2ZONA

Crystal structure of electron transfer complex of nitrite reductase with cytochrome c
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dissimilatory copper-containing nitrite reductase
publication title Structural basis of inter-protein electron transfer for nitrite reduction in denitrification
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
total genus 92
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zonA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zonA02
3MX0B 5AKRA 1NICA 4KNTA 5B1JA 2EILB 3PPSA 8PAZA 5B1KA 3QJQB 2UX6A 2PPDA 1NIAA 2HX8A 3AY2A 1KBWA 1CC3A 3S3BB 3WG7B 2FWLB 1L9SA 1X9RA 1N68A 3HEIB 2VN3A 1RKRA 1WA2X 2YAOA 1L9QA 5B7EA 1SHWA 4YL4A 4BXSV 1ET8A 2H3XC 3TBCA 3TBBA 2IDQA 1CYXA 1NWOA 4PCYA 5TK4A 4BDVB 3CDZB 1OOWA 2HZHA 2YAFA 2R7EB 3EF4A 3PLYA 3S3CB 3IN2A 2J55A 2VMJA 2BHFA 1M9WA 1ET5A 2J57A 3OM3B 3CDZA 5F7AA 1IBYA 4HCIA 4GXFA 1JZHA 2XV2A 1AOZA 1X9UA 1TEGA 1GYCA 2Y69B 3PAUA 1QHQA 1OE1A 2AANA 3FYEB 2W88A 5EHFA 4A2HA 2WO3B 1JOIA 1L9OA 5I28A 4YSDA 2DYSB 1BXUA 1WS8A 2GIMA 1NIBA 2BZ7A 5A7EA 1HFUA 3WKPA 2FT7A 2YARA 1JZGA 1OE2A 2UXGA 1W6WA 2OJ1A 3NJGA 4G7SB 1PF3A 5B1BB 4JKNA 3FSVA 1TEFA 2EIMB 2DWSA 5E9NA 3ZDWA 1JERA 2YXWA 2TSBA 2PCYA 3FPYA 3ERXA 1AZNA 2VM3A 1OF0A 3ASNB 1SF3A 2XXGA 1AG6A 1XMEB 4KOBA 4NB7A 2CCWA 2YAQA 1YLBB 2XXFA 2DY2A 2GSMB 3ABKB 1NDTA 4AX3A 2XLLA 1E5YA 1KBVA 1W8EA 4FAAB 1T5KA 5B1JC 1CUOA 3V9CA 4DP6X 2Y1AA 2IWFA 3WKQA 4BXVA 2HRGA 3OMAB 1R1CA 2MTAA 3NJLA 3T71A 4F2EA 2EINB 1F56A 1DYZA 1VLXA 1PLAA 2FQDA 2HX7A 2OV0A 2W8CA 3AG1B 3OMNB 4G72B 4YSPA 1J5CA 1ZPUA 4YSUA 2FQEA 1W6LA 2DWTA 5I6PA 3QJRB 1ZIBA 3PAVA 1URIA 2UXVA 4G7QB 4E9RA 1V54B 2WSDA 4F2FA 1OCCB 2BWDA 1A3ZA 3T6XA 1ET7A 1IC0A 1JZEA 4YSRA 1J9QA 4G71B 4HHGA 1E5ZA 2QDWA 3TU6A 2I85A 1SFDA 1NWPA 2HXAA 3NSDA 3H56A 3U25A 3S8GB 1GS8A 2BW4A 2AZUA 3FYIB 4BK5C 1SDDA 4N8UA 5IY5B 2H47C 3X1GA 3NJFA 3NP4A 3OQRA 1UATA 4MFHA 4UAHA 2GI0A 3PCYA 4YSEA 2YAHA 2BZCA 1RCYA 3AZUA 2CAKA 1AAJA 4DP0X 5I6NA 2I7OA 3NJIA 3NSYA 4DP5X 2EIKB 4HALA 4A66A 4L0PB 3KW7A 3UABA 1WAEA 2XUWA 1BYPA 3UADA 4DP4X 3NJJA 1A4CA 4ENZA 4DP9X 5D4IA 1SJMA 2IDSA 4DP7X 3CVCA 3TA4D 1AG0A 5D4JA 4HCFA 4N4YB 3CVBA 1JZJA 1OCOB 1MDAA 4GYBA 4GP8B 4FA7B 3G5WA 1KV7A 2HRHA 1E30A 2YAEA 3CVDA 3TASA 3X1NA 1OE3A 2FT6A 1BQKA 4AKOA 2BP8B 4DP2X 1V55B 4YSSA 3X1FA 4BDVA 3FSZA 2R7EA 3SBPA 2BP8A 2J5WA 3NJKA 5PAZA 1PY0A 3DIVA 3NJNA 2BWIA 4ZK8A 1AANA 3FU7B 3GYRA 4M4RB 2IDTA 4AZUA 3FSAA 1AS7A 1HAUA 3FU7A 3QQXA 4F7KA 1JXGA 4P5RA 1AS8A 5I5JA 4X4KA 2PLTA 2UX7A 4YVNA 2UXTA 1L9TA 1ZV2A 5I26A 3X1EA 4DPCX 4DPAX 5TK2A 4BWWA 3QPKA 1AR1B 3EH3B 2VSMB 1KCWA 3D12B 3EH4B 1WS7A 4QLWA 1M57B 1I53A 1GW0A 1AS6A 1GS6X 4E9SA 2A3TA 3MBWB 3ZIYA 1V10A 2Q5BA 3ZBMA 1MG3C 2ZXWB 4AKQA 3FS9A 4BWTA 3NT0A 5I6LA 4TXVB 1ETJA 2GC4C 4KO9A 4GY4A 1ASOA 3FU9A 4HCGA 3IN0A 3T6ZA 3DTUB 3NP3A 2IWKA 3X2QB 1BAWA 1PLBA 2OCCB 3QJVB 4GP5B 3BVDB 1GR7A 1OCZB 2VW4A 3QJSB 1GY2A 1XB6A 1KGYE 2Q9OA 1J9TA 3WIAA 5ANHA 3H4HA 3NSFA 4A67A 1SNRA 3ZX1A 3FQYA 2P80A 2ZWNA 2PP7A 2P80D 3UAEA 1JZFA 1AZCA 1EZLA 2IDUA 3UGEA 1JXFA 2XV3A 3FPXA 2VSKB 2VW7A 4A2EA 6PCYA 4KO5A 1GS7A 4DPBX 2QPEB 2GC7C 3N2JA 4HAKA 1PMYA 4A2GA 2FQGA 4A68A 1DZ0A 1IUZA 2B3IA 2XV0A 3KW8A 3N55A 5AZUA 1XB8A 2CBPA 2JXMA 3T6WA 1PNCA 1OCRB 3X1BA 2XWZA 3OD3A 2VW6A 2JKWA 4KO6A 4E9XA 2AVFA 1L9PA 1PNDA 1A4BA 1FA4A 2WO2B 3UACA 1TU2A 2CALA 5AFAA 2BP0B 3ABLB 4HHWA 1GSKA 1SHXA 2H5UA 4M3HA 3WNIA 5I6KA 3JT2A 4KOCA 2AFNA 3FT0A 1AIZA 3ABGA 2E86A 5F7BA 2BP0A 2TSAA 4NAJA 4DP1X 4AKPA 2X88A 2N0MA 1CYWA 2I7SA 2PPFA 3L45A 4E9WA 4YSAA 4UANA 3ASOB 1J9RA 2HX9A 2XU9A 4YSQA 1A4AA 1MZYA 1AQ8A 2FNWA 2YXVA 1IBZA 1ILSA 3PXLA 1NIFA 5D4HA 2DYRB 2DV6A 3IBOA 4AI7A 2FTAA 4Q89A 2IH9A 3WNJA 1AACA 3PAZA 2PP8A 1KDIA 3SBRA 2RACA 1N70A 1XB3A 1QLEB 1ID2A 2B08A 2UXFA 1E65A 5B3SB 1E67A 1IKOP 2MRYA 4HIPA 2NRDA 1PZAA 3FQ2A 3C75A 1ADWA 1PAZA 2FJSA 2BO0A 2PP9A 2QDVA 4DP8X 1A65A 3IE9A 4A2FA 4WKXA 3NYKA 1MG2C 1PZBA 1JZIA 2CUAA 1ZIAA 2VM4A 2ZOOA 3QJUB 3WI9A 2PPAA 3T9WA 4BWUA 4QKTA 3IEAA 1BQRA 1HAWA 1AZUA 3OMIB 2FQFA 3EHBB 1GY1A 2YAPA 1WA1X 4YSOA 1OV8A 1WA0X 2CJ3A 2QT6A 3HB3B 4P5SA 3S8FB 7PAZA 2PCFA 3ABMB 3BQVA 3AG2B 3GDCA 4KO7A 1RZQA 1KDJA 5B7FA 1KCBA 1JVLA 3AW5A 2J56A 4E9VA 2XYBA 3FSWA 3V9EA 1FFTB 2LLNA 4NERA 4G70B 4HZ1A 4PAZA 4KNSA 1JVOA 2GB2A 2IAAC 1TKWA 2PPCA 2IDFA 1BXVA 4WTQA 4G7RB 1MZZA 3CZUB 2IH8A 4YSCA 5I6OA 4JHUA 5B1AB 4E9TA 1BYOA 2GBAA 3NJMA 3QJTB 1B3IA 1M56B 3RYMA 4E9QA 1JXDA 1ZDSA 9PCYA 2YQBA 4CSPA 2GHZA 3AG3B 5I5IA 2XVBA 1NIDA 3NJHA 1NPNA 3H4FA 1J5DA 3SBQA 5B7MA 3FU8A 2FT8A 3EH5B 1RZPA 5FC9A 1NIEA 5I6MA 1ASQA 2X87A 1QNIA 3GXUB 3AG4B 3JTBA 4KNUA 1FWXA 1ZDQA 1NINA 4GP4B 1NZRA 5I5MA 5PCYA 2QPDB 2BW5A 1BEXA 1SF5A 4YVUA 2PPEA 1EHKB 2XX0A 5LDUA 4CSZA 4YSTA 1SDDB 1BQ5A 1BXAA 4E9YA 1ILUA 2YAMA 3T6VA 1PZCA 1A8ZA 1PCSA 7PCYA 1KYAA 4EF3A 1NPJA 1CURA 1PLCA 3FQ1A 2XX1A 4JHVA 6PAZA 4RH4A 2AZAA 3SQRA 3NSCA 2IWEA 4UF7C 4W9ZA 1SFHA 4K9JA 1AZRA 3CG8A 2EIJB 4W1TA 2JFCA 3S3DB 4A2DA 4Q8BA 3UAAA 1J9SA 2ZONA 1L9RA 2HLEB 3DKHA 1ASPA 1AZBA 1NTDA
chains in the Genus database with same CATH superfamily
5AKRA 4JHAH 4XT1C 1OZUA 3P77B 3QXAB 1KG0A 1QASA 2WVUA 1E8ZA 1PW3A 4BELD 4FNSA 1SEBB 1NJ9B 3WG7B 1XIWB 3O0RL 5E2VH 4JR9H 5F9WC 4CGTA 4XVJH 2ED9A 2X89D 2VZUA 2G2PA 4QR7A 2VMDA 4ZUVB 1KGUA 4XP9L 3TBBA 4CILA 3SCMC 1EEYB 5DYOA 5ESAB 5BW7C 5KYNA 2AJUL 4HIXL 5GGSY 4EBQL 4LASH 4OF7A 5FO2A 3ULAB 4CN4A 4AIEA 2CPUA 3B9VA 1MJJB 2QSCH 1WBYB 4S1DD 1Q1JL 2CKBB 1I8UA 2X1XR 4UM8A 1TZHA 2A4CA 3KEHA 4QY8A 5MP6L 2Y69B 3X17A 1I3VA 2BNRA 3BP4B 1TZGH 4YAQB 2P24B 2ZCZA 3SE9H 4GSXA 2W07A 1FFNA 4PJAF 2BXZA 4F57L 1PKQE 1YMMA 2HFGL 1PSKL 2A0LC 2DM2A 2YEZA 2DQ6A 1QKZL 1GGBH 3RI5F 3TIEA 4JRYB 1ZLEA 4IU3B 4H1LH 4L4JA 4Z7WE 3MRPB 3O4LD 4M9OA 3ZT7A 3MXVH 2N56A 3ZHNA 1IE5A 5I18H 2X42A 3GXFA 5K9OB 2R4RH 3OX8B 1RLWA 1JERA 3MRMA 4NO0A 4M6NL 5DC2A 4FFZA 1OXYA 4N8VB 5E6IB 4HUCA 4E0RA 1XMEB 2G2RA 3I02B 2CKBH 3VO0A 3U6RA 3U83A 1IFHL 5K1NA 3V5HB 5EULV 3C5SB 1HE7A 3DX7B 1KBVA 3L1OH 4XNBA 2YBRA 3GS4A 4GI9A 2HWZL 3EYOA 1HH9B 1MF2L 3EYVA 4N0RA 4M1GH 1UM4H 4QRSB 3T08A 4DQOH 4H2CA 4FLHA 4N2IA 3GSXB 5EUOB 4R7NB 1KCVH 4XVUC 4P3DA 4FTVA 1B4RA 3O41B 4WWKA 5FUCC 1NBVH 5JDSA 4PWGA 4XAWL 3T4AA 4TNFA 2CO6B 1ZVSA 4MCYB 4ODSH 5ETUB 2O1AA 4I2XB 2DI8A 3QORA 4XH2A 5CGYC 4PJ9D 3HC3L 4ZXBD 2Z1PA 3MAWA 4W9KC 3IGUA 1NL0L 4J28A 1P5UC 1J11A 2VXQH 3H9HA 4ELKA 4Y4KA 4YC2B 5I1IL 4IRZH 3D18A 4CDGC 5EF1A 3LRKA 3U25A 1LK2B 3BPCA 5CCKH 2XQYK 3FRPA 3NRFA 1R5WB 3HRZC 5HHNB 1DSYA 2QQLH 4FQIL 3R4RA 1WEJL 4KK9C 1T1XB 1A6TB 5I73C 2FECL 4Q97A 1LP9E 3T5WA 3T0XA 2DWEA 3QR2A 5DJ6B 3I75A 1FZMA 2JJWA 3BCFA 5D7LB 32C2B 5D71L 5DLLA 4WLCA 2KZ1B 2EDWA 3BOVA 3S5LB 1TZIA 5F97E 4M7JH 2LU5A 5H94A 3MNMA 4BUGA 1W72L 1YEJL 3SDCC 1GIGL 4LU5L 4DP4X 4A38A 3NCJL 4PJAA 3EYUL 4PP1D 4GRLA 3DUUB 5F3HA 3SGDI 4HWEL 4WFFD 2EKJA 4RGMC 2WQAA 5CCHE 4V33A 5HYJD 4U0RC 4GEJA 2X53A 3L48A 4PSPA 4YDJA 2KKQA 1DVFD 2AEPH 4YHNA 4WWNA 1D5XB 3O4LE 5D7JB 5G5DB 3ARRA 5LBSA 4FA7B 4ZPVB 3O6FA 2C9SA 3G5WA 5C7XH 1W0VA 5DD6B 1KTLB 1MQKH 2BOBA 3A67H 1KJMA 3HN8A 5DQ9A 4JAMA 3WNPA 4MNGB 4D9QE 2P5PA 3RWDB 2O6PA 3TH4T 1AQKL 1E43A 1OLZA 1MHHA 2UUDH 5FF6A 1LO4H 4HFUH 5JW3H 5CKGA 2HFFA 3VRJB 3I6KB 3IYLW 5DZ9A 3ESNA 2HYMA 1XWVA 1YYMH 1MLCA 1LDPH 4U1MB 1KUMA 4FQLL 3KBPA 1KIPB 4IHBA 5LLIC 3ULVF 4FADA 5E2WL 4U4IA 4XPTH 4LEXH 4Y88A 5H37A 3VXQB 4GPVA 4QWWC 1AS8A 1N67A 1TO5A 2QL1A 4GAFB 2AKRB 3FU6A 2V5RA 3S36H 3TBTB 2VDOB 5EBLA 5A3ID 4OIAA 5JW4Q 1F3DH 2ZCLH 4I9XA 4FP8H 3QPKA 4K71B 2YPVL 5FFGA 4TUOB 4RQQB 2F5AL 4PRHA 4LLUA 1IU1A 1WUZA 4GKSA 1JPGA 3HC2A 3LN5B 4WI0A 2WIIB 1TCRA 4EI6B 2OMBA 3WTWA 1WBZB 3VFPA 4ACPA 1LVEA 4IK7A 1P4IH 1PPIA 4UQEA 1S46A 4K07A 2Y7MA 3ILPA 3L2LA 4JX0A 3GKWL 1DVSA 3DDGA 1IC4L 1YY8B 3APFA 5KS9B 1BAWA 4GP5B 1D3CA 2OX5B 3L2MA 4ZFGL 1ML0A 1X7TA 4TPRH 2IEPA 3K71B 1SHSA 3FHAA 4LBAA 5E99H 4MDJA 2XZAH 1JFQH 2GVYA 1GZQB 5ELIA 5IVXF 2VDOH 2VJXA 4KWUA 1IKNA 4NM4L 1OTSC 1RIVL 2QHLA 2XA8L 4N2NA 5KZCB 2B59B 3BAEH 4MMZB 1R3HA 1FNLA 1JHKL 2VYRE 4LLVA 5E1AA 2DIBA 2DDQH 3MNVA 5DDHB 4YDLB 4MRCA 1GS7A 1KCRL 4NGHH 5ICXB 2XC8A 3IGAA 1DLHB 1C08A 5J0BA 3Q3GA 4WFFE 1DQDL 3A6CL 4I0PA 1GGYA 5F88B 5HYJE 4E68A 4NT6B 3AQDA 5MEPA 1IL1A 3T09A 5DFWH 3RUGE 4PRAB 3TS8A 3SQOL 4W4OA 3VD0A 4CKVX 3IS0X 1YPZF 1MJUL 3P4LA 2JKWA 3U9PL 2HT4C 1NC4B 3BE1L 3IETB 1TJGH 2CBQA 4MJIE 4I1NB 5EU7C 1U58B 5BS0D 3AREB 1Q72L 1TU2A 4ZSOA 1AHMA 1R19A 1FVEA 4POZC 2J8HA 1GSKA 2E47A 4IMKC 4Q0XL 4YEEA 3MOAL 4Z0XA 4HOXA 1IGCL 4HJJL 2F58H 3NPSC 4KOCA 2DWYA 4QTIH 1HKLH 1PKOA 3EGXB 4NAJA 2Z0BA 1NFDB 5FECB 3L3HB 1IAIL 4GO9A 2A9AA 3ELAT 4ISVA 3S4SG 4A6YL 3KWVA 1FG9C 3O3BB 1LJMA 5T3ZD 1SXAA 2PCXA 3FFCA 3HCVB 1PS3A 2N59A 3SYOA 5EZIH 1A4AA 4FFTA 1PU0A 2QVIA 5AENA 4NXSA 1K2DA 3RAJL 4LSSL 5GRJL 5IB2A 5TF1H 3ZMRA 1WZLA 4F9PC 2PP8A 2WJ5A 3FAXA 1DBMH 3E3QC 3LB6C 4M6OH 2F7OA 1ES0B 1EZSA 1ZT7B 2RA1A 3HI5H 4GEIA 1S9YA 5T5FH 3JUZA 1CI3M 2CHNA 5L4IA 5D7HA 2NY4C 2MRYA 1IKOP 3X12A 1WG3A 3P3SA 1I1FB 1NEZA 1V3JA 3UTTD 2WQSA 1DSFH 5CEYA 2IQAB 4HUXB 1TR7A 3IT8D 4UM8B 1TZHB 5E0FA 4M4RA 5EOCJ 1HHIB 1MN4A 2NY7H 3FK3A 3U9UA 1KXHA 5LWYH 3ATEA 2ALWA 2WXQA 5L2KD 4FA6A 1EFXB 3Q8FA 2W07B 2XWBA 1FFNB 4YBQD 4KPHH 5GRUL 3P30H 5IVXA 1E7VA 4O58L 3INOA 3RPKA 3RKDD 2FEEI 3EFFA 4G5AA 3SZ6A 1JGVH 3TIEB 4PBWD 15C8H 2R0LH 2RIKA 3C6LA 5D1XC 2XIIA 1X9LA 3KNBB 3PJSB 2BNQA 3HIZA 2J56A 3HBGA 4AV4A 1JD7A 1FO0B 4BFNA 1DBKL 1PEWA 3DHUA 2ADYA 2W0KA 4YXLL 2I07A 2VR5A 4KNSA 1V05A 4E0RB 1WLHA 1FI8C 2IAAC 1P7QD 3QUZA 3U6RB 2PPCA 3H7LA 2B1AH 4PVMA 1SJEA 1YPZA 1INQB 2G3MA 3TEWA 2COQA 3C87A 3LPGA 4QRFA 5EN2B 2IH8A 5ECJE 2BSEA 2C3HA 3HZKA 5F7KC 3VXME 5BS0E 1V8HA 3EYOB 3QJTB 4XP1H 5DD0L 5L9DH 3EYVB 3QUXA 4JPIB 1JXDA 1L7IL 2BPBA 3WS3B 4RAUA 3R18A 5FV2A 2YQBA 1RZKH 1UA6H 5F1SA 4EEEA 4FTVB 3SDXE 5JDSB 2XVBA 3QO1A 4YDIH 4EQ3A 3S5YA 4CL7A 3T4AB 5BQ7A 4QHKJ 1NPNA 4GI8A 5EC1A 1QYGH 3WMQA 2IGTA 2WQ8A 2W59A 3L3GB 2DI9A 5KJRH 4Y7OC 5T3ZE 5L88H 1FO0H 5MI0C 3QORB 2ZOUA 4RGNC 5A1AA 4XH2B 3MV11 3M8OL 1YQVL 4ZX5A 3TP4A 4JG1H 2HN7A 3UPCA 5I5MA 3AGWA 3HHMA 4JE4B 4AT6B 5E6ZA 3UTZA 2G5UA 1N7ML 5LDUA 3PQYD 4KHTH 3U7AA 2DICA 2FATH 3BPCB 3K8KA 3FRPB 4OD1H 3HE7D 3SY0A 1WZMA 2ZCKL 1IGIH 5JDJA 5DTFB 3DTXA 1AO7B 1IEBB 3JZYA 5CJ5A 2XX1A 2VQTA 2OYLA 2X4RA 4PY8I 4RH4A 1NUFA 3I75B 3GMNA 3OF6A 5LN8A 3BPNB 4Z7QF 2OMZB 3V0EA 2G5BA 4RETB 4W1TA 2GQHA 3UROR 1TZIB 4EXPX 1CDBA 2JKTM 2KLRA 5H94B 2DN7A 1CDGA 1T3FB 4GRMA 1NUGA 2HLEB 4XCEB 4UDUB 3DUSA 2DMGA 1B0WA 2NSMA 4X6EB 4GRLB 5F3HB 2YBGA 4K3EH 1JYXA 2AK1L 2H8PB 3FF7A 1SQ2N 5GZNC 5M95B 2ITCA 3BP6A 4ZFFB 2GSGA 2VERN 4Z3JA 1LM8V 4S2SA 1DJGA 4X4ZA 4YDJB 4DW2L 5MEND 2DLTA 2Z6FA 4NYLA 3VDBA 3C5ZC 3P11H 3GMMB 3EYSH 4ZUTA 1G4MA 5B7EA 4PJGF 5F0MB 3NQIA 2R29A 1W0VB 2PYFA 1IZJA 3MHZA 4ONGL 1U8JA 1VEMA 4P3CL 2I9TA 1DUZA 2BOBB 5DD1L 2GITA 5DQ9B 4JAMB 4NN6C 2OW7A 4RAVB 1HN1A 1LHZA 2AJVL 2XOTA 2YPLA 5TQ2H 3ELQA 3FOLB 1MHHB 3IVKB 2J55A 3ISWA 4U1NA 1ZLUK 2ZF9A 2ZXAA 4MLSA 2WJ7A 3BFOA 2HFFB 3BAIA 4OM0H 4LNVA 1RXLA 3CDZA 5F7AA 1QNZL 2X7LB 5HDRA 5T3XD 3LIZH 2E74C 1AOZA 3MSPA 1PJWA 4PV1C 5FGRA 1A6ZB 2VO8A 3SDYL 4ZW5A 5IVNA 1DN0B 1JS4A 2WO3B 3HE6C 3QEHA 4H8QA 4TVPD 3TA3D 3HBZA 1N6VA 2CHWA 5K9QG 1R3KA 1XGRA 4FRWA 1BXUA 1WS8A 4NRXB 3BXNA 4XMKH 4ANWA 4N2EA 3BZEA 5LBSH 3VAEA 2UXGA 1U95A 4OLZH 4Z7UB 2LHAA 1VPOH 2WSKA 2J4WL 2O72A 3UDWC 3OGCA 1WZ1L 3HS0A 4LLUB 1FG2A 3KVDD 3NCYS 3P3RA 2O6CA 3GSQA 3FPYA 1SVZA 3KPSA 1FHGA 3DX9B 3L3KB 1OWWA 1TCRB 2PYEB 3S4SA 1F3JA 2WKOF 3HNSL 4QOKB 3VFPB 2YAQA 2DJ4A 5I8KH 1A1MA 1P7KA 2C4FT 2WP3T 3ILPB 3RWGA 1WZKA 4IOSD 2XWCA 3O6LL 2BSSA 3DX6A 2Y1AA 2IWFA 4RFNB 4BXVA 2ZUXA 3WNMA 2MTAA 4JQIH 2DKUA 2OI9C 1RU9H 1F56A 3SCMA 2HX7A 3ARTA 4EJ1C 5C3IA 3CK0L 4MDJB 3SPVA 4BH7B 5T5NG 1O6SA 1ETZA 1G7HA 4IS6A 4XCFH 1JDCA 5EA0L 4JBSA 3AG1B 5C3LD 1GW6A 3KS0H 4UQ2B 5KVFL 1J10A 2G2NA 2EDFA 5GPRA 1TO4A 4BSVB 5BUAA 4EZMA 3W9EA 4L3ED 5JA8B 2X70B 1RULL 3K2UH 4LLVB 1H5BB 2EC8A 1A6VH 4WNJA 4MJ2A 1C5BH 4M02A 2E75C 4IBSA 1SY6A 3MNWA 4FFYL 1BF2A 1C08B 3JVGC 3FOMB 4RDQG 3PFUA 2C5DC 4YHMH 4I0PB 4CN1A 2EVGA 3O2DL 4GRWF 5C07D 4XN2A 5MENE 1E90A 5T1LA 5MEPB 3TBWA 4KDVA 1FFPA 2FLMA 3TFKC 2P5WB 3S88L 1SDDA 4N8UA 1HINH 2P8MB 4PJGA 4LNRA 2GAZB 4H5SB 2MSPA 1X5AA 5LNGA 4JL1A 3WY4A 4QJ5B 2NOYA 1FVEB 2VNCA 3WJJA 4EBQH 4L0YA 1IBDA 5L6YH 1UXSA 1EA9C 2EADA 4NRZA 1A22B 3U0WH 2BIOA 4OCLC 5T3XE 2WGXA 3LZNA 4GI6A 5HI5C 5G2NA 1Q1JH 1SJXA 1AI1H 3CN4A 3RIAK 4U1JB 2OW6A 4WGVB 2R59A 2MPAL 1P84K 3EH2A 5E5LA 1R3IH 2V6HA 4LEOA 4QGTA 4ENZA 3RX8A 1S5HA 1G0XA 4X4MA 5MHSD 4P9HH 2IDSA 1AKPA 2BH0A 2F7IA 4HMEA 4FQ2H 2Q8AL 1JGEA 4PJ7F 4KMTH 4U1KB 1SZNA 2A9BA 4IU2A 1ZMYA 1NBZB 2W9EL 4DK6A 2PR4L 5KG9A 2G9HA 2DTSA 3DURB 4LKXB 2JE8A 4XZUA 4P59L 3O6ML 1MJ8L 3RWHB 3GINA 3X1NA 4YWGH 1KGXA 1ZLSH 4JO4L 1Y18A 1V3LA 3ZKND 4R3SB 1CDHA 5I17B 1AH1A 5MERA 3DOHA 4F58H 2WKOA 1IM3D 1NEZB 1UCBH 3ALXA 3GB7A 3DJ9A 3I6GA 3PV7A 4NQED 4QNPF 5GZOA 3V6BR 2JJTC 5GGTL 3EGSA 3K74B 1IFHH 2OS7A 3O8XB 4GMSL 4AEHL 4M4RB 3LKPB 5FGBC 2HP4A 4X9IA 1C16B 5FS5A 1EVTC 1MCEA 3ULVH 3OQ3B 4D2NA 4RDBA 5JMRA 2FBRA 2HWZH 2N0KA 3DSFH 3FU7A 3B3BA 2AV7B 5EBMA 2K0RA 1Q4NX 2XWBB 4RWHA 3PP4H 4YHZH 3ZE0E 1BJ8A 4BQ6A 5IVXB 2B4CH 2J21A 4PYHA 3N1PC 1Z9MA 3QDGE 3EFFB 4E41B 3OKNA 5D5MF 4L3EE 3K6IA 2YQGA 4G6AC 1YHPA 3UTSB 1WISA 3SDCA 4YHLL 3EH4B 5A6IA 5T5NF 1NCOA 4Y2DC 3QIBD 4UT7H 1AR1D 3SYCA 5AEAA 4HF5H 1NL0H 1GS6X 1MIEL 4G8IA 5C07E 4HPOL 5FAAA 3DBXB 1NGXA 2I07B 1QTSA 2NZ9D 1TOXA 1WRFA 3MBEA 3WMPA 5JXAH 4KVNH 1RSFA 3QUZB 1LEIA 2XPGA 1JZ2A 2QQNL 4RGOL 3RPIA 1T1ZA 4FQIH 3QJVB 4M6MH 1WEJH 4WK0B 3X2QB 1HOEA 1E50A 4XXCA 4Q9CA 3QUXB 9CGTA 4JFEB 4L2YA 4OT1L 3GSRA 2R69L 4EVNB 4RAUB 2R9HC 2HB0A 2OZ4A 2AAVA 5A2LH 4JO8A 3MGTA 5J11C 1H8SA 3FT9A 1EZLA 5DJDB 2NUTA 4F1ZA 3RWCA 5KN5B 5JXED 4OZHF 1I8LC 4X9GA 4OGZA 5F7DB 2AK4A 1YEJH 2VJ0A 4GH7B 5MHSE 2OYMA 2H6OA 2HFEB 4J27A 3DO7A 5FW8A 3UTPD 1JUFB 3TN0D 3EYUH 3GO1H 4FQXC 2HN7B 4NFBA 2QFRA 4PJ7A 3C60C 4A68A 1XR9A 3MOBH 4L1SA 3TYGH 5F0JB 3MLRH 4P2OA 1RUPL 3HHRB 5KJ4A 4KV5F 1XB8A 1UB5A 1UGKA 3UTZB 3WOVA 1Z5LA 3H9SE 3ZDYF 1CDUA 3OD3A 2GG1A 2R2BB 4OZIE 4TTDC 1CR9L 1UQSB 4F7CA 4OM1H 5SWSB 3IJEA 1EIBA 3GMPA 3N9GL 4H8VA 1TT6A 5DI8A 4BUQA 1J5HA 5J1AA 3IDGA 3IDUA 2R8SH 4KROB 2AFNA 3IMUA 2XWXA 2VLJD 4MQ7A 5JO5A 5JYMA 3TBVA 5D7SL 2I7SA 2OMNA 4DGVL 1OTUC 3FN9A 4XZ4A 5C0JA 3W5MA 4FQLH 1CLOH 3CQQA 4G1EA 4PYGA 2XU9A 3IMVA 2MOGA 2P9RA 3DVIA 4IQHA 4WI3A 5E2WH 2Y5QA 3G6JF 3TO4C 3OTTA 1FZKA 1WSST 4NAQA 5D5MA 2XVKA 3RY6C 2FTAA 4S2SB 5EU6D 2ZWKA 4MKMA 4XXWC 3QNXB 5AOKA 3T3PF 1WO2A 3SKOA 4NYLB 4NQTA 5C0DA 1X5IA 2ERJC 2LTQC 1G5AA 4ZUTB 2F5AH 4MD4A 1AOHA 2HFTA 2PWHA 3GSUA 1U8JB 4I5BA 3MRKA 2AQRA 3T3ME 3FQ2A 4OTXL 4LF3A 3IDMA 1U2CA 4C57C 3VFSA 4JHBA 1N0XL 2E27L 3FU0A 5IMLA 2ODIA 1AQDB 1VADA 1AD9B 4M48L 2JKJA 1LK3L 2AMUA 3IDYB 2AQPA 3M07A 2E7BA 4H8WC 5JHMA 3TESA 1ZLVH 4UOZA 3MR9B 4KX7A 3QEHB 2W38A 3T9WA 4PJEB 5B22A 3IJHA 2Q7AA 5J9PA 4JG9A 4IMKA 1GY1A 1ZS8A 5LXGL 3BXNB 2EDKA 1SYSA 3Q0HA 5BOPA 1JPFB 3DVGA 1A0QL 1UFUA 3II3A 1RIVH 2XA8H 3Q2WA 4ONHB 4AWJC 1BWMA 3ABMB 1U92A 3DIDA 4AGMA 1AC0A 3ILQC 4GW1B 1COBA 2A83B 2UV3A 3ARXA 3L95B 3NAAH 4OZHA 4UWQB 2R29H 4WEUD 1EBPA 3VFTB 4GFXA 1JVLA 2AXWA 3OR7A 2ZP9A 4NKMA 1FG2B 2E5EA 2PWFA 3WFCH 3GSQB 5EOCL 2Z35B 1FFTB 2OQJB 4G70B 4HHAB 4FXLA 3E6HB 3ZO0A 1GKEA 2Y6SC 3GBNL 2EIBA 3AS3A 4MRBA 4EN3C 1F3JB 4NQSB 5BRZA 4BK8A 1RZGA 1YAZA 3MACL 1P7KB 1TETH 2CJUL 4PRID 2WANA 3JVFC 3SQOH 4WTQA 5F9WB 4F9PA 1I1RA 1DQMH 1W16A 5IGXH 1HNFA 3QS2A 2OA9A 1VZGA 3OL2A 4YDKH 2ZKWA 4J2QA 1VRSA 3JWDL 3SCMB 3DROA 4ZTEA 2ZWSA 4IBVA 3PWPD 3QRFM 3TZVD 3V7MA 1IGCH 1G7HB 2VLJE 1OP3H 1S7RA 3ARBD 3GLDA 2GEEA 1UWXK 1QBMH 3W9EB 1UOVA 4FQHB 2O26U 1XSJA 2GJ6D 2UZIH 3DTDA 2GBTA 3OKYA 4HG4J 1ZEAL 3B43A 2X4NB 1MCCA 4W9FC 3IJ9A 5C86A 3G6JA 1BEXA 5D9SB 4HUVA 3QHTC 4JE0A 3A4AA 4ETYA 3FUDA 5GRJH 5EU6E 5JW4M 2FK9A 4YHKL 4LPUA 1SDDB 4QXUH 3GT6A 3S3JA 4P99A 1F41A 1PCSA 3ARZA 4PJGB 5TDNB 3CQPA 4XCCL 4A63A 2WLLA 5GGVY 4QXWA 1KWKA 2AZAA 4BZ2A 4X42A 4JFVA 4KQ4L 1UXSB 4UF7C 2OMVA 1FORL 5D70H 3LKRA 2RFXA 4FA8A 1TSHA 4BQCA 1IKFL 2HTLC 4RFEB 4WUUA 1WAAE 1BG1A 3R06B 1YYLL 2H2PD 1G7PA 1O6TA 4FNPA 4CKQA 1SY6H 4H44C 4LEOB 1FNEA 2H2SD 3ARDC 4XNDA 3B2VL 4QRTA 1EEZB 3FTXA 5BRQA 1I75A 2W65A 2NNXA 2UZPA 5D93B 2H9GB 3VFVA 5GRUH 3TPKA 2GY5A 2GK0A 1MUJA 3MX0A 1U2HA 2HX8A 1CD1A 4LE8A 2NXZD 1JWSA 3GDBA 1MFUA 2IXQA 4APXB 5LKNA 1QFUH 3ZRCC 4F5CA 4WEBH 3VWKC 3QCVL 4PJ6A 4F37K 5KG9B 4WTWA 3O9WA 1GYWA 2G9HB 1INDL 1S7UB 4ZFZA 4XGZB 4G6JL 2YIHA 3D39D 4RMVA 1U4EA 1Q9LB 3BAWA 1MXDA 1NGZA 1P9MA 1P0SE 5AAMC 4UM9B 3VTTA 3FQ4A 2F61A 1P5UB 4ZNEE 3PLYA 1BYNA 1GCFA 4J4PC 5MERB 4Y9FA 5EIQA 4JFDB 5KVDL 3I6GB 3GB7B 1DEEA 2VMJA 4LSTL 4PRIE 4AW7A 5TTRA 2J57A 1KJ3L 2DKSA 4HCIA 2AQ1A 1LDSA 2JV6A 4OUUA 3Q8CA 4O2CA 1GYCA 2MCAA 4R26L 3LH2L 4FG2A 2PW2B 1P1VA 2E76C 2UWEF 2WCGA 5I73B 4P5KA 1S78D 1RP9A 3PWPE 4HULB 2X0VA 2ILLA 3B9KD 2ENJA 2BZ7A 4PQXA 1Z9NA 5AW8B 2KLTA 5GGUA 3FZUC 1HHHB 3MV9A 1QA9A 5JQIB 1KGWA 2GJ6E 1RY7B 3EOYG 4UNUA 4Q9QH 5CR8A 3V0GA 1EO7A 3SDCB 1TMCB 1MLBB 5IFAL 4G42A 5LGYA 2J8UE 1TFPA 2UY7A 4QTFA 3DIFA 4NLHA 4OF3A 4GRWB 4RGMB 2CCWA 3UYOD 2LW3A 4U0RB 2OJZL 2ADJA 5IROD 5CBAB 3QULB 3T04D 4P9MH 5CSBA 1LEIB 2XPGB 3C5ZA 1HSBA 1ZLDA 5KYXB 5I0ZA 3VFWB 3RPIB 1FF5A 2M26A 2FRGP 3CVHL 3WGVB 5C92A 3VGHA 1BV8A 1P6WA 4QXGL 5GRVL 1HVXA 4PRPA 3MBXL 1DDHA 2H0PA 4JPWH 5AB0A 1UXWB 4W9GC 5LN4A 2GJRA 2IH1A 4ONFL 1XBDA 5G4MA 2VXTH 3MGTB 4LGRB 4OQ1A 1J8HD 1VA9A 3PAVA 1AGFA 4FKHA 4E9RA 4S1DC 5F96L 3DO7B 3EOBB 5CGBA 4GRWH 1ET7A 4M56A 4PJ7B 3CBKB 1E5ZA 4X50A 2QDWA 1PZDA 4I4WB 3VXSA 5IT2H 1NWPA 4JQXC 3NFPA 4F3FB 1CLCA 5IP4A 1SJHA 3X1GA 3IMTA 4J3XA 4M43H 3NP4A 2MKLC 3D39E 3NCMA 3K6OA 4ODVL 2IOOA 5HDBF 1F8TL 2FWUA 4Z7AA 3P2DA 2GJJA 3QEQD 3TEZA 2OZ4H 3IDGB 2AJVH 2AHIA 3D69A 4AMWA 3K8LA 3DRTB 3L5WB 4MQ7B 5JO5B 4MJJA 3WTSA 3TBVB 1XBRA 2BMKA 1T0PB 3RWJA 1RURH 4Q56A 2BVYA 3N1QC 2CLVB 5C0JB 3FB5B 2C3VB 1VIWA 4KZDH 2UWEA 3MV8A 1Q0EA 4TMPA 2IG2L 3D3VE 4G1EB 1QW8A 2J88H 4LVEA 5T1MB 1X5GA 4YR6A 1FC1A 1FZKB 4IBLT 2BVOA 4ZNCD 5JOPD 5GS1A 2AJSL 2AJXL 5D5MB 4AH2A 1JXJA 4RISL 1UA7A 1G7IB 3OHXC 3T2QA 3KXFB 5F70A 6FABL 5FDYA 2ZTBA 5FKPA 4IRJD 5KSBF 1U0QA 3JXAA 2YAEA 2BNUA 4MXVF 3DJZA 3ULSB 4GAGL 3TWCL 4I5BB 1B4LA 3JVGA 1F00I 4JKMA 3DX3A 4LF3B 3GWJA 4DO6A 5HHQA 1S2EA 1NOLA 4PJ9C 3VFSB 3HMXH 3MLTA 5HGAB 5PAZA 1EAOA 5I1DB 1ZRUA 8FABB 1AANA 1FYTE 4ZS6D 3BP7B 3R0MA 1OD9A 2NY2D 5E7BA 5E6RB 4AJ0A 3BKMH 5EZOL 5LG6A 1QRKA 1DJZA 1G7JA 2H1LM 3IJHB 5J9PB 1ZY9A 1ZS8B 3CK0H 1G4RA 1GPOL 3OC8A 4L5FE 3NPSB 4B9JA 2NZIA 3H8NA 5KVFH 1J8HE 3SGDH 5E5MA 2VSCA 5TFSL 4GG8A 2CO1A 2QVFB 3V9FA 1U92B 3NK4A 1T1YA 3US9A 3LN4A 5AG9A 1N8ZB 3OR7B 2MCPH 1XQ4A 3IDIB 3EFOA 1MRDL 4MAYA 4AITA 1GW0A 1SXNA 2V7HB 4IGBD 2A3TA 2F68X 3ECBA 4G43A 1X7QB 4WHTB 4Y4FD 1ULVA 2V2WB 1B88A 1WJ3A 4NKOA 3ZDYB 4PP1C 5ECGA 3RZCD 2Z92B 4WW1A 3SQBA 3QVAA 4OLVL 3FBQA 1U8PA 2YEQA 4N85A 2OCCB 2DWXA 1LO3L 4EIZC 3DVFA 4GQRA 3UBXG 3QEQE 1DVFC 1GY2A 1D7BA 3EYFB 4FI6A 2NY4B 3B3IB 3DROB 4C56A 4N6QA 3VCLB 2A6IA 2FWOA 2GT9A 2RTTA 3V4PA 3NIFB 2JLPA 3ALPA 5DFTA 2XV3A 1A21A 2D31A 1F90H 6PCYA 2FUQA 2MPAH 4S0TD 3C8KB 5IHHA 3PNRB 3WSQH 1SOSA 1QRNA 4S1RL 3SIKA 1CICD 1BGXH 1SDYA 1TPXC 2QVKA 3G6JB 3GLEA 5HJBA 2Q8AH 2BY1A 5JOPE 3PF2A 3N55A 4IKIA 1D5BB 3V6ZA 3WLWD 5J6GB 2VDNL 5DRWA 4MB1A 1UEYA 3BSZA 5E9DD 3NCCB 3PY9A 4ZFOL 4AE0A 2K1MA 3BIKA 3RU8H 5D1XB 4MNQD 5EO1A 3O6MH 2JKRM 1WICA 4MQXC 2WLLB 1JGDA 5A3IC 1E3FA 1HZHH 3QDMD 2V9UA 3CHSA 4O00A 1NC2D 3PHOA 5CZVL 1F86A 3QW9A 4N5UA 1GHFL 3Q5YA 1EANA 3C08H 4DP1X 4NQDD 2RFXB 3QZPA 2ROYA 4Y16A 3U2IA 4M7LL 1EJOH 2XQBH 5E8NA 2QR0A 4J3OG 3TEXA 2A6KB 1FIGH 5CN1A 4CC0A 1MWOA 3T8VA 4HUUB 1E4KA 4XVTH 1QFWH 3NCWA 1D6VL 3MLXH 4TNWF 2XI9A 4ANKA 1AFVL 2B3RA 1CD1B 5C08D 3ZE1B 1A3RL 3OXRB 2WBJA 1T83C 4BHUI 1E9QB 3O9WB 3QZWA 4QD2E 1YMHA 3FJTA 3KYOB 1L0QA 4U1HB 3U4KA 5MI0B 4LRNL 2OM5A 4RGNB 1CMOA 2WZPD 1E65A 4BZ2H 1CE1H 4JHWH 4B5EA 1YUKB 4FQXA 4HIPA 3FTGA 1PZAA 4GW5B 3F58L 4HPOH 1K8IA 2LU3A 4YFLI 4PMEA 2WWKO 4XNUH 3I50H 3T2LA 2ZX9A 4DUVA 5C2BH 1RPUA 5E00A 4Z3IA 4NNXA 3L3JA 4LOFA 3EOAA 4OUUB 1VCAA 4O2CB 1RH8A 4YH6A 2IBGA 4AIXA 4KK6D 4KITB 1UEMA 1GCYA 5C0CA 1HAWA 1CFVH 1EGJA 1YEKL 1MVUA 4XMLH 3QWRD 4PRNB 3GKZA 2FHBA 5JPNC 1RZQA 2ITDA 1KB5L 4QRRA 4MJHA 4LVNC 4DERA 4E9VA 1DP0A 2RR3A 2VR7A 3V9EA 1N6QL 1A64A 1QFWM 3EJZD 4FMVA 5FO8B 1XCXA 3NACL 1I1YB 2YQ3A 3SSGA 5CEZH 1I85A 2EH7L 1VESA 5D96C 5J6SA 2DQFA 5E9DE 1YC7A 2IDFA 3BW9A 5G4NA 3EZ8A 3FO0H 4XXWA 4L3AA 5E2TL 5MEQA 4NX0A 1MZZA 2DTMH 3LSOA 4MNQE 2ETWA 3C5ZB 5A7BA 1URZA 1AGCB 4LCCA 5B1AB 3HNVL 4O9HH 3FC8A 3FHEA 3QDME 3SOBH 3D08A 2YRLA 4FN0A 3N9GH 5DC4B 4X7FC 1HSAA 1ZTXH 5LO7A 1DDHB 5INCB 4CSPA 5F3BA 3AG3B 3DXAD 2F1BA 4NQDE 4OBRA 5SWZB 2IH1B 2WTPA 1D2PA 2PW1B 4GBXD 3FU8A 4OAWB 5D7SH 4I3GA 2VERA 5C70A 3EW3B 4BBWA 1T4WA 2QV4A 3L7FB 1QNIA 4MZIA 5JA9A 2C1OB 4XN7A 5F7LB 1TEYA 3GMLA 3JV6A 3MRGB 5CJBA 5A6MA 3DMMC 1M2VA 3HE6B 2A77L 5PCYA 1RJLA 1ETA1 2X28A 1BBDH 5C08E 3SO3C 5DRXB 1UZ6F 3W57A 3DGDA 4J3OF 4JZJA 4PM1A 4CNIA 4DAGH 5L0QC 2F7RA 4HS3B 2ZYSA 1WFIA 3LZQA 3NFPB 1BXAA 4YBQC 4ZDHA 2A7BA 1SJHB 1PZCA 3REWB 4H2AA 2R1XA 2JIXD 4P06A 4TQEL 2ADIA 2HUHA 1LE5A 1HOCA 1UVQA 3U7YL 4FDWA 3II2A 4GAJH 4R7XA 4JCMA 4P46D 3VXPB 3LZOA 5IG7A 2IH3A 4EN3A 1DVYA 3CFIC 1UC6A 1BP3B 2CR3A 2E27H 1NUDA 3CDYA 5A2BA 3O11A 4YHIA 3RWJB 1QSZA 2L7QA 2WV3A 3H0TA 1LK3H 3UAFA 1ZANL 4Q52A 3IAPA 1E9PB 3MV8B 1LL1A 2A9NL 4TLUA 3N41F 3ZDXF 1KPUB 2OSLB 1E27B 1YQ2A 4NNYA 2OI9B 3LYRA 4KNTA 1YRKA 5AQ0A 2HKHL 4Z7NE 4WSGA 1CXIA 1DJHA 4L8DA 8PAZA 4JFYA 5FLUA 2Y23A 1OB1A 4YR6B 1LEKA 1IAOA 1GL4B 3ARWA 2BVOB 1MI5B 3UBXA 3QUGA 3QRGL 3OKMA 4G3YL 4M7LT 3QQDB 2CE6A 5C09A 2BHZA 5KWYC 4RRPM 2OSYA 2BNUB 3PU7A 1K3IA 1G9MC 3VNZA 4N0YH 5JHLA 2YD5A 2H32B 4CGUB 3WY3A 4QYAA 3OSKA 1G1CA 5ERWB 2Q2EB 1HZLA 2C9PA 5ACZA 2VSDA 1M9WA 4IOIB 3MLTB 1RZIA 2CJUH 1NDGB 5FM4A 3FQXA 3N6YA 2A9CA 2Q10A 3M1CA 2BVPA 2YZ1A 2AANA 4FZ8H 1WGVA 2Z7ZA 1AY1H 1DCEA 1KBGH 4I85A 3DGGB 1E3XA 3DSNA 1G7JB 4FLOA 4DESA 5IQ7L 3DXAE 3HE7C 4MD5B 3VG0L 1UD8A 1YNTB 4JZOA 4ATTA 2FT7A 1CFNA 2OJ1A 2BCMA 3NJGA 2IANB 1IZKA 3KWUA 4B9CA 1T1YB 3LN4B 3EJYD 4PWFA 5EU5B 1L9NA 4DHLA 2DWSA 2VE6B 4JDTH 4CAGA 1JP5A 1YNLL 2DLIA 2YXWA 3BYYA 2H32H 5I1GL 1KYOK 4OLWL 2VRKA 1IJ9A 1KXQE 4MA7L 2NW3B 4KOBA 4YFEA 4NB7A 5HHOE 4H25A 5I19L 1F02I 3MRCA 1G6RB 2X44D 4HGWA 4NKOB 4WEEA 1TQWA 3VI3E 2BDNL 1TIUA 2FBJH 1KB9J 3RIFF 5T1KA 3TBSB 3GTVA 1U8PB 4YDNA 1JL8A 1T7YA 4PHZA 3GM8A 4OJCA 3Q13A 5HBBA 2ITFA 4ZI8A 4GAAA 3O45A 4UDTA 3FO1B 4PJHF 5C6TH 1N6UA 2A6IB 1JPSH 1ZPUA 4WEMB 2FQEA 2FWOB 4YDMA 3PAYA 3SKNA 2VR3A 3F7QA 4ZAKC 1IKFH 1XZWA 4PB9H 1FCCA 4UQCA 3BFWA 3EJTA 2C9VA 1UZGA 1R4XA 1UOWA 1QRNB 2NXYD 3WO4C 1A7NH 3HR5A 1IC0A 3KPMA 3V8CA 4EQ2A 4NZRH 1RZ8B 4QF1A 3RVWC 1G6RH 1N3NA 2DBLL 1O9VA 1BZ9B 2NUPA 2CIKB 5E23A 4ZO8A 1E9OA 2J72A 3U9WA 3V6ZB 5E56A 3CXDH 4NHCL 1LE9A 3TA3C 1BQUA 5AOLA 4NKIH 1E4XL 1AXTL 1NM9A 4XP6H 5AVVB 5KSBB 4D3CL 3BIKB 1OY3B 1U42A 1TQTA 4D9LL 5EO1B 1UJ3A 4Z7OF 4ODWA 4Y2DB 2YAHA 1RZFL 1ND0B 5EV7A 1RCYA 4JVPA 2Q6WB 3BESR 3PHOB 4P4KD 4U4BA 3SE8L 4EKJA 4PR5B 3PABB 2A9ML 2AQ2A 4HALA 4JDEA 3LS5L 1KJ3H 2QSQA 4ACTA 5HDLA 2LR4A 2EXSA 3B1UA 1BYPA 4JM2F 2QR0B 4R26H 1E2VA 3ZU8A 2YLHA 4DP7X 3ARGD 5IHBA 4ZD3L 2ZPKL 1OAZL 5DURD 2PO6A 2XV6B 1X7SA 2UY6A 1C5DA 1QWUA 2BIHA 3CX5J 3RTQA 1FNFA 3Q6FB 3WTVA 4K8RH 1MFCH 1KACB 3BSZH 4QHNB 5GXBB 4HXAL 5ICUA 5J11B 2EE9A 3O2WH 3CPUA 2BSDA 3QZWB 1J0KA 2CBMA 4N0UA 1F2XK 5AALA 1BQKA 1BZDA 2E0PA 2CWRA 2B16A 4X8JB 5AZEH 4FQXB 3FQNA 5CUSL 3S34H 2R7EA 3FTGB 4R8WL 3C60B 1K8IB 2J5WA 2DQEL 2IAMA 3FQTA 4ILDA 3EO1A 2OJZH 4MDRA 1TFHA 4TKWA 5E00B 5FM5M 5FIEA 4AVJA 2BWIA 3P4OB 4L9LA 3D06A 5F7MC 1VFMA 3EOAB 1U8LA 3F7RA 5JOFB 5J56B 4KK5D 4WWOA 1DBAH 4DGIL 3ZL2A 1WT5A 4Y7MA 4WU7A 2XQYG 3RGBA 2WK2A 3RBGA 4QXGH 1PDKA 3L6FB 1CGSH 5ANMB 2VOTA 3JWOL 3O4LA 1JXGA 3RUGF 4B7LA 2D0GA 2I69A 5CU9A 4PJHA 5I1AB 3HW7A 1SEQL 4X4KA 2GKIA 2E9JA 1MVUB 2XXMB 4KJWD 4XNMA 3TNMB 3X1EA 1R47A 4BWWA 5TDPA 4YX2L 4YLCA 1TJHL 2IFGA 1MFBL 2JH2A 4U6YB 3WEOA 3QIUD 1DLFL 1AHWC 1PY9A 4X5XA 2J3SA 4L4VE 4YQXL 4IBQA 1V10A 4J6RL 1NAML 3GSVA 1UYWL 3TO4B 1F6AA 1MG3C 2P43B 3QG7L 4G9DA 3G5ZA 2BZDA 5CP7A 2DQCL 1ETJA 2DQFB 4P49A 3AWFA 3ZUNC 3BW9B 4GY4A 3FU9A 3OHXA 3M1OA 4E5XG 5MEQB 4FLQA 5TDOB 3NP3A 2WPGA 4B7IA 2ERJB 2LTQB 1IBFA 1EV2E 1UD2A 1MCSA 1EGJH 1KLFA 1KGJA 2BCKA 2WWOA 2Y24A 4Q9BA 4RMBA 4APQD 4WGKA 4X5WA 3FT2A 5TQ0L 2H41A 1H3PH 1I9RH 2R56H 1KMGA 2ZOLA 5FPIA 2Q1EA 3THML 1YEIH 4H13C 2PP7A 4NN7C 5IVZB 4S1QH 1AZCA 2IDUA 3ZKNC 1C5CL 4JM2A 2DLGA 4U6VL 4YE4L 2A6DA 4NJ9L 4JFFD 2JB5L 1DE4A 1XGPA 5K33A 1M2VB 3WTXA 3KHOA 3GBEA 2B3IA 2J5LC 1E2WA 4KUCF 5T1DL 1MEXH 1L7TH 4MXWH 5AZUA 3GLZA 1RUKL 2CBPA 5D1QD 2DQDH 5E5RB 4R96A 1ZHKB 4LOVA 4PJDE 1H3GA 1BFVH 3OR6B 4I9WD 4LSPL 4Y89A 2VW6A 3OKLA 5D2NE 4ZDHB 4FHJA 3WKML 4DT2A 1WWBX 1YYCA 3CUPB 1PCXA 4MB4A 2IJ0C 2LFGA 1BX2A 3MYJB 1IC5L 4JCWA 4ENEC 3NZHH 2NX5A 3B7YA 3MUJA 4GAGH 4OGAD 3ZVVA 2BP0B 5AFAA 4AGLA 2NW2A 3ZZLA 3GBLA 1IBBA 2I60L 5FDWB 4EN3B 5HYIA 1RFDH 1QSFE 1UB6A 3QIBC 1AR1C 5F9JA 4EZLA 4H8WH 4ZX3A 4E9WA 4K3GA 5C71A 2YKLH 1CF8L 3SDAD 2NZ9C 2JCCE 2DEYX 1Q9WA 2AXGA 2HX9A 4YSQA 2BSTB 5DUPL 3RUGA 2E7LA 3G3LA 4N2DA 1EVUA 4LP4A 3JV5A 4JFYB 1OB1B 1EHAA 2DYRB 4FG6D 1IAOB 4Y19E 5DJXA 3X14B 2OAAA 1Q90A 2G60L 4MJIA 1ZHNA 2GABA 3D0LB 1NMBL 3OKMB 1XTMA 1LMKA 4XX1E 5A2CA 1G9ML 3SJVA 1VSCA 1XTLA 1I1AA 3G04A 2V9QA 4QUOA 1MREL 2X9XA 2EVFA 3FFDA 5JXEC 2V2XA 5F6HJ 2BO0A 2QDVA 3KPLA 4XXDB 5D7EA 4TNGA 4PG9A 4UINH 1A65A 2YD8A 2CIIA 5EUKA 3TN0C 4A2FA 5DWUL 4WKXA 2UVEA 4K23L 1RJYB 4OLVH 1KEMH 2BVPB 3MLPA 1OAJA 4OZGF 2WXPA 2PPAA 1TJMA 3IEAA 5HPOA 3V0VA 3CFNA 1N64H 1VACA 3LEYH 5FYKD 1JNNH 1NDMA 3DSNB 4HBQA 1BFOA 5DSCA 1DQKA 3SPHA 4XMPH 3QFGA 2OBGA 4J6IA 5HVGB 2CDEB 2PCFA 3L1GA 3U1SL 1TMQA 1AXIB 1JTPA 5IK3B 3R7QA 4LHUG 4MA8L 4IHOB 1F4YL 1E5UI 4JFFE 2HKFH 1M1XA 3UZEC 3WU1A 5GGSA 1U3HA 4FQCH 1HYRC 5JHLH 2EDLA 4TQ8A 1J7VR 3EO9L 5KVMC 3T0EA 5E2UH 4HLJA 3G6AA 4X8CA 3DJRA 4H25B 1ZVNA 2DQUL 2OP4L 3FN3A 3QQ9D 4I9WE 1GOGA 4HGWB 4ECNA 2XZZA 4LLDB 3VWKB 3BWUF 2W80C 3MRFA 1Q8MA 4YFLF 5T1KB 4PLKD 1T22A 2CDFA 4QPEA 1PKQB 3RPBA 1T89A 4BQ9A 1M56B 2W60B 2ZX6A 3F5WB 2WLNA 4UOW0 4ZZKA 1BIIA 2X1WL 3D87B 3MROB 4Z7WB 1D9KD 2F54D 1TQUA 2B1HL 1GHFH 4EKXA 4UT6A 1M53A 4UIKH 2AJZA 2R2EB 2XKUA 2WZ6A 5CHNA 3K91A 5DHMC 4GOSA 3WN5A 3EDKA 4NM8L 2VXVL 4WHYG 4XPGL 3KPMB 4G8FB 4J3OH 4ADIA 3HZVA 2GJZB 4DTGL 2WXMA 1AFVH 4K9EL 4QF1B 4TVPL 2XQYA 4CSZA 5BS0A 4NS0A 4UUJB 4XBGA 3VXMA 2MIZA 4JDVA 4E9YA 2XZCH 4L48A 1D7CA 1A8ZA 1JZ5A 1G0DA 3EH1A 4PJCE 5ALCL 1CURA 4HS6A 4HQQL 5EO0A 2EDOA 5AKSA 3R1GL 1F5WA 4KTDL 5FCUH 4ODWB 3DJTA 4AIOA 2CPCA 4UV7H 1FNAA 3X3FL 2CO3A 3F58H 4PUBH 4DFHA 4XNQA 1TYJA 5I1KH 3QO0A 1YEEH 4K9JA 3ZT6A 4JDEB 1ZWIB 2C3GA 2JK5A 4S10A 3KWTA 1MCWM 4KMQA 1CXEA 3E0GA 4JN1H 5FK9A 5EEZA 3X3GH 4OZGA 5BVJB 2EUZA 4DN4H 1EWHA 2F5BL 3K2KA 4HLZG 3TWYA 4ZX4A 4DPRA 5FYKE 4H88L 3US0A 4E5XA 3V52L 2EILB 2UY6B 1FCGA 5KYUB 4TSCL 4B9ZA 3QJZA 4DKEH 3LX9A 1WF5A 3AY2A 1ACCA 3E1ZA 4U7MA 1UACH 1A9BB 1KBBA 1ZLVK 2FWLB 1L9SA 2X4OA 4UNTA 1X9RA 5T33L 4G5ZH 1LP9B 3TZVC 3Q9QA 1R17A 1SHWA 2O5XL 4YDZA 5E03A 2WQWA 3ARBC 1UD4A 2Z31D 2C7FA 3BGAA 3BJ91 3DMMA 5EU3B 4PP2A 5CU5A 4HK0A 5C0RH 2R7EB 3RGVA 1PD0A 2FIRT 1LILA 4GXVH 2P8LA 2QTVA 1N26A 1DQQB 3GFUA 1ET5A 5K69A 3HLKA 3L13A 4X4YB 1N5YH 3NCBB 3WXWH 1IB5A 1DL7L 1X9UA 2BFGA 2MNWA 3QI9A 4MB5A 1U8IA 4D9RD 4P23D 1JNLH 3K6FA 5SX5H 4DOHE 2OXGB 4LCWA 1DVTA 2NLJA 3LKOA 4TRPL 1WWCA 3HPLA 4WI4A 5T8IA 4YXKH 1X5KA 3L9EA 1MELA 4MHHI 3TH2T 3GTNA 5G55A 1K5WA 1JGUH 2F54E 1H6FA 3O4LB 2JQZA 2WBKA 3ZJAA 1ROWA 2Y07L 3HB3D 1GH7A 4P04A 4LDEB 5HVFB 2BINA 1W0YT 3EFDL 4YL9A 5FHBH 5BV7C 1N4XL 1X6LA 1F4WH 1BMGA 5E08L 4F2MA 1T7XA 1NBQA 1BQHB 3GRBA 4FCAA 4NQVA 3ZDWA 3AMKA 1OP3K 3RKPA 3MJ9A 4TVUA 1U93B 1MOEA 1X4YA 4DK5A 2XXGA 3ME0A 1KIRA 1JHTA 1I7ZB 2H2PC 3GSVB 4I18C 3K2IA 5DT1H 3V4LA 4BA8A 4AQ8A 3G5ZB 5EOTA 3BDXA 4X98A 1G7LA 2PN5A 4A2MA 1W8EA 5HXMA 3OHXB 4NO3A 2DQJL 1IBHA 4G8EB 3S2AA 1GAFL 1QO3B 3KPQA 3D9AL 5I1JH 3HC4L 4AG4L 2MHAB 1R1CA 2NXZC 4YFDB 2DAVA 4TQEH 3NJLA 3UJIH 4F33A 5IB4B 1VEPA 1BZ8A 3UYRH 1H3WM 4FOMA 3TVMA 3GS0A 1MAMH 2ZAGA 3JUYA 4UILL 2ZOLB 4MMXC 4PJ9B 3KDMA 1NCUA 2VXSL 3HZYA 3IB4A 1ZIBA 3HZMB 3B5TA 1EAQA 3QHFL 4ONOA 3SPIA 4X8XA 3ES6B 3CH1B 2A6DB 4Y2OA 4S1SL 2Z8WC 3KD4A 1EHXA 4DN3L 1KYDA 2HKHH 3UAJA 2VLKD 3KL5A 1FNHA 5HHVL 1T21A 2I85A 2P45B 1HDMA 1XD0A 1GJWA 2D03H 4R96B 4BK5C 1HXYA 2AC0A 4HUKB 1S78C 5E6SB 5IY5B 5JLZB 3QRGH 2CLZA 3NJFA 3CU7A 1X5LA 2Z9TA 3B9KC 4HBCL 1S5IL 4A2LA 2HH0H 4F91B 3VFOA 4FQ1L 3ZE0F 1U8OB 1BX2B 1MHPH 4KKAD 2VQ4A 2NY3B 2JELH 4LHUA 4HA1A 2NW2B 5LHDA 3EDJA 2DYPA 1WZAA 3FUHA 3HVDA 4NBYB 1DBBL 1UB6B 1KN4H 2XWTA 5I1EH 4D9RE 3DECA 1T80A 5F9JB 2EDRA 3CLWA 1D5MA 2NNAA 1CI5A 1XF2B 1KN2H 5HYJB 4PIRF 2NR6A 5D4IA 1Q9WB 2APTA 2X38A 5IROC 3BAXA 1DVFB 2YC1B 4ELDA 3WAKA 3MV7D 5C0IB 3RUGB 1IGMH 2IADA 1K9TA 1V7ML 2DM4A 3W0WD 1Z3GL 4NDMA 1GGCH 4JRLA 5FM5O 3L7EA 4OVUA 5HGGS 4I1PA 3BZ4A 4GAYB 4MJIB 4Z9KB 4K5LA 4ZAKA 4AYDC 4LLQB 4YZFF 4DEWA 1B0RA 1S7WA 1XH3B 5ISZD 3BWAB 3WS6C 2NT1A 4IDLA 4JO1H 1YNLH 1T6VN 1EFQA 3B5HA 5AYUH 3VXOB 3WGUB 3WIHL 4WI6A 1TPXB 2V2XB 2BP8A 4W9DC 4W9CC 2EC9T 4XN5A 2C4FU 2BSBA 3CQFA 4U1LA 4WJG3 4FQQA 1KLGA 4AC4A 1RK1A 4BFIB 1BXXA 2P8PA 3FSAA 4P4RA 2IBZY 3OGOE 1MCQA 2QKIA 3LJ3A 4X0KA 2WLZA 3P0YL 2PTTA 1MKFA 2GFBA 4KRMB 5C0AD 3UTQA 5DMGD 1QTYT 1NM4A 2FJGA 4KKNA 2VQUA 4U7SA 4OZIF 2BSRB 3C2AH 1MHCB 3B83A 4UT9L 1CFQB 4NENB 4XRCA 1CLYL 5D55A 3KJ4C 4LHQB 2WMPA 2Y3NA 5DJAA 4EI5A 1XFPA 4AQAA 3MKGA 4UTAH 3VSUA 5GGSB 1KFAL 4N25A 1H3VA 2LU4A 1SYVB 4P2RD 5BUPA 2VLKE 4I87A 1O5PA 3ZPDA 4RVBA 3ZL4L 2ZXWB 2OR9L 3FS9A 4BWTA 3L5HA 4TXVB 4DZBB 2GC4C 1I9EA 4NHCH 1T1WA 5LCVA 4OV5A 2ZKXA 2G75B 2JCWA 3MA7B 2CDFB 4IBWA 1S4IA 4D9LH 2OTPA 5EO9B 3KLLA 4FLSA 4ES8A 3QDGA 1VFUA 1FRGL 4L3EA 4F7EA 4XMVA 3NABH 4IRJC 1GSMA 2K3TA 1I8KA 3TGXA 3UC0H 2ZWNA 1AKJA 2R15A 3UAEA 1IIIA 3LQAC 4AJWA 3K8MA 3LS5H 1FZOA 4UB0L 2O6EA 4G7VL 4A2EA 3T3MF 3WFZA 35C8H 3MV7E 1PMYA 3M17A 2ZPKH 4ZS6C 5AG8A 3HZVB 1KIUB 3X13A 3IGKA 2NY2C 2GSIB 3N1GC 1JZ8A 4U05A 1FHNA 5D72L 3KYNA 4XI5D 2UYLB 3OKKB 5DK0A 5BZWA 5BS0B 1GRWA 3OAUL 4XBGB 3VXMB 5JPNB 4AIZA 1L9PA 4FEIA 4DFIA 4FABH 4XVOA 1AHWA 2ICWI 3SDXB 5E8PA 1MW2A 4BEIA 3MV01 3QA3B 3QB7C 5CUSH 3BN9D 4UT6H 3F7PC 1AIZA 1INEL 3ABGA 2QLVB 4XNQB 1XH2A 4Y9BA 5IMOB 1NAMB 1MCJA 3OLDA 4IGBC 4ZTOH 4TOYL 2MNJB 3L45A 5EWIL 2JK5B 1IGJB 3WIFA 2R23A 1RUQH 4ZG1A 2YD9A 3FFOA 4Y4FC 4J5VA 1XSIA 5FK9B 3I9PA 5I8CA 4KFMA 5DZNA 2P1YA 1YJDC 5FLVA 3RZCC 1MZYA 2XN9D 1BLIA 3CHPA 3HMWL 3H9SA 2DIEA 4WY7H 2FNWA 4E5XB 4OCSL 4U1IA 4P8QA 5DR5H 5IQNA 4OZIA 2EVIA 4ZRGA 1UGNA 1SEQH 2DV6A 3GMQA 3IBOA 1SQMA 1F4AA 1HK6A 5E24E 5AW5B 2X4OB 2PMZA 3L54A 4LFHG 3V4PL 1XT5A 3Q2NA 3ZMNA 3N43F 3IAGC 3W82A 4N0CD 1MCOH 3VRLE 3LHPL 4P2RE 3NG5A 5FYLL 3VNYA 1DLFH 1V3MA 3K4AA 3TYFB 1LQSR 2PWGA 1UHVA 3DMMB 5DHDA 3ZYIA 4KNQA 1KTBA 1PZ5B 4L8SC 2IIJA 4HK0B 3ZHLA 1LD9A 1NAMH 5T3ZH 3M46A 5FKAA 3SO3B 5IHWA 2P8LB 4G6KH 5L0QB 3INUH 3P9WB 3RIAF 4N1EA 2XVGA 4YIQA 4BD4A 4JANA 3TCLA 1N59A 1OGTA 1CICC 3KPPA 2BX5A 3NYKA 4IIZA 4MNHB 5B39G 4KVCL 4PJ8A 3P3TA 2CUAA 2Y72A 1NOFA 3WLWC 3AJ7A 2YA0A 3LAFA 3CHQA 4DJMA 1I9JH 2P44B 5JORA 1OSZA 3NA4A 3FCBA 4TULL 3F7VB 5IJBC 2JJSA 5DJ2A 2Q2LA 1USQA 1VGKB 4Z76B 2D4DA 2DL2A 4EIGB 3QPXL 4KY2A 2Y2YA 1E4JA 2F0CA 4XMXA 5E8OA 2FX7L 2BJML 5AVYB 2ZF8A 2E8YA 1HKFA 1NGQL 5HD8D 4Z8FL 2C1PA 5KSUB 1KIRB 5CLTA 5I1CH 1ZT1A 4YPJA 2ZUTA 4TQPA 5BO1L 3F84A 1G0YR 1AYRA 1RUKH 2KPNA 2WBWB 1WAAF 5EOTB 3ZSSA 5DD3H 4X98B 1G7LB 3QFDB 5H4ZA 3KPQB 2OR8A 4OSUH 4X9YA 4WRLA 5DRNB 4UZGA 3BX7C 1T66C 4FYTA 4TUKH 4IRSD 4XBPA 4B9PA 1WHPA 1HEJC 5BZXA 2Y2TA 4Q4IA 1I9IL 4L37A 4W9LC 5FHAH 5K9JL 5KAQG 1OL0A 3QP3A 4ODHH 3QUYA 3P0VL 4JB9H 3KDMB 3TN0A 3HZYB 1IC1A 1HC1A 1NA8A 3IKKA 1K5NB 3IPBA 4JPKL 3ZSTA 3DOIA 3GXUB 2KZKA 4LRIC 4NQUA 4PRBA 2XN9E 5ALBL 4BZYA 1KJVA 1CD8A 4PJFE 5D6CA 1H3TA 3WHE1 1QSED 3FMGL 3JWNG 4BFOA 3CV5A 3HE7B 3LXUX 4KK6C 4PJIF 2Z93A 3V4VB 1GZHC 3O3AB 1MCWW 1UWGL 2MPVA 1HDMB 4DVBB 2G60H 1DJWA 1CDJA 1GC1L 1E4HA 3VUAA 2CLZB 3K72B 1KYAA 4YK4C 3UJJL 4BFFA 1BVLA 4P2QD 3VFOB 4FFVD 4EF3A 1B2WL 3IU4L 4JHVA 3KLSA 1I8AA 2YJQA 4HIJA 3R8BB 5C9JB 4NP4L 3Q1SL 4HPHA 4PWJA 1AZRA 4JPVL 4J23A 1ZT4A 5DUML 2G3XA 4H0IA 1NPUA 2F53D 3EJZC 1MPAH 1JPST 1J9SA 3DX1A 4K23H 1D5MB 2SODB 2NNAB 3MC0A 1F6FB 1O7VA 1K72A 2X6MA 1NTDA 5KSAA 3Q48A 4JREC 5MENB 2WNXA 3KPRA 4LP5A 1U8NA 4JGMA 2UX6A 2LFEA 1F45A 3G6DL 3V4VH 4XOCA 2BVQA 4ETQA 4JO3L 5DLML 1CQYA 2ZG1A 3L7EB 2X4PA 5A16A 1U2YA 1J05B 2P5ED 4JRXD 3HEIB 3UC2A 4ZAKB 5AW0B 3S37L 1B0RB 1S7WB 3IBEA 3NRQA 4HKJA 3TXAA 4BSWA 4N86A 1YAIA 2NPLX 1EZVX 1ED3B 1NWOA 2UZYA 5CINL 2EVHA 4PG2A 4GBXC 4OF8A 2GTWA 2JNZA 3WO4B 4HJTA 3EO9H 1E5BA 4LIQE 3S3CB 5D1ZA 5K9KA 1BECA 1WAAA 3SGKC 4Y5XC 4GXFA 4U1SA 4FCHA 3TA3B 1TEGA 3IXTB 3KGRA 4JY5H 4FQQB 4RESB 1HCYA 2EAEA 4XNYL 5I76B 3VACA 1RK1B 1GVIA 2P8PB 4A2HA 1I4FB 2QKIB 3RX7A 4X0KB 5I28A 4LOEA 4WV1C 3A23A 2P47B 2B2XL 3NMEA 1NIBA 3UTQB 1T6WA 5HJ3B 3JV0A 1CGTA 4HH9A 5SV3A 3BGFC 3LPOA 4C4KT 1JZGA 3KYKL 2WY3B 5AB1A 2X09A 4K94L 1PF3A 2LAAA 3VYPA 3ULUD 5KYYA 1JF1B 2BRRL 3K1KC 2WMPB 3OSVA 3PP3K 1QBLH 2EIMB 1A7RH 4P46C 4X6FB 1ZV5A 3LQZA 1CD0A 5F89A 3VTAA 5T3XH 1BOGA 4IEFA 1I31A 4QDGA 5KAQF 1FFRA 3SGJC 4K15A 1NSNL 1ORQB 4XPBH 1DJSA 4PJIA 5LVEA 5LNDA 1ZK5A 2DEWX 4FL4C 2IFFH 3S98A 1E5YA 4WHYH 2IF7A 5E94A 5JHDA 3DX0A 4B3VA 2E4TA 5B38B 1T1WB 2R83A 1IBGL 4OV5B 1BREA 1NCCH 3ZE0B 4ZMXA 3K2MC 2OTWB 3ZTCC 4BGDA 2BIQA 5ALCH 1IX2A 5GS0D 1PLAA 1JE6A 1H3UA 3QDGB 3HNTL 4L3EB 2C9QA 4R7LA 3VWJA 5HYEA 1U8CB 2ADGB 3EDDA 4OU3A 1S9XA 1BAFL 4X5LA 5EU4A 1OGAD 1B2YA 2F53E 3T8XA 3PRZA 4FHBD 2HG0A 2DWTA 5GGVL 3F05A 4M61B 1MCPL 1MH5A 2FX8H 5C07B 4H8PA 2EIEA 1OARL 1A3ZA 3M17B 5LGJA 3NJVA 2VISA 4TSCH 3ZGHA 1NCTA 4YXHL 2P5EE 4JRXE 4H0HB 1IILE 4HIEA 5LCVH 3TJHD 3N5AA 1AIFB 4WO4A 3KH4A 2LLGA 5J4MA 4NFCA 4AIZB 4HAFA 4PJXF 4YGVB 1ZGLP 2HJLB 5FA4A 1A5FH 5EH1A 2VDQL 1AHWB 4HKZA 1UM5H 4F24A 2M8XA 4KI5D 2XCMC 4DP0X 3PHQA 2FYYA 4I18A 1A1NA 1QSVA 2M83A 1OAQL 3C09C 1THCA 4HWUA 4XPFL 4IDJL 1NFAA 3ARPA 4XB7A 1DL7H 3EUUA 2EZ0D 2DQHH 1N18A 5CLYA 1A4CA 5CJQH 4V1DD 3HI6L 1Z7JA 1RVFL 3RWEA 5CWSB 5I8CB 5GJSL 4PW3A 4UMGA 3H9SB 1B6DA 1E7UA 4Z95H 1JTOA 2CR0A 3QXUA 1B9ZA 1AVAA 2OULB 1UXMA 1J86A 4R83A 3ZHDA 5K5YA 2Y07H 3VQ1C 1H9DA 1HXMA 1SDAB 2GUYA 1JZJA 3CVBA 2AP2A 4MMXA 5I9QC 3ULUE 4NN7B 4K7FA 3BQUA 4A1RA 3HHSA 2CH8A 1PQZB 4AVIA 4XP5H 4IBTA 3D30A 4NUGH 1IM3B 2M1KA 1NGWA 1OE3A 4I3RH 3RZWA 3D52A 3FL7A 4RLDA 2O5ZH 3ATAA 3MLSL 1I3UA 4K7PX 3TTSA 1KENL 2HRPH 4PGDA 3BKYL 4JO2H 1HH6A 1F18A 1LD9B 4G9FA 4JM0A 4MS8D 4FXTA 2Z8VC 2ADFH 4MX7A 2RB8A 3QZOA 2QSVA 1OIOA 4YIQB 4N3TA 1XF5A 2X6BA 1J1PH 3D3VA 3H42H 3PHSA 4OIIL 5HI3D 1YN7A 2IDTA 3HTLX 1AS7A 1BFTA 1U8KB 4WUKL 1LXMA 4YNYA 3RNKA 4AMXA 1XAKA 3WJMA 4S0SD 1OSZB 1U8QA 4URKA 2AXHA 2CMRH 4MD0A 4DPCX 4JFQA 4F37F 2X3BA 3CFBA 3S0PA 3P1VA 3DETD 3QIBB 3WFDL 5DJ2B 1K4DA 4ZOCA 1AR1B 5SX4I 2EXWD 1IEAB 4DETA 3T3MB 4PD4K 4P4KC 3BI9X 5CSGA 1Z1WA 5E8OB 1RK7A 3VXRD 5J6HA 1LNUB 1Q0XH 1KT2A 1I53A 3U46B 1ZHBA 2A1WH 2ATPB 4MYWB 5IROA 1ZLUH 4R0LC 2C1PB 1HCZA 1ACXA 3MLWL 1QQDA 4HMDA 1UH4A 1FYTA 4P2YA 2VLLB 3SZKC 4LLMA 4Q2ZB 4J3VA 5CSZA 5I0WA 5I6LA 3ESVF 1WBXA 2CKNA 2WZ5A 3N42F 5JUEH 2PCPA 3DTUB 1MFDH 2K7PA 3SDDD 1SPDA 5JHAA 1HL9A 4PJXA 4BZ1A 4HBCH 1VFBA 1WFMA 2OMYA 4AYFA 2AI0L 2IPKA 4KI5E 2J73A 1J9TA 3E38A 1NFIA 5E4AA 3VFRB 1HWHB 3PV6A 2NY0D 1NAKH 4QRPD 2FX9H 3TN0B 3UPRA 2EYTA 5FA3A 4WTZG 3KLDA 3AU1A 2VW7A 3DARA 4KO5A 4V1DE 3QQ3B 3ZTJG 1A7QH 1M9SA 2QPEB 4HAKA 4PRBB 1CT8B 1UJTA 2NMSA 4Z78A 5FUOL 2WXKA 1OAKH 5D6CB 4C59B 4ELME 5ITBH 1AQHA 1GKOA 2EUVA 4XCNB 4KK5C 3MMEA 3U2SB 3WFBH 1MFMA 2Z93B 3NIGF 4N2OA 1H6EA 2R1WA 4K5OA 3IFPB 1G9EA 4YMPA 1CL7H 5CMAA 2VQ1A 3WJLA 2R0KL 4OBSA 4QKXB 3VSTA 1QI3A 1FA4A 1BVLB 4KJWC 4UQ9A 3BT2L 2VLJB 2ESVE 4QAWA 5AZ2H 2MJWA 2VC2L 2QHRL 3LEVL 5I6KA 5IFHL 2R27A 1ZA3A 4E2OA 4E42B 2IGFH 3QIUC 1BD2A 4HC1A 4XCYB 3ETSA 2KBGA 2VN7A 1C8PA 3VM7A 1FBIL 2AITA 4KQ3L 4XVSL 2OJEA 4Q6KA 3M7OA 4I88A 4N8VG 5IF0A 5HVWA 3BH9B 3P0YH 3PWJB 2WM0A 5EU6B 1U8NB 2XN0A 5IUCA 1ILSA 3S48A 4IRJA 3G7TA 1CE6B 4UTBA 2ATKA 2BVQB 4ETQB 1WVZA 4UT9H 4FZEL 5D7JD 5EDSA 5A16B 5IMMA 4APQC 4OLYL 3PG2A 2QV2A 4KTEH 3VXRE 5GRVK 2H3KA 4CW1B 3MJ6A 5BMFL 2RCSH 4PEEA 4HKJB 1T5XA 2AQTA 3V7AE 1NCDL 2UZYB 4Q9RL 1NMAL 2NRDA 1QHPA 2DQGH 5DZVA 1OK0A 1PZ2A 3EJCA 5IMKA 3C75A 4EZJA 1KGCD 2VDLB 4NBXB 3ZL4H 2QGCA 1I82A 2X9ZA 4LSVL 1LLAA 3D85A 4PVNA 4LKCB 2TRHA 5CP3H 4XWGH 4WWPA 5I71C 4Y4HA 1JV5A 4HU2A 5DS1A 4N9GA 1MG2C 4HH8A 3SE3C 3HG3A 4MS6A 4OCMC 1ZIAA 4WZ9A 4GG6E 2G3ZA 1ZJBA 2JQAA 2YAPA 1P7BA 2X05A 3MJ8A 3D2UD 1WA0X 3GMRB 1YEFH 2KERA 4QRPE 1U8HA 5AWNH 4OGAC 2XKNA 3OLIA 5KYYB 3BKJL 1DO6A 3D0VA 2EABA 4L8BB 4UB0H 5GJTL 4CVXA 3QZNA 2X9WA 1FJ1A 2WC7A 4K3DL 3LQZB 1MWAL 2MFNA 1AE6H 4ZUUB 2VMCA 2FZ3A 1XGUA 4AM0B 3STLA 4Y5YC 4UQBA 3WN6A 2VDLH 4PRIB 3MNZB 1J0HA 3FB7B 1YUHA 3SDAC 5IESH 1FLRL 2AEQL 2QZ5A 5E94B 2P52A 4G82A 1P4LA 2CO2A 4YSCA 1BQLL 2FO8A 3PWPB 3TZVB 3D1MC 4FG6C 4Z7NF 2AV1A 2ZUUA 3S35H 4QT5A 5IJCC 2EKSA 3QH3A 3ARBB 1JN6B 3EKCA 5DVLA 2LT9A 1MFAL 2EYRB 5KW9H 4L8SA 1SXSA 3BWSA 4XC1L 5I5IA 3GHBL 2GJ6B 3GZPA 3O6KL 1S9XB 1OAYL 4GSQA 2F1AA 3VGBA 2H1XA 2DD8L 1ADQA 3LZLA 4X99A 2F8XC 3A3YB 4WNSA 3IJSA 2J8UB 2FGWH 1Z5HA 4H40A 1FPTL 5I5RA 3HG4A 4KRPD 2X40A 1UD3A 1YNKL 3NSXA 4JM4L 2CJTA 4YVUA 3ZKXC 5LGJB 4OCSH 1M6UA 3PL6A 1AGEB 3DPBB 4MNQA 1U3JA 3VXUD 3QNYB 3S8WA 4G8GE 2Z1KA 4HIEB 4KHXL 5BXFA 3VFMA 1E5AA 4Q6IC 4U2YA 3T1WA 5L7XH 2BIPA 5BV7B 1NC4D 3KE0A 3BVNA 3LHPH 1JV2A 5FA4B 4PV9B 2K8QA 1C12A 2JKLA 1OSPH 3Q7JA 5DUJA 5D7KD 5F7EH 3BUYA 2FYYB 3F01A 4I18B 2YD3A 2ICWA 4I48A 1A1NB 1ZHLB 4UQDA 5EUOF 1WTLA 3C12A 4JFXA 1KTDA 4JJOA 3C6SA 4NNPL 5TE4H 2E7HA 3MLUH 2ZZUT 3BEWA 2NXZB 2AJYL 2XQ0A 3QQ9C 4L8CA 1OW0A 2YMTA 3UCQA 2CGYA 2ZXCA 4ODTL 3IJ8A 3QC6X 2L7JA 4P2AA 4PLKC 3AXLA 3VI3F 2DPKA 3KPOB 2Z4QB 3QPQC 3QXAA 4MMXB 1U3YA 2D7OA 3D39B 4I77H 1VF5C 2WZPA 5I0XA 2VABB 1FFOB 4C47A 5BV7H 1SEBA 2L7EA 3CDGB 1WA2X 3HHSB 1IC7L 1XIWA 1D9KC 4BXSV 1ET8A 1PVHA 5HYSB 4HETA 2GBUA 1NGWB 2WUBH 4JHZA 4LPWA 2FX7H 4R4BA 4Z8FH 4OCYH 2IQ9L 5FR3A 2QMJA 1MNUL 1ACYH 3PGFL 3CZGA 3QXDB 4WTZA 1JGLH 1P84J 4Y8DC 4ZUVA 1HH6B 3BKCH 3FUFA 3K81A 4MAUL 3WTYA 4MX7B 4AV0A 2FLBT 3U36B 2HPTA 1MJJA 1XF5B 2VR8A 2XIBA 3D3VB 2CKBA 1UWEL 1H19A 3TV3H 2AS5M 2BNRD 3B9KB 2H0FA 1JOIA 4XPAH 4P5MB 1MCBA 2FECI 3RNKB 4PW9A 2QQKL 4X6DE 3BP4A 2P24A 3BLBA 3WJMB 1H15A 1OAUH 1YMMD 1T03L 4YUEH 1HFUA 1VGEH 3CTTA 2PXYA 4X6CE 3WKPA 3E8VA 3GHEH 4MD0B 3U2JA 3DC0A 4RX4D 2F7QA 3HI1B 2E8ZA 4WI8A 3ETBJ 4Y9CA 3FSVA 5CJXC 1XSKA 4ANXA 2RMNA 3LNFA 4JRYA 4NKQB 4IU3A 3V5KB 3FQWB 2H1PL 3N40P 2R0WL 3MRPA 5J6HB 1KT2B 4Y8AA 4NO0D 2CG9X 3TT1L 3D5OF 1OF0A 5KVDE 5FYJD 3OX8A 5FWQA 2D0HA 4R90L 5GSVA 3VXUE 1RMFL 1ZPLA 1QQDB 3FO2A 2L0DA 1FYTB 2XXFA 4N8VA 4LLMB 4P5TD 2GSMB 4K7PL 5E6IA 5CSZB 1FFQA 3I02A 3V95A 2VMFA 4OGXL 3H53A 4ZMYA 3JWNH 3V5HA 5ILTL 4IRZA 3UO1L 5I23A 3OMAB 1BOYA 3IFNH 4OGQC 3KDPB 3UJJH 1VFBB 1DQJB 2OMYB 4AYFB 2IPKB 4HV8A 1RAMA 3QISA 1J8HB 1CK0H 3B6SB 5D7KE 1YN6B 3P9MB 1NCWH 4BKLA 4QHLA 4KUZL 4NP4H 4QRSA 4JK0D 4WWKD 3B37A 3Q1SH 2Z31C 3PV6B 5EUOA 1IARB 4R7NA 4ZTPL 5CF3A 3O41A 2O5YL 2EYTB 4KKLC 5FA3B 3AU1B 1QVOA 4NXKA 2UXVA 4MCYA 1NANI 3QORD 5ETUA 1KXQA 3WD5L 5JR1L 2BWQA 5HHOA 4TLSA 1ZOXA 5CS7A 4I2XA 5FV1L 5LGKA 4DGYL 3OPUA 1Y7VA 1WK0A 4Y4KD 3VI3A 2FB4L 3KWWA 4OQTA 1NGPL 3MMEB 3FYIB 4L1TA 4KKCD 4F93B 1F58H 3ZK0A 4XODA 5A40E 3KJ4B 3QEQB 4BZ1H 4E9LA 1EAJA 5CMAB 3S37H 2VQ1B 4L5FH 1LK2A 3AABA 1R5WA 5HHNA 1AGDB 1S3KL 5IWLA 3SGJA 2OK0L 2YN3A 4U3HA 3AZUA 5I66B 2XA3A 3L4YA 3QYCA 2FJHB 3NFSH 5KS9F 2EACA 5JYLA 2ATAA 3RWFA 2IGLA 1JVKA 2ORBL 4XO3A 3DX2A 3TX4A 1KTJA 32C2A 3D4YA 3B7SA 2BNRE 3T1FA 3S9DB 4XNYH 5C0EB 2VH5H 1XDTT 4G1MB 1W8OA 1MCDA 1YMME 4EDWH 4JKPH 4C83A 3MGAA 2FIKB 4IRJB 4OI8A 4N5ED 3DRQB 4M1CD 2ZG2A 1NMCC 4GFTB 3OBAA 3ZL1A 3KGTA 5F9OH 2B15A 7TAAA 3O6FD 3CVIL 1D5XA 3AC0A 5E8DL 3FU5A 2J2ZB 5FYJE 4A37A 4DP2X 4M62L 1T0MB 4LB8A 4B3EA 1YDPB 4X7DC 3VFNB 1KTLA 4DQAA 4A39A 3UJTH 4HJGA 4HC1H 2WVVA 3IDXL 4MNGA 5JNYB 2NY2B 2LOEA 1G9NL 1PD6A 2GEQA 3N42B 3LD8C 4RAHA 4F7TB 3VRJA 1G43A 5EORL 2YXMA 4CC4A 2W9LA 3SE4A 1FGVH 1FN4B 1NFDF 3IGLA 4KKQA 4YHOL 3BGMA 3RIFK 5LQBL 5D8JH 2FJUB 3D05A 4FYSA 4UTBH 5I5JA 3AU0A 3MJ8B 3ENEA 3KBEA 4YVNA 3VXQA 5FFLA 3EJRA 1OCWH 3LQAH 1U8HB 1HNYA 4KKAC 1I7RB 1TQBC 5GGVH 1JYWA 2AKRA 1IAII 2I27N 3QUHA 4Y1AE 2F74A 3S35X 5HDQL 2XFGB 3R7RA 4KGLA 4N87A 1FJ1B 4PRHD 5EZPA 4Y4FB 4TUOA 1CG9B 1G6VK 4HG4K 1KJ2B 3D33A 3IMBA 3CH8A 3RZCB 3ZBMA 1V7NL 3B7TA