2ZONA

Crystal structure of electron transfer complex of nitrite reductase with cytochrome c
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of inter-protein electron transfer for nitrite reduction in denitrification
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
molecule keywords Dissimilatory copper-containing nitrite reductase
total genus 92
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zonA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zonA02
1OF0A 3PAUA 2HX8A 3EH5B 1M57B 2BW5A 1SNRA 4DPCX 1M56B 2IDFA 3GDCA 4DP5X 5AFAA 2IDQA 2QPEB 4GP5B 2XV0A 2IWKA 2IWEA 2J56A 4YSUA 1J9TA 4GYBA 4E9VA 3H4FA 5IY5B 3UACA 2YAQA 1WS8A 2WO2B 2IDUA 2R7EA 4YSEA 1JZEA 2DY2A 4YSQA 2HX9A 4M4RB 3FT0A 2YXWA 1ASQA 3FYIB 3ZDWA 3EHBB 1QNIA 3AY2A 4YSSA 1TU2A 1PMYA 4KO9A 4YSCA 2Y1AA 1ASPA 4YVNA 2P80A 3NJGA 2MTAA 2OV0A 2PPCA 2YXVA 2BWIA 2OJ1A 2XLLA 3CVBA 3FSWA 2BZCA 2IH9A 5B3SB 4G7RB 1AACA 3ERXA 1KBWA 2W88A 4A2HA 1V10A 3PLYA 3NJFA 1E65A 3IE9A 2BP8B 4BXSV 3PPSA 2FQEA 1X9UA 2VMJA 2FTAA 3AG3B 2NRDA 4E9SA 1ID2A 4G7QB 2JKWA 5AKRA 3FU9A 5E9NA 3ZBMA 2XX1A 1MG3C 1IBYA 1ASOA 1F56A 3S3DB 2VW7A 1NPNA 1L9RA 1L9OA 1BYPA 4G70B 4JHUA 1BXAA 1PZBA 1URIA 1WA1X 4HAKA 5EHFA 3S8GB 1HAUA 3QPKA 1W6WA 4KOCA 3T6XA 1HFUA 1FFTB 5I6NA 4FA7B 1BAWA 3S3BB 1OOWA 4YSPA 1B3IA 2OCCB 4E9QA 3X1EA 4YSDA 4F7KA 1IKOP 1FA4A 1GY2A 2P80D 4HCIA 1ET7A 2B3IA 1AIZA 4E9XA 3TBBA 2IAAC 5B7EA 2FQFA 2IDTA 1IUZA 5PCYA 5I6PA 1JZJA 3OMIB 1J9SA 3FU7B 2DYRB 2QPDB 3ABLB 1AANA 2J5WA 2FT7A 1AR1B 2XYBA 2JFCA 3U25A 3AG1B 4BDVA 1X9RA 1SJMA 3QJRB 2R7EB 3MBWB 4QKTA 2AFNA 4JKNA 1NINA 2HRHA 1W8EA 3C75A 5PAZA 5F7BA 3TA4D 2J57A 2UXGA 2PP9A 4KNUA 3SBRA 1QHQA 2JXMA 3CDZB 3OMNB 3T9WA 3V9CA 4A2EA 4HALA 3BQVA 2YAOA 2CBPA 1JVOA 2YQBA 1PAZA 3JT2A 2PP8A 1A4BA 2YAMA 3SBQA 1NIBA 2BZ7A 1AS6A 3NP3A 2XWZA 3OMAB 1JZFA 3ZX1A 4FAAB 1HAWA 1JVLA 2AANA 3T6WA 3NJLA 5B1AB 3IBOA 4DP7X 2HLEB 1JZGA 2VN3A 3NYKA 2FT8A 3NJNA 5D4IA 1R1CA 2TSBA 1NZRA 4NB7A 3X2QB 5FC9A 3N55A 4YVUA 3QJSB 1L9TA 4YSAA 4AKQA 2FWLB 3V9EA 2AZAA 3DTUB 4BWTA 5TK4A 4F2EA 1PCSA 2GBAA 3CZUB 1NIFA 1JXFA 5A7EA 3QJTB 4GP8B 2CUAA 3X1FA 1L9QA 4GY4A 5B1BB 4AKPA 2XVBA 2A3TA 1AS7A 1OCOB 4WTQA 2UX7A 1UATA 2X88A 4CSPA 1SDDB 1ZIAA 2ZOOA 1A65A 4DP0X 1CYWA 1NDTA 2BW4A 1ILSA 3PAZA 6PAZA 1A3ZA 4MFHA 1SFHA 1BXVA 4HCFA 2LLNA 4KO6A 4UF7C 2H3XC 2BHFA 3FU7A 3QJQB 1ETJA 1V55B 3FU8A 1N68A 1JERA 2XXFA 2W8CA 3T71A 1AQ8A 1PLCA 2ZONA 1AG0A 2EIMB 1A4AA 1NIDA 2FQGA 1TKWA 3WG7B 1YLBB 3X1GA 4YSOA 3CG8A 3QJUB 4CSZA 2GC7C 3NJKA 4G7SB 4GP4B 1AS8A 1JXDA 4Q8BA 4NERA 2B08A 3FQ2A 1GS6X 3L45A 5I6MA 1SHWA 4DP2X 2YAHA 2Q5BA 1JOIA 6PCYA 3FPXA 1KYAA 4UAHA 2RACA 1KCBA 1FWXA 4QLWA 3NP4A 3NJMA 1AZRA 4A2FA 3PXLA 7PAZA 3OM3B 1KV7A 3UAAA 3D12B 3UADA 4DPAX 3AG2B 1ZDSA 3CVDA 4ZK8A 3PCYA 4AKOA 4BK5C 2YARA 1AAJA 1GS7A 3ASNB 1WS7A 4P5RA 1GS8A 1RZQA 4NAJA 4KO7A 3WNIA 2FJSA 1OCCB 3QJVB 2FNWA 1XMEB 2UXVA 2UXFA 4RH4A 3FQ1A 3FQYA 3ZIYA 1MG2C 3FSAA 3QQXA 2Q9OA 4BWUA 3IN0A 2I7SA 3EH4B 1ZV2A 2BWDA 4X4KA 3X1NA 4A66A 5I6KA 2VM3A 4N8UA 2BP0B 2PLTA 2HRGA 3FSVA 3GYRA 3HEIB 4HCGA 4DP1X 5B1JA 3IN2A 4PCYA 2BP8A 1E67A 1A4CA 4KOBA 1GY1A 1XB6A 1KDJA 1NICA 1V54B 1NWOA 1AOZA 3WI9A 1BYOA 1VLXA 3WKPA 1BEXA 3IEAA 5B7FA 4G71B 1PF3A 2GB2A 3AW5A 1PLAA 2YAFA 3H56A 1SHXA 3NSYA 1E30A 2VSKB 1XB8A 2XU9A 2XX0A 3AG4B 3NJJA 1ILUA 3UAEA 1L9PA 2I85A 2HX7A 3S8FB 1CURA 5I28A 3WIAA 5I5MA 4KNSA 1IBZA 1NIEA 2I7OA 2H47C 1CUOA 2PPAA 4A67A 4HZ1A 4GXFA 1JXGA 2EINB 5D4HA 3UGEA 3BVDB 2IWFA 1TEGA 4DP9X 2IH8A 7PCYA 3ABMB 3X1BA 1J5CA 1PZCA 3TU6A 4HHWA 1PNCA 2UX6A 3KW8A 5B7MA 2GSMB 1E5ZA 1E5YA 9PCYA 2X87A 2HXAA 1CC3A 2PPFA 5F7AA 3H4HA 5ANHA 1QLEB 2GIMA 4Q89A 1NTDA 5D4JA 4L0PB 2DWSA 2VW6A 4DP8X 2MRYA 1RZPA 4K9JA 1A8ZA 1N70A 2E86A 1ZPUA 2QDVA 3FS9A 4UANA 3TBCA 4E9RA 2DWTA 1OCRB 3SQRA 4AI7A 1AZUA 1I53A 2XXGA 2WSDA 2Y69B 2PCYA 4M3HA 4DP6X 1KDIA 2HZHA 2BP0A 1GYCA 4F2FA 1AZBA 2BO0A 1JZIA 1OE2A 1SF5A 3S3CB 1GR7A 1M9WA 5B1JC 3ABGA 5I5JA 4ENZA 3WKQA 1JZHA 2EIJB 3NJIA 5TK2A 4DPBX 1NIAA 2GI0A 2VSMB 2QT6A 1NPJA 2PCFA 1KGYE 4A68A 2XUWA 5I26A 2AZUA 1XB3A 2IDSA 2UXTA 1RCYA 3RYMA 4P5SA 2CALA 4AZUA 4AX3A 2WO3B 3NT0A 1IC0A 1KBVA 1ET8A 3NJHA 4N4YB 1OE3A 2EILB 3FSZA 4YSTA 4YL4A 4JHVA 1DZ0A 2CAKA 4DP4X 4EF3A 1J9QA 2FT6A 4TXVB 3T6VA 4BXVA 2CCWA 1SF3A 5I6LA 1MZYA 1BQKA 1MDAA 1J9RA 1OV8A 2TSAA 2VM4A 2YAPA 3FYEB 3KW7A 4KNTA 1T5KA 2DYSB 3UABA 1AZNA 3GXUB 3T6ZA 4YSRA 1DYZA 1PLBA 1RKRA 2PPDA 1GSKA 2PP7A 3JTBA 3CDZA 2CJ3A 2N0MA 2XV3A 1BQRA 1ET5A 1WA0X 2ZXWB 1AZCA 1CYXA 2VW4A 3FPYA 1WA2X 2GC4C 5B1KA 1WAEA 2FQDA 4WKXA 1PNDA 3NSDA 1W6LA 4BDVB 4KO5A 3G5WA 4PAZA 3MX0B 3NSCA 1OCZB 1EZLA 3SBPA 4W9ZA 2XV2A 2H5UA 1TEFA 3EF4A 1J5DA 1NWPA 3CVCA 4A2DA 2YAEA 1SDDA 8PAZA 1OE1A 4W1TA 4HIPA 3OQRA 2GHZA 1ADWA 1ZDQA 3WNJA 2AVFA 1BQ5A 3OD3A 4G72B 3ABKB 1PZAA 3N2JA 3ASOB 2QDWA 3EH3B 1SFDA 4E9WA 5LDUA 1BXUA 3DKHA 1AG6A 4A2GA 1GW0A 2ZWNA 1KCWA 3TASA 5I6OA 4BWWA 2EIKB 4E9YA 5AZUA 1MZZA 5I5IA 3HB3B 3NSFA 2J55A 2PPEA 1L9SA 1ZIBA 3DIVA 4HHGA 3PAVA 1PY0A 3AZUA 2DV6A 1EHKB 4E9TA
chains in the Genus database with same CATH superfamily
3BN9D 1QLEH 1EV2E 4UYPA 4PUBL 4ODTH 2NXYD 4MWFB 2DLGA 4OUUB 3DARA 1VERA 1I75A 3QUYA 3V0VA 2R2BA 2X9XA 4YSUA 2G9HB 3PNRB 1XVSA 4WJKB 3T8XB 2VL4A 1Z9SB 3H4FA 1TNNA 4F8QA 3QDJA 3MRQB 3O11B 4KXZI 2XY1A 2YWYA 1T04B 5EIIB 5CZRA 4TTDD 3MFFB 1G5AA 3PWPE 3KJ4B 4UQ2A 3EYVB 2O93L 1PDKB 2JCCA 3PFUA 3U0PA 3RWDA 3GHPA 5BS0E 1J8RA 1ZEAH 4MYWB 4PP1D 1FIGL 3SDXB 1UVQB 3F8UB 4J3OC 3CVBA 4M3JA 2AGJL 3VRJA 4K8RL 1IT9H 2EDOA 2NSMA 3DXAE 3DIDA 2V7HA 4B0MB 3SJVB 2GIXA 3A4AA 4HEPA 3HG2A 3QUHA 1PDKA 1SN0A 4HFWB 4ZW5A 4BA0A 3NG5A 2EO9A 2IPKA 2DMCA 1VADA 3IDMB 3LKOB 3KXFB 3FT2A 3AB0B 1GAFL 1B0RB 4TL5A 2L7QA 2ADGA 4ZFQA 2X4SA 2BRQA 4JPSA 3WFHB 4D0BB 5IB4B 1USQA 2P5ED 2CXGA 4IMKA 3JTTB 2HFEA 4JFZL 5IVXE 2ZX6A 3V0EA 5HVWA 3DPBA 2C3XA 4C56B 2JK5A 3KLHC 4HIIA 3N43B 1XCTA 2ADYA 2YPVH 4WJ5A 3WN5A 1AP2B 3T65A 3A67L 3RNKB 3L08A 1AY1H 1IBFA 3FTXA 4ONOA 1HFUA 3S3BB 3IK2A 4N2EA 4PY7B 3VGFA 1WCQA 2FYYB 2W07A 4B9FA 1ZT4B 4GKSA 2G5RA 3ARPA 4JFWA 5LGHH 1GY2A 2GJRA 1DQJB 4JRYA 4QHLA 3T1WA 3BPOC 1NCCH 4HK0B 4BIKA 2KERA 3PJSB 2CDEB 1S5HB 3VH8B 4HKBA 3T0DA 1T6WA 4KKAD 4MS8D 4TUOB 4Y0GA 5FYKH 5J0BA 3TBBA 3BIAX 3BE1H 2OL3H 4OM0L 3K80A 4NNXA 5H37H 1ECYA 4UAOC 1A6AB 4APQC 2OTWB 3D25A 4PJGF 3PP3H 4K2UH 3TO2A 2R1YA 4P4RB 5ALCL 3ISYA 1BZ7A 5H94B 2VZOA 2A4CA 3PQYD 4I1RA 4PWFA 5KSAD 2X7LA 3WXVH 1MH5A 3GT6A 4YWGH 4D3CL 2J5WA 3IVKB 2IQAB 2GJ6E 1JN6A 2JCWA 5HBBA 3TZVB 3Q44A 4D7BA 1OM3L 1XF4A 1KXTA 2F1EA 1HYRC 2Y07L 4E5XG 2C3HA 4MJ6B 1N0XH 1R34A 3NEOA 3C75A 5CEXB 3QYNA 4LKCA 5FB8B 1KJ3H 4JM2F 3MLTA 1Q94A 2P48B 3NFPA 3VX1A 4ANWA 5J89A 4DN4L 1PQZB 4R0LC 5DTFA 3V6OE 4KRLB 3BW9B 3QZBA 4ODVH 1SY6A 1CL7L 1E28A 2W0FA 5E1GA 3PABB 4HZLB 3RHWF 1PAZA 2B5IC 1A2YB 3H9HB 3KPPA 2A5UA 1RIHH 1HQ4A 2CLZA 1WDAA 2DMBA 3WE1A 3SIKA 2QKIC 2Z1KA 2VAAA 2AANA 2O5YL 5TH2A 2OXHB 1FIGH 3OVUB 5FDYA 4ZD3L 1JZGA 1UWXH 2VN3A 2YRBA 3RGVB 1A5FL 3MCG1 3NJNA 4JY5H 4KY1H 5D4IA 3TT3H 1MF2L 3ME0B 5DRZA 5J1SC 5BVPH 3WOVA 3ELAT 4LPVA 4F2EA 5GZOD 2YD5A 1OWWA 5EG6C 5C0AE 3TVMB 2Y2TA 2BCKA 1C8PA 4APXA 4QT5B 3B3BA 1MOEA 3L3GB 3ZMNA 4YHLL 1JCVA 3KDPB 2A3TA 4P23A 1AS7A 1OCOB 3CTTA 2B39A 1AGFB 4ISVA 2FH8A 3QA3A 4F58L 5C0JB 5CBEB 2UX7A 2VLJB 3ZE0E 4FEMA 1ZE3H 5CGMA 3VA2C 3F62A 5IMOA 2BW4A 5DRXB 1HSBA 3PAZA 1WC7B 3NCBB 4OKVA 4TNWF 4QOKB 4D9RD 5CUSL 3TO4C 2GBUA 4M9OA 4Z3TA 5JW3L 3NAAH 3FU8A 3WUWB 3BLPX 1AXSA 1DEDA 1MCFA 1UWXK 3MCYA 4JO8A 5KUMA 4ALAL 4ZMWA 1HHKB 1NGPH 1RIHL 4N5EC 2EVFA 1TO4A 1L7IH 1WHPA 5I1HL 1YLBB 3HFML 3QFDB 4OR1A 5E08L 1LK3L 4YDVB 1D9KA 3ESNA 4LRIA 2NY6D 3PWVA 4R4BB 1DQML 5DD5H 5D6CB 3VMNA 4BRVA 1AS8A 3F6IA 3STZB 5ENWB 4G6KL 3RWIA 1PKQE 3FQ2A 4XNYL 4M4PA 2K3HA 4P04A 2OBGA 4FQ2L 1W0VB 3WFZA 2Z0UA 4Z7AA 3CFTA 3MV8B 5JPNC 1BPVA 2DI7A 3TH4T 2V5TA 2B14A 4HOMA 1SMDA 1QFWL 3OM3B 5E6IC 3VMOA 5T3ZD 2EADA 3MBXL 3AADB 2LU5A 3I75A 4JPIB 3CSGA 3TT1H 2FD6L 3WEOA 1UWEL 4GMSH 2Y1VA 1GGCL 4HK3J 2WLMA 2OMWB 2PTUA 3GJEB 3L3KA 3VFRA 4P5RA 4UM8B 4HF5L 2AVGA 2E6JA 1P2CB 3WTUA 5F3BA 2W9LA 1XMEB 4PLJD 5EN2B 1AD0B 2G5BA 4PRPE 4H8UA 4LARH 3TA3D 3BEVB 3EH4B 3GSOB 4AM0B 1VEMA 3BKJH 2ZIDA 1R19A 3I02B 5DHDA 3TA3B 2HVBA 5FO9B 3SBWC 4I2XA 3KPQB 3MRFB 3UC0L 1BQLL 3LZFH 5B1JA 1DQKA 1A4CA 2YPLD 3MTRA 3TJEH 2FCBA 1OGPA 5JIHA 4ZOBA 3ZO0A 1ZVYA 3REWA 4IKJA 3OXSB 2W0LA 1SZNA 2WYZA 5EWIL 2EC9T 3L3HA 5GGUA 2EYSA 5TFSH 4Z3GA 2NX5B 4G71B 5E94B 3U83A 2WZPA 3UJTH 1FP5A 3T08A 2XWJA 2Y3NA 3V0DA 5AALA 2WUBH 2YSTA 3JZ7A 5BQDA 3MRIB 4GUPA 5C08A 4BCXA 4LLMA 3QPXH 5D70L 3VFMB 3C5ZC 2VZ3A 4CN1A 4YE4L 2Y2WA 1S9WA 2Y9RT 3GQFA 2YZ1A 3HZ3A 2WTOA 3WN5B 3NIGE 4YO0A 1DUYA 4E42B 1YY9C 3HG5A 4GAGL 4CAGA 2P5WA 4X98A 2EVJA 3WJLC 1FQ9C 4C56A 3CQFA 3ARGD 1MJUH 4ESKA 4KROB 2YPKA 4PHZA 3NCCB 1RZKH 4P2QA 3ZSSA 4OLZL 5J9PB 3C87A 3DYPA 4N8VG 3V4UH 4HHWA 3WNKA 5LGJA 3KWXA 2Y6SD 1OW0A 3LN5A 1G9MC 1BOGB 1HZHL 5DK0A 5ISZA 2O6DA 2OX5A 2JJSA 4HSCX 1NSNH 5GGUB 3B9KB 1ONQB 3ETBF 4YXLH 5DJCA 5FCUL 1RK7A 5D71L 4B9PA 4DP8X 1CFVL 5LQBH 3NOIA 3GMMB 1DQMH 5DD5L 1QI5A 1ZPUA 1EO7A 5DFVC 3SQOL 1A22B 1YQVH 1UVQA 2EXWC 2OSYA 3O3BB 1AFVH 4JKPH 2Z8WC 3G6DH 4M3HA 1KDIA 1AKJA 3TCXA 3AGWA 3RJDA 1G9EA 5F44A 2JCCB 3ULVC 2G9KA 1YNKL 4ODUB 3VQ2C 2CE6A 1GR7A 4ZMZA 5IHBA 4J4PC 3F00A 2EIZB 5D5ME 5EBMB 1GZHC 3O11A 2XN2A 3UAJA 2SEBB 4S1QH 1C8QA 2VH5L 4XODA 1WFUA 3O6LL 1J88A 5BZWA 4GAYA 2YMXH 2NY7L 3QUML 3WIIH 5I8EB 1S5IH 4HH8A 2LLLA 2UZPA 3B43A 1NAMH 4CVXB 3N40F 4Y2DA 4AC2A 5D2LB 1UEMA 3Q6GH 1R17A 2E47A 3FSZA 4FNUA 1Y0LA 3WELA 3QWRA 4YHOH 5LGKA 1YAZA 1D5MA 2QMKA 4L1SA 2EDXA 4LEEA 4LL4A 5E6RB 5D1ZD 3N0AA 4BXVA 1T20B 3UG3A 3N1MC 3F7VA 4H5SB 1KG0B 2YZ8A 1J1XL 2DQGL 3KWVA 4KMTL 4PVNA 4G9FE 3UGXA 1EBPA 1NL0H 4FJZA 3RGHA 1JDDA 4WF7A 1E43A 4U1KA 3VXPB 4HX1A 2H45A 3SKMA 2HFFA 1F8TL 3QZOA 1HI6A 3V7MA 1JI2A 3HG4A 1K8IA 2E9BA 5INDB 2VLJD 4P2QE 2W9EL 3DPDA 2J43A 3KXFD 4Z0XB 2UY7A 4HCRH 4N8VA 1A7PL 5JHAA 1AOHA 2WZ6A 1ZLUK 2A74A 1E50A 3RFZA 1UT1A 1FGNH 4BZ1A 2YHGA 3BAXA 5KJRL 3WFDL 4N2LA 2H32A 3B7RL 5L6YL 2ZG1A 5C71A 1HSAA 1A7OH 2VT0A 4JJ5A 1ZDQA 4Y19B 2MPVA 4NQEA 1E4KA 3WFEL 1BZ8A 4LL1A 2EDBA 3L95B 4XXWC 1VJSA 4FMFA 4AMKL 4NUMA 3T3PE 1VCBC 5HDLA 1S7UB 2VR4A 1NFKA 3PJNA 1NCAH 4NPJA 1BXUA 2AXFA 3WUWG 3FCBA 2IAMA 4N2OA 3CQQA 4NO2B 3TN0D 2F0CA 2VN4A 5DZLA 1T6BX 3MOAH 5EU6B 2ILLA 3ZE1B 2VJ8A 2QVFB 3G5YB 5IB3B 1M71A 5KOVC 2EIKB 4KMLB 3S34L 1LXMA 4OZ4B 2BSRA 5TH2B 1I3UA 5CD5C 4AYGA 2CRMA 4UWQB 2J55A 4HS6B 5AOKA 4OIBA 4CUCA 3H9SE 2JJSC 3D18B 4HS8L 1YYLL 5DZVA 3O9WC 4HHGA 3AZUA 2R69A 3JUYA 2QQNH 1HHHA 3KPRD 4MA8H 4FLHA 2WUCH 2BVQB 2DH2A 3G6JA 4DPCX 3UZVB 5AW6B 1P5VB 1X5IA 4JZOB 2IWKA 3KGTA 2J56A 3UXFA 4FA8A 5D7EA 1I4FA 3ZYIA 3H9ZA 1FBIL 2HRLA 2DZEA 3ECBA 1HKLL 4PEEA 5HHOE 3RY4A 4HUUA 3U6RA 4AIOA 1RZ8A 4XCNA 2I07B 3D52A 3AS1A 4PJFA 4Y4FC 1KXTB 2VISB 5BXFB 4LCCC 4OIAA 5LCVH 1JZ2A 4WO4B 2CIIA 2W60B 1JWSB 4F8NA 2Z9TA 2W38A 5EEWA 2X0WA 4ZW3A 4KO9A 3LEVH 2WVUA 4A55A 2JI2A 3BLKA 4JMXA 3U30B 5GGSY 4NKOA 1G9ML 2X2IA 1XGUA 3L3OA 5E03A 1P7QD 2XLLA 32C2B 4U6XA 1L7IL 1N5AB 2EZ0D 4P4KC 3RY6C 4X9HA 3R0MA 2BJML 2AABH 1S9YB 4FFVD 4ZSOE 2ESVB 2V33A 2IOIA 3L4TA 3U9UB 1NC4D 1V10A 3VYNA 4NKMB 3DX1A 3GHBL 4B5EA 1OQXA 5FAAA 4YEFA 2W1NA 1U95B 4NO3B 3QS2A 2EXYC 3VWJB 1U8MB 2A9DA 2E9GA 2YMTA 1F86A 4JM2D 5GGRY 1K4DA 1FAIL 3R8BB 3ARBD 3OJMB 5D1ZC 5HYQB 3D0VB 1QSZA 2R0KL 3TGXA 4AIZB 2XRAH 3ARBB 4L3CB 3ROOB 2DBLL 5HPMB 5JW4Q 4K15A 3APDA 5IV2A 3D2UB 3WFCH 2ZCKH 5IVXB 4W4OC 5KW9H 2PCPA 1M4KA 3QXDB 4OD3L 3D39A 2CJUL 1EAPB 1QNZL 4ODHL 3V7AG 1CD1B 1SYSA 3D09A 3ZOAA 1KACB 4AEEA 1M3JA 2PXYA 3MV9D 5HI4C 4DVBB 2H2PC 5CCKH 3G04B 1KCVL 3JWOL 1BBJB 4FA7B 2GQHA 3TIEA 3TBWB 5JQ6L 2MOVA 3VI3B 2YXFA 1MFBL 1JWMB 2BS8A 5CF3A 4O5LL 4LIQH 1QZ1A 3EG9B 2PUQT 4PPTA 4YGVA 4I18B 4X9FA 4U49A 4HUMB 1F18A 5DXWA 3PWUA 3EUDA 3UYRH 5BZDB 1ET7A 3EYUH 4RRPA 1FO0L 1XZ0A 4MQ7A 5T5FA 2FYVA 5CJOL 4ILDA 4W81A 4P46A 1IEHA 5FUZH 2IDTA 5E56A 3F64A 2ODIA 4M6OL 2E8ZA 4AQ1B 2OMXA 1J9SA 3WS3A 4IRSC 3VGEA 2XPZA 1F4XL 3DRTB 3Q3GA 4G6MH 2MCAA 3RURA 3CFMA 5HDQL 2J4WL 1QMUA 1AR1D 5D70H 4GSRA 1UZ6E 1WZ1H 2XFGB 4GQRA 3FRPG 2F7PA 3MJ6A 2ZAIA 1K5WA 3C6LB 3VGAC 5F7BA 3BFWA 3RE0A 1QD0A 5E8OA 2PWHA 1ZRUA 2ORBH 4AJWA 3L3GA 4QT5A 1VRSA 1CFNB 4B27A 1R47A 5CAYB 4IDJL 1P4LA 4OFVA 3BFOA 4OZIE 4ABVA 5LCVL 1R0AH 1A9BB 1OF2B 4EBQL 5C0DB 2B1AH 4DGYH 1CD8A 2XWZA 4GAAA 1WWCA 3V5DA 3QNYB 3ZX1A 1S7WB 1T21B 4V1DE 1MRCH 4ES8A 1A6TB 4PJDA 5IB5A 1NDMB 3D05A 3CFEA 5IEKA 2Q2LA 4XX1G 4Y4FB 1IO4C 2NZ9D 2CNYA 4NHUB 3FUMA 2J8UE 4G7VL 4LVNB 1OAKH 5FECA 3ULUE 4GSXA 1BX2B 1EFQA 1N4XL 5KBMA 1XGYH 4GIPD 1IVTA 4GRLA 4J3OF 2FWUA 3CHRA 3D39B 3RA7H 4F3FA 4YK4C 3DTXB 3WY3A 3GMRA 4LT7A 4PRIA 4WTQA 4XVTL 3ZDZB 1A3RL 4IRZA 4C56D 2AEPL 3A4EA 2OCJA 4M93B 3A4DA 4NN5B 4X6BB 5C0BD 2C7UB 4DP0X 1XGPA 5JPMC 3VXNB 3IGKA 4CKVX 5C0BB 1AQKL 3RVTD 4F7TB 5FOJA 4JKWA 4ERSL 1OY3B 3E38A 2Q76B 5KVMC 4JY4A 1UQSA 4Y8DC 4HIXL 4HJ0D 2B4CH 2XXFA 3P4OB 5JMRA 1KPVA 3GSRB 5I66A 2ZONA 5CCKL 3C8KA 2ZX7A 2A99A 3RFRA 5GRUH 5MI0C 3D4ZA 2GJPA 1GA2A 1S3RA 1IQDA 2HKAA 2K4AA 32C2A 3VW3H 2R51A 4QGYA 4U1SA 5EU4B 3Q9PA 1XH3B 1SHSA 2NDFA 3HC0B 4PP2A 2IWGA 3KJ6H 4KI5E 2IADA 1PX3A 4HEPG 1FG2A 5JZ7C 1WZLA 1LO4H 3NAAL 1EDQA 3NEEA 3JUZA 25C8H 3GZOA 1MWOA 1NQBA 5BV7H 3MDJA 4LHJB 3BP4A 3F7KA 1SDAB 5CJOH 1DANT 4RGOH 5E5UB 3NJMA 4KK9C 4F8PA 2NNXA 3FC8A 2ICCA 1BREA 3LPOA 3D12B 3SYOA 3FSOA 4EUPG 3RVXD 3EGDB 3LEYL 1MCSA 3HE7C 4IIZA 1CFNA 5B22A 4ZFOA 1EFXA 3UZVA 1XFPA 3DYOA 3MFGB 5K39B 3VRIA 4UT7L 4Y5XC 2PCFB 5DFVD 3GMPB 1WBZB 4PJFE 5EBGA 3C5SA 3CBRA 2R23A 5SWSD 2YD4A 1H6UA 4Q6IA 2IJ0C 3HJEA 1HE7A 3FT2B 2MEJB 2RTTA 2X40A 2FNWA 4M62H 1E7VA 4X6EA 3H6JA 4RH4A 4ZTOH 1SQMA 5CNHA 3FQTB 3PXHA 1LM8V 4X80L 5HY9A 4BWUA 4X9BA 4WW1B 1F13A 5D2NA 9CGTA 2JJTC 3HEIB 4HCGA 1U8JB 4OJEH 2XNAA 1PSKL 2OMXB 1EUTA 4PRAA 3MRNB 3ZHNA 2Q86A 2VDLH 1JAEA 4FFYL 3QE5A 2CIKA 1P7KA 3I6KB 2H3NA 4JO1H 3RWDB 2MSPA 5CJQL 5ICXA 4JQXC 3U0PB 4Z7NF 2HKFH 2Z92B 3TPUA 2QLVB 4PV9B 3VAEA 3SGKA 1RK0B 1RUPL 1UOKA 4JM4H 1U8OB 3DGGB 2RJMA 1EVUA 4QNPF 4WFHD 2FATH 4XGZB 3LKPB 1IVLA 4QAMB 4R4FL 4ADGA 3OAUH 2YKKA 3NZUA 4WFGE 2R2BB 4CU7A 1MJJA 3P30L 5DUMH 1GYVA 3RA7L 1SYSB 1EHXA 4Y1SA 3FO9B 3IAGC 4FYTA 4Q58C 2JTYA 2K6YA 4Z0XA 3X3GH 3KPOB 1KGIA 3P3UA 5C0GA 4Z7UF 4LLDB 4ATWA 4CW1A 1ZA6A 3QISA 4NQXB 2VQ1B 4MZIA 4XC3H 2EINB 5ABAA 5JNYA 3SKMB 1QP1A 2JCCF 2EKSA 1FZJB 1MFCL 3NUKA 4YFLI 1HKLH 5I82A 5BZXA 3X1BA 4NPYA 3QUXC 4JG1L 4PJGA 1NFIA 3QUYC 5EC1A 5HGDB 5ICZB 3DX3A 2AXWA 3IJ8A 5T1KD 2AQPA 4XNMA 9PCYA 3BXNA 4QXTB 3VD2A 2AAAA 3D51A 5LAPA 2CK2A 4GFTB 4KY2A 3A6CL 1INQB 5EU6D 5GGTL 1NOLA 1XR8B 3HNTL 1JTPA 2DWSA 4JS7A 1TR7A 1N12A 4BUHA 1D6EB 1ITBB 4DN4H 1N70A 1FL6A 5GS0L 5K9QG 3ULVD 4CVXA 1E5AA 4QRRB 3X3FL 4M8QB 2NXZB 2X89A 3L3OB 4M6NL 1GPOL 1A7QL 1DJGA 1TJIL 2R29L 5MERB 4KRMB 5DUBA 2F74B 2OTUA 4HUXA 2Q3ZA 1GYCA 3SPCA 2P46B 1J1XH 1ZGLP 1MJ8L 3BP7B 1BZ9B 3C5JA 5INCB 3HG3A 4H7VA 4EPSA 5AYUH 4BFBD 3CPLB 1ZKAA 4XCNB 2AITA 2Y5TA 4NRXA 2GI0A 1X44A 3MJ9L 2L8AA 5EZOL 1XB3A 4JZOA 4YQXL 1LHZA 2IH1B 4LHQB 3IXTA 4R7LA 3WAKA 3UAFA 3MUHL 2APSA 2QLYA 5IGXH 3BCFA 5BUAA 3H3PH 1E2ZA 5D72L 1OE3A 4XCYA 4UM9A 5EA0H 3OR7A 3QFJD 4MCYB 1AI1L 4YSTA 5DJCB 5D2LE 5C8JB 1KEML 3CZKA 1C08B 3JVFC 4V1DA 2YMOA 4PGBB 5AB0A 2WXRA 4X5XB 3NEXA 4MX7A 4Z77A 5ISZB 4DIXA 2XHNA 2EAEA 1H19A 1L3WA 4BJLA 3K6NA 4ODXA 4DK5A 5CSZA 3FOLB 4S11A 5BW7C 5BVJA 3FYEB 4ZTEA 3P0YL 1FGVL 1UB6B 1Q1JH 5J9PA 4G82A 3ILPA 4RQQA 4YSRA 4FX5A 1DQTA 4X2UA 5ECGA 4MYPA 7CGTA 4V1DB 4DK6A 3EDFA 3GUTA 1S7UA 1NGYB 2JXMB 3F04A 2HRPL 2F54E 5DJXB 3RPBA 5A7BA 2WCSA 3DECA 3O3UN 4AZ8B 2NTFB 2QJDA 3Q6FA 1I8MA 5KG9B 1TMQA 1SPDA 2R9HC 4MD5A 5DQ9B 2KBGA 4DZ8A 2FX9L 5EU3B 3FK3A 1L9NA 3C09C 5D96C 4TUJB 2H0JA 4WUKL 3CVHB 4LSQL 3RL2B 3WO4C 1ORQB 1TEFA 4EIUA 2QBWA 2Z3FA 3LH8A 4JAMB 4NGHL 4XNXL 1UCTA 1KT2B 3HVNA 3MR9A 3U30C 4Z7OE 2NX5A 1I3RA 2ZOTA 2M8XA 1TPXB 3GIZH 4YS4A 1OSZA 1YZZA 4LEOA 4WWKC 5HHMB 2X10A 3B9KD 3D3VD 1G9NL 2CLRA 3D85B 3P0VH 4E9WA 3MQIA 2CQVA 4JDTH 4M8QA 4MMYA 4JFVA 4X6DA 5LJYH 1ZLVK 2XVKA 1KCWA 1J8HD 3BJ91 3UX9B 2WXFA 1N59A 1FL3B 2VXSH 1VACA 4MA7H 5CLZA 4P2OD 1HT6A 4PS7A 4PG9B 2GSIA 3SKUD 4BGDA 2YC1A 2YRPA 4R3SA 4JFEA 4AGLA 4KI5D 4UQDA 4POUB 4Z7WB 4O58L 5EWIH 5TFSL 4HC1L 3PAVA 6FABL 2NY5H 3JWNC 5FYJU 1FVEB 1IL1B 2KMWA 4EZMA 4QRTA 1FZJA 2WWNA 4WFFD 1VZIA 2WBXA 3ATBA 1NMAH 5A2IH 2XV0A 2YEQA 1WICA 4J2QA 4WNQB 4JB9H 3KPOA 3DX9A 4GUOA 4HV8B 3QARA 5F93C 5B21A 3F85A 1BMZA 2FEDD 4M7LL 4Z7WA 5T3XL 3RWJB 1RHHB 3U1PA 1JGEA 2R7EA 2DM7A 5HHOB 5DMGD 2CRIA 2HX9A 3L7FB 3OZ9H 2X28A 1JPSH 2RALA 5HP5A 5KVEE 1G7LB 2YXWA 1I1YA 5HHOD 1A3QA 1MCNA 3FHQA 3CFDB 1JZ5A 1KGUA 2WLJA 1KV3A 1Q9OA 4YZFF 3FT4B 1MW3A 3KBHE 4YZWA 4BD4A 1S7QA 5T3XE 2JKTM 1XR9A 4UILH 4MDJB 2DB8A 1GMIA 3LZRA 5IMMB 2OJ1A 3EJPA 2VZVA 5FHBL 3QS3A 1XAUA 4WW2F 3TPUB 4ICXA 2X44D 1OOAA 1KBWA 4IQHA 4WIQA 3SZ6A 1F58L 2E76C 2I26N 1G4MA 1ONQA 4WHYG 3PWJA 3ECWA 4LCCA 3L1GA 3SCMD 3NJFA 3EYOB 4IRZL 3PPSA 1DDHA 1CFTB 3UJIL 1BF8A 3S88L 3BDBA 1TQVA 3VVVA 4QOKA 1E4XL 2KZBA 2EH7H 1WISA 4L4JA 3QWQB 3GB7A 2KZ1B 4QRQB 5E8PB 5EOCJ 3DBXB 3SDAC 4ACPA 2OMZB 3TIDB 4XMLL 4QXGH 2ZKMX 5LGHL 1RUMH 1URIA 1DVSA 2OMVA 2I60L 1HAUA 2VE6A 1NUDA 3EGDA 1FFTB 4XN1A 3MC0A 1T03L 3WEAA 4W9JC 1U8LB 1SJXA 1JGUH 3HNVL 2E7MA 3HG1E 2YFOA 4DUXA 4OGXH 3VD5A 1P4UA 4GQQA 1CGVA 1A9EA 1BJ1H 4IOIA 4MX7B 1I3GH 4XT1C 3HBQA 3Q6GL 4TTDC 5DT1H 3ZW3A 4JDTL 3ZKXB 5F8QC 1FPTL 2P8LB 3P0VL 3VXRA 1KIRB 2E6QA 2K9UA 1TZAA 3D08A 1UD8A 4HMDA 5FGRA 3OR6B 3NGBB 3UTTE 3E8VA 4LFHG 3B2VH 4PJ7A 2X4NB 3DV6B 2V17H 5G4MA 4MXVF 1HILA 3ABLB 4LLVA 4CADA 5JA8B 1CLYH 1SMOA 3IPBA 3K2KA 4LAJH 1AD0A 1KIQA 2G5BB 4ZFZA 1A9VA 4R26L 3QZPA 1M6OB 5HYEA 4P2AA 5BQ7B 5TQ0L 2L7JA 5BRZE 3P11H 3GSUB 4DW2H 3DV6A 4WW2A 2DWEA 2UXGA 1T6VN 3K74B 3GSXA 4KNUA 4G8EA 4LF3A 1PY9A 4TYUA 3VXTB 3QCTL 1U36A 3ARWA 3VXRD 4MJIE 5DJ0A 5KVDL 5EF0A 4HKZA 1W91A 2B0SH 1JVOA 3JT2A 4HH9B 5EEXA 1FNGB 2YAMA 2Y36H 1NCUA 2APBA 1D6VH 3MJGX 2BZ7A 3SYQA 2VDNB 2PYFA 3GKWH 1ZD6A 3GBLA 3PV6A 1MHPH 4J1UB 5MEND 4YXHL 2ESVD 4YX2L 2JF1A 3ARBC 2Z7WA 3NJVA 4NBZB 2QVIA 2X2UA 4XOBA 1JIBA 2XG5A 4AKQA 4F2ME 4L9LC 4FQPA 5E1AB 2FSEB 4M48H 3KPSB 3SQBA 1UGKA 5HYIA 5C3TA 2VE6B 2RR3A 5EOTA 2X70B 4PJBA 3GO1L 4UBDD 2CUIA 3BP5B 1OF2A 1BJMA 3UMNA 2PETA 2CPUA 1HK6A 2KQMA 5E2WL 4KDTC 5ID1B 2VJ0A 3FO9A 1X5XA 3KLAA 4RMUA 2GIYA 3L17A 2NY4C 5FK9B 5K1NA 1DSYA 2XA8H 1YQVL 4IMKC 4Q14A 4QOKD 5C0EB 3V6OA 3M1CA 2F54B 6PAZA 4BKTC 4XMKL 3C6LA 2X4RB 5IB2B 3HHRB 3DVGB 5DHVA 3A6BL 1IAIH 5BO0D 3DGGA 4JHAH 4BFIB 2IANB 2WVSA 3MJ9H 2ADIB 4BK8A 1WUZA 1F11A 4KVNL 3VXUA 4ZW8A 4UQBA 1MHCB 2VXUH 2EIMB 1OSEA 4IOFC 3D34A 1A4AA 5ICXB 1X7TA 1RD6A 5J56B 2FLMA 2VWEE 3AAZA 2B15A 4J6IA 2H0FA 4LGSB 4XPBL 4YSOA 3T0EB 4LU5L 3EBGA 3S96B 4Z78B 3EKCA 2JQMA 3VB9A 3S8WA 4P23C 4PRAB 3DUHA 3E7JA 1JXDA 2HKHL 3FQNA 3NCJL 5IMKB 2V7NA 4NUJA 4J39A 2OYPA 4RDQF 4OUOA 3P77B 1QACA 4ACTA 2FX8L 4PJCA 3S2AA 4GH7B 4O02L 5KSVA 2J88L 1IFRA 4N26A 2X4PB 1ZHBA 4W6YB 1JZ3A 3FOMA 3IFNL 2ZCHH 3H7BB 4XNQA 3MV11 5E70A 4AQAB 3WS6C 1JYXA 4HW6A 4HKJA 3VRIB 5ADPL 5GZNC 3UZQB 3I3EA 5KZCD 3IETA 1A21A 2A6IB 3G5ZB 2DM4A 3LN4B 2YARA 1IL1A 2WLYA 1IFGA 2FECL 3ASNB 4Z7WE 4CMMB 1WS7A 5IQ9B 5AVVB 4B3EA 3UL4A 2JELL 4RGND 1CTOA 1U6AH 5IVXA 4XNZB 4RZKA 1P7HL 1U3JA 4J8RB 1JPTL 3ZHLA 2UZXA 3MRJB 2WOBA 3DGDA 3TEYA 3MXVL 4MSWA 4ENED 4OM1H 3QQXA 1NPUA 1E42A 4X4KA 3BSZL 3U4BH 5CGYC 3X1NA 3ML8A 2IADB 1ZXKA 3OF6D 1SXSA 2HH0H 2ORBL 4WUUB 3L8QA 5DQJB 4MD0A 5LN4A 1Q38A 4FL4C 1TTGA 3VFOB 3ZE2B 4FFZA 5I75B 3MROB 1O5PA 3JV6B 2XZCH 3L7EA 3NFSH 4G80B 2X4TA 5JLZA 3QIUA 1QSEE 1EXUA 1BYOA 3FTZA 4U0QB 1OP3K 3WKPA 5HI5D 1QW8A 1WCBA 1KBGL 4P07A 4Q6IC 5L7XH 3FUNA 2J7LA 4M7JL 5EORL 2NW2B 3BLBA 5I1HH 5TF0A 2R15A 3DMMA 3KYNB 5FUZL 1YEIH 3OXRB 3OTTA 3V0HA 5HXMA 3MACL 2DRUA 1SJEA 3QJFB 1N64H 5C2BH 2ARJB 5J6HB 2O26U 2F7IA 3JXAA 3PRZA 2P28B 3QIBD 3KGSA 1RJZA 3Q6FB 1NMAL 1UXMA 3RVUC 5DJ6B 3PYCA 1NIEA 2Y06L 4H8PA 2P8MB 3RUGA 3GUTB 4NZDA 4YLQT 1MRFH 3BVDB 3MLXH 4J6RH 1BX2A 3ABMB 4JY5L 1N67A 3IS1X 3L4ZA 1AKPA 1IC5L 1HHHB 3B37A 3WFHA 1KCSH 3AUVA 3RJOA 5B7MA 5GXBB 4H8WL 3F65A 3WU1A 4KZEL 3OPZL 4U1LA 5EUOF 3QDGD 4HGMA 5JDSA 2R59A 5E9DB 3U2JA 1WAAF 1S7WA 1HS6A 3QNYA 3BZDA 2A1WH 4WWOA 1S9VA 1UM5L 1YN7A 3CLFL 4Q9RL 4W9CC 2OULB 2Z7ZA 4X5PA 2CM6A 2QDVA 4E9RA 3ZRSA 4DNLA 4F5CE 2DQCL 4TQPA 3HNTH 1NMCB 4WJG3 3CFJB 5JW4N 4FYSA 1OCRB 1S9XB 2EUZA 2V3FA 4N0UA 3WIHA 2BP0A 2GCYB 4B60A 2QV4A 1CB4A 4ZQKB 3UTZB 4BSVB 3TWCL 3IMSA 1UENA 4AT6A 4WFED 1ZTMA 4KX7A 4CMHC 2GJ6A 2QKSA 1KXVC 2BSED 2VJXA 3VXUD 4M61B 2NT1A 1W0WB 5GRVK 5FX3A 4N0CC 4EEEA 4OSUL 2DQTH 3UPRB 2VN5A 1WUNT 1M2VA 3FB7B 1U93A 4S1DD 2A6DB 5DUBB 3QFJE 4WRLA 1NCWH 5AG8A 2ATKB 1AQKH 4G6FB 2C9RA 2H9GB 1RVFH 1WK0A 2C3GA 3F2LA 3GUFA 4XNBA 4ELKB 4OF8A 5INDA 2ZKWA 5BRZB 3MREB 4O4YL 4YC2B 1M9SA 4Y5YC 3RVVD 1NCGA 1CBJA 2J1YA 4XBGB 5ALBL 2TAAA 3NK3A 2GSGB 3TCLA 2E75C 1OGTA 3CSFA 4J23A 4I18A 1SF3A 3EG9A 4KKCD 2XICA 1MVYA 5C09B 2CM5A 5EH1A 5KVFL 1T5KA 1TCRA 3CC5A 1BBJA 4I7ZC 1EO5A 3QDHA 4OZGA 1YPZF 5DEJA 2PP7A 5H4YA 4HQQH 4YDJB 4UOZA 4JFXA 2G60L 1IRAY 2PTTB 2CJ3A 5E1HB 5IT2H 5FGCB 3U1QA 1BQRA 1NAKH 2AS5M 4J3UA 2IVFC 4UV4H 4NC0B 4P2RA 3O4LA 5FYLL 4KXZH 4ZX4A 3VACA 4Y2DC 3HMXL 4M1DH 1W6LA 2YOAA 4F7MB 2FEEL 1ROCA 4FHJA 1U33A 3AU1A 5C97A 4IJ3B 4MJ5B 1EZLA 3CDFA 1N9PA 4JKLA 3EF4A 1I1AC 1J5DA 1KJMB 3S37X 1EEUA 2XQYK 3P69A 8PAZA 3SE9L 5KN5A 4F57H 4FQLL 4HIPA 4PJ5A 3CC1A 4KKPA 5FYKU 3BRFA 5KSBF 4X83A 2NY1D 4G72B 1G7QA 1JD7A 2G3MA 1UXLA 4Z95H 3LY6A 1P7KB 1J8HE 4RFNB 5L0QC 3CCHB 5IR1A 2Y4SA 2R4RL 3ARVA 2W81C 4B53A 1R5VB 2YUXA 3OZ9L 4LCUA 5A43C 3SODB 3SO3B 1UXSA 1A7NH 2BDNL 4TLKA 5JOFA 1S4IA 2R4SH 2F1BA 1XEDA 3R0NA 4N2IA 3RAJH 5I5IA 3T0AA 2VISA 3DIFA 5D1XE 2R1XB 1MRDH 1ZIBA 3DIVA 4HJ1A 3SZKC 5DJDA 1KDJA 1BEYL 1M7DA 1WBZA 4M48L 1B2WL 3EO0B 3ZVVA 4Z7QE 2VITA 1BQHB 1OARL 4FRWA 2BPBA 1M56B 3GRGA 3P9LB 3LD8B 1HCYA 3MLZH 2YQGA 5JQIB 5J8OA 5FKPA 3OL2A 1KWGA 5DHYB 5A2AA 1JHLH 4YO0B 1VKXA 3R06B 4GEJA 2IAMC 5AWNL 3HN8A 5KVEH 5M95B 4IU3B 1S9WB 3ZLQC 3JZYA 3DETC 1AGDA 2V2WA 2X5PA 4FMVA 5JHDE 2M26A 3BZEA 3TH3T 5HJ3B 1KGXA 4MD4B 5JYLA 1TSRA 3DVNA 5C6TH 1E4HA 1ASPA 4OV5B 2C34A 3HI1A 2XZQL 3CHSA 3QYCA 3MA9L 2GABA 1KN4H 1Y1UA 3EYFA 5J1AA 1Z3RA 3C08L 5K1JA 3T77B 4PBVC 1F41A 5DJAA 5ANME 5B3SB 4MB5A 2V9TA 3QHZH 5DVMA 3GLDA 1T0OA 5B39B 3L7EB 3LHAA 2BXZA 4X7EC 5J3HC 2OR7A 1L4IA 4N0CD 1J0KA 4KGJA 1JFHA 4I5BB 5F9JB 4KHTL 2FX8H 1A8JH 3WLWD 4E0RA 5KTEL 1OARH 3I6SA 1U9KA 5C0BA 4AYMC 4CDGC 2FE0A 3CLEH 4O9HH 4N3TA 4BKSC 3ZYJA 5FOBA 5HHOA 5I73C 4ZW6A 2H26B 1L9RA 2UY7B 4N8VB 4HDIB 1MHEA 1HHGA 2E5EA 2BVEA 2CDGA 2EJ1A 5FGBC 1FAIH 2GUYA 4YHPA 2AJUL 1JNJA 1CTMA 4JFQB 1FHGA 2DQUL 3B1TA 2I27N 2QZ5A 2IAND 2DDQL 1UADC 1S7RB 4IIQB 2VXTH 4H5SA 1PD0A 1XAKA 2CLVA 1KXVA 4N90D 1LNUB 3HHSB 3MNMA 1OGTB 3OC8A 3OLEA 3F83A 5KBLA 2ATAA 2B3IA 5D1ZA 4HPOH 2IBGA 1RU9L 3QEQB 3S98A 3HFFA 1Z9NA 3GTTA 2KHAA 1USZA 4R4ND 2ZXDA 1SM3H 3TFKD 5DJYA 1RQ5A 3NFSL 3CXHK 1GZPB 1L6ZA 4ZS7H 3BPNC 3KDMB 3VFGH 3T0EA 1TDQA 2FVNA 3HG0A 3MNWA 3BVNA 3M17A 3HW7A 1ZA3A 4RMQA 2A6KA 3U0TB 1HEHC 4LO9A 2DTMH 3UAJD 2V8MA 3VWJC 4UTAL 1CU4H 1MFUA 1C1EL 4G8FA 4PRHA 2X38A 1KXQE 4L8BB 2W94A 1MWAA 3NIDF 4UTBL 4YHLH 1GOGA 1P5UC 3GBMH 3CZGA 5F6IC 1YEKL 4BHUA 2XN9D 5ANMA 3UC0H 5IW1A 4UCFA 2PP9A 3L5IA 4BCZA 5IMOB 3CDZB 5GGTA 1J1PL 3MU3A 5HHNA 1KJ2A 1I1FB 3L9RA 2GUOB 4O00A 3THMH 2ENJA 4MDRA 4TNGA 4A2EA 4HT1H 4ZXBA 4PB9H 4AIEA 5I1IL 4YHZL 2YQBA 5MENE 1G9HA 4P23B 1RK1B 3QBTB 1ES0B 4CJ1A 1EEZB 3FO0L 1QRNE 5C0FB 1JYNA 1W8NA 1KELH 3HI5H 4JUTA 3L3DA 3CQPA 3FXIC 4TSAH 5C09D 3EJJX 4DAGL 3BAIA 3JTSB 4ZZKA 3HRZA 3O6FB 5IZ7A 4ODXB 5DO8A 1Q9LB 4K3JH 5I0VA 5HDBE 4BWTA 2B1AL 1R4XA 4DGYL 4FXKB 2G4EA 2COVD 5L2KA 5I1JL 3D39D 4LPWA 1TTFA 4F24A 4WWNA 1EAOA 2BOCB 1L0QA 4O5LH 5DVPA 4X5QA 3AJ7A 1MVFA 1FF5A 4NZUH 2VZ1A 3NFNA 1D7FA 3I50L 4TSCH 2NCMA 2NR6A 1DUZA 4ADIA 2ALWA 4YHOL 4H1LG 5KTEH 3G5VB 4PP1C 1CLZH 4XN8A 2DLFL 1HVXA 3AT9A 1P0SE 4MFHA 2QEJA 5DGRA 1UZ6F 1JNHB 3E2HC 3AMLA 1JTTA 3LPPA 3PGFL 3BD5A 4DVRH 5C0CA 4I0KA 5D1QB 5DO2C 2XQ0A 1MEXH 2W8CA 2EYSB 3CZFA 1PX8A 2BIIA 4JO3H 4P2YA 1KIPB 4KDTA 3AWFA 4XE5B 3U4AA 1XV8A 3CSYB 1ZANL 3NJKA 1PEZA 2UVFA 3UPAA 2AC0A 5DQJA 4JFFA 1SJVA 4NKOB 4AENB 4OLXL 1KNOB 1KIRA 4EUPA 5DZJA 2OZ4H 2HVKA 3JWNE 5D4QA 1KXQA 5FYJL 4DOHB 3VH8A 2Q5BA 3QPQD 1ETA1 1EMTL 1G7JA 3QJZA 1UA6H 1OL0A 4UT7H 3ML9A 5T1DL 5I8KH 4J8RA 1L7TL 4K3DL 4Q6YA 3ARXA 3L1FA 1QQDA 3VFRB 5JZ7D 1EDHA 5L88L 4UQ9A 1ZDSA 4XZUA 2OJEA 1HINH 4DKTA 4KTGA 3F6JA 5E8NA 1GOHA 4URKA 3MNZB 1J0JA 5T3ZE 1OHQA 1GS7A 2IPTH 5FUCE 3EDDA 2OMZA 2NW2A 1U8PB 1X5MA 2CHDA 3QJVB 4Z7QB 5I1EH 3C2AH 4JPKH 5CU5A 1W16A 2VSCA 4H25A 3O0RH 1MG2C 3IFOA 2WMPB 1JG9A 2D7TL 1AGBA 1DLHA 2VUKA 2JIXA 3BEWA 4FNQA 1EHAA 4F7PA 3PS6A 4HS8H 4KH9A 1EO8L 1N26A 3IKKA 3SCMA 5ENWA 3RWIB 4ZAKC 1QPPA 4DUWA 5MHSD 3X14A 4HYTB 4GW5B 1P7BA 4Z78A 3SD5A 4PJEA 3VJ6A 3AQYA 4PG2C 1UA3A 1D9KB 1DR9A 1Q1PA 5GRYA 4DH2A 3ZDXE 1G1YA 2MFNA 1D9KD 3WE6A 1J1OL 1OPGL 3ZMEA 1MHCA 1IGJA 3FUHA 1L7TH 4P2OC 1B4RA 3BH8B 3FFCD 4RRPM 5IMMA 3WUWA 3BSZH 3T04D 3W9DA 2YAFA 1WTGT 3CFKA 4CMHB 2ZUUA 3OHXC 5IB2A 2YQ3A 2WKLA 5IQ9A 4LSVL 1FVDA 2APXA 5LGYA 4CMMA 1WC7A 2ENSA 1ZE3C 3ZYOA 5FLVA 1M2OA 2DKUA 3HE6D 5FK9A 1ZLUH 2IPTL 4LCWE 3ILQC 1NEZA 3WIHH 2VLJA 4KPHL 3IF1A 4AMXA 5HI5C 4XMXA 1ZLSL 4ZZFA 1DN2A 4LVOC 1D5RA 2I9LA 5DWPA 1IBZA 2B59B 2H6PB 1UKQA 3O0RL 4WNQA 2I7OA 2Y7QA 4DCQB 1HHJA 4MWFA 1EFXD 3TU6A 4A7VA 1RUQL 4YE0A 3MRBA 4JB9L 2F53D 2OW6A 1JV5A 2AJ3B 2NY1B 1S78D 1FL5A 2DIAA 2GFBA 4GQZA 1SBSL 1BD2B 1OB1A 1OD7A 5CGBA 5ERWB 4N2NA 2J20A 3AQZA 4F8OA 1UEYA 2Y36L 1I8IA 3T1FB 5I9QB 4M3KB 2MRYA 5D7SL 2OP4H 4KAQL 1A8ZA 3C9NB 4PGDB 3U2SA 2IXQB 3VG0H 4NQEE 1FVCA 4HKZB 1YUKB 4FZ8H 4HJGB 3LCYA 4RDBA 3BW9A 1EJ6A 3QHZL 1TQSA 2JCCE 1LILA 1OSZB 3H1ZA 4PMEA 3NZSA 1E27B 2J8UA 4F7PB 3DUSA 1FNSL 1EGJL 1WZMA 2BO0A 1U8HA 2KLSA 1I3RB 3OGCA 4DUVA 1HDMB 2YSSB 2BVOA 4L2YA 1UQSB 4K7PY 3ABGA 3BWZA 2JB5L 5IWLC 2CO1A 3RL2A 2BY3A 3C8DA 4TNWK 1S7VA 2GEQA 1NPJA 5AW5B 4CADB 1ZJAA 5IREA 1X5GA 4B96A 4LB8A 4PJGE 4OJFL 2X70A 4E41E 1YMMB 4J3SA 1V3KA 3T4AC 4EI5A 4YLCA 1B9ZA 3MLPA 5D71H 1WBXA 1YPZA 2C26A 3FTGA 3QUZD 5IJKA 3ARFD 4ETQB 4U4IA 2Q8AH 3QUZB 1PD1A 2G0KA 3B9AA 2ARJQ 4TV3A 4DP4X 4IM8A 4JRYB 4Z3IA 3HC4H 1HL8A 1EO8H 5EZIL 1IE5A 3HBZA 4LRNL 3KD4A 3QAZC 4XPAH 5MENB 5EMYA 1RURL 4J5VA 2Q7YB 3AXHA 3JTSA 2VLJE 1W15A 3FTGB 3ZE0B 4A2LA 4ZUTA 3L3DB 4V1DD 3U7YH 5T1MA 1AZNA 2CMRH 5FV2A 3T6ZA 3DSFH 1DYZA 5C09E 2XIDA 4JM2B 1QKZH 4I3RH 3OKLA 4OCSH 1UOLA 4KXBA 4I1PA 2LR4A 1A9BA 5EBWB 4WI9A 4A38A 1RUKL 4OCNC 4E42A 4OFKA 2A0LC 4OV6F 1RFDH 2NTSP 4EIZC 4S0HA 4HGKC 1WAEA 2Y1YA 1S9KC 1C5CH 4X5WA 5DHVH 3Q2LA 1JE6A 3KXFE 2I5YH 4PWGA 1A4KA 1D7DA 5IB4A 1CXLA 3OHXA 3PGFH 2BHUA 4KPHH 2H1PH 5TQ2L 3OSKA 2YAEA 3GK8L 2IPKB 3LNGA 5E8DL 3DX4A 3GBML 3QR1A 5DS1A 2FX9H 2J8HA 3OGOE 1IGTB 3ASOB 5SWQA 3QZWG 3QZNA 3QR0A 3D85D 2E7HA 4I0CC 3BRGC 1IEAB 3KLDA 5I1AB 4IS6A 1BVKB 4S2SB 3UYPA 1SOXA 4DWHA 3CD4A 4HAGA 3QEQD 5C0NC 1NC2B 4QRRA 4B5ZA 1BECA 2FRGP 5L2JB 4A2GA 5D2NE 1QO3B 4XOEA 4NZTH 1LDSA 1WAAA 2Y22A 3HRZB 3OAUL 4UMGA 4X6CB 2UYLA 4L37B 5ALCH 1K3IA 4UQ2B 5IMLA 5AW2B 3IFLH 3OKEB 5GSVA 3HB3B 3NSFA 1D5XB 3BO8B 5BUGA 1EEZA 3RGVC 3FQWA 2X6AA 1EZSA 4D7PA 2CLVB 1TETL 3MRQA 3VFWA 3E80A 2G2PA 1OAQL 2DV6A 5F3HB 3VI3A 1QR1A 2OMWA 3GJEA 2G9HA 3PL6C 5GJTH 2ZSWB 4GI6A 8FABA 1E40A 3B9KC 2VQ1A 3I50H 2F7OA 4LHUA 4MA3B 4W9KC 5EPMB 5JNYB 4FTVE 1J9TA 2XN9B 4NO5A 4PRPD 3D2TA 1HEJC 3VRLF 2GAZB 2D8KA 3VM7A 4OLUL 1S6NA 3ZDZF 4P9ML 3MV8A 5A2LH 4MDIB 4NP9A 5I30H 4M4RB 1CF8L 2FO4A 4M56A 3BUYB 1K8DB 2DKSA 5CIPH 4G8GE 2WC7A 4RLDA 5MEPA 4OY9A 3SE3A 5JTWA 3LQZB 2CHWA 4K3HA 4F9LC 2NYZA 2WXJA 3PNWB 2OYLA 2OV0A 4FQIL 2PPCA 4MMYB 2WKOF 2VAJA 4X6DB 3MLZL 4EKJA 3MNDA 3UCQA 1P6WA 2DS4A 4KVNH 3ERXA 1H9VA 3D50A 4N5UA 3RWFB 4DGIL 5CJ8A 3QFDA 1T7ZA 4XVJH 2FJGA 1IBGH 3L5WB 4FCAA 4PJ9B 4OF5A 4B41A 3FQRB 4RIRA 1HC1A 2A6JA 4TQIA 3HS9A 4N6RB 4PJ8C 2EDDA 3QI9C 3IE9A 3MRNA 3GD1C 3LKQB 4Q9RH 1H6EA 4TM9A 3TZVC 4UT9L 5E24E 3O41B 1E6JL 5HJ3A 1KGCD 1EJOL 4D2NA 4LHUD 2FJUB 4TUJA 4NO5B 1LWJA 3FFCE 3NCYP 1MI5E 4EUPH 1PSKH 4NRZA 1KB5H 1DZBA 2H8PA 3BPCA 3EYUL 3DUUB 4KK8C 4NENA 1D7BA 1GIGH 3LKNB 3VFGL 4BFRA 1F4AA 5B4MC 1W80A 1QTSA 4WHCA 1XZWA 4IK6A 5BMFH 3WTTA 3JWNG 2VDNH 2BCKB 3TYFA 5C07E 3BO8A 3O2VH 1G7JB 3V4LA 4H1LA 4XPGL 5IESL 2EUVA 1JBJA 3B56A 3S3SA 1OP9A 3ZQ9A 1LL1A 3CGTA 4OGQC 2GBVA 2FB4H 2MPAL 4Y16A 1KNOA 4ZMPA 1DVUA 2RBLA 1X7QB 1N8ZB 3VSUA 4JO2H 2KH2B 4G3YH 2R0KH 3FHAA 4AW7A 4TVPH 1VEOA 4OAWB 2JKLA 2R0ZH 4KUCF 1TZHB 1TZGH 3HI1B 3NFPB 1R33A 3PGDA 4ZFGL 1TKWB 1GHFH 1XGRB 3BPLC 5B39G 3F12A 2F5AH 2LGNA 4NQEB 3AG1B 1JVKA 4XI5D 4YEEA 4BZYA 4U31A 3FONB 2Q6WB 15C8L 1RZKC 4JQIA 2WVVA 1MELA 3RX9A 1KJMA 2WYTA 5IVXF 4PUBH 3QPQC 5HPOA 5DHYA 2AV7B 5T33H 4RX4A 3OJ2C 3LKSA 1B6DA 4X6BA 4GQPH 3OMNB 1YNTF 4HWBL 1V7MH 2B1HL 5MERA 5F8RC 3KVDD 1IKNA 5LDSA 3CFCL 1IM9A 3GMNB 5D9SB 2ENQA 3DVIA 3REVB 5GRJL 4GRWE 3B6SA 3DI3B 1GZQB 1DE4A 4Z77B 1J48A 1P9MA 5KSUA 1NFDB 1W2KT 2HLEB 3NYKA 3BE1L 3QUZA 1WZAA 1OALA 35C8L 4YDLC 4NB7A 1MY7A 2VDRB 2VTFA 3MHZA 1NMBL 2MQGA 4Z7UB 2PABA 3GRWL 1PCSA 1HH9A 3PL6D 5GZND 1I1FA 3DJ9A 3L9RB 1BVLB 4YHZH 5GRVL 4GP8B 4LCIL 1Y0LB 2CUAA 3NPSB 1E4JA 1E9PA 3D6GA 4GY4A 4G2AA 4KQ4L 3MRDA 1LEIA 3ZDZE 1J0YA 4XCEA 5IG7A 3HR5B 4PJ5B 4JM0A 4OF6A 4N6QA 1Q72L 2W65A 2UWEE 4PRHD 3TP4A 2RQEA 4PWKA 4EQ2A 2B4CL 4KHTH 1TUPA 3KHQA 1CDIA 5LN8A 3DUSB 5TD4A 2LLNA 3V5HA 4I1NB 4XBPA 1X4YA 4UF7C 1ULVA 5C0ND 5K9OB 2EIZA 1YEGL 3ATDA 1KCRH 1K6QL 5GGRA 4GKZA 3NTCL 1NIDA 5CMAB 3WG7B 4Y89A 5E5MB 1DCEA 3ZKMD 3RI5F 3T1FA 4FQCL 4JY6A 2J25A 4K71B 3CFJA 1VHPA 3R4RA 5FWQA 1VESA 3MVSA 2F53A 1QFHA 2VLLB 1ZS8B 4GT0A 2B08A 1K3ZA 1NCCL 3QQNA 3WMSA 4P3WA 4DP2X 5AWNH 3FCSB 3VM5A 2HMID 1NLDL 3L1EA 3P40A 6PCYA 1VFBB 4Q2ZA 1ZK5A 2PKDA 5GRZA 5JW4M 4FQQA 1AO7E 3W39A 2ICES 5D7LA 3PP4L 3AY4A 1TVDA 1G87A 2DQDH 1MCKA 3EH2A 3EYQD 4L9LB 4MJJA 6CGTA 1LQBC 3GSWB 4HLEA 1IM9D 2CJUH 1T80A 3ALPA 1AXTH 2H1XA 1U0QA 5CR8A 4ZFOB 1GMEA 4EZJA 3N41F 5I18H 1YJDC 4PVBA 2NY6C 3QXDA 4GXVL 3VG9B 2D3JA 5BJTB 2VSDA 3MRMA 1DN0B 3ARGA 1C7TA 1OSPL 5IK3A 5LLIC 3HCVB 3EJCA 5HPMA 2UXFA 1RK0A 4NJ9H 3SGKC 3LIZA 3ARBA 3KLKA 4L3CA 4PFEA 3GMLA 3SDAA 1T4WA 1BFOB 2VERA 4HFUL 1X9QA 1ZV2A 4FTVB 4WO4C 1FRGH 3KYAA 5CP3A 2VQTA 1UCBL 5DK3A 4A7GF 3DJZA 1UB5A 3B1UA 3FSVA 3I6KA 2F7QA 2O4EA 4YIQB 4BZ2L 4JFHE 2XWJB 1TZHA 4ZPVA 1LEGA 4CGUB 2BP8A 2NR6C 1PZ5A 4DGIH 1KTDB 4GINA 4M6OH 1MCEA 3T0VA 3WBDA 4G43A 2WXMA 4X0KA 4MD4A 3IRPX 1MHHB 1BM3L 4NCC1 1AQDA 5ADOH 5I8OL 2YEZA 4UDTA 3UZEA 4X7SL 4ICWA 4TUKL 4HULB 4Q6IB 3NSYA 4MNGE 1E30A 1G7IB 3CVIL 3G3LA 5LWYL 3ROLB 3GF8A 4HWZA 1T1YA 2O1AA 3MCKA 4WO4A 5DWUL 1QTYT 3DOSB 5CEYB 3TX4A 4ODSL 4XZUB 5F3BB 2CA3A 2EC9U 3VXQB 2I85A 3HI6L 2VITB 5TE4L 3SGDI 3M1BA 4OLVH 1EVTC 3EO0A 2ZOKA 3L1OH 4FI7A 2B7DT 3VWKD 3HPJB 4RGMC 2H47C 2XFXB 3Q8CA 4C4BA 4JFUA 1JXGA 1JF5A 4LSRH 4NKDB 1T1YB 5IJCC 1NANH 3KWWB 3CK0H 4GMTL 1YNTA 2VR9A 3BAEH 3A23A 3NH7L 4MNQB 2YIHA 1YEHL 4PP2B 3QXAB 1VZHA 3WMPA 1NDMA 5F7AA 4G83A 1BHGA 2IBBA 5ADPH 1G6RL 1OAKL 4R7VA 4FQIH 2NY3B 3BP6B 5IUSA 2DTSA 5C0DA 5JHBA 4K9JA 1IZKA 5EU7C 4XNDA 3T3PB 3TLRA 2AXFB 4XVJL 2LU4A 1DFXA 4OM1L 3DDGA 4M5SA 3HE7D 2HG5A 5CJXA 2PCYA 2WBKA 3IE4A 1JF6A 3HPLB 1WRFA 4NQED 3M88A 4KJYB 2X9WA 3ZE2F 4Q9CA 3WCYA 3ZE1E 1PZ3A 2F2HA 1FBIH 5IBTL 1XGPB 2EE2A 1NCWL 4LKXA 4HSAC 1DDTA 2PYED 1LP9E 4E41D 4ENZA 1DUZB 1EJOH 2VUOA 4AQEB 3UTSD 5T33L 3APCA 3NJIA 5TK2A 4H26B 8CGTA 1OK8A 3RKDC 4KKRA 2BXYA 3DRQA 1GC1C 3QUXD 5EPMA 4ZTPH 4E5XA 4AQ1A 3T8MA 1T1WA 5L6YH 3VUAA 4R7NB 3BHBB 4BM7A 4NLAA 5F3HA 4NX0A 2YS4A 5HHPA 5CP7B 1L0PA 5HTSA 3SKNA 5KBNC 5KS9A 1HI6B 3BRDA 2QV2A 3FUDA 5DYOB 1JI1A 1O5DT 4F80A 2OMBA 4KVPA 1FNEB 1UKSA 3PJLA 3D39E 2IF7A 4FE9A 5FF6A 1DJXA 1EZUA 1MDAA 3RVTC 2V7NB 4NUJB 1YC8A 4BSWA 3HMXH 3B7SA 2ATKA 3GBNL 4GRWB 4P49A 1MJ7H 1I7RB 3S96A 3UO8B 3EFDL 4DVBA 2R0WH 1BVKA 2RD0A 1NFDE 3WUZA 3DRQB 2O6FA 1CK0L 4CN4A 2CO7B 2JKNA 3N85H 3W0WA 3RI5K 1CYXA 4RAUA 3UCRA 1XH0A 3T3MF 4P0DA 1AC6A 2K45A 5DRNA 1A66A 3BX7C 1INEH 3AT0A 2ZP9A 3U0TA 3P9MA 4X7DC 5F7UA 15C8H 1ZA3B 5CJ5A 3Q3GB 2WWOA 3I3BA 5G5DA 5FR3A 2XV2A 4Z7OB 1OCWL 2OSXA 5AL8A 4OJAA 1QX1A 4G1EA 1ZAGA 2I5YL 3HLAA 3WLBB 1JDCA 2ICWB 3GPSA 4DQAA 2HT3C 1CXFA 3RPIB 1BD2D 1X5KA 3IT8D 1EEYA 1IAOB 3WL9B 1ODAA 1XZ0B 4FQXA 5F1OB 5E2WH 5C0RL 3INUH 5IQ7L 4QXUL 5GS0C 2QSTA 3CZEA 2EE6A 4U6TA 5LDUA 1XGUB 3UBXA 4KV5F 3U36B 2ZXGA 5C3LD 1XSJA 1EX0A 2UUDK 4FA6A 3V4PL 3ARED 3CUPA 1UD4A 1MJ7L 2GT9B 3MODL 4KK9D 5CD5D 4E9YA 5AZUA 3TIEB 4WW2C 3G08A 2PPEA 2Z93B 5AENA 3O3EA 3O4LE 1WWAX 4KRNA 1F1AA 3AS3A 1U8LA 5AAPA 1IM9B 2Q20A 5D9SA 3EH5B 4JZJB 2BP3A 2FJFB 3GTVA 1DVFD 1GYAA 1Q9WB 2XY2A 3QAQA 4M7LT 4RX4D 4MXQC 1AJ7L 2JMRA 3WD5L 1MFEH 1SXAA 2B0SL 3JWOC 5FM5M 4QHMB 3KL5A 2E7LC 4RBPH 4YNYB 5K33A 1T4KA 5IVOA 1EBAA 3MTXA 3ORJA 4KTYA 4WFFE 1R3LA 2AQSA 1EK3A 3M46A 5ITFA 5C08D 4JR9L 4OI8A 4I18C 2XJKA 4NWTH 3ARFB 1RZFL 5IOPA 1XF5B 4FG6C 4NKMA 5G4OA 5ILTL 4AYDC 5GRWA 4PGJA 5L4FA 4YSCA 3BUQA 4XO5A 1JNLL 3IGFA 3OAZH 3VTAA 3O9WA 3QIUD 3SB3A 2AKRA 4WTWA 1KSRA 1VPOL 4ZPVB 2H2PD 2IH9A 1CD9B 4GW1B 4YXKL 5T3XD 4S0SD 4OZIB 3ZQWA 3QZWB 1UJ3B 2YD1A 3DX7A 3GMQA 3KPSD 3PU7A 4L4TB 5F9WC 3OF6A 4MJIA 4A2HA 4CNIB 3UJJL 1ACXA 2MQ0A 4FQJL 5IBUB 3VXSA 1B4JL 4G1MA 4Y16B 1H5BB 1FL5B 3TS8A 1BFVL 4HZAA 2K8QA 3KNBB 4FDWA 2WUCL 3QH3B 3ECBB 1NBVL 1SBSH 3GSOA 2X05A 5GRXG 1HQRB 1G7LA 1CXIA 1KTLB 1WO2A 4LASL 3NABH 4P5MB 4PCSA 5EIIA 1MDTA 3FHEA 1E4WL 3GBEA 4JKKA 3RWJA 1CXKA 3FF8A 4IKLA 4HOXA 5T1LD 1JPFB 4TNFA 3FT1A 5D7LB 2FD6H 2J71A 3QDJD 4FFVC 3ARSA 3D18A 2NQCA 3QPKA 1BF2A 1IM3B 1JK9A 1XX9C 4TF4A 3GJFK 1I7UA 1BAWA 1MUJB 3FO1A 4PW4A 3MMEA 4AUJA 1HEZB 1B3IA 3L5HA 3GEFA 4E9QA 2HVJB 4N9OB 2ZZUT 1ICTA 3SOTA 4N2DA 2VQ4A 2P80D 1JFQH 4PG9A 2NY3D 3R1GH 5B38G 3I9PA 1KBKA 3T2NH 3C2SA 3OLDA 3S88H 2OR9H 3EOTH 4RIRB 4E9XA 4ANKA 3UTTD 2VN6A 3ZTNH 3RB5A 3VFVB 3PQYE 3VJ6B 3GXIA 4G42A 4S1SL 5B7EA 3CN4A 2FQFA 1FFPB 3S4SA 5I5RA 4JFTA 3LQZA 1UD3A 3AXLA 4PJXB 3OB0K 3I84A 3C5ZD 4NN5C 4GSDL 4W9DC 4XMTA 1QASA 3HNSH 4MJ5A 4MCNA 1E4WH 1K8DA 4IOSD 3MX0A 2XZQH 4MCZB 5DD0H 2PMZA 4H25B 3UERA 1SJMA 2R7EB 4NS0A 1JGEB 4JGJA 5L4JA 2A4ZA 5E6YA 3MJ8B 3SOBL 1D2OA 2GAZA 4LDLB 2Y6SC 1J7VR 2MJWA 2WHVA 4JG0L 1N0LB 4RBPK 4KX9A 5EEVA 1E9PB 4CBZA 5E4IA 4GAGH 4WO0A 4NBYB 4NQDA 1CD0A 4DESA 1TT6A 2ZXBA 4X7TB 4P23D 3ARGC 4QRTB 4FOMA 2QR0A 4YQXH 3WJMA 2MH4A 1U3HB 5DRWB 4OBRA 3HKFA 2VDMB 4GLRI 4GRWH 3S35L 2YD2A 4N0YL 1XF3B 3JYCA 4XCFH 1JVLA 4PW9A 2GSGA 3TCLB 1WE5A 1MNUL 3K6OA 1QBMH 4W9FC 1H8NA 2MTPA 1FL3A 4AH2A 5H2BB 4MKTA 4Y9GA 2CHZA 3TONA 5LXVA 4WV1B 2D7QA 4OLEA 2GBTA 3NPZB 4HKXA 4LPCA 5TK4A 5F0LB 1MFAH 5I1EL 4JFOB 1JHKH 3KAAA 2CLRB 3D85A 1ZLWK 1I8AA 3UIZA 1IEAA 5I1AA 1RSFA 2DWEB 2GYSA 1O6TA 3V0JA 4OTXH 2E9JA 4OQTL 3L6FB 1M6OA 1ZCRA 1Z0MA 3IXTB 1INEL 1XWVA 5C0CB 1DP0A 3VSTA 2DEYX 1SDDB 2E6PA 5LXGH 5IQLA 1ILSA 1FO0B 4LQFL 3UTOA 1JGLH 1U2CA 5C0CD 3N9GL 4CGTA 5GQBA 5L9DL 1OCWH 1A4KB 4HK3N 3KGUA 2DM3A 1J8SA 3TFBA 5I1LA 1MFVA 1U8KA 2Z4QB 3P3RA 4AM0Q 3FU7A 3TBTB 3V5KB 4WUKH 3KEDA 4K07A 5J57B 5DHMC 4MKMA 5FYJE 4FHBD 1DJHA 1FG9C 5DA4A 3UP6A 4M9PA 4L4TA 2OK0L 1YYCA 1PVHA 3V0GA 1MCPH 3BFQG 3W11D 4UQEA 2J21A 2HP4A 2O6EA 2AKRB 4YR6B 3LRSB 4ZUSB 4OCWH 3KWTA 2R1WB 4GW4B 3I9GL 1SDYA 4HQQL 1IGYA 5I6MA 1SHWA 5JPNA 1TJIH 5D7IB 2YAHA 4ZX6A 1S5HA 4UT6H 1TZ8A 5FM8A 4QHLB 1BQLH 3LZFL 1I3VA 2CUMA 1C08A 4QTHB 2MNUA 2P8MA 4J28A 3RUGB 3NIDE 1FWXA 4QLWA 4ETQA 1ZT4A 5ACLA 3BVXA 4TVUA 4I3SL 4EI5D 3LKNA 4PS4H 3SE4C 1EZVY 4ZXBB 3BPCB 1AO7B 3DBXA 3BVTA 3OKDA 3Q43A 1OTUC 4QNPE 2D7NA 2X6MA 1PFCA 1RVFL 1TTBA 3LNFA 2OP4L 4KAQH 1HE8A 4MAUH 5F1NA 3UTSB 4L8BA 3TEXA 4OW6A 4W9IC 4TVPE 4IGBD 3IM1A 3K2IA 4RWHA 4Y4KC 3WNMA 3TO4D 2Q7AA 4OF0A 3HNVH 4XP4L 2WJ7A 3CUPB 5TE4H 3U2IA 4FJ6A 1OAUH 3WO4B 3VXOB 3QIUB 5AB9A 2EUXA 4QJ3B 3U46B 1QSED 2LVCA 3REWB 3S4SB 1CFMA 3LZNA 1E67A 3RVXC 4JPVL 4R4BA 1FC2D 5DEZA 1S7QB 4W93A 1NICA 1GGIH 1MW1A 5MEPB 2H3KA 3VFUB 2QQKH 4KJWC 4UQAA 2F8XC 2VIRB 1AR1C 2Q86B 4RGOL 3L7FA 3SO5A 2WNXA 1A1OA 3EOBB 2YN3A 3NCXA 3TCTA 4XI5C 1YEJH 1LE5A 1BJ1J 4KVCL 2LVEA 3WO3B 3F58L 4U1GC 3IAQA 1MFAL 4U0RC 5FW6A 5LAXA 4HWEH 2MHAB 4P48A 5KSAC 4L4TE 1INDH 3VA6A 4QO1A 3EFFB 5SX5K 3W11C 4ZS6C 3SEPA 1R75A 4NO0D 4WV1C 3L3JA 4CW1B 2XVGA 1I9IH 5C0GB 3HC4L 4HIEB 3W0WB 2CDGB 3WD5H 4CBPA 2GY7B 5B8CC 2AQRA 3HE6A 2BNQB 5I0XA 4X80H 3U0WH 5I1GL 3CX5K 2PPAA 2WQRA 1I7RA 2XWRA 4N2MA 4WSGA 2BSCA 4I2XE 3DO7B 4HIHB 3QQ4B 1BFTA 1WBYA 5I8KL 1LO0H 5T1DH 3VX0A 4ERSH 2RFXB 5EO0A 3QO1A 1I7ZB 4AV4A 1O6VA 3KYMA 5I16A 4C57C 1CC3A 4ZMOA 3DJSA 3FU5A 5I1JH 2VDLL 3ULUL 3AABA 4HS3A 1PAMA 5ANHA 1DQLH 4I13B 1UHVA 3O8XB 1NTDA 4UINL 3BESR 4PV9A 2DIEA 3KM2A 2MQCA 3WIIL 1P6AB 3MJ7A 1I31A 4J3TA 1ACCA 2BOBA 4OZIA 5I71B 2DOCA 1WD8A 2V3EA 1IGTA 3KBPA 4UT9A 5A16A 5SWQB 3NA9H 3S4SG 4ZUWB 5C0IB 1CLZL 2OL3A 4LGRB 2ICWJ 5F96L 1I53A 3VGDA 1PQZA 1QFOA 5DTFB 3J8F7 5TGBB 5CZKA 3DVGA 5DHVB 3DX2A 1CQKA 3WNLA 4OKVB 4MMXC 3BVUA 3S0PA 1XF4B 1ZHKB 3MLWL 4MD5B 5DQ9A 3VI4F 1QUPA 1ZJBA 1W72A 1BQUA 3OG6B 4PJ8A 1M1SA 4K94H 2X7LB 2GTZB 3H2QA 1OTTC 2AJSH 3MNZA 4L5FL 5DJXA 1A25A 4QAWA 1A6UH 3OKMA 1FORL 5KANI 3IFPB 4MAUL 1A47A 5EN3A 1ND0B 3MI6A 3QDAA 4NKIH 4JVUA 2VLMD 1IC0A 2WN3A 2F9BT 3E6HB 4RWYH 2YRZA 3Q8EA 5MENA 4L5FE 1T5XA 4NXKA 5EO9B 5G55A 3BP6A 4BYHA 4ELMB 4ALAH 4G6AC 4XHJD 1DZ0A 3G08B 1FSKC 3G7TA 3NIGF 4NHCH 3F7PC 4OVUA 1PX4A 2VLRE 5KYYA 4RMSA 2D0FA 4UM9B 5I17A 4YDIH 1B0WA 2J88H 4TLTA 5AW0B 2TSAA 1NKOA 1I82A 3LV3A 2NCEA 4UM9D 4NI6A 4UNUA 2CKBH 5JIIA 7TAAA 4JZJC 4GXUM 3LH9A 2BVTA 4QLRA 1OTUD 1K2DB 4FQXB 5EO1A 3IGAB 3OPUA 4ZX3A 2XWCA 1BBDL 1NA8A 3V6ZA 3S37H 4DT2A 3BN9C 2IG2H 1F6AB 3FU0A 2YGPA 4PTUB 1NCJA 2VABA 2DQUH 4D9RE 2VDLB 3E3QE 1NBYA 1HESA 1KIQB 3AITA 3UBXI 3PHAA 3ZXAC 1Z9OA 4Y4HC 3AREC 1Q90A 3DYMA 5KOMC 4LEXL 3K81A 1RLBA 1SHMA 1MCLA 5T1LB 1QTPA 2AXHA 1LE9B 1YPZE 2OTUB 2NR6D 4KI5F 5DUML 1V5JA 4GXUN 4G8IB 4U7KA 1DBKH 4EN3B 3E8UL 3TA3C 3OQRA 3FT3A 3T0WA 2AMUA 5C0CE 3WKNA 2EXTA 2Z31B 4CRPA 4K94C 6TAAA 4XP1L 5F71A 3F7LA 4QRBA 4ONFH 4KXAA 5I1DB 4XWGL 4WZ9A 5C0IA 4NM8H 4GFXA 3W56A 3M6DA 4PB0H 4HXBH 3MJWA 3WSQL 2FBRA 1CR9H 5C09A 3A6CH 4HPHA 1HIML 2CKBL 4N1CA 3C60B 3MGAA 4EDWL 5BRQA 3UO1L 3HG1B 4QWWD 1LMKA 2EICA 4Z18A 4D9QD 3MFFA 3C5ZB 3ZUCA 1AP2A 4JQVA 4PJAF 1F3DH 1KB5B 1KCUL 1KYDA 3UGEA 1IV8A 4OZFB 3VD3A 2AEOA 3LEYH 2JK5B 3BHBA 4X4XA 5D7IE 4R7NA 4QRSB 3GS4A 3GSQB 5E0QA 2HMIC 4QRQA 1M05B 4G5AA 3LH2L 1BZEA 2BNQA 4HBQA 5FXCH 4JUSA 5F7EL 4ZBJA 1GGYA 3W39B 4GAFB 1X3DA 1OAYL 3MLXL 3ESMA 5DDHA 3EDJA 2PO6C 5KSBA 2NSQA 2DY2A 1TZGL 4LDOB 5CP3H 1AGEB 4K8RH 3IDJB 3ZGIA 2CR0A 4AT6B 4LCCB 1CZ8H 2QHRL 1T2QH 4KWUA 4ODWB 3EHBB 3AY2A 4H13C 3KPTA 3N50A 3V95A 2VLLA 1E2WA 2A73A 2YXVA 3QORD 4N2CA 4I48B 4JDVB 3VB8A 5HI3D 5CZXC 3VFTA 4XN4A 3X12A 3AMKA 4RWYL 3GXMA 1XF1A 4P3DB 1TYEB 3V4VA 3K0WA 3CVHL 4Y4HD 2W88A 2CGRH 4PS8A 5GSRA 1ZEAL 1PU0A 4U2YA 2Z8SA 5J6SA 4Y7MA 3V6OC 5JDSB 1NDGA 2AMGA 1OGAA 2GITA 5D7JA 5EOCH 4KKBC 2YD3A 5IFJB 4UAOB 4APQB 1QA9B 4XC1H 1T0MB 2ATPA 4ORGA 1S7RA 2EIEA 1QRNA 3MA7B 4NN6B 5C0AB 1FSKB 4HV8A 3TN0C 2NRDA 5JXED 2GTWA 5AVUB 3V0VB 5BXFA 1F56A 4JFQA 3O4OB 4F7EA 4WWKB 4MHHI 1QFUL 4GBXA 4K5OA 4KRPB 4LCWA 3MV01 3U6RB 3QRFM 1NGXA 4LESA 2ETWA 4FJYA 3MRDB 1E6JH 2BWQA 2D4FA 3QI9A 4PJCE 4G8GA 1NCDH 4FNPA 4HAKA 4IBZA 1QBLH 1RZIA 3O81A 5E8EA 5DEGB 3DOSA 3FN9A 4KOCA 3K72B 3QIWB 3F7YB 3HN5A 3EDKA 4OT1H 3TBYB 4WLCA 4NXSA 4TVSa 4A6YA 1OT4A 2GEEA 2E56A 3BVVA 5DR5L 1BG1A 4AV0A 2R8SL 2V2TB 5GJTL 5H4ZA 3OZLA 2IANE 3UDWC 2WIIB 4GQ9H 1LDPL 2G2RA 5D7IA 5D55A 3SGJC 2Z64C 1ZTXL 3SD2A 1FIEA 5B39A 2WAHA 4PB0L 4X8CA 1OEZW 4UTBA 4LLUA 2DW5A 3TOPA 3LRSA 4FERA 4WI7A 2KPWA 3TTSA 3CX2A 3EFOA 5D1QA 3OKMB 1SUJA 4LSUL 1T0NB 4WU5B 3TBSB 3ARDD 2NUTA 5FYLH 2Y7OA 3QQ3B 1HXMA 4M02A 3UTQA 2H4EA 2C7UA 4NFCA 3SCMC 5AOIA 1E9OB 1MN4A 2BVPB 2CDFB 5AG9A 5IBUG 1DQQA 2H41A 2PTVA 4XO4A 2ICWI 2AHIA 3IJ7A 4HUUB 3NFNB 2GTQA 1S7TB 3KWUA 3EOAA 1TQWA 3OJDB 5ITBH 1EXGA 1FI8C 2NUTB 3X13B 4KKQA 1NGYA 2JXMA 3IETB 3V9CA 3UC2A 2MWCA 1N6QL 5F9WB 4NC1C 4O02B 5FIEA 2BX5A 2YFNA 3BKML 4LLUB 2E7CA 3QWOA 4K73A 1UXWA 1O75A 3H7BA 12E8H 5E99L 1IJ9A 1KYOJ 1TQCC 4XMWA 3GRWH 3BUBA 2I69A 5DZPA 2V4LA 4EQ3A 4MAZA 5KSVB 1MW2A 3B9DA 4U1JA 5K5YA 1FZMB 2YA0A 4PGBA 1OQOA 3R7RA 4DP7X 4JBSA 5FGCE 1NZRA 3MUJA 1I7ZA 3QJSB 5T5NG 1E5UI 1SMAA 1HCZA 2EXYD 3L4XA 2IAMB 3QEGL 4FNSA 3GGWA 1CBVL 1D5MB 3RY5A 5DEGA 2QFPA 1ZWIB 1Z32X 2LQRA 4OGAC 1Y18B 4MXQD 4ZUVB 2D03L 3X1FA 5KYWB 2D4DA 1Z9PA 3RU8L 1F2XK 1VSCA 2VMFA 2QKIA 1OAJA 2GK2A 4RSVA 5DVOA 4BH8A 2DMGA 3L3JB 1Z9LA 5H35A 1WH0A 4G8FB 3QRLA 4F7EB 5TQ0H 1KJ2H 1NDTA