2ZO2B

Mouse np95 sra domain non-specific dna complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
209
structure length
201
Chain Sequence
b'HMPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGRDGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPEGYLEALANKEKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title The SRA domain of UHRF1 flips 5-methylcytosine out of the DNA helix
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/dna
total genus 49
structure length 201
sequence length 209
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.10 Mainly Beta Roll PUA domain-like SRA-YDG 2zo2B01
4PW5A 2ZO1B 2ZKGA 4NJ5A 4PW6A 2ZKDA 2PB7A 2ZKEA 3DWHA 3FDEA 3F8IA 3CLZA 4PW7A 3F8JB 2ZKFA 3OLNA 3BI7A 2ZO0B 2ZO2B
chains in the Genus database with same CATH superfamily
4F0PA 4PW5A 4YGIA 4F0QA 3Q0CA 2ZKGA 2ZO1B 4NJ5A 4PW6A 2ZKDA 3Q0FA 2PB7A 2ZKEA 4RZLA 3DWHA 3Q0BX 3FDEA 3F8IA 3CLZA 4PW7A 3F8JB 2ZKFA 3OLNA 3BI7A 2ZO0B 2ZO2B 4OC8A 3Q0DA 4R28A
chains in the Genus database with same CATH topology
4PW5A 2ZO1B 2ZKGA 4NJ5A 4PW6A 2ZKDA 2PB7A 2ZKEA 3DWHA 3FDEA 3F8IA 3CLZA 4PW7A 3F8JB 2ZKFA 3OLNA 3BI7A 2ZO0B 2ZO2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PW5 A;  2ZO1 B;  2ZKG A;  4NJ5 A;  4PW6 A;  2ZKD A;  2PB7 A;  2ZKE A;  3DWH A;  3FDE A;  3F8I A;  3CLZ A;  4PW7 A;  3F8J B;  2ZKF A;  3OLN A;  3BI7 A;  2ZO0 B;  2ZO2 B; 
#chains in the Genus database with same CATH topology
 4F0P A;  4PW5 A;  4YGI A;  4F0Q A;  3Q0C A;  2ZKG A;  2ZO1 B;  4NJ5 A;  4PW6 A;  2ZKD A;  3Q0F A;  2PB7 A;  2ZKE A;  4RZL A;  3DWH A;  3Q0B X;  3FDE A;  3F8I A;  3CLZ A;  4PW7 A;  3F8J B;  2ZKF A;  3OLN A;  3BI7 A;  2ZO0 B;  2ZO2 B;  4OC8 A;  3Q0D A;  4R28 A; 
#chains in the Genus database with same CATH homology
 4PW5 A;  2ZO1 B;  2ZKG A;  4NJ5 A;  4PW6 A;  2ZKD A;  2PB7 A;  2ZKE A;  3DWH A;  3FDE A;  3F8I A;  3CLZ A;  4PW7 A;  3F8J B;  2ZKF A;  3OLN A;  3BI7 A;  2ZO0 B;  2ZO2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...