2ZONA

Crystal structure of electron transfer complex of nitrite reductase with cytochrome c
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
334
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dissimilatory copper-containing nitrite reductase
publication title Structural basis of inter-protein electron transfer for nitrite reduction in denitrification
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
total genus 92
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zonA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zonA02
2HX9A 3CZUB 5B3SB 1FWXA 2EIJB 1JZHA 3FS9A 2H47C 3MX0B 4E9QA 3T9WA 4A2HA 1SFHA 2UXTA 3SBQA 4HCFA 2FWLB 1E30A 1TEGA 3TA4D 3WKQA 1NPNA 1ET7A 1A4BA 4MFHA 3PLYA 2JKWA 5B7MA 4YSQA 1ILUA 1KBVA 3FSWA 3U25A 4YVNA 1GS7A 3RYMA 3WNJA 4YSCA 2YARA 1WA0X 1IKOP 5ANHA 3GXUB 3EH5B 1L9TA 1PY0A 3NJKA 3DIVA 3DTUB 3OQRA 3V9CA 4WTQA 4RH4A 4YSSA 3IBOA 2FTAA 4FAAB 8PAZA 2GC7C 2XVBA 5D4IA 2VMJA 5I6LA 1GW0A 4AKQA 4UANA 1L9SA 2BZCA 4QKTA 4AKOA 1MG2C 2BZ7A 2R7EA 1GYCA 1JVOA 3JTBA 3CVCA 1KV7A 1PF3A 1WS8A 2BP8A 3FQYA 1KDJA 1QLEB 2QDVA 1ASQA 2IWFA 2UX6A 5PCYA 3FSVA 4A68A 5I5IA 4BDVB 2FT6A 3NJJA 2VW4A 3IE9A 2P80A 2FQGA 2XV2A 1OE1A 2J56A 3FPYA 1AZRA 4YSOA 4GY4A 3CDZA 4NB7A 3AY2A 4UAHA 4KNTA 1M56B 1PNCA 3X1EA 3QJVB 1A4AA 1NPJA 1NICA 2XXGA 3FU8A 2HX8A 1JOIA 1E65A 3FYEB 4WKXA 1EHKB 4G7RB 2XX1A 3NSYA 3UGEA 2YAFA 1SF3A 3JT2A 1GSKA 3H4FA 3S3CB 2Y69B 2PLTA 1AIZA 1ET5A 1GY2A 2HXAA 2YQBA 2ZWNA 3ABGA 3PAZA 3NJMA 2RACA 2BP0A 2QPDB 3SBRA 4DP7X 5I5MA 4Q8BA 4W1TA 3UAEA 3X1NA 4GP5B 3UACA 1V55B 2PPDA 2UX7A 4P5SA 1CUOA 5F7AA 2AZAA 1RKRA 4BXVA 1MZZA 2WSDA 4BWWA 1OE3A 1PLCA 2CCWA 4YL4A 1UATA 4BWUA 2HX7A 2YAPA 1BQRA 2IDUA 2CUAA 5TK2A 3NJIA 5I28A 2DYSB 4AX3A 4F2EA 1PLAA 3AW5A 5I6KA 3OMAB 3IN2A 3ZBMA 3X1BA 2OCCB 5A7EA 4G7SB 2AFNA 3SQRA 4A2GA 1KDIA 4A2DA 3MBWB 1JZIA 1OF0A 4ENZA 3C75A 2UXVA 3FU7A 1OCOB 3V9EA 3FSAA 1SFDA 1CC3A 2YAOA 4G70B 1KCBA 4G72B 4K9JA 3T6VA 3WIAA 4HIPA 2H3XC 1XB8A 2CAKA 1BQ5A 1PAZA 1AOZA 3IN0A 4DP1X 2IDQA 5IY5B 2N0MA 3NJFA 4M3HA 1RCYA 5I26A 7PCYA 1ZIBA 1NIAA 1JZJA 2AZUA 4YSTA 3QJQB 2AANA 2IWEA 4KO7A 2XV0A 1JVLA 1B3IA 1WAEA 2WO3B 4YSPA 1AS6A 1JZFA 1ZDSA 2JXMA 4DP5X 2NRDA 1TEFA 1E5YA 1W8EA 1ZDQA 2XV3A 1AZCA 3CG8A 5LDUA 1HAWA 1IUZA 1OCRB 3FSZA 3FPXA 4CSZA 1SDDA 3PAUA 4E9RA 3H56A 3ASNB 2FT7A 1L9PA 2X87A 3AG1B 2QT6A 4AI7A 4KO6A 1J9QA 2BO0A 3QPKA 5I6OA 3EH3B 3ZIYA 3UABA 2AVFA 2CJ3A 2E86A 4GYBA 2PP7A 3UADA 3AG3B 4E9TA 1KBWA 3D12B 2EILB 1CYXA 3TBCA 1J5CA 4M4RB 2BHFA 1BEXA 2BW5A 2XLLA 4TXVB 1KGYE 2PCYA 4F7KA 4CSPA 2DWSA 2GB2A 3ABLB 3CVDA 1AR1B 3TASA 2QDWA 1AS8A 3PPSA 1SNRA 1AS7A 1ZV2A 2HRHA 3QJTB 5D4HA 1JZEA 4A67A 4DPAX 4P5RA 1T5KA 3H4HA 1ET8A 4BXSV 1YLBB 1BQKA 1BXVA 1MG3C 2EIKB 3S8FB 3BVDB 1TU2A 4N4YB 1XMEB 3NYKA 1E5ZA 2XWZA 4YSDA 1DYZA 2HRGA 1AACA 2XX0A 2UXFA 2GI0A 3ERXA 4DP9X 2HLEB 1J9TA 1PMYA 1OV8A 5E9NA 3FYIB 3NSDA 4YSRA 1AZUA 3NJNA 2B3IA 2I85A 3AZUA 3X1GA 3GDCA 4E9SA 3T6WA 1GR7A 3WG7B 4GP4B 1E67A 2A3TA 2FQFA 2VN3A 2PPFA 1BYPA 3FQ2A 5I5JA 3QQXA 2PPEA 1L9RA 3EHBB 3X2QB 2EINB 4JHUA 1MDAA 4DPBX 4NERA 3WI9A 1GS8A 4AKPA 3T6ZA 5I6MA 1KCWA 2VM4A 1L9QA 4E9XA 5B1KA 3NSFA 2IWKA 4KNUA 1BXUA 3OD3A 4KO9A 4AZUA 2VSMB 2VW7A 1JXGA 2J57A 2B08A 3NSCA 1ZIAA 2GIMA 1AANA 4HHWA 2YAQA 3S3BB 2YXWA 2Q9OA 4N8UA 3N2JA 4BDVA 1OCCB 4HZ1A 2HZHA 2FQEA 3HB3B 3AG4B 2BP8B 2VSKB 3PXLA 2FJSA 3GYRA 1F56A 1HAUA 2JFCA 2PCFA 1JERA 3FQ1A 4HHGA 4KO5A 4A66A 1EZLA 3ASOB 2QPEB 1HFUA 2I7OA 4L0PB 1OOWA 4KNSA 1KYAA 1N68A 1RZPA 2FQDA 4HALA 3TU6A 4QLWA 5EHFA 2VM3A 1V54B 3CDZB 2J5WA 3FT0A 3HEIB 1PZAA 1J5DA 1AZNA 1SHXA 1GS6X 4E9VA 4UF7C 2BWIA 4E9YA 2BWDA 1W6LA 3IEAA 2W88A 2YAHA 3L45A 3NP4A 3EF4A 2IDFA 1QNIA 4JHVA 2DWTA 3WNIA 2W8CA 4EF3A 4G71B 1JZGA 2YAEA 1A65A 4PAZA 2GSMB 1WS7A 5F7BA 1NZRA 4Q89A 1NTDA 1OE2A 6PCYA 1V10A 1BAWA 1XB3A 1NIFA 2FT8A 5B1BB 3ZDWA 1IC0A 1XB6A 2BP0B 1AG6A 2DV6A 2DY2A 3PAVA 2ZONA 2PP8A 3OMIB 3UAAA 1AG0A 1ILSA 2XU9A 4YVUA 1X9UA 1A3ZA 4DP2X 4ZK8A 1IBYA 4HAKA 2Y1AA 5B7EA 1N70A 2XUWA 4GP8B 2LLNA 3WKPA 1CYWA 1NINA 2OJ1A 2P80D 1FA4A 3NJGA 2GHZA 3T71A 2IH9A 3ZX1A 3AG2B 2WO2B 1QHQA 2H5UA 2J55A 4YSAA 1J9SA 4E9WA 4YSEA 1NWOA 5D4JA 2MRYA 1M57B 3ABMB 1URIA 9PCYA 1WA1X 4GXFA 2EIMB 1SJMA 3NJHA 1R1CA 3FU9A 2YXVA 5I6PA 1X9RA 4DP4X 3G5WA 4HCIA 4KOCA 1OCZB 3T6XA 3N55A 2TSAA 2CALA 3FU7B 5PAZA 1AQ8A 1ASOA 1NIEA 1SHWA 3KW7A 1PZCA 5AZUA 1FFTB 4A2EA 4DPCX 1J9RA 1IBZA 4X4KA 1RZQA 1TKWA 4G7QB 4KOBA 5I6NA 4BWTA 4F2FA 4NAJA 4PCYA 1VLXA 3BQVA 2ZXWB 2GC4C 5FC9A 1BYOA 3NT0A 2GBAA 1BXAA 1WA2X 2PPAA 1JXDA 1L9OA 2DYRB 1ADWA 5AKRA 1PCSA 2TSBA 1JXFA 1PLBA 1SF5A 3S3DB 4BK5C 2IDSA 1SDDB 3QJUB 3NJLA 5B1JC 4DP6X 2MTAA 1MZYA 2UXGA 5TK4A 1A4CA 1M9WA 2IAAC 4HCGA 2OV0A 3KW8A 2PPCA 2PP9A 2R7EB 1PNDA 2XXFA 4JKNA 4A2FA 3TBBA 3S8GB 6PAZA 5B1JA 1W6WA 7PAZA 1ZPUA 3PCYA 1ETJA 2IDTA 1AAJA 5B1AB 3X1FA 4W9ZA 4DP8X 2IH8A 3OMNB 1NDTA 3DKHA 1A8ZA 1DZ0A 1ASPA 1PZBA 2ZOOA 5B7FA 1ID2A 2VW6A 2X88A 4DP0X 2Q5BA 2I7SA 1I53A 1NIDA 2XYBA 3NP3A 1NIBA 2CBPA 3EH4B 4FA7B 4YSUA 2YAMA 2BW4A 1NWPA 3QJSB 1CURA 3ABKB 5AFAA 3SBPA 3QJRB 1GY1A 3CVBA 1AZBA 3OM3B 2FNWA
chains in the Genus database with same CATH superfamily
5MEPA 2WWNA 1MN4A 1MLBA 1KG0A 2XA8H 4H4NA 3SBQA 3O2DA 4U1IB 5FB8A 3IDXL 4PJ9D 5J6GA 4RA0C 1ET7A 3IJSA 2R8SL 2R1WA 3W57A 5B7MA 2YLKA 3UGUA 4JZNB 3V4VA 3OKEA 2XNAB 4FLRA 2HAZA 1OOAA 4DAGL 1HHIA 1JHTB 5IEHA 4YHZH 1ZAGA 3EH5B 5BW7A 4OUUA 4MDIA 4UT9H 5F1NB 5F7EL 3WMPA 5BJTB 5M7QA 3UJIL 5DU7A 2Y5TA 4DKTA 1IGTB 1S5IL 4JO3H 2VC2H 3N6YA 1Q94B 3HPLA 4GAGL 1KCVH 1W72L 2GAZA 3HHRB 3TPUB 3UTQA 4G42A 4OF0A 4MD0A 2O61A 1U8HB 3QJHB 4IBLT 4LKXB 1LNUA 5I1JL 5CWSB 4ZFQA 4AKOA 3B2MA 3R4DA 4PJ8B 2FH8A 3CHOA 4HF5L 2AMGA 4N0FB 4PJ7F 3DUSB 1NCDH 1YVLA 4I85A 2AXHA 4OLWL 4ANWA 4KVCL 5HYFA 5KN5A 4HKZA 3DVGA 3T1FB 3NIGF 4X9IA 4NBYB 3S2AA 3DMMD 4BDVB 3CFBA 5FM4A 1A4JB 3UPRB 2MSPA 5HYEA 2YKLH 3PQYB 3OSKA 2EDYA 4E5XA 2WZPD 1XCXA 2YSTA 3FO2A 3P3UA 5J0BA 1EO8L 5GSRB 4ZUVA 1DBAL 4UAHA 1KB5H 4HWNA 1M56B 5FGCB 4DVRL 1V5JA 2WKOF 5I71B 4OM1H 2NX5A 3SKOB 5CM1A 5IFHH 2O5XL 5F21B 3LSOB 2BNQB 5AW5B 2BH0A 4PREB 2COVD 3DETC 3VUAA 3ZR5A 1C8QA 1D5RA 2WCSA 3NFNA 5KYUA 4X6CF 1HJCA 3QORD 1BFSA 4L0YA 1MCPH 2R2HB 3MRGA 3PHSA 2A6IB 2V5YA 2TAAA 4B97A 2VMFA 3TPKA 1J86A 4G7VH 2KPNA 5DD1L 4HCRA 3VXRE 3ABGA 5J89A 4UBDD 4RFNC 4P2OA 5KYXA 4RISL 5IB3B 1SMDA 5EU3B 3VXMB 1F58L 1GYVA 2YZ8A 2PR4H 1LEKB 2DQTH 4G1EB 2GTWB 1QRKA 4XCNB 3SKNB 3X1NA 2R0KL 2OTWB 5CUSL 5DR5L 5H4YA 4MMZB 4HJEA 1EMTL 2JCCE 4H1LB 2G3XA 2X4NB 6FABH 1RAMA 1MIML 2WSDA 4I0PB 5C0DA 2CCWA 5TQ2H 4IU3B 4OD2B 4UTBL 2VDRH 4TSBL 2ZD0A 3WJJC 4NZJA 2LTQB 2WP3O 2Y7MA 4KK6C 4PJCE 1PTZA 2FLRT 5F3HA 5T1LB 2VUYA 3MR9B 5LB1A 1PLAA 3U4EA 5GRJH 5J12C 5IW1A 4N2NA 4EIBA 5IGXH 2NY6C 2E6QA 4C56E 2R9HD 4LLVB 1PZDA 1U3ZA 2F53E 4NC1E 4EJ1C 1A47A 2WKOA 4RA3A 5G4MA 1J1XH 5AVUB 2OL3B 2ZKWA 1TFPA 3C75A 5JO5B 1QW8A 3QXAB 1QABA 3IETA 1HESA 4TLKA 3PJLA 5EU5B 1FYTA 5FOBB 1Z9LA 3CH1A 2XFGB 3K4ZA 4V1DE 1ITCA 4F33B 4JG1L 2VE6A 3M1BA 4Y4HC 5I26A 4Z76A 3IWUA 3L5JA 5ACLA 3BZEA 3MLVL 4JKLA 3SD2A 5A16B 2FO4B 3STLB 3HI5L 1IL1A 1I3RB 4IRZL 4HSQA 3EOBB 5DJAA 4JY6B 3UBXG 2NY2D 1LO3H 5GHWL 1UACH 2KLTA 3A67H 4KQ4L 4L8SB 2EXYC 3F12B 4PTTB 5CLZA 3W39B 3B2UC 2B4CH 2EH8L 2BP3A 5EOTA 4HLJA 3UTSB 1D6VH 5ALCH 1IUZA 4PVLA 4ELKB 4LVNB 2RCSL 4PRPB 1Z9NA 1A3LH 1SVZA 2FL5B 2J2ZA 5FYLD 5DTFB 4AZ8B 4LSVH 4TUOA 5I17A 1MJUL 1VFUA 2EH7H 1XGRA 1RJZB 3FTVA 3CQPA 3ZL4H 3FRUB 5FW8A 1MCLA 3WTUA 4EI0A 3RRQA 5C0CA 2MCAA 3HI1A 4H40A 2F19H 2CJ3A 4XPTL 1LJMA 3VFNA 4LF3B 4O2EB 2BOCA 4NX0A 5E70A 5FGRA 3B9KA 4K5NA 4EVNA 5JW4N 3ETBF 4U0RC 4Z8FL 1EUUA 1Q90A 3I50L 3SE6A 3L48A 2DQGH 4ADGA 1JYXA 1NMCC 5I6XB 5FF6A 2Z4QA 1T2QL 4CSPA 4UUJA 2QADD 4KXZH 4EIZC 3TASA 4BBWA 3KVQA 2EO1A 2X4TB 4RDQF 3FT4A 4JFXA 5I5RA 3MRMB 2Q0ZX 3IE4A 4XPBH 3SYQA 2ICWB 1CFNB 5IROD 2N7BA 1KB5A 2WYHA 4PRHA 3TCXA 3V0GA 2ICWJ 4LMQE 2NX5E 3QJZA 4A7UA 1BZ9B 1CLYH 2EIKB 4KKCD 1FL6A 2A74C 2CK2A 2YR3A 4Z77B 5EBLB 2GUOB 2CE6A 1WYJA 4ZMYA 2UZIH 2W38A 3UOAB 1OEZW 3CZJA 1J9TA 3IB4A 1OV8A 4JANA 4JPWH 1AMXA 3D39D 4U1JA 4XP1H 1XGYH 1L6XA 1GGCH 2I85A 6TAAA 1HQRB 1TJIH 2C9QA 1BGXH 3P77B 4JFYB 5GISL 4FQHB 3RPIA 4U33A 1YN7B 1XCQA 4GP4B 3W2DH 3CD4A 3WHXA 3MRCB 1BOYA 1BYPA 1UFUA 3SE3A 1SN0A 3TT3L 5MEQA 4K5MA 5CP7A 4QRBA 3BVXA 4JKPL 3ULUC 2QQKH 1Q1JH 1LO0L 2GFBB 1UWEL 5HHPB 5IJCC 3GTTA 3ARPA 2BLFA 4NERA 3MCKB 5IBUG 4ZMOA 1NGWB 2O6PA 3OR7B 4A6YB 4JNXA 3PJSB 2NNRA 2VZ1A 1RK7A 2GT9B 3DHJA 4YHNA 2RB8A 5T1DL 1A9BA 1RJYB 2J57A 3E2HB 3C2AH 2Q6WA 5DMKB 3RVXC 3T4YB 1OCWL 2BMKA 4AVJA 1R3IH 2SODB 5EF1A 5GGTA 3MZTA 3WUWG 1IFRA 1NGYA 3X11A 3N2JA 1TZGH 3O6MH 5A6LA 3EDJA 3QO0A 4HZ1A 2FB4L 3APDA 3IBEA 5GRUH 5HJ3A 1EAPB 2O5ZH 4OLYH 3NBNA 3EBAA 5HPMB 3GBLA 2PYEA 4JS7A 4L0PB 1W91A 4YZFF 3SPVB 5EU7E 3WJMA 5IHZA 2FQDA 4HH9A 5E08L 4F7EB 3MTRA 1TUPA 35C8L 1NFDF 3CDZB 4LHUD 1BFOB 3ASWA 5EO1B 3ZT6A 3EHBD 3EZ8A 4PD4J 5F9OL 3RWCB 2GJPA 1XT5A 2BVOA 2BWDA 2DQUH 1NAMB 4KY1H 2HPOA 1RERA 2Q7AA 1LWRA 3AFLA 2W94A 4K94L 4YGAB 3WN6A 4OM0L 2OM5A 5L6YH 5DJDB 3FH5A 4Z78A 3MFFA 1GIGL 4TNEA 4BIKA 1IC7L 3M45A 1JZGA 4PAZA 3VXOA 4XNZC 1JTTA 1EJOL 2OK0L 2Z31C 5BXFA 2CO7A 3R06A 3ZDWA 3CHPA 1S7VA 5E9DD 4ZUSA 2D7QA 3W9DA 1UOWA 2Q8BH 2XU9A 4HETA 1AIFA 1X9UA 4JFOA 4NHUA 4PLJD 2IADA 1OSPL 4N1EA 3G6DL 4UCFA 5HGAB 5SWZA 3VFPA 2VLRB 4HUUA 3ZDZE 4K2UL 3V0EA 1E6JH 1PLGL 1QHPA 2KZ1B 1T66C 3EOAB 5B7EA 2EC9T 2X2HA 3QDAA 3B5HA 4PY8I 1FA4A 3BP4A 3VM7A 1B0RB 1WD9A 1A6AA 3QUZD 3EYUL 4G6ML 4N5EC 3O2DL 1SXSA 4HLZH 2YGQA 4GBXB 3B6SB 3PGFH 1HI6A 1S9YA 4U3XA 5HGHA 2FWUA 1RU9H 1C08A 2IDCA 1NFDA 2MRYA 1MRDH 3B7YA 4Y2DB 4UNVA 4JRXA 2DTSA 1Q0XL 3M8OL 1R1CA 4L37A 4F20A 2UY6B 5D7JD 4IOFC 3JV6A 3L1OL 4AUYA 4DP4X 2F1AA 2KZKA 3OJMB 4KOCA 2UZXA 5EWIH 3VU1A 3WEOA 3AABA 4FXGB 2Y25A 3TBWA 4IIQA 2EIBA 2WWKT 4H25B 3O6FA 4JM4H 1IRAY 1FL3B 3TIEB 5AZUA 5IB4A 1ITBB 3P30H 2Z7WA 1DLHB 1AO7B 4BV1A 3NK4A 3ZDXE 1BPLB 3H3KA 3DBXA 4NAJA 2NNAB 5EBMA 3LRKA 3ARFC 3KH3A 3LN5B 4ZOBA 1YEJH 2P52A 3HTLX 4XCEB 2OJEB 4DETA 3VWKA 4Z0BL 3RX8A 4Y9FA 3N1FC 3RL1A 3RKDC 5DD3L 4RX4D 3HAEB 1IGIL 4EIGB 3BMWA 4CSSA 2ZCLL 5MENA 2EDMA 4ZX5A 4NQVA 4GS7C 4TSAL 1DHKA 1SDDB 1TQTA 3NJLA 4JFDA 1DL7H 4LPWA 5B1JC 4XMLH 2EE9A 5FLUA 4BFBD 2V5MA 3S34L 2ERJC 3IFNH 3DWTA 2Y06L 3QUGA 4I5BB 2Z0BA 4ZMLA 3WAJA 1CLOL 2WZ0A 2IAAC 4HCGA 1P4LA 1YPZB 4OFVA 2ZXQA 4DO6A 4NEHB 3EIFA 5HI4D 4D0BB 5FO8A 2BJML 4I77L 3HN8A 4X0KA 4Z6AT 3ZRSA 4OKVB 3BRGC 4W4NA 3S3PA 4PGBB 1MCEA 3T3PF 2WHVA 5D1XA 5IOPA 1QZ1A 4EE2A 1PZBA 1DSWA 2XTJB 3LS4L 4YJZL 3BP7B 3EBIA 4ENEC 4FA7B 3PWLB 4HCRL 5K9KA 2BW4A 4NQDA 1XF2B 4F5CA 4QUOA 5AFAA 3EO0A 3Q3GA 2CRIA 1UXLA 4RGOH 4KUCF 3KR3H 4YAQB 5IJKA 3MGAA 3LEVH 1I7UB 2Q1EA 1T1XB 2DKSA 1SFHA 1Z32X 2UZYB 1JWSB 3PF2A 3BAXA 1FG2A 3WFDH 3RIKA 5I1CH 4H20H 4GXVH 1A6ZA 5C0FA 2NMSA 3WKQA 4FLSA 5T1KB 3OAWA 3AAZA 2FSEA 4WWKA 3V4UH 1MI5D 3OAYK 4AC4A 2E9GA 1UD5A 1K8DB 4ELDA 5LWYH 3FSWA 4W9LC 1BQHB 1T5XA 2WAQA 3GIVB 2D7TL 1CDHA 4L1HA 5I1KL 3STZA 1I8MA 1C5DB 5IFJB 2ZKYA 1MFEH 1A25A 1ZLSH 1KCUH 3L4UA 1P4UA 1EGJA 4OF5A 2R15A 3U48A 4ZOEA 4XI5D 5BVJA 2OQJB 1KXQA 3F05A 3K6SB 2BHYA 3BZ4B 4PJGB 2EYSB 4I9WE 4XAWL 5FUCC 4OZIA 3ZQXA 1R0AL 1XGQA 3CFCH 4IU2A 5D4IA 4AVKA 4P5KA 3WNKA 2GJ6A 3NZ8A 3SYCA 4YDVA 3NESA 4MNGB 5DDHA 1FZMA 3MLTB 1GYCA 2HVJA 2XA8L 1QPXA 2OMXA 1BFTA 2PNDA 1ZKAA 2CHZA 3BGMA 3JTBA 4WZ9A 4BQ8A 3WTWA 4P9HH 4F9PC 4XVTH 2B14A 1KDJA 2Q86B 4JRXE 1QBMH 4I89A 4WNQA 4XODA 3HUJF 3SYOA 2BC4A 1IGJA 1Y0LB 2P5WD 4M1GH 1KLFA 1EZVY 1KZYA 3K71A 1KC5H 1MVFA 1OTUC 1QFWI 1WC7A 2F9BT 5DZVA 2J56A 1AZRA 5J12B 4JLRA 4NWTH 3KEHA 4MXQC 2NY6B 3LQAL 4TKWA 4NO0A 3QUKB 4FQJH 4U1LB 3GKWH 5JW5B 2MHAB 4JRYB 2ZKHH 4OBRA 1GGIH 5ICYB 4ZXBD 1IEBA 3EGSB 3O3DA 3QBTB 2QZ5A 1DJGA 1KB3A 2KH2B 4P3CH 4WTZA 1JCKA 5JIMA 2OR7A 4M03A 2Y69B 1U4EA 3CVHH 2WQXA 1IGYB 4FJZA 4GUPB 4V11A 2XN2A 4Y4HB 3LV3B 3E6FA 1IVTA 1NCDL 2RACA 3VMPA 4A1RA 1TZHA 5HDQL 4JFZL 1COBA 4U4BA 3UACA 1ND0A 1A7OH 3K6IA 2EDJA 3F84A 1JV5A 4WTXA 4X8JB 1BREA 2QQLH 4QRFA 4XVJL 5T1JA 2K6ZA 3GSUB 1Q9LB 2ATKA 2CR0A 4X99A 1LE9A 2HMID 3PL6D 4IEFB 1BAFH 1E8WA 3UP1A 1KPRA 2BSCA 2RBLA 1E4WL 3NABL 4PWEA 5IFHL 1NGQL 1UXWB 5FGSA 1DZBA 4JG5A 5D1XE 4RIRA 3N41B 2HT3C 3QNXA 4YDKL 2YGPA 1NGXA 2AK4A 4LMQI 3EADA 5LNGA 3GD1C 4G43B 4G7SB 1IJ9A 5DZ9A 5I0XA 1LO2H 1NBQA 4PV9B 4Q74A 3F7KA 4U0RB 4NQDE 5EN2A 1N6UA 2Y7SA 4F5CE 2JKJA 1IQDB 1GXEA 3QEGL 2GW5A 1A4JA 2WWMD 4YDLC 1HXYB 1NSNH 2DI7A 2V7HB 1RUQH 3GSQB 3KBPA 3X12A 4HIPA 1JNJA 3A3YB 3P40A 5GSRA 5I1EL 5HYQB 1PAZA 2IDQA 2N0MA 1G7QA 1MHPH 2NY7L 3SPCA 2K7PA 4AGLA 5I66A 2A6DA 1ZS8B 3BDBA 1AHMA 4LAQH 1I3GL 4U7KA 1P4BH 3M1CA 4OF3A 4M1CD 3POHA 4ZPVA 1BQLL 5LGHL 1I7ZB 2MKLC 3FH8A 4PJ9C 2VH5L 3KJ6H 4NO2B 1I7RA 2WO3B 4YSPA 2CKBH 3VWJD 1AS6A 3WE6A 3WMQA 4OKDA 1BDYA 2VMCA 1B4JL 3FRPA 2JV6A 2FZ3A 4YXHL 4D8OA 4K3DL 4G1MB 4DUXA 1K4CB 5GGTL 3QDGB 3GI9H 2R39A 5C0RH 4Z7QB 1CDCA 1KEML 1IKNA 2D3VA 4EKXA 4OZIE 3R4RA 4L4TD 2Q2EB 3MRDA 4UM8B 1EXGA 1J0IA 3ZIYA 1E6OH 2GJ6E 1UQSB 4WSJA 1R24B 5M95B 2V17H 3P54A 2E9WA 3PUUA 2AJZA 3U2IA 4N6RA 4XN5A 4BFOA 3CLEL 1I8KB 1N26A 3TBCA 5D70H 4D8PA 4RQQA 3ZYIA 1YAIA 5DWPA 3MLUH 5T1LA 3UTPD 2IOIA 5E24E 2HVKA 1AXSB 1P1ZB 1LO3L 3MRBB 4XO9A 1MH5A 5K93A 1UACL 3ABZA 1D7DA 3A67L 5FA4A 1O7DE 1LWHA 5ID0B 3DMMC 2IANB 1R5WB 3WSQH 5IFAL 4NQCA 2VDKH 3OGCB 1BJ1H 5ALCL 3UC0L 3ARDA 5CMAA 1IILE 5AVVB 2E6JA 3V0WL 1N8ZA 3ZUCA 3S8FB 1RIUH 3PV6B 3QA3A 2R0WH 2I07A 1JPSL 3T65A 4NQXA 2VDOB 4NYLB 2YO3A 4Z3EA 4PJBA 4G5AA 4KK9D 2JVUA 3SHSA 3DPBA 4MTMA 4TF4A 4YUEL 2WC7A 3CVHA 4NDMA 1R47A 3OHMB 3QORC 5E8DH 4AQAB 3V4PA 1YCSA 3X1GA 5HYIA 1XZ0B 3KLSA 4EDXB 2XKSA 4UINL 1MQKH 1FG9C 4N2LA 3HC3L 4N2HA 1A66A 1ES0A 1OAUH 2A3TA 4UBDC 3SBWA 3UTSA 4FZ8H 4K3JH 1E42A 4J12A 1MOEA 3AM8A 2OMWB 1K4DA 1OAYL 2QVIA 1PKQB 1UWXH 2NDGA 2LFEA 3FQXA 4PYGA 3W0WB 4ZSOA 3GMOB 3N43B 1YN6A 3ARBD 3LZPA 3W5MA 3NRFA 1P7BA 2Z65C 5INCA 4EZKA 3DOSA 1LE5A 1CLYL 4XNZB 2H2PD 4KV5E 1R19A 1U8MB 1UXSB 4MNHB 3QDMB 2Z31B 3CGTA 5F9JB 2L3BA 1IM9B 1P5VB 5FKPA 1DBML 2O1AA 2AK4E 4GRMA 4GQRA 3RWJA 3NSCA 3O45B 3EGXB 1JBJA 2W59A 1AGCA 5AAMA 2UZIL 4KY2A 5IWLC 1TSRA 1S2EA 2ZWLT 2IPTH 4N8UA 3MV9B 5I76B 3U2SA 2R9HC 5IMOB 3I02A 3AG4B 4G80B 2ZXCA 5DQ9A 3P73A 3QVAA 3EJRA 4FQIL 3VFSA 4PN6A 4HHGA 4A66A 1JGIA 3FC8A 5ITFB 2A7BA 3VG0H 5L2KB 3T0XA 3OGOE 2KMWA 3P9LB 4HALA 4X83A 5E0FA 1G5GA 5T8IA 2WNWA 4LSPL 3QUMB 2CGZA 5D1ZC 4ANUA 3C5SB 1CGSL 2X9WA 5D7EA 3MPCA 4HX1A 3P9WB 1M6OB 4YR6A 3EOYG 1C16B 2FECL 1EHXA 3CIAA 5D72L 4YHOL 3MFGB 4MS8D 5ALBL 3GSNB 2JI1A 5F89A 4TRPL 5LGKA 2ATAA 3S96A 2YAHA 3WO3B 1NCBL 3CXDH 4QMEA 2JKTM 3VXME 4HS6B 3ZVVA 3D8MA 5AAWA 5HI3D 3H7BA 3QDJB 3DX2A 1OT2A 1NCHA 3DRQB 4HT1H 4V2BA 5E51A 3EYSH 1A7PL 2GI7A 4HXBH 2B1HH 3IJEA 4RAVA 1V10A 1KB9J 1FHNA 3U82B 4FHBD 5H37A 3ARFB 3TTYA 1VFAB 4OZFB 4AL8L 4F2MB 5I82A 4BZ2A 4PB0H 4I2XB 3VTMA 2FX8L 1C5BL 3C6SA 4GO8A 5EOQL 4QF1A 4GS7B 4WIQA 5KUKA 3IMRA 1M6UA 3TO4D 1EK3A 1F3DH 3V5DA 1ZVSB 2QHRH 3WKPA 2X1QA 1QASA 1FH5L 1SJHA 5MERB 2DQUL 3B8SA 5DRXB 3ZX1A 2WBXA 5C9KA 5L6YL 2H5UA 1FVEB 3GNMH 2QADC 4NQCE 4YFEA 1EA9C 4U3HA 3IJYB 3L9EA 2GJRA 2IWGA 4EBQL 2BZDA 3ARRA 3AS3A 5LUMA 4F3FB 3JXAA 3IDGA 5IROC 4LRNL 3TFKD 3QUXA 4KK5D 4UB0L 5BVPH 2H26A 5D7KD 3R1GH 1A6WL 1EGJL 4PJBE 1T0NA 2ATPB 1U93B 3LMJH 4Y4KB 3VFWB 4B9ZA 3U46B 1QSED 5GRZA 4TULL 2PCXA 1T3FB 3L3HB 1CXHA 4OFYD 3P3YA 1QFUL 2C7FA 3EG9B 5E6IB 2WMPA 1MW1A 3B5TA 4ONFH 4ATWA 4QO1A 3GKZA 5E94A 3UTSE 5DJDA 1N5AB 4M8QA 4RFEB 4R3SB 1CD1B 1I1FB 3NFSL 4KTGA 4CNIA 5HBBA 4WU7B 4JY4A 2JXMB 4KJWD 4L3AA 5ERWA 3BWZA 1VKXB 1NPUA 5ESQB 4ZSOE 1K72A 4HKBA 4QYOB 2V5TA 4TVPE 1JXFA 5ESVA 1XGPA 2X3CA 1FFOA 1SF5A 2ZOKB 1EV2E 1SGKA 2IO5A 2PO6A 3IDYB 3S3DB 1AY1L 3ILQD 3N44F 1AC0A 2MTAA 5EU6D 2FEEL 5GIRA 5EWIL 5K9OA 3VDCA 5JOEA 3E80A 4HC1H 5HHMB 4YBLC 3S5LG 2HA1A 1XAKA 3X13A 2NYKA 5KBMA 3V5KB 2PP9A 3EOAA 2R7EB 4JFFA 4MDJA 1PNDA 1KGIA 5BS0B 4L8DA 4OY9A 1K9TA 1P6AB 4QRSA 3CZFB 4MB4A 4DKDC 1XH1A 2AXJA 5LCVL 2IH8A 3II1A 4F57L 3UFIA 3S36X 1DZ0A 4NAQA 4K5PA 3FT3B 1ID2A 2ZSVA 5H2BB 2WXHA 1MWAH 3L3KA 3CLFH 3VJ6A 1QRNA 4XCYB 5CEYB 3T2PA 1RMFL 1XGZA 4GSDH 4M6OL 2VAAA 1P84K 4LL1A 4UQ3B 3S36H 1T6VN 4XMLL 1AFVL 4Y16B 1FO0H 3MRJA 3R0MA 3L4TA 1LK3H 3IFNL 2G2RA 4NCC2 2O26U 1I82A 3EHBC 4PU2A 5F7DA 4X6FA 3TIDA 1WFJA 4WRLA 2FECI 4LESA 1HQ4B 5BOZG 4F91B 2YUWA 3D25B 5E99L 1BYNA 2ID5A 3TWYA 1RZGA 3V6FA 2APBA 4M9PA 3U25A 1O5DT 3CN4A 1W16A 3MRPA 3TEXA 4ADIA 1BQSA 1FPTH 2BNUA 5F1KC 1A4KA 5ANHA 1KTLA 1EO7A 3BPLC 3DUUB 1AP2A 4LLYB 5E1AA 3A6CL 1SVCP 3MVSA 1AQDA 3MXWH 4WDIB 3HPJA 4OJFH 4RMSA 1AXIB 5LNEA 2B39A 4HWBA 4PD4K 1IQWH 3I6KA 4OTXL 4UDUA 5JHMA 3PAYA 3BE1L 3OKDB 4D9RE 3PABA 4K3GA 3WJLC 1XTMA 4PLJC 4A39A 4GUQA 1GW0A 1L9SA 2DEXX 2P8PB 5ID1A 5E00A 4Z7WB 4QRRB 3TA3A 1J9CT 4CVZA 3O4LA 1AHKA 4TUJB 4XMPH 2WW8A 4HJJH 5F0JB 5I8KH 2FH6A 1PYWA 1QLEB 1XIWB 1WDAA 1S3KH 1DP0A 1YY8B 2FWOA 2CK0L 4KKRA 5DRWB 3VYOA 2EADA 3AS0A 5HYJD 1SEQL 4JKKA 2GJJA 2X6BA 2PCPB 3L17A 2YPVH 5MEOB 3BP7A 2GPZA 4XE5B 3IGLA 5D7JC 2DLHA 1U41A 1E43A 3BQUD 4CC1A 4TNWK 3DTXA 5IB5A 3TBTB 3UROR 4NFBA 1H3WM 1T1WA 3EDDA 3QJVB 4XNYH 1JN6B 2IBZY 2XXGA 2P5EB 2X1WL 1W0WA 1CO1A 2ARWA 4YDLB 3CFCL 2PWGA 3U7YL 5JA8B 2GTQA 1FHGA 1HS6A 5DK2B 1DN2A 2WQRA 3IDJB 3FUJA 3QWRD 2F61A 3G04B 2J43A 1NJ9B 4FNRA 2D7MA 1GY2A 4XVTL 2F8OA 4HBCL 5IFJA 1KFAL 2YGVA 1I8UA 3QC6X 3WTYA 3OTTA 1GKOA 1THAA 4KTYA 4PWFA 3WO4C 1DJHA 4M1GL 4PJ9B 5DZLA 1JMXA 1V55B 3FFDB 3VW3H 3V7AG 1BQHG 1CUOA 2VZTA 2XWEA 2LQRA 2OL3L 1X7TA 4EZLA 1UZGA 5DQDH 2VIRA 4G6KL 3UPCA 4NWTL 4OIAA 3BW9A 1YECH 3ZHFA 3IFLH 3S5YA 4JFWA 4BCXA 5I0ZA 1MFCL 1BX2B 4U1SB 1EFXD 4LOUD 2HB0A 5HI4C 5IF0B 4F2EA 1YSOA 3LNEA 3HBQA 4AUJA 5EEUA 4X42A 5L9DL 4P3CL 4HP5A 4NT6B 1IM3B 4BCZA 2ZG1A 5H35B 2OCCB 5A7EA 3ECQA 4P59L 2AFNA 3H9SB 4K7FB 1MWAA 2C3WA 4CKVX 1QRNE 4QKXB 1AGEA 4FFYH 3V4PL 3BWAA 2E56A 4ZPTB 4NQED 4KRMB 1XD0A 3HCVA 1OM3H 3CUPA 2CG9X 1KJ3L 2G3ZA 2OMYB 3HHSA 4XPAH 4KVPA 4NN6C 2GSIA 3RPBA 4KKAC 4BGLA 1FO0A 4O9HH 1MIEL 4XWGL 2CRYA 3VGFA 1QFWH 3GI8L 5C0AB 5I30L 3DMMB 2PETA 3ZJAA 3MRKA 3N1QC 3WXWL 4MXWL 2RA1A 3VGHA 4TVPL 3FUIA 1V7MH 2XV0A 4LSRH 4G8IB 2WTRA 3ULVH 1ESOA 5JOFB 3SKJH 3QWOA 4PJDA 2APXA 4YXKH 1TKWB 2VN7A 2CLRA 2WB7A 2C9VA 5AZEH 3GF8A 3LZQA 1UCBH 2FJFB 1JPFA 2AABH 2FT7A 1X5XA 4FNPA 2VZOA 5C09A 4XI5C 2ENJA 2Q7NA 3MNMA 5GS0H 4MCZB 5J1TC 1NSNL 5KSBB 2OMZB 3BKCH 5EUOB 3ZO9A 3HG0A 4ANVA 4PJIA 2ZSWA 1EAOA 4L3EB 5AAPA 2E9JA 3HE6A 4IBWA 5IMLB 3IT8D 1G5AA 1KSRA 2F5BH 4M7JL 1K6QH 3O4LE 1U2CA 1Y1DA 5I0WA 1AQHA 1QR1A 5CHNB 5CGYD 3E8UL 1KJ2A 3RGVD 2EDTA 5K9QG 4WHTA 5E2TL 4LAQL 1OGTB 1DJIA 3OL2A 3BP6B 1F42A 3NA4A 2XKNB 4Z7NB 2G75B 4GI8A 2Y3AA 4F7KA 1K85A 3IGAB 4JFQA 2YPVA 1EAJA 4JFPB 4AMKH 4ZW5A 4K9EC 5DZPA 3ZL1A 1IQDA 3MMEB 3V4LA 2BOLA 5TE7H 3M6DA 1DUZB 2AJ3B 1U92A 5C0RL 1NCAH 1PAMA 1ED3B 2V2TA 5TF1H 1G7JB 4NKOA 3AQXA 4ALAC 1MFNA 3FCTA 1CFBA 3EJZD 2J1ZA 4YWGH 4BZ2L 1G84A 4IBZA 2Q3XA 3ARQA 2VR3A 3BO8A 2A74A 5D1ZB 1GZHC 3MA9H 2K4AA 1ECZA 4MQ7B 2WYTA 5SV3A 4K8RH 3CWGA 1KIPB 2XJLA 1OGSA 4Q6IC 5F1OB 4N3TA 4N86A 5E8PA 3REWB 2EICA 3ULVF 4PJGE 3QQXA 5DJ8A 5SX4I 4YLBA 4NRZB 5F7KC 5KYWB 1AR1D 3N3EA 2KDGA 3ARSA 4EI6A 4WGWB 2H6PB 2XACC 1RFDH 3N42B 3CVIL 3QAZC 2HMIC 3KWWA 3PL6C 4QOKA 5HVFB 3JWDL 5C08A 3O8XB 1PEZA 2BY1A 4M7LH 4JPIB 4NO3A 3UZVA 4JCLA 1MHEA 4PJHB 5IQ7L 3DSFH 1U8KA 2VABB 2BM3A 2V9RA 5IB1B 2NTFA 1BZDA 4M7KH 2YD5A 2Y36L 4FFYA 4JJ5A 1DEEA 4HMCA 2UVEA 3EJJX 3D0VB 3KXFD 4OV5B 3MOQA 4OSUH 3K6NA 1QFPA 4L4VB 3OC8A 3MUUA 1LWJA 1JGLL 2E47A 1F56A 2FO8A 2VISB 2WWMC 4K3JL 2RH0A 1DQDH 5LVEA 1HE7A 3ES6B 3GLAA 4J28A 3HZVB 2I7OA 3FB8B 4UIKH 3VU2A 1A7QL 4XNQA 1ACCA 1J8KA 3MOAL 3OKKB 2EDLA 4JM2B 2VLJA 4QLWA 5EOCH 4W9HC 1H8OA 4YIQB 4QRPB 1J05B 4XPFH 1ZV5A 1AZNA 1VPOL 3MRLB 1XBRA 2IFFH 4IOIA 4M1CC 4MDRA 4PJDE 4E9YA 2CLVA 4G8EA 5LGJB 2JMRA 3WY2A 1FN4B 3VWJC 1JPST 3KVPA 3CN3A 2YUZA 4GW4B 2IPTL 2XZQH 3NCJH 3V8CA 2AV7A 1ZD6A 2OXGB 4AIZA 3WHE0 4BSVA 2OMWA 4PJIE 2DWEB 4KKPA 1OF2B 1YDPA 4WW2C 4DGVH 5DJYB 4WFGD 3L5WA 3LEXA 4FL4C 1AG6A 5G2NA 4DKEL 1A3RH 1Q72H 5FV1L 4PG9B 2Z7ZA 4MA3A 2WVUA 4N2GA 3CZKA 1VEPA 5LKNA 4APQD 2XQYA 1XF1A 1RZ8B 1IV8A 4IMKA 4PRIB 4Y9EA 3WN5A 3FAXA 4WEEA 2Y1AA 4KPHH 1CZ8H 5KUMA 5F88A 3HR6A 3QC5X 4ZAKB 4JDZA 5FOJA 1CQYA 2DWDA 1BCIA 1IEAA 1AVAA 3LIUA 2CRMA 4QAMB 4WFFE 4WI5A 3W9EA 2NOYA 3RX9A 5T33L 4LLDB 3VFRA 1I8IB 3OXRB 4P4RA 1OD9A 3N06B 2FR4A 1CFQB 4HXBL 3OJDB 4M29A 3MUJA 4N28A 4APXB 3P0YH 1MVUA 5ICXA 5PAZA 5TDNB 2RR3A 5GGVH 1NIEA 3BEWA 4PY7B 5GSVB 1SYVB 4UIMA 3D5OF 2C1OA 1LD9B 5ADOL 1FLTX 4IGBD 4KK9C 1ZA6B 2DMKA 4HWBL 1MCBA 1TJGH 2OZNA 2XRAH 5IEKA 2DD8L 4BKSC 2VB5A 4F93B 5IIEA 1M1SA 5DJ0B 4ORGA 2P7TA 2XSKA 2ICES 4FQQB 5CZRA 3QDGE 5FYJU 1YYLL 2XN9D 2GC4C 3OF6A 5D7SL 1DBKL 3B9VA 3UTZB 3WNNA 4I4WA 4P48A 2GBAA 1BXAA 1ADWA 1NC2B 4OZHF 4KZCA 1C7TA 1T2JA 1M4KA 3CZSA 5AOLA 1BG1A 4OCWL 2WQUA 1HSAB 3FCUB 4MYPA 1GZPB 3QJUB 4BFFA 2OYLA 4QOKE 1Y07A 2VM9A 3ARBC 4OLVH 5C08E 5BVPL 4QTIL 4CSTA 3ZDYB 3K72A 2H2PC 2ZKMX 1OAXH 4I2XA 4KI1A 1DCLA 1JDCA 1PG7X 2EE3A 1ZT4A 2OXHB 1CLVA 2ARJB 3RL2B 2NT0A 2XXFA 4UQAA 3CQQA 1QBLH 1KPVB 5B1JA 5DLML 5MERA 3CHRA 1ZPUA 3QPQD 2Z35B 2OR8A 2ZF9A 4R96B 1ETJA 1KN4H 1AAJA 4HIQA 1K2DA 4BA8A 2ED6A 1WZLA 4ODUB 3KWVA 3T3MB 1PG7H 2C9PA 5EIQA 3HI6H 4HJGA 2WB1A 4NN7C 3UBXA 3QQ4A 2ZE0A 4ZI8A 1MQ8A 4FA6A 5F8QC 1E7VA 1ZLDA 3NP3A 1G6RB 1PZ2A 2VLJE 2EEAA 2H32B 1AHWA 1TVBB 4GKZB 3QJRB 4Y1TA 3N1GC 3RE0A 4P3WA 5L9DH 3IF1A 4M61A 4DGIL 1A14L 4XBMA 2JLPA 4NKDB 1SYSA 1NBZB 5F7MC 4E9QA 3V0AC 4GQZA 3NCBB 4TLSA 3TYFA 4JL1A 1GOGA 2MPAL 2X4UB 5C2BH 4PVMA 3ARWA 1L0QA 4XT1C 3FFOA 4DSYA 1JUFA 1KXVC 1U21A 1ZHLB 4NN5C 5LBVA 1VJSA 4G6JL 2NY5H 2VDMH 3UYPB 1G9NH 5ABZA 1R3HB 1PQZB 1DN0A 3A4AA 4PJAA 1L9TA 4U6XA 3GWJA 5K59E 5F6IC 3N9GH 1KIRA 3AMLA 3EGDB 3RQ3A 3G5YB 2CD0A 5DRZA 2QSTA 3U7AA 1CFSA 2FTAA 2W5PA 3LRHA 5E8NA 1IFGA 5HHOA 2VUOA 1B4RA 4HPYL 1ETB1 1PD6A 1TMQA 3LPOA 2QZQA 2UYLB 4Y5YA 1H6TA 4UANA 3WO4B 3GO1H 4X5XB 3SQOH 3T8MA 5D2LB 3QCVH 2R7EA 5C0EA 1LK3L 3TO4C 4DGYL 1MUJB 1ZE3C 2LE9A 2JELL 2VN5A 3RIAK 1BLNA 2F6AA 3BSZH 4M00A 3QIBA 3LRSB 3P9MB 4DJMA 4L0ZA 4MB1A 4XCFH 4DCQA 3DYOA 1KB9K 1VFBA 5L2KE 4EZJA 4XTRD 3NAAL 4NRYA 3LH2L 1ULVA 2WLMA 5D7LA 3CSYB 4L3FA 3JVFC 2F1EA 3SDXF 2ADFL 3TFKC 4F9PA 4KK5C 3Q6FA 4GFTB 3MXWL 1F3JA 2HG5B 3I75A 4AH2B 2L4OA 2PCFB 4UQ3A 1ERNA 5AB1A 4MAUL 2K9UA 1IQWL 3OZLA 2IGFH 1MHHA 2JCWA 3Q2VA 3FMGL 1QAWA 4YO0B 4WV1C 4PJEB 1Q9WB 3I3BA 4G7YH 3GXPA 3HMXH 1Y18B 1PZSA 4NN6B 3NSYA 3UGEA 2B2XL 4UNTA 4JDVA 4YPJA 2LV4A 3KNBB 1KJ2L 5I19L 1TTCA 1OGAA 3SCMD 2V2XB 3GSWA 4PYHA 3WTVA 4AXWB 1S3KL 3E7JA 4KJWC 2BP0A 3WUWA 5CCKL 3IXTA 4E0RA 5DHVB 4B0MB 4F2ME 1VACB 1KY7A 1IBGL 1C9SA 1SQ2N 3OWEA 5EA0L 1E3ZA 1G94A 1VEOA 3WY3A 1JK8B 2V3FA 4HJIA 4I2XE 3TTSA 3ILQC 4KHTH 3VXSD 4W81A 2AQRA 3VH8G 3MJ6A 1IB5A 2HX7A 3A0OA 1CVSC 4NNXB 4XNYL 2DTMH 4G5ZL 3QIUA 4Y8DC 5DUPH 1NEZG 3HLKA 4TV3A 2XDHA 4M62L 2J88H 4BYHA 1RUPH 5J6SA 1TTAA 1N0LA 3GHBH 3PWPA 3VFUB 2DBLH 2OX5B 1UM5L 5DXWA 1BG9A 5C0IA 3KDMB 2J6WA 2VXVH 3TZVD 1TZ8A 3Q1EA 2J44A 5L8LB 2JKIS 3KM2A 5I8OL 1DVFD 1ADQA 1QZNA 2P5PA 3BGFC 4NM8L 3F7YA 5EUKB 4AJVA 5CBAA 1CC3A 1FDLL 1TETH 2NSMA 4IYKA 3APFA 3L5XH 5HJDA 5BZDB 1T20A 1BQ5A 3IN0A 4LFHG 2EVFA 2MCPH 3TYGH 1RL1A 2FYVA 4N90E 3ORJA 1NH6A 4TYUA 5JHDB 3H55A 1WZAA 4N1CA 2R83A 4B27A 4BZYA 4FQ1L 3TBSA 1TCMA 2X0VA 4KXCA 2CXKA 2JKSA 1YMHB 2AJXH 3D52A 4PJAE 2EJ1A 3B9AA 4G8FA 1EVTC 2E6PA 4HFWB 4JZJC 3C6EA 2K1MA 4CVXB 2C3GA 1HAWA 2WLJA 2AMUA 2L7UA 1H8LA 1JD9A 2XG5A 4E9RA 3AWGA 4UTAH 5HHOE 4OLUH 4DVBA 3MNDA 3AG1B 2ITCB 1O6TA 5HHME 4X7FC 4PW3A 1OM3L 2W0FA 2IPKB 1YA5A 3ZGIA 4Q6IB 5I1HH 3D34A 3LB6C 5L0QC 1HHKA 3O41B 1TJMA 1T6WA 3H2PA 1MCOH 4FXKA 1G9HA 5FUCE 1N2RA 3Q48A 2VL5A 3NPSB 2XWDA 5L8KB 2VDOL 4LCUA 4JK0D 3QQ3B 3WS6C 3UH8A 3CMOL 3NQKA 4ZOCA 3RNQB 2DWSA 4FZEH 3QAZB 5D7LE 4QXVA 3PL6B 1SY6L 1INQB 2N56A 3DVNB 4MKMA 5FM5M 4ACTA 4PI2A 3MJ8B 4JQIH 1AS8A 2JIXD 5DC9B 3FT2A 1VAHA 3D69B 1ZANL 2HRHA 4IMLA 2B1AL 5AZEL 1JHKH 4PJFF 1UCBL 3NCYP 1W0VA 3BQUC 3LTVA 3GZQA 1A6TB 1E27B 4X6DF 4YDJA 4E41D 3MX0A 3FUMA 2ZTBA 1UKQA 4L9LC 1WBXB 5FO9B 3L3DA 2A6JA 2GJZB 3BAIA 5K1JA 3HMXA 1S9WA 2R2CA 1M05A 5I1AA 1GTNA 2WLKA 4LEOB 3FL7A 2WZPA 2GI0A 43C9B 3P2BA 1RZIB 3VMNA 1UZ8A 1OGAE 2NW2B 3RI5K 5BQ7A 2WN2A 1T5WB 3MV01 3ZPDA 4BRJA 5KOMC 1Y7VA 2HFEA 1IAKB 5I74C 5FYJH 1A1OA 4XN1A 3FTGA 4R4BB 2OSLA 1CTOA 5BV7B 3BJLA 1LHZA 3IDIA 5FKAA 1F4HA 1KGXA 2AQQA 2UUDK 3Q06A 5I2IA 4GUOA 4AMKL 2NNFA 3ZK0A 3QORA 3QG7L 1F86A 4KH9A 2BS9A 2J72A 3AADB 2AVGA 1NLDL 1A2YB 2NZ9D 2QL1A 1CF8L 1DLFL 1XBDA 2WNKA 4PJXB 3OPZH 1D5ZA 4I3RL 3T0EC 2ED7A 2I5YH 3NSFA 3VNZA 4J1UB 3I9GH 4PWKA 3PWPE 3Q6GH 1VDGA 4L4TB 4LOUC 4K71B 5DVKA 3CSFA 1JGUH 3FO1B 4X6DA 5D7IB 1BEYH 3VXTA 5I73B 4CJ0A 4KHXL 3RFZC 3PWVA 2HJKB 3LZFL 1WAAF 1FYTD 3PXLA 4FE9A 1YC7A 4X7SL 5AUMA 3VCLB 4AQEB 5T3ZD 4LVOB 3MOBL 3NH7H 4NUJA 5B39A 1R17A 2FGWH 4PIRF 2I9TA 3SQBB 4KO5A 4N8VB 3ASOB 3VI3B 4AT6A 3I6GA 1HFUA 1SMAA 4JO8A 4ZUUB 5IWLA 3RUGF 5D9SB 1OB0A 2ZG3A 3UTTB 2DQIH 3NMEA 4XN4A 1XF4B 5C7ZA 1U33A 3Q2CA 3WD5H 1ETZB 4E9VA 2C1PA 2BY2A 1RXLA 2DQJH 1JDDA 2BWIA 4QRQA 1CS6A 3IEAA 4IHOB 5DMYA 2BNRD 3JWNC 1CXEA 1XSJA 4HUVB 1QNIA 2E46A 1TITA 2CR3A 3A6BL 5TH2A 4ODHH 1A65A 1I7TA 1KIPA 3DI3B 4JFED 4P5TB 4P57A 1BHGA 1KLGA 2VXQH 4OBSA 1B4LA 3EYFB 4GKSA 1NZRA 1F97A 4G9DA 3OZKA 2PR9A 3TN0B 3HS0C 3KHQA 2FT8A 4UZUA 5ECJE 1KCRH 3B9KD 5FAAA 3RVWD 1HYSD 1DQDL 3V0VB 3PAVA 1C12A 3FHEA 4UIKL 5IQ9B 3Q7JA 4XPHH 1CG9B 3ECVA 3P4OA 2X1OA 2NQCA 2FCBA 3VSTA 3KCWA 4LSSL 3COOA 5EOCL 5CGYC 1IBYA 4FJ6A 3RGVC 2RTTA 5HI5D 2EYTB 3FO0H 4AEIH 3H9SE 7FABL 4AK1A 1JYVA 3RUGA 2KHAA 4DUVA 2IH9A 4NZFA 3WIHA 3LNHA 2J1XA 2X6CA 2EDEA 3G9AB 1GVIA 4J23A 3K2UL 4PWIA 3NZSA 4OZGB 3BVNA 3PXHA 1CBVL 4PRHD 2BSSA 2XBTA 3VXUB 9PCYA 5JQHC 2XZQL 4YEFA 4JEGB 3VO0A 3TM6A 2WQ8A 4H0IA 4X7DC 4HUMB 5DZJA 2J20A 4JO2H 3VSUA 3ZY7A 5JIDA 4QY8A 2FEJA 3U4AA 5BOPA 2O6DA 1PGRB 3QQDA 4XOCA 3OKKA 2EABA 3JWOH 1A3RL 4NN7B 1F4WL 3RDTD 1GGYA 4X98B 3UDWA 1Y1UA 1ZXKA 2LVCA 3EDKA 1OP4A 2YMOA 4HGWA 3CBJB 1JGEB 3EJZC 5IROA 1WWBX 4C4UA 4XHQA 5LJYH 5B38B 3MNWB 1T22B 2APTA 4UQEA 1BZOA 2CH8A 3HFFA 5FUOL 3T77B 4EUPB 5JLZB 5GZND 3D06A 1H9DA 3D3VD 1R3KB 2YPLB 1G7LA 5DZAA 3ZUNC 1BYOA 1EANA 5IW3A 2O93L 3JZYA 4YMPA 1ZHKA 2MTPA 1IGMH 5FCUH 4RGMC 5KSBE 2Y4SA 4LO9A 3G08B 4W6XB 3K1KC 2TSBA 4QXGH 5AG9A 3D39A 5DGRA 4KXDA 3K6OA 3BH8B 1GZQA 2WBJB 1TYRA 3QG6A 1AR1C 4QNPE 1HCFX 3KWUA 4F8OA 4NN5B 3C8KA 1MJJB 4XH2A 1TTBA 1HHHA 3BEVA 3LH9A 4WWID 1T80A 5TK4A 3B43A 3MYJA 4U1NA 4RLDA 1M9WA 1YQ2A 1F3RB 3MLWH 5HHNA 4Z7NE 2HWZH 1A6PA 1TZIB 3CDFA 1OPOA 4M3KB 5FWRA 3UBFA 4Z7UB 4F37K 5DJ6B 2ZOTA 1NM9A 4Q9QH 3EBHA 1E9OB 2D7NA 5BCAA 3MLYH 4JB9H 1X5HA 4N2CA 4HGKC 3MRQB 5C0ND 3GB7B 4HEMA 1OVZA 3RZCB 4N0YH 1OSZA 3KGUA 4DP8X 5L7XH 2PYED 4XB3A 1LMKA 1HXMB 4OCRH 2EUWA 3OKYA 3MKKA 1KZQA 5DD0H 1WISA 5BO1L 3D85B 4X4ZA 1K5WA 1WCQA 4W93A 4NFDA 2LU7A 4AYFA 3B8YA 2D7PA 4UV7H 5FDYA 3RFRA 3WIFA 4FG6D 3OZ9H 3HIZA 4QRAA 4JG0H 1A64A 2VLLB 3FTXA 3HKZA 2QGEA 5E6YA 5CEXB 2CZNA 3CZUB 2I60L 5ENWA 4OLVL 3GMPA 3ESMA 2ZG2A 1K8IA 1UUSA 3PP4L 3QWQB 2OYPA 4FRWA 4HCFA 3PPEA 1JL8A 3T4AC 1TEGA 1JWMA 4PGEA 3TA4D 5DJ0A 3FOMB 2JJSA 3PDGA 2FWSA 3PLYA 1QBLL 2QELA 2XI9A 1ILUA 3QPXH 3MJ9H 4N2BA 3UZEA 4LHUA 5EF0A 4LARL 2YK1L 3VVVA 1WA0X 3ZO0A 3V52H 4MA8H 3L8QA 2AEQH 2JQAA 3PWJB 2R29H 4IDJH 4S1QH 4WV1B 3TXAA 1PG7L 1VGKB 2XY1A 5TTRA 4QJ3B 4A6YH 2AF2A 4BFKA 2KS0A 2F54A 2WUCH 4Y5XC 2R56H 1FGNL 3HW7A 2H9GB 5FYLE 5SWZD 2EIDA 5GXBB 4WGKA 1ADQL 4PGCB 3ILPB 4YH6A 4APQC 3CXHJ 2Q8AH 15C8L 4LNRA 5I6LA 1YJDH 5HDBB 4F7MB 3QWNA 1F5WA 3SDDD 4XBPA 1DUYA 5E9DA 3RTQD 1KV7A 3V5HA 3FQYA 4WLCA 2RFXB 4G3YL 4L4VE 3D05A 3WJLA 5CIPB 4OCXL 5EZLB 1MFBL 12E8H 1ACYL 3DYPA 3N0AA 4MRBA 2V5SA 3AB0C 1OP3K 1IBDA 3N0PB 4GAYB 4KBPA 4NBXB 4M1DH 1JYWA 2E4FA 1G9NL 1V3MA 3FCBA 1JGVH 3ME0B 1HOCB 1OE1A 3I3DA 1JPGA 3HE7D 3QUZA 1SOKA 3SKMB 5FGBC 3VA6A 2W60B 3BMVA 3NRPA 4QCIB 5LXGL 2D31A 4JN1H 1PNCA 1NAMH 1ZK9A 2Z1KA 4F15B 4AEFA 1HDMB 3FU8A 5ITBH 1MAMH 1FNFA 2K0RA 1O6VA 4IGBC 3ZU8A 4GI6A 5D7JA 3TNMB 3CDCA 4KRLB 3MJ7B 4MQSB 5IJDC 1N6VA 4A7TA 2IAMB 3LKOA 3NZUA 4BFIB 3S4SB 3VWKD 4GUCA 4EXPX 4CJ1A 3HC4H 5FECA 4FQLL 4P3DA 1DFBL 3S3JA 3OKNA 4R7LA 5C3TA 4LEBA 3FU0A 1RZFH 5MEND 2WLIA 3O9WD 2WGXA 3SN6N 3D39E 1NCCH 5F7YC 3NJMA 3QIWB 2CDFA 4W9KC 3L95B 2HT2D 2TRHA 4JFDD 4LSTH 4PUBH 1YEIH 3L5IA 1FAIH 3SE8H 1RUML 1TFHA 3CN1A 3VFOB 3RKPA 3I6LD 4ZDHB 5L88L 2V6HA 3QRFM 4D3CH 1P9MA 3EYOA 3EUUA 1MFAL 4JZJB 4XO4A 2WIMA 5FCSH 5FK9A 4OFPA 1IC1A 1UATA 1FNGB 1NCGA 1UKTA 2ZUQC 4IRJB 4RX4A 1IAOB 2X12A 4PRAB 3KPPA 1UM4L 4DN4H 3TVMA 2IDUA 4HEME 4L8CB 2YA2A 4R26H 3GPSA 5DD5H 5E2UL 3B5GA 1E4XL 4XP9H 3EJSA 3Q44A 4N1HB 3QPQC 3DHMA 3HZKA 3L3IB 5FO7B 3OMAB 2P24A 5KWYC 2AEIT 5DEGA 3SKUD 4YGVA 2A4ZA 3BDXA 3EOTL 2YUVA 3KYAA 5KSAB 3O2VH 3UO8B 3DROB 3WV0A 1H15B 3EO9L 5F9WC 4UU9A 4M93B 2PW1A 5F3FA 2E7MA 2YAOA 3FJTA 2NPLX 2UWEF 5EIIG 1O5PA 1RIHL 4JG9A 2H3XC 3GSXB 1KNOB 4FG2A 2R1YA 1DEDA 3MLXL 3TBVB 2MH4A 4PMEA 4RGND 5E9AA 4DZBA 2NUPA 4LLMA 2AZUA 2QMJA 4U3SA 1BMWA 2X4QA 4ONHB 5HGBB 1E9PB 1X5MA 2G5UA 1HCYA 2K9FB 4U6HA 2XFXB 5IBTL 3SDYL 5GJTL 1VGEH 7TAAA 2VJ8A 2HUHA 3KPQB 3QP3A 1AGDA 5DHDA 2OSYA 3N85H 4IM8A 5BRZD 4U1HA 4ZFFB 3J07A 3RHWF 1JSYA 3LRGA 1E40A 2YWZA 5F0LB 1L9PA 5FYKU 3ESVF 4Z0XB 3ZDYE 4AI7A 1OKEA 3H53A 1J9QA 1MI5A 4J3TA 3VFGL 2HN7B 4HFUL 4X7TB 5KVFH 4TNWF 1QLRA 3PWNB 2P26A 1R5VB 5E9DE 4LU5H 2MCPL 1KBWA 2ZAIA 3EFFB 5DO2D 4DHLA 1ZA3B 3FQ4A 1CT8A 3ZE0E 5D1QA 1J5CA 3QFDB 1HHGA 4KUCD 4M4RB 2QPFA 2R27A 2UWEA 3DGGA 3AQYA 2OX5A 3L4YA 5AVRB 3T0EB 5IMMA 1JI2A 3FCSA 2VLKB 4ZW3A 5ETUB 2F58L 1UT1A 5CJBA 4XTRC 1F6AA 1I9RH 3II3A 4HKJB 1EFXB 1N0XH 1I3VA 5AYQA 3GRBA 5EUKA 1FUNA 3RWHB 3TWCL 1HEHC 5EBWA 5ABDE 2W92A 1OIOA 4BXSV 5JHLA 4OLUL 3QHTC 1XDTT 2NY3D 2AJSH 4Y7OC 5J1AA 4PV8A 1MFUA 3MGOA 1J0HA 4H88L 4KRPB 1DE4A 2P5WA 1T21B 4GG6B 2JQZA 2IXQB 5IOKA 3WFCL 4DN3H 1J8HD 4ZMQA 3ERXA 3KVDD 3C60C 5E6ZA 1HL4A 2A1WL 2ORBL 3MNVB 1MCOL 5FYLL 3S5LA 1NANI 4YSRA 4TNVK 5E5MA 3CSBA 2IOMA 3NUKA 4WFED 1WP6A 4LHJB 1MJ7H 4YPGA 3MXVL 5CD5D 3SCMC 3QT2A 2WVVB 3KYMA 2XETA 1WHOA 1CFTA 4XGZA 5IG7A 1CXIA 3HG1B 4KTEH 4LPVA 1T1ZA 4ZXBA 1E8XA 3WIHL 3UERA 4FN0A 4WCYL 1KGCD 1B90A 3D18A 3L3OC 3DDGA 3BRDA 3SPIA 1TQBB 3IJHA 3M17B 5I6MA 2LHAA 4L1DA 4AKPA 3T6ZA 2JKNA 4PW4A 3WFEL 4FQXB 3TJEL 1FORH 4Q6IA 3RB5A 3P4MA 4WKZB 3DSNA 3T1WA 2VDQH 1NUGA 2IPUK 2MJWA 1GC1C 5JORA 1YPZF 5CBEA 2E27L 2YOAA 3DYMA 2CLZA 3G5VB 3LZRA 4HK0B 2OP4L 2WIIB 4HDIB 4ONOA 1FV1A 4I0CC 3FHAA 4MAYD 4HIJA 1QWNA 5HVWA 5AOMA 4DKFL 4NZ8A 3V6BR 3PL6A 4JZOB 2ITDA 5CLXA 1K5NB 3TZVC 2BOBA 3AGVA 4CL7A 3SB3A 2ARJQ 1JNHB 1KBGH 4ZS7L 4OB5L 3BZ5A 3LIZH 2JFCA 1M3JA 3SSGA 4S1RH 1DQML 1X5KA 1TG8A 4QRUA 1A6TA 1CD9B 4FLOA 3ESNA 1LO5A 1YEHL 1UWGL 2J8UB 3QYCA 3JUYA 5EORH 4HUXB 3F5WB 3D2TA 4NKQB 2OCFD 4PJEE 5FWQA 3TBYA 4OI8A 1DVQA 4JDEB 5IJVB 1YEDA 3VRIA 1AGFA 3RJQB 1YNTA 1NBYA 1OW0A 2YQ3A 3FT0A 3HC0B 1A1NA 1TLKA 1ETA1 1KIQB 4UF7C 3WBDA 2N01B 5C07D 3KPLB 5KYYB 1RZIA 2BSRA 4KXBA 3V6OA 4MJIB 1MRFH 4Z1PA 2I26N 3LKRB 4OCNC 5BW7C 3N50A 3FQUA 1XCTB 4WI7A 4P9MH 1WTLA 2GY7B 1RP8A 2FHFA 1AQKL 1YC8A 2A6KB 2FJHB 2WPGA 5J9PB 5ABAA 5JYMA 1NTDA 3G6JA 5HHVL 1FFPA 2IC2A 5E2JA 3VWJA 3TEWA 4ZFOB 1MRCL 1F0LA 4WU5B 1A1MB 1A9EA 1M7DB 3BUPA 2E9IA 5TE4L 3DURB 1AG0A 1E3XA 3QEHB 1FZJB 1DFXA 5CZVH 4H26B 3ARED 2X7LB 1U8QB 3CC1A 4H8WC 4WW2A 3WD5L 1E2VA 3HN3A 3BZFA 2DW5A 3D4CA 5KSVA 1U8NA 1OHZA 4Z18A 1P69B 1MFVA 1IT9L 3QI9B 5HDRA 4YSAA 2JH2A 4F7TB 4E9WA 1LEIA 2BVEA 3ARDD 1SXNA 1CFVH 4ODXB 4PP2B 3PIQA 4YHIB 1M57B 4QHLA 1WHPA 4G6AD 4NUGH 1SJMA 1SLXA 3FN3A 1F4XL 3WIIL 3LVEA 4DZ8A 3N40P 3VI3A 2I32A 4LP5A 5D1ZI 4K3HA 2P5WE 3SYAA 2XVGA 5ANMB 1W72B 2R2BA 3DHPA 3N55A 3FU7B 4LRIA 1U9KA 3KXFB 3U6XS 3NEEA 2AV1B 1XGUB 1Q38A 2EIZA 2MQCA 1X5FA 4K7PX 1KTJA 2VLMD 4N8VG 1I9IL 3MV8B 2LAGB 3GBNH 1C1EL 4W4OC 3P2TA 1QP1A 2BHZA 3D09A 4ODVH 2R4RH 2D3NA 1XCWA 2CUMA 3LCYA 2ED8A 4KZEH 3V7MA 3RPKA 4K7PH 4XXCA 5KVDE 1Z5HA 5I9QB 2OZ4A 2NXYD 2D3JA 1G0YR 3SDAD 5CF3A 5AVTB 3L9RA 1F11B 1HE8A 4LGPB 2I9LA 3M86A 3QZWB 5DT1L 2GG1A 3QRGH 2V7NA 2ZYRA 1U8PB 4OCSL 3WY4A 1ORQA 1XH3B 3T09A 3GSOA 1HWGB 2YJQA 3JT0A 3A5VA 1F18A 5T5FA 1RVFH 3F7RA 3MACL 1DVTA 4KZ0A 4O5LL 4LCYA 1E4KC 5B22A 5KBDA 1QVOB 1G87A 2PPCA 4QT5A 2E0PA 5HVHC 3S3SA 1T03H 4Y1AD 4CC4C 4Y5XB 4ELMB 1U8OB 1W6WA 3NIDB 2ENYA 3FUEA 5HD8D 3ARBA 4NKIH 3KG5A 1OQXA 5D71H 3N41F 1SOSA 2X2IA 4APQB 1ZJBA 2YBRA 4AQZA 1OTTC 3NG5A 4OZGA 1NDTA 5EB9A 4QHNA 2VQ4A 4GAJL 5J06A 4OIIL 3TV3H 4UAOC 2CXGA 3TV8A 4TN9A 5FCUL 5JMOC 3BRFA 2ROXA 2XXMB 4Y2OB 4Y9GA 1ORSB 4XRCA 3TCTA 3ABKB 1QMUA 4O02H 3LKNB 1ROWA 1KCKA 4CADA 3WTXA 2EIJB 2PXYA 5EFIA 5JIHA 1S7QA 4GRWH 2UXTA 3VQMA 3ZQ9A 2J3SA 3L5HA 4QHUB 5CJXC 1V7NH 5A2BA 1D2PA 3RX5A 1E30A 5C97A 1DVUA 1NPNA 3BIKB 1UB5B 2DQDH 3V10A 5C7XL 4Q9QL 2OMVA 4MKTA 2VDPL 1TVHB 2AITA 4MWFB 1KEGH 2EDOA 3QUHA 4FNTA 4GKNA 1N64H 5DS8B 5AD0A 5C0GB 4MMYA 2Y7QA 3G6JE 1M7IB 1P2CB 3O3BB 1C5CH 1Z5LA 2D03H 4MA7H 3P4NB 1FQ9C 2GKIA 4OCRL 5K1VA 2QFRA 3DTUB 1N67A 3H3PL 4Z7QF 3MI6A 2XWCA 4TS6A 3CHSA 5FYKH 3B9KC 3RVWC 3KAAA 4MB5A 2K3HA 4P2RA 1KXVA 4L8BB 4XHJD 1Y6MR 2YRZA 1MJJA 3BKMH 3IBOA 5JOPD 5B4MD 1MXDA 4KUZL 4OQTH 5F6HJ 3S35L 5ACZA 2PYFA 3NN8B 2VRKA 4AUUA 1TJHH 1WQVT 2DQEL 3MCYA 4L4TE 2F7OA 3FDWA 2GC7C 3MV7B 1YEGL 4U1KA 5JR1L 1JZ5A 4PEEA 3HZMA 4QKTA 2N4IA 3LKSB 4Z7UA 1QA9B 3DRTB 5D7IE 5J1SC 2P43B 2WZAA 4S10A 4X8GA 4YHLL 4F7PA 5HI5C 3ULUF 3FB5A 1TEYA 1LP9B 4NQUA 2FLMA 1GGTA 3UAJD 4BGDA 3MA7A 2K3TA 2ZUQB 4QHPA 3RDJA 1I4FB 3EYVA 3UTPE 2EDXA 3VI3E 1B0GA 2WJ5A 1FE8H 4HHAB 5A1AA 4NP4L 3TO4A 3C12A 4IDJL 3EFOA 4S1QL 2FQGA 1HH6A 4OI9A 5KANG 5LBSH 3V7AE 5E4IA 5G55A 2YD1A 4GY4A 4AGMA 4G9FB 2Y23A 1LYQA 5DUMH 1WGVA 3AT8A 5IK3B 1VADB 2P3YA 3GSNH 4HUWB 2PKDA 2YPKB 1T0PB 2QV4A 3C5ZB 1WF5A 5TE6L 3RDTC 3BVTA 5KG9A 1W9XA 4O58L 5C6WH 1E65A 1G7PA 3BP5B 3ILEA 3KPMA 3BT2H 4WKXA 2QPUA 5BMFH 1KLUB 3Q43A 3K1DA 3CPLB 4CVUA 4DUWA 1WFMA 5GZNC 5EPMB 4OAWA 3KPSD 1QSEA 4NO5A 1X5IA 1U58B 3SE3C 4P23D 3V0DA 1ET5A 1NC4D 4MGXA 4HOZA 4WWOA 3SOTA 5KS9F 4BFJA 4OFYA 3PWJA 2PO6D 2WVTA 2Y6SD 5TFSL 2QMKA 3LJ3A 2G5BB 5DQJA 1A0QH 4LLWB 2A4EA 1TMCB 2BCKA 3PGDB 3BUTA 1H3VA 3RVUD 4M5YH 1RKRA 3MRHA 2DJSA 4XC1H 1N4XH 1JRHH 2WLYA 3BDYH 4NKMA 3WNLA 1SHSA 3N43F 4N0UA 4BKLA 4PVNA 4JFFD 1NUNB 1OSYA 2BY0A 4MXVF 2GABA 4JN1L 4HJUA 2NQ3A 5JHLL 3QJOA 1EEUA 5FW7A 4JFTA 4NHCL 5F1IA 3WFBL 3PNWB 1F90H 3CDGB 4K9EL 4NENA 1YUHA 4OZGE 5EU6A 1USQA 5C0NC 4NZUH 5CGMA 2IJ0C 4IBUA 4LSQL 4F27A 2DOCA 1LEGA 1NDMB 2QSCL 2GSGA 3SQRA 5DCCA 4GW5A 5EO0B 1PD1A 1LTXA 4X5PA 3VXPA 1PY4A 3NFPB 3VACA 1O75A 3WKMH 4Z9KB 1NFIB 4ALAL 4OD3H 2K6YA 4G70B 2O5YL 2VZUA 5HYSB 2YEZA 3IKCB 1YEIL 2MWCA 4FG6C 4JAMB 4O02A 2HJFA 4PS4H 2DQ6A 1L7IH 3SE8L 2JTDA 1N9PA 3K4AA 5DURD 4DEPC 5KVDL 1HC1A 1A7NL 4D3CL 5KS9A 1JZ7A 5FLVA 2N0KA 2B4CC 4G8GA 2D2CC 4NBZB 1UT9A 3T8XA 3TNMA 5I15L 2GBTA 2CMRH 5CJQH 3F2LA 1OAQH 1XHHA 1BOGA 2NRDA 1RJLB 4QXUL 4LAJH 3NK3A 4LPUA 2BSED 3RIAF 4ODTH 3RTLA 3UTOA 1HYRC 1P6WA 3H9HB 3GZOA 3B4NA 5C0JA 4CSZA 2PWDA 5CSGA 4Y0GA 3C60B 1U8JB 4K5OA 2HRLA 1P1VA 4R90H 4YXLL 3X14B 4UDTB 1DQJB 5ESAB 4D9LH 4ZMWA 1WBYA 4HV8B 5JUEH 1VCBC 4LCWD 3ZKQD 3QEUA 2XA3A 4V2CB 3MRNB 1GOHA 1YEKL 3IWVA 4Z7UE 1AGBB 1FRGL 3VXRB 4Z7VA 4MSWB 4E9TA 3GMRA 2YUXA 1FNGA 1N3NB 2E8YA 5LXVA 1BBDL 4TMPA 3IVKB 4N8PA 1XF3B 4WQOA 3ELAT 2RHEA 3SDDC 5IVZB 3L3OB 2CIIA 1RULL 3RTQC 5IVXA 5F3BB 3K0WA 3VXSB 3S9DB 1BJ8A 1AC6A 2YA1A 5JW3L 2XTLA 4IJ3B 1VGEL 1J8RA 3SO3C 1SLWA 3MCLH 4JO5A 5AVQB 2M26A 4X4YA 3B1TA 4MNQD 1BVNT 1BJMA 4IRSD 2NY1B 3FUDA 4F92B 4PJCB 3FK3A 3W38A 3Q5TA 1A7BA 4NFCA 3D4ZA 5IB2A 6CGTA 3UBHA 4XZ4A 1OT1A 3W3BA 3TT1H 4RAUB 2H3NA 3QEQD 5AALA 2C9SA 3U7WH 5AW9B 5HYJA 2OTUB 5D7KE 3GMMB 3MRIA 1YNLH 2HKHH 3OKMB 2OMBA 4ONHA 2A77H 3H9ZA 2BK8A 5A43C 2XX0A 1QSEE 5MEPB 3BQUA 2YLHA 1TLMA 4KDWA 2HLEB 1MLBB 3VWKC 1UOKA 1KG0B 1MAKA 4FQ2H 4L9LA 1WZKA 1AE6H 2BIOA 3NJNA 1OB1A 3KPQA 1CE1H 2CWRA 5FB8B 1A8JH 1KMGA 1NM4A 1WPCA 3ZT7A 4ZD3L 3ZE2E 1KBBA 4AEHH 5J6GB 3IJSB 2HT2C 2R1WB 1OPGH 4I1PA 3V4VB 3JV5A 4S1SH 2LU5A 4JPKL 4NGHL 3OKEB 4JHAH 4N0UE 3QWRA 1HHIB 2XHNA 5IEHB 3O0LA 4OUUB 2FEDD 4MDIB 4HXAH 3CMGA 1S8DA 2H3KA 2Y5TB 4KMTL 1PG7W 3LPWA 5D96C 4M43H 2VSCA 3Q1SH 2QSVA 5IQMA 2AKRA 3HPLB 3JSSA 2GAZB 1K3ZA 1QLEH 5EU6E 3UTQB 2ZX5A 3FU3A 4G42B 1U6AH 1UB6A 2B08A 4P46A 4LQFH 4MD0B 4BZ1H 2O61B 3SGEI 3RWIA 2BS71 2XWBB 3K91A 1LNUB 5JXED 1JIBA 2C9XA 2UUDH 5C71A 4NC0B 2FQEA 4Z7OB 2CO6A 3HMWH 4HZLA 4OT1H 2DS4A 1HAUA 1R6VA 2P8MA 2DZEA 2WQWA 4I48A 3SJVA 5KN5B 5IJKC 2OZ4L 3B2VL 3DVGB 4YX2L 4XO5A 5CSZA 4FXTA 3RFZA 3CFBB 1P53A 4ZT1A 4E5XB 4RRPA 3B2PA 4AE0A 1B6UA 3FO2B 5EHFA 1V54B 4ZUVB 4NQEA 3FONA 1SHXA 1GS6X 5T5FL 1FORL 2Z64C 1X5LA 1SLUA 5LLIC 1J1OL 1NA8A 1QO3A 2NX5B 1CLCA 5DHXB 3WCYA 4FGMA 4N87A 5K5YA 3RWGA 4K3EL 3EF4A 2IDFA 1T04B 3KLQA 4L5FE 3ML8A 3NFNB 4Z95H 1EDHA 1O7VA 1UKSA 5C09D 5JQ6H 3MRGB 4JO1L 1YQVL 2VRAA 3PGCA 2VDNL 2XWXA 3S37L 2CKNA 5BQDA 4Z7VE 1HKLH 1KELH 1YY9D 5GZOA 4LIQH 4P2OB 3B3BA 3QH3A 1E8YA 5KYXB 4R9HA 2JQMA 2WYZA 1YEEH 2A4CA 3OMIB 3TESA 1IGCH 3CE1A 5IVXE 3U79A 5A3ID 5J11B 4WENB 4PJ7B 4ZTOH 4B7LA 3CK0L 3HS0A 5C0DB 3FZUC 1N70A 4Z7WF 2P80D 4H5SA 4KKLD 5D6DA 4CUCA 4J3BA 2AJYL 3RG1C 3IJ8A 3MBWA 3AG2B 3X3GH 5DJ2A 3RI5F 4WO4D 1J9SA 5F3HB 3BAKA 1NWOA 4JZOA 4PI0A 4ZRGA 2Z4TA 3NZHH 2HRPL 3RGVA 3U4EB 4AQ1C 2VWEC 5IW1B 3CFJA 3DXAA 3CFKA 5HVHB 4XWOD 4NI3A 4EOWH 2DMCA 1G0XA 5HYJE 1Z0MA 4KTDH 2QTVA 2NY3C 3QCTL 4WGVB 5AKSA 4LCCC 3IETB 2FJUB 2W9DH 5DEZA 1IO4C 2NY0D 1FYTB 3KW7A 4CMHC 4Z3HA 1RIVH 3CH1B 5AVXB 3QS3A 3ATEA 3A4EA 5CCJA 3VH8A 4HU8A 1FLRL 1PFOA 2HP4A 2VE6B 3M1BB 4Z76B 3AU1A 3BZEB 4Q9BA 4KOBA 2CHNA 3U1PA 1OAZL 1VA9A 5GGVY 2Y7NA 2HVBA 3VD2A 2K70A 4DFIA 1IL1B 1NEZA 2E8ZA 1DSFH 2ZXWB 4X7CC 3TS8A 5DJAB 3I84A 4CGTA 5JXAL 3NT0A 5E4OA 4UNIA 4P2QA 2R4SL 2QFPA 4YK4C 4BQBA 1PCSA 5EOTB 3LN4A 4AYEC 2VUKA 5CFHA 1EJ6A 3QQ9C 1PLBA 4HPOL 4AGOA 4UM9D 1Z2KA 5SWSD 1UASA 5E03A 4DERA 2J2ZB 3C08L 4TUOB 5I17B 2AGJH 2F7RA 1XGRB 1ROCA 3C09C 1DDTA 3RA7L 5IT2H 2VXSH 4YE4L 3ZSSA 5C0CB 3HI1B 3Q0HA 1MCQA 4MJHA 3VE0A 4R7VA 2X7LA 5C6TH 3GJFH 4RFOL 1YMMD 3VFNB 2B8OT 3T0EE 3B9KB 1XZWA 4EVNB 1A6UH 2VLKE 3GBML 4URTB 1Z9PA 4FFZH 4XZUA 3AQDA 2IDTA 4OGYL 1KCLA 1LO4H 2AXGA 2W65B 4M7ZC 4W9ZA 3SZKC 4PWJA 2D7OA 4KZEL 2DN7A 4J3WA 5EZPA 5FF6B 2Z4QB 4FF9A 4K7PL 3QGVA 4PSRA 4OFQA 4JPSA 4UUJB 1DDHA 3OX8A 2FD6H 1KT2A 1Z9OA 4M5ZH 2BWQA 4F8NA 3QJSB 4FQCL 3FT4B 1S7XA 3QJFA 4JFXB 1J5OH 1KTDA 1WUNT 3SBPA 4NQEE 1BXXA 4GG6E 1MNUH 1MVYA 2X09A 4YFLI 3ULVD 2AV1A 1KB5B 3QXVA 4FYRA 4A55A 4PRHB 3GK8H 1CIUA 3GM8A 3MUGA 4A2HA 4KXAA 1FL6B 4W9IC 5F97E 3ECBA 3UP6A 4A38A 3VX0A 2DQHH 3MUZ1 4DQOL 4R2GD 3UL4A 3K74B 5F96L 5GS0D 5D71L 2X6MA 4JANB 4XN9A 1E5CA 1IKNC 4U1JB 1J11A 4R0LC 2QBWA 3JWNE 3BCFA 4U6VL 5HHXH 2NXZC 2X6AA 4QRTA 2Y07L 4XMKL 3T4AA 2EDDA 3FN0H 4HGMA 3VDAA 1CI3M 3RPIB 3ZDXB 3WHXB 5MEQB 2R69H 5CP7B 5EUOF 5MI0C 2FX7H 4FNLL 1RUKL 4P9HC 4UMSA 1JHLL 8PAZA 3CJJA 4BKTC 2GCYA 3NA9H 1UWFA 2YMXH 3F58L 5G5DA 3FW6A 3OJVC 1OT4A 4ATTA 4U1GB 1ZTXE 2VDRB 5CU9A 2WQAA 3H9YA 2IQ9H 2BZ7A 2HFFA 3G6AA 5T3XD 2OR9H 4CAGA 4YHNB 1PF3A 4LP4A 3I74A 2BP8A 3BC9A 5F1SA 1A9BB 2DQCL 4FFTA 3WKYA 1L3WA 1U3HD 4HIHA 4N25A 2Q6WB 4DTGH 1XX9C 2PWFA 3O6LL 4H0LC 2BMKB 3ARDC 3FSVA 5PCYA 1NCUA 3DJSA 3FKUS 4YHYC 1AKJD 2VXUH 1NGYB 3X11B 3EJYC 3LHPH 2J8UE 3D6GA 3QO0B 4AGPA 2E5EA 2VOTA 3GMLA 4MA7L 4JN2A 2BIMA 4GSQA 2OW7A 3O3AA 1JNLH 5HJ3B 4HVBA 5I1IL 2ZZUT 5D5MA 3AY2A 3R8QA 4PB9L 2PYEB 4L5FL 4YNYB 1YYMH 1NICA 4MVBC 4MJIE 3NACH 3WJMB 5IHZB 2FGZA 4HH9B 4M56A 4Y19D 3U1SL 4DK5A 2YS4A 3U4BH 1EHKB 3F8UB 2YKKA 1R5IA 5FGBA 1MELA 1FIGH 1OP3H 4P06A 5CP3H 5AEAA 4F37F 4GMSH 2BVOB 4YC2B 3JTSA 2APFA 4OUOA 5EEXA 2DDQH 3ARTA 1LILA 2NXYC 3PAZA 3OR6A 4IGBA 1P2CA 4RETB 5LQBL 4KH2A 3DBSA 1CICA 2A83A 3MFFB 2NW3A 3HNSL 3SBRA 3P4NA 4Z78B 1S6NA 2EDBA 3THMH 1B9ZA 1TO5A 3FFCA 3D4YA 3VXOB 4NOBA 2DWYA 2VXTH 2V2WA 2Y2WA 3FQRA 4LSUH 5KVGE 1WRFA 2A9MH 2XN9A 3BPCA 2CO7B 5BXFB 4KVNH 1S7TB 1PZ5A 4UZSA 3R06B 2Z6FA 4AENA 4OIBA 4I13B 1S7VB 3ZZQA 1ZHNA 4ZUSB 3W9DB 1F1AA 1P4IH 3BKJH 3X17A 3ZRCC 4FMFA 4FABH 4HW6A 5KYNA 4JRFA 1UC6A 2CUAA 1AIFB 4JFOB 3BT2L 4NHUB 3VFPB 2IADB 4AX3A 2X3AA 5SWZB 2GK0A 2Y72A 4PJHF 2DIEA 4YHKL 1PX3A 4FKEA 4LNVA 3GJEA 3NTCH 4A2GA 3VXQA 1A6AB 5LAXA 1M3IA 2F8IA 4X8CA 1JV2A 4TPRH 1OCOB 4XNUL 4EI5D 3KXFE 1NGPL 1HI6B 1S9YB 1Z9MA 5AKTA 5AW0B 4ETQA 4K9JA 4YS4A 1NFDB 5HGHB 4P04A 3P11H 4AGNA 1RZJH 4S0HA 4JRXB 4PLKD 4FQPA 3LYRA 4L37B 4ETYA 1JS4A 3MV8E 3JV6B 3RBSA 5JPMA 3Q8CA 3ZL2A 3HG3A 1RCYA 4JM2F 3II2A 2UZXB 4JPVL 1NKRA 1JZJA 4XP4L 1CXLA 1U30A 2BCMA 3LNGA 2AK1L 4I3GA 4QLRA 2ZXAA 3TBWB 4IIQB 1ZXQA 5AAWC 2C9AA 1WAEA 3O6FB 1QPPA 5E5LA 3ZMNA 1F90L 5IB4B 2DMGA 1I31A 2BFVH 2GVYA 1LMIA 4NIYE 2G9HA 4IKJA 1TEFA