PGT A;  3GN3 A;  2LJA A;  2JZS A;  4MCU A;  4IW9 A;  4YQU A;  3ERG A;  2V6O A;  1O6J A;  1O81 A;  5G30 A;  3HCZ A;  5IMV A;  3D6I A;  4LL4 B;  2F51 A;  2FD3 A;  4TOP A;  3M3M A;  4XS4 A;  1Z9H A;  3HDC A;  3H4K A;  1WWJ A;  1PKW A;  2FWH A;  1V40 A;  2MYG A;  4PGT A;  3FYG A;  2OBK A;  2WDU A;  4K2D A;  3HVS A;  4KSO A;  1X9S B;  3ME7 A;  2KUC A;  3QFB C;  2ZCT A;  5DJM A;  2TRC P;  4MH3 A;  4IKH A;  3LQ7 A;  5A4U A;  3TJJ A;  1SD8 A;  2QKE A;  2DJ2 A;  4H86 A;  5IMA A;  4EIQ A;  1USB A;  1PN9 A;  4IN0 A;  3CSH A;  2HRN A;  2UZ8 A;  1X9M B;  1B9X C;  1TKD B;  1X5C A;  3VUR A;  2LV3 A;  4CY6 A;  2RUE A;  2IFQ A;  1PL2 A;  4AJ6 A;  1SYR A;  1OC9 A;  2H19 A;  2GQM A;  4TR3 A;  1WIK A;  3VFI A;  3KH7 A;  6GST A;  1JFU A;  1PRX A;  1UVZ A;  2NPB A;  3UIW A;  2C3Q A;  2C0E A;  2YWN A;  1S3C A;  3A2V A;  2IMD A;  3L78 A;  5CRE A;  3P2A A;  3GKN A;  3O3T A;  3M1G A;  4ZXG A;  3DIE A;  2FCH A;  2PU9 C;  2BJX A;  3IAM 2;  2QC7 A;  3CMI A;  3DVX A;  1GUH A;  4CHS A;  4GSN A;  3HY2 A;  2ES7 A;  4USS A;  2IN3 A;  2WS2 A;  2GT5 A;  3K8N A;  5G1L A;  3FR6 A;  3ZMK A;  2RM5 A;  1GSU A;  3GX0 A;  2HI7 A;  2QGV A;  2FA4 A;  1SKW B;  2DJK A;  4YQM A;  2FGX A;  3LGC A;  1SK0 A;  3GUR A;  3BD2 A;  5A5K A;  3F6F A;  4ECC A;  5COH A;  1PL1 A;  3F4S A;  3IOS A;  4IGJ A;  2DC5 A;  4GTU A;  3ZFB A;  3NOF A;  4RI6 A;  1OVN A;  2CZ3 A;  4HU7 A;  2WUL A;  1B9Y C;  2EC4 A;  2B6M A;  2JZT A;  1DUG A;  4WF4 A;  1Y6E A;  5HR2 A;  5JWQ B;  1W4V A;  1IYI A;  1GTI A;  2ZNM A;  4PNG A;  1EV9 A;  1UN2 A;  2GQK A;  2MMZ A;  2AYT A;  5HR0 A;  3TGZ A;  4KGI A;  2V41 A;  5LNK e;  5B8B A;  5FT3 A;  1A2J A;  5AGY A;  4I2U A;  4G10 A;  1JZD A;  3R3E A;  4ZBB A;  4MLY A;  3L0H A;  4HUA A;  5H5Q A;  1SU9 A;  1SL1 B;  1AQW A;  4MJE A;  3U6V A;  1JLW A;  4F0C A;  4XS4 B;  2HYX A;  3EUR A;  1ZYQ B;  3BCK A;  2LKU A;  2R0G A;  1RQM A;  3GL3 A;  5D73 A;  4NHZ A;  4G0L A;  3G7J A;  1N2A A;  4WR5 A;  2RLI A;  4GST A;  1R7H A;  2MMN A;  3FMW A;  1XWC A;  3GRX A;  5D93 A;  2PPT A;  3KEB A;  1WOU A;  4PX1 A;  4E8E A;  1OC8 A;  4OD7 A;  1YY7 A;  4MF6 A;  2LEG A;  3HKR A;  2A2P A;  5HQP A;  1OAZ A;  3M9K A;  3C8E A;  4BWQ A;  4LMW A;  2IFQ B;  2EIR A;  5HFG A;  5KN3 A;  3ZRD A;  3D4T A;  3IAS 2;  1OC9 B;  2IWT A;  1PX6 A;  4JR6 A;  1XBS A;  3IC4 A;  4KA0 A;  5BRT A;  2DIY A;  2H01 A;  1J08 A;  1TK0 B;  5A4W A;  3RAZ A;  4YKG A;  5AIV A;  3HVX A;  1XW5 A;  1AAZ A;  1DBY A;  3CYN A;  5D9X A;  4IBP A;  3FZ5 A;  5B6M A;  2GSR A;  3UVH A;  5GSS A;  4L8E A;  3L9U A;  3WGE A;  1PN0 A;  4Q5Q A;  2IJY A;  2H1D A;  2CAQ A;  2O8V B;  4N10 A;  3EE2 A;  1X5E A;  3M0F A;  2VL3 A;  1FO5 A;  4HZ2 A;  4V1A g;  4TVE A;  1A23 A;  22GS A;  4JU5 A;  1XOB A;  2FWE A;  1N8J A;  1OKT A;  2XHF A;  3F8U A;  2EIQ A;  2X4A A;  3N5O A;  4OFT A;  2GTU A;  3GTU B;  3PH9 A;  4ICY A;  1O8X A;  4OO4 A;  1S3D A;  2AUV A;  4ZL9 A;  4RQR A;  1TJD A;  3VLN A;  5ECQ B;  2K9F A;  2N5B A;  4XTS A;  5G2Z A;  3ZL5 A;  1VGL A;  18GS A;  1K0O A;  5LD0 A;  4P3Y B;  3ZYW A;  4HEA 2;  1A2L A;  1Y25 A;  4I5Q A;  4PUF C;  5ECO B;  2MMO A;  3TRX A;  1ZYN A;  1M2B A;  3MYD A;  2VUP A;  2L5L A;  1AW9 A;  2LTK A;  3HJO A;  3VK9 A;  1BX9 A;  4HDE A;  5E59 A;  1T1V A;  2VLV A;  2VM2 A;  1BYE A;  2B7J A;  5HR3 A;  2H0I A;  2C8U A;  4O32 A;  2VL9 A;  4PTS A;  2CQ9 A;  4XCS A;  4L0U A;  1YDK A;  1PQN A;  3A5I A;  5J9C A;  4AJ7 A;  1R4W A;  3FK8 A;  2G2Q A;  4DSQ A;  1VF3 A;  3LYK A;  3PGT A;  4LMV A;  1TU7 A;  2AV4 A;  3ZVJ A;  1C72 A;  1V2A A;  1ERU A;  4EXJ A;  2R6K A;  3D21 A;  1K0B A;  4QL9 A;  4F82 A;  1DE2 A;  1ZZY A;  4Q5R A;  4AJ8 A;  2VCW A;  2MBT A;  4NPB A;  3ZZX A;  5AIS A;  2HSH A;  4MK3 A;  1YJ6 A;  3F4R A;  1VF4 A;  3GKK A;  3F63 A;  1GL8 A;  3Q6O A;  5J3R A;  1Z7R A;  5GAP D;  1MD3 A;  1TRS A;  3DD3 A;  1BG5 A;  2IME A;  4YH2 A;  3KXO A;  2CA8 A;  3RPP A;  4GSS A;  4K0G A;  1F3A A;  16GS A;  1GSS A;  1QUW A;  4XHM A;  3KGK A;  2GS3 A;  3CRU A;  3AY8 A;  2DJ3 A;  4BL7 A;  2H74 A;  3HVV A;  2OE1 A;  2VO4 A;  2LUS A;  3KMN A;  2L6D A;  1T8E B;  4TXO B;  2X99 A;  2FLS A;  1K0D A;  1CQG A;  3RHB A;  2B1L A;  4POK A;  3C71 A;  3H79 A;  1U3I A;  4MZB A;  4KX4 A;  2VCV A;  1OE8 A;  4X43 A;  4MPF A;  5AN1 A;  3D0Z A;  4ZBA A;  2XBQ A;  5D8I A;  3FZ9 A;  2DJJ A;  4DVC A;  1RK4 A;  2KHP A;  4PNF A;  2C80 A;  4NV2 A;  2GLR A;  1SEN A;  13GS A;  3KMO A;  1LBK A;  2PBJ A;  1V57 A;  4J57 E;  5LCZ A;  3S9F A;  3SWL A;  1YKA A;  3EU4 A;  5F06 A;  3ZIT A;  2H70 A;  4MZC A;  3FHK A;  4HQS A;  1DSB A;  3EC3 A;  2MBS A;  3ZFL A;  2IMI A;  2IIY A;  3LXT A;  3FRC A;  3IR4 A;  3ZML A;  3RHC A;  1XWB A;  4X0X A;  3FZA A;  4IS0 A;  2MZC A;  5IMF A;  2V6K A;  2YWI A;  2YWO A;  1S3A A;  3D4M A;  2F9S A;  2KOK A;  2HSM A;  5J4U A;  3MDK A;  4BVX A;  2E7P A;  3ISO A;  3BJ5 A;  4V1A p;  4WBJ A;  3C1S A;  4K7N A;  4OMV A;  1MDK A;  2FHE A;  1SJZ A;  2FUG 2;  1QXH A;  5DQY A;  4POM A;  3SBC A;  2LRT A;  2K6V A;  2B7K A;  5KOW A;  4JE1 A;  1ZGN A;  2R2J A;  3EU3 A;  2H0G A;  3TKR A;  4G9H A;  1NSW A;  3A3T A;  2LQO A;  1SD9 A;  4ECB A;  5G5E A;  2AB6 A;  2CX3 A;  4XRD A;  3TJG A;  1R5A A;  1K3L A;  3ZVJ D;  1EP7 A;  3IV4 A;  2VD1 A;  4MDC A;  5FWG A;  1F2E A;  1GLP A;  2EIO A;  5CRW A;  2LRN A;  4KE3 A;  1SJ6 A;  4J2F A;  4JR4 A;  4YKF A;  3ZLP A;  5F05 A;  3FY7 A;  4TR4 A;  1A2M A;  1K3O A;  2NTO A;  4FYC A;  1ERV A;  4PQI A;  3TB2 A;  1TTZ A;  4FYB A;  1THX A;  3TKP A;  2E0Q A;  1H75 A;  2FNO A;  4KF9 A;  2OJL A;  4ZB9 A;  2LJR A;  1YEX A;  3ERW A;  3WT2 A;  4HQZ A;  3VI5 A;  1XVW A;  4AGS A;  1A0R P;  5ECK B;  4HS1 A;  2DSA A;  4MNN A;  2KLX A;  1F3B A;  1ON4 A;  4JZQ A;  2H75 A;  4HJ2 A;  1EV4 A;  17GS A;  1TOF A;  4AF2 A;  4BL7 B;  4LLR A;  5KN1 A;  4Z2R A;  2A2R A;  1PA3 A;  2V32 A;  3MWH A;  1Q98 A;  4KCA A;  4MA9 A;  4IP6 A;  1WE0 A;  3LFL A;  4RI7 A;  3APS A;  3RBT A;  4KAE A;  2M80 A;  4F0B A;  4XS1 A;  3JCM L;  3U5R E;  1WJK A;  5G31 A;  1HD2 A;  1BED A;  5EY6 A;  1GH2 A;  5CRH A;  1TU8 A;  1FAA A;  4TXV A;  2WCI A;  3GTU A;  1AQX A;  3KH9 A;  1R5P A;  5A4V A;  1AC1 A;  1VRS D;  5CO3 A;  1U87 A;  2N5F A;  5CNW A;  3KZQ A;  1FW1 A;  1MDJ A;  2VAF A;  1O7U A;  1ZOF A;  1R26 A;  4BVX B;  2DJ1 A;  4ML1 A;  4ZIJ A;  3IK7 A;  4QQ7 A;  3TJF A;  3IDV A;  1TXX A;  1ZCP A;  6GSW A;  2PVO C;  4ZL7 A;  3FZ4 A;  1T4Y A;  3US3 A;  4K5R A;  5DCH A;  4EL1 A;  1QQ2 A;  3F0I A;  2DKI A;  4EKZ A;  1Z6N A;  3EIN A;  3FW2 A;  2VOC A;  3QCP A;  5D96 A;  3HZ4 A;  3TKS C;  1SK2 A;  4G19 A;  5ECR B;  2YJ7 A;  1TRV A;  1I5G A;  1GSY A;  1X5D A;  2FA8 A;  1SK1 A;  1T7P B;  4X1U A;  2M72 A;  3D22 A;  3VWW A;  2OE0 A;  3GX8 A;  4IEL A;  3DEX A;  2PVQ A;  3CXG A;  2HSY A;  3G7Y A;  3APO A;  3WT1 A;  4GQF A;  3PPU A;  1IYH A;  5J5N A;  3DGQ A;  2L5O A;  1EGR A;  3CSJ A;  4IHU A;  3A2W A;  3FR3 A;  5CAX A;  1GSE A;  2OA7 A;  3TJB A;  2RII A;  2GQL A;  2YJH A;  4MP4 A;  1ZYP A;  1X9W B;  2VCT A;  1XZO A;  4F9Z A;  2CZ2 A;  1F9M A;  1TRW A;  2YP6 A;  4K2X A;  3EVI A;  2QSI A;  4F03 A;  2DIZ A;  6GSV A;  4ILF A;  3TUE A;  3TRP A;  3UMA A;  2HXK A;  1YF1 A;  1G7E A;  3FKF A;  4J56 E;  2JZR A;  2OBI A;  2C3N A;  1AIU A;  3DYR A;  5F0G A;  10GS A;  1ST9 A;  1ML6 A;  2GGT A;  1PD2 1;  1NM3 A;  4EVM A;  3KIJ A;  1EEJ A;  3ZTL A;  1XFL A;  3HD5 A;  3WYW A;  2V2G A;  3HA9 A;  4TRX A;  4ACS A;  3CTF A;  2YCD A;  3TKS A;  4OCE A;  2DJ0 A;  4ZB6 A;  1AXD A;  5KN2 A;  2XC2 A;  3UL3 A;  2YNX A;  3I69 A;  3Q19 A;  4NV5 A;  3UVT A;  5INY A;  12GS A;  2H8L A;  1EP8 A;  4TXO A;  5J9B A;  2O87 A;  3F6D A;  4ZB8 A;  2WGR A;  1J9B A;  1A24 A;  3BBY A;  3KCM A;  3TRQ A;  1K0M A;  1TI3 A;  1GSD A;  4GXZ A;  8GSS A;  2K18 A;  4PQ1 A;  3ZIV A;  4FIW A;  4KDY A;  4IQ1 A;  2CVB A;  3GV1 A;  4IJI A;  5IQY A;  2H66 A;  4KW6 A;  3GKX A;  4KDU A;  3LOR A;  1NHO A;  3GNJ A;  2H76 A;  3MNG A;  1DE1 A;  3EPT A;  2WRT A;  2YZH A;  4EIP A;  3WD6 A;  1OKD A;  4ULX A;  3NZN A;  2QA2 A;  5IPG A;  1U88 A;  4EDZ A;  2ALB A;  3LJR A;  3KD0 A;  1KNG A;  1NW2 A;  1KTE A;  4XRA A;  1GSQ A;  1EOH A;  4BVY B;  3GMF A;  2D2Z A;  3O6T A;  2C4J A;  3WGX A;  4TKY A;  1SL2 B;  5EVO A;  1BJX A;  4N11 A;  5HR1 A;  3FR9 A;  5KEJ A;  2H6Y A;  1QFN A;  4TW5 A;  4K6X A;  2LRC A;  1JZW A;  1MEK A;  3D5J A;  2HRA A;  3DXB A;  5ECP B;  3E3E A;  3EMX A;  1SYX A;  5D9T A;  5ENU A;  1QK8 A;  3GUS A;  1PSQ A;  5L71 A;  3A2X A;  4FO5 A;  1THO A;  3QPM A;  4O5Q A;  4FYU A;  1GTU A;  1Z3E A;  5JWR B;  1JHB A;  1MD4 A;  4NAX A;  3W8J A;  1FB0 A;  1B4P A;  5H5S A;  3LSZ A;  3IE3 A;  5J41 A;  3VWU A;  2C0D A;  2VL2 C;  1V98 A;  3EWL A;  3LYP A;  2LNT A;  3IXR A;  2VLU A;  3GSS A;  5FHI A;  1YKC A;  5IMZ A;  5DAL B;  2NDO A;  1SKR B;  4K7O A;  4I8B A;  3BOA A;  5DJL A;  3H8Q A;  3TKS E;  3L9V A;  4IJ3 A;  2JSZ A;  1K0A A;  4MJB A;  2TIR A;  2LNS A;  5G5F A;  4ISD A;  4GCI A;  1XWA A;  4GF0 A;  1VF1 A;  3G7I A;  4MF5 A;  3MSZ A;  2K8S A;  3IRA A;  4FH8 A;  1M99 A;  3HJM A;  2WFC A;  2A2S A;  2F3M A;  4V2N A;  4RUV A;  2R37 A;  4N0V A;  2XPD A;  1GUM A;  2H72 A;  1PX7 A;  1NHY A;  5DAK B;  1X0R A;  5ELG A;  4HU9 A;  2VM1 A;  4JBB A;  1EEM A;  2C1Y A;  2YPM A;  1MTC A;  2RM6 A;  3W8S A;  1YEP A;  1YF0 A;  1A8Y A;  1J0F A;  2H73 A;  4ML6 A;  4MZW A;  3CTG A;  6GSY A;  2VCQ A;  2YV7 A;  4WF5 A;  3NIV A;  1YQ1 A;  4E8H A;  2H6X A;  2WB9 A;  3UBL A;  1JZO A;  4NXI A;  2YN1 A;  5F8B A;  4WXT A;  2VL2 A;  2R0P A;  3LEF A;  3VWV A;  4EO3 A;  2DBC A;  4GWR A;  4GRF A;  5IMC A;  5ID2 A;  2L6C A;  2IPA A;  4HOJ A;  1WPI A;  2BTO T;  1ZMA A;  2I81 A;  3VI7 A;  4PUR A;  4JRR A;  4OFM A;  1T00 A;  2DKH A;  3UEM A;  1GUK A;  2WZ9 A;  1JLV A;  2H1B A;  1XW9 A;  5ECS A;  4OFN A;  1G6Y A;  3R2Q A;  6GSX A;  2HNL A;  5ECI B;  2CVK A;  4TR0 A;  4GLT A;  3IHG A;  3KJY A;  5CRD A;  1H4O A;  4KDX A;  4V2L A;  1GLQ A;  4YAV A;  4MMM A;  1EGO A;  4GQC A;  1GRX A;  2FWG A;  4G0I A;  2PUK C;  2A4V A;  1F6M C;  3VPQ A;  4ID0 A;  14GS A;  4EUY A;  1TK8 B;  5GST A;  1XPV A;  5B7C A;  2K8V A;  2XBI A;  1ACV A;  2C3T A;  3GH9 A;  2IMK A;  2GZP A;  1Z6M A;  1OE7 A;  2PWJ A;  4K1F A;  3P7X A;  1MDI A;  1WRY A;  4XIH A;  5ECM B;  3TKQ A;  3DWV A;  2L57 A;  3KTL A;  1BQ7 A;  3O76 A;  3TOT A;  4XS6 A;  1VF2 A;  3QR6 A;  2G0F A;  2HT9 A;  3WGD A;  1QMV A;  2WJU A;  3ME8 A;  5C04 A;  3VPT A;  4L5O A;  2H0H A;  3IC8 A;  5ECL B;  4L5L A;  3UOM A;  3L4N A;  4POB A;  5GAN D;  3L9S A;  1GSF A;  2X8G A;  4KND A;  1AUC A;  1OC3 A;  1ABA A;  4WR4 A;  4V2M A;  4O7H A;  3C7M A;  1XCC A;  4DSS A;  3ZIJ A;  4PXO A;  5DVB A;  1XW6 A;  2FY6 A;  4A5P A;  3PIN A;  20GS A;  1G0T A;  2YOI A;  3N9J A;  1K0C A;  3GH6 A;  2NVL A;  2MMA A;  5DQS A;  5H5R A;  3E0U A;  2YZU A;  1HNA A;  4OO5 A;  2DML A;  1URM A;  2HRK A;  3C73 A;  2I3Y A;  3KP9 A;  1OYJ A;  1E2Y A;  2X8H A;  5ID2 B;  2VCX A;  2JSY A;  5ABR A;  5IIZ A;  1GNW A;  3HHV A;  2YWM A;  4LL1 B;  1PKZ A;  4OCF A;  1HYU A;  1Z5Y E;  2CAI A;  2J23 A;  3I6A A;  2HLS A;  1QGV A;  2X64 A;  1AQV A;  3CSI A;  4MAB A;  2DMM A;  4IVF A;  2H71 A;  4DEJ A;  1B48 A;  1A0F A;  1EZK A;  2Z9S A;  3F3R A;  3UBK A;  1XVQ A;  1E6B A;  3P90 A;  4BVY A;  2J9H A;  4Q5N A;  5IPH A;  3E9J B;  4G0K A;  4EDY A;  4MJC A;  2B5X A;  5EPF A;  2ZUP A;  19GS A;  2RUF A;  2X8C A;  5E4W A;  5IO0 A;  1BAY A;  5DCG A;  1LJR A;  1RW1 A;  1HNB A;  1KBN A;  4CW9 A;  3QDN A;  1TK5 B;  3QMX A;  4EC0 A;  5DBQ A;  2HZE A;  1EOG A;  5B8A A;  4PQH A;  2B1K A;  3W6G A;  4G2E A;  3RDW A;  4KH7 A;  4HI7 A;  1PMT A;  4Z2T A;  1XOA A;  3UJ1 A;  3RPN A;  2X49 A;  3EMP A;  2GZY A;  3MAK A;  3GKM A;  2GSQ A;  2TRX A;  4DSR A;  1GNE A;  4OWY A;  2B5Y A;  3CBU A;  2B3S A;  4IP1 A;  3QAG A;  5DAL A;  6GSU A;  4I97 A;  5JCG A;  2JL4 A;  1FVK A;  1KEB A;  1T3B A;  1K3Y A;  1G7O A;  2FWF A;  2V1M A;  3GYK A;  1U6T A;  2XPE A;  2JAC A;  2P5R A;  4I2T A;  2R4V A;  4YAP A;  3GHA A;  2E2M A;  4DSS B;  2GDR A;  5HFK A;  1FOV A;  1YZX A;  2DLX A;  1LU4 A;  1FOH A;  2CT6 A;  1V58 A;  4YQV A;  1GP1 A;  3ZRE A;  4TR1 A;  1M0U A;  3EYT A;  5KN0 A;  5IO2 A;  5DAK A;  3LWA A;  3H1N A;  1O85 A;  2LJK A;  2P31 A;  3HYP A;  2GSS A;  3QOU A;  1T4Z A;  1TW9 A;  4X4J A;  1ERT A;  4BWS A;  1M2D A;  2GT6 A;  3A5W A;  3V1W A;  2KP2 A;  4ECJ A;  3DVW A;  4N30 A;  2JU5 A;  5HFI A;  2CX4 A;  1I9D A;  2N5A A;  5ECH B;  1FG4 A;  2PER A;  2IMF A;  3GL5 A;  5ELA A;  4WKW A;  1V9W A;  2AHE A;  3I43 A;  1SL0 B;  3UAP A;  2B5E A;  4PUA A;  2F8F A;  2I4A A;  3CRT A;  3Q74 A;  4RQX A;  3IBH A;  3TCO A;  4IQA A;  5CYY A;  1ILO A;  3HJP A;  1W89 A;  1UA5 A;  4K8M A;  6GSS A;  1GTA A;  4EF0 A;  5BMU A;  4I6X A;  2ON7 A;  3HXS A;  3J7Y b;  2GZZ A;  4HZ4 A;  2OKA A;  5IOX A;  5B6N A;  1A8L A;  2PGT A;  3MIX A;  3ERF A;  2H1G A;  1XIY A;  3HZ8 A;  4N0Z A;  3LXZ A;  1HNC A;  3UAR A;  1UC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...