2ZONA

Crystal structure of electron transfer complex of nitrite reductase with cytochrome c
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
334
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGHGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dissimilatory copper-containing nitrite reductase
publication title Structural basis of inter-protein electron transfer for nitrite reduction in denitrification
pubmed doi rcsb
molecule tags Oxidoreductase/electron transport
total genus 92
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zonA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zonA02
4BDVA 5B1KA 2IDFA 2J57A 2XYBA 1AZNA 1GS8A 3WIAA 3EH4B 3PPSA 1BEXA 5AKRA 4DPBX 5D4IA 5F7BA 2ZWNA 1JZIA 1AG0A 2PCFA 5EHFA 4KNUA 3WI9A 1W6LA 2BW5A 2XV2A 3ABGA 4G7RB 2J55A 1ZDQA 1ZPUA 1L9SA 2ZONA 2J5WA 1NPJA 2TSBA 5B1JA 5I5IA 4Q89A 4DP1X 4BK5C 4DP0X 2BP8A 1J5DA 1HAWA 2I7OA 2ZXWB 4AKQA 1PLCA 4A2HA 1GW0A 3T6ZA 1NIDA 1SDDA 1RCYA 1AOZA 1NIBA 4QLWA 4G7SB 3T6WA 3WNJA 3X1NA 1FWXA 1A4AA 1KV7A 2AVFA 5I6MA 1M56B 1IUZA 4DP9X 2QDWA 2W88A 4YL4A 1SJMA 5I5JA 4YSAA 1WA2X 2DWTA 1NIAA 2NRDA 3AG1B 1CUOA 5A7EA 3TBCA 3CDZA 1B3IA 1JZHA 1E30A 2PPFA 3L45A 4NAJA 2VW7A 2WO3B 2XXFA 4YVUA 3S8FB 3TBBA 2AFNA 2GSMB 2YAQA 1MG2C 1XB3A 3CG8A 1WAEA 2FQGA 1NIEA 3U25A 1AG6A 1J9RA 2GBAA 3X1BA 1J5CA 3GYRA 3FQ2A 3SBPA 4KOCA 3FYEB 3OMNB 3AW5A 1L9PA 3FSWA 1TKWA 1QHQA 2CCWA 4YSOA 2PPCA 3ZX1A 2B08A 1V54B 2CUAA 1ASQA 1OOWA 2H3XC 3FU7B 1QNIA 3X1EA 2HZHA 1AAJA 2MTAA 1JXFA 3NJIA 3EF4A 4ZK8A 1N70A 3CZUB 2H5UA 3D12B 1HFUA 2PCYA 1ZV2A 1CYWA 1E5YA 2HLEB 4DP4X 3PAUA 1PLAA 1PAZA 1ILSA 1RKRA 1NWOA 3QJTB 1R1CA 3NJKA 3T9WA 1DYZA 1OCOB 4BWTA 4KNSA 1AQ8A 1T5KA 1PZAA 3NSYA 4HAKA 1ET8A 3PCYA 3TA4D 2EIMB 4X4KA 1EZLA 1OCCB 3AG2B 1L9TA 4UAHA 3QQXA 5ANHA 1AZCA 1NWPA 3FSAA 2J56A 1NIFA 1RZQA 3NP3A 1A8ZA 1ZDSA 1IBZA 1SFDA 2UXTA 4AZUA 2QT6A 3RYMA 4AKOA 4E9XA 2JXMA 5I28A 1J9SA 2FT6A 2YARA 5B1BB 4DP5X 4WKXA 3ERXA 1E67A 1BQKA 4JHUA 2Y69B 2FNWA 2YQBA 2BP0A 3WKPA 5TK2A 3NSDA 3NJNA 3SQRA 5D4HA 3N55A 1NINA 2IDUA 5I6PA 1M57B 4A67A 1X9RA 3PLYA 2N0MA 1WS8A 3NT0A 2DWSA 2IDSA 2BZCA 1CC3A 4A66A 4G71B 3ASOB 2HX9A 1KDIA 2FT7A 2DYRB 1JZFA 2Q9OA 3AG3B 2CAKA 3FPYA 4M4RB 4EF3A 1A3ZA 3BVDB 1PZBA 4HHGA 1PY0A 3DKHA 4DP2X 2TSAA 2RACA 1PNDA 1BYPA 1OV8A 1KCWA 2HX8A 2HXAA 2B3IA 2EIJB 2AZUA 3N2JA 4HCIA 2W8CA 4KNTA 4P5SA 1OE3A 2YXVA 1JZJA 1UATA 1WA1X 2UX7A 1L9OA 3OM3B 2HRHA 3CVCA 5F7AA 2GC4C 2OV0A 1OF0A 1MG3C 2YAHA 2OJ1A 4YSEA 1NICA 2VMJA 2I7SA 2E86A 3S3DB 3FQ1A 4DPAX 3UAAA 4BDVB 5AZUA 3FQYA 2VN3A 2FT8A 2I85A 4BWUA 2HRGA 3JT2A 4P5RA 1JZGA 3T6VA 2BZ7A 4BXVA 3EH5B 3AZUA 4ENZA 5I6KA 4NB7A 1GY2A 4A68A 1DZ0A 1IKOP 4A2GA 3UGEA 3S8GB 3SBQA 2GC7C 4N8UA 2Q5BA 3IBOA 4HIPA 3H4HA 8PAZA 2CBPA 2P80A 3ABLB 1SF3A 5B1AB 2BP8B 3EHBB 5B7EA 1W8EA 2DV6A 1JXDA 2FQDA 4JHVA 4UF7C 1QLEB 4E9YA 2XWZA 2YAEA 1SDDB 1HAUA 4YSQA 5E9NA 3UABA 3CVBA 1TEGA 2UXVA 3DTUB 4YSCA 5TK4A 2VW4A 2PP9A 4E9WA 4KO9A 3ABMB 1W6WA 4YSDA 5FC9A 1KYAA 1JVOA 3CDZB 4KOBA 3QJRB 2CALA 1OCZB 4HZ1A 4G7QB 2R7EA 3WKQA 2VSKB 4KO6A 1PF3A 4RH4A 1TU2A 1ZIBA 2YXWA 1GY1A 2FTAA 3NJHA 4PAZA 2FQEA 1XB8A 4G70B 1GSKA 1L9RA 2LLNA 3QJSB 3ZBMA 1NDTA 4HHWA 2IH9A 3IE9A 4KO7A 2IDQA 3C75A 3FSZA 4E9SA 3QPKA 1JOIA 2AANA 4HCGA 1GS7A 2A3TA 1I53A 1KGYE 3FT0A 1FA4A 4YVNA 4GP8B 4PCYA 3WG7B 4F2EA 2VM3A 1BXUA 4AX3A 2XV3A 4GP4B 1A4BA 3HB3B 7PAZA 4GP5B 2XXGA 1MZYA 2BO0A 1KBWA 2IWKA 2XVBA 1AZBA 2GB2A 4KO5A 3AY2A 7PCYA 3OMAB 3FU9A 4TXVB 4DP7X 1EHKB 3HEIB 5B1JC 1N68A 3NP4A 4L0PB 4YSRA 4A2FA 5I5MA 2MRYA 2PPDA 2DY2A 2YAMA 4AKPA 3EH3B 4BWWA 1ETJA 1J9TA 3FS9A 3QJQB 1OCRB 4DPCX 1AZRA 3UACA 3IEAA 5PAZA 2UXGA 2H47C 1CURA 1GR7A 2JKWA 1KCBA 5I6NA 3GXUB 3TASA 3UAEA 1L9QA 2WO2B 2QPDB 3BQVA 4GXFA 2WSDA 4BXSV 4E9TA 1SFHA 1ILUA 1J9QA 1F56A 4A2DA 1AZUA 1SF5A 9PCYA 1JERA 2EINB 2BP0B 3GDCA 1SHXA 1PZCA 1URIA 1MDAA 4W1TA 2IH8A 5I6OA 1A65A 3MX0B 2QDVA 4UANA 1OE2A 1NZRA 3FSVA 2BHFA 4AI7A 1AS7A 2CJ3A 1FFTB 2XV0A 1ASPA 4FAAB 4HALA 1ZIAA 1NPNA 1AS6A 1BXVA 1IBYA 3JTBA 3NJGA 3FU7A 3NJMA 4QKTA 3ZDWA 5LDUA 3QJVB 1AS8A 1WS7A 1BQ5A 3NSFA 3KW8A 1JXGA 3X1GA 2QPEB 3QJUB 2PLTA 5B7MA 3T6XA 3G5WA 3S3BB 1KDJA 1M9WA 2EIKB 4CSPA 3V9CA 1MZZA 4E9RA 2AZAA 4YSPA 3ZIYA 1WA0X 2BWDA 2FJSA 4MFHA 3OMIB 4NERA 2XX0A 3FYIB 3T71A 5IY5B 4DP6X 4A2EA 3NJLA 1BQRA 2UXFA 3NJJA 1BAWA 1TEFA 1AIZA 2GIMA 2PP7A 2VSMB 3AG4B 4YSSA 1XB6A 5B3SB 1E5ZA 3PXLA 5I6LA 2PP8A 1GYCA 5PCYA 4K9JA 3WNIA 1YLBB 4CSZA 2X87A 2UX6A 3H4FA 1JVLA 2VW6A 1ADWA 1AR1B 1VLXA 3FU8A 3IN0A 2DYSB 4Q8BA 4WTQA 2BWIA 2IWFA 2YAOA 3ABKB 1A4CA 2X88A 2Y1AA 6PAZA 1ID2A 3FPXA 3SBRA 4JKNA 4F2FA 3DIVA 4F7KA 3TU6A 2GHZA 1GS6X 3PAZA 4YSTA 1AANA 3X1FA 3CVDA 5B7FA 2VM4A 4G72B 2IWEA 4W9ZA 2HX7A 2BW4A 3H56A 3KW7A 5I26A 3NJFA 3UADA 2XUWA 1PLBA 1OE1A 3NSCA 3NYKA 1SNRA 1IC0A 2PPEA 1SHWA 3IN2A 6PCYA 4E9QA 1ET5A 5AFAA 1XMEB 4DP8X 1RZPA 2FQFA 4GY4A 4E9VA 4GYBA 1PMYA 1V55B 4M3HA 2XX1A 1AACA 2YAFA 1KBVA 3X2QB 3OQRA 3MBWB 5D4JA 2XLLA 1ET7A 1PCSA 4HCFA 2R7EB 1BYOA 1X9UA 2ZOOA 2IDTA 3OD3A 1CYXA 2GI0A 2P80D 2OCCB 1BXAA 2XU9A 2EILB 4YSUA 2IAAC 3V9EA 2YAPA 2PPAA 1JZEA 1ASOA 3PAVA 1NTDA 4FA7B 2JFCA 2FWLB 1PNCA 1V10A 4N4YB 1E65A 3ASNB 3S3CB
chains in the Genus database with same CATH superfamily
1EWHA 5SWZD 2KLRA 2J57A 3UL4A 4CVUA 3TA3C 3WIAA 3QNFA 5EU5B 2QGBA 1UZ8B 5AAMA 5AKRA 4JFUA 2VZTA 4PRNB 1AZZC 3HE7B 2FO4B 1M7IA 4FQLH 4KNUA 3U4BL 3WI9A 4Y9GA 3VFWA 2N1KA 3W11C 3HUJF 3GIVB 5DJZB 3VFVA 2ID5A 3KWXA 1DQIA 1AY1L 1FYTA 5FUZH 2YPLA 3BT0A 3RUGB 2ITEA 2FJHA 1FAIH 2BCKB 4MNQB 3O3EB 3LKRB 4WI0B 5F8QC 5HI5C 5K9KA 4XCNA 1RERA 1TJIL 4I9WE 1UUNA 4K23L 4TL5A 4E9LA 2OJEB 4EN3C 4B50A 2YO3A 5ADPH 5E6ZA 2XRAH 4TVPH 4JR9H 5AVXB 4QYOA 1FORL 4XC1H 3OTTA 1IGTB 2AVFA 3AFLA 2N59A 3GSWA 3ML9A 2W88A 3DVNB 4YL4A 5FHBH 3UJTH 2JJTC 4I1PA 1J1PH 3SKMB 4X6FB 1A7OH 3DYOA 2UWEF 4GI6A 3VE0A 1OGTB 2DBJA 2BSEA 2RAMA 3O41B 3B8YA 5KUKA 2HG5B 4U0RB 2Z1KA 2F54B 4DCQB 1BVNT 2OW6A 2JKSA 4YE0A 5K33A 2MQ3A 4OGAD 2FD6L 2XTLA 3ZYZA 1AO7B 1GZPB 1F5WA 3CHSA 2H9GA 1QSEA 2OSXA 3B9KD 4GNKB 1HZHL 3T0EA 4OKDA 1HILA 1HIMH 3GHBH 1QHQA 3RAJL 3DGCR 1BEYH 5C09A 2CK2A 4U2YA 2YD7A 2YMXL 1AZVA 4UOW0 2ZAHA 2R0WL 4JL2A 1IU1A 5IFAH 4QIRA 4W4NA 5JO5A 2RFXB 4NJAH 4TULL 2XQBH 3FOLA 1SVCP 2ZUQC 3KPLA 5DZOA 2R4RL 5EZLA 3FCSA 3B2MA 4NKIL 1H6EA 3T09A 4O4YH 3ROOA 2XN9A 4BZYA 2APSA 5GQBA 5CD3A 2CRMA 3OF6D 4M6OL 3ZKXC 3P3SA 5K9JH 1U4FA 5HYJE 3SBWA 1MEXH 1KGWA 5IQMA 2XNAA 2A9DA 1CXEA 1S7QB 2IQ9L 3G5VB 4PGBA 4YLQT 1BF5A 5AZ2H 3QUXB 1N8ZA 3HG1B 3CX5K 1EX0A 3IDUA 3VRLE 1P7KB 4NZRH 5CN2A 1A7BA 1QRNB 5I8KL 4BFJA 2R2HB 5A2LH 3EG9A 3H3PH 4HJEA 2XQ0A 4S1SL 3MNWA 4GW1A 3W81A 1NFIB 3F05A 1E6JL 4NLHA 5DJCB 1ZDSA 1MCOH 4WI6A 3V0IA 4XVOA 3D2UD 1FJ1B 3LCYA 4G9FE 1VPOH 4WI2A 1ZSDA 4Z8FL 2XZAL 1KN2H 1R0AH 4UM8A 2UV3A 5IHWA 2OS7A 1TPXC 3C6EA 1GTFA 2PYED 1JNHB 2P5WE 3FSOA 3V5DB 1GKOA 5DGRA 5LAXB 2LFEA 4B3VA 1WT5C 1J5OL 3BD4A 1C1EH 5HPMB 3D8MA 3C5JA 1HZLA 3RDTD 1JF6A 4UCFA 3PLYA 3UGXA 3A23A 4R9HA 5ECGA 2F53A 4NQCD 4FKKA 3CU1A 4W9IC 1JD7A 1UEMA 4DZ8A 5T5FA 5TQ2L 4KI1A 2P8PB 4OFYD 1LO4H 3US0A 5CSBA 5J9PA 3A4AA 3BWAA 3VGDA 1KXVA 4WI8A 2PCPB 3MPCA 4F37F 5BS0D 3TN0D 4FQXD 4UQIM 2DN7A 3QDGA 3NCCB 1PG7X 2VXVH 2V7NA 4M00A 4RLDA 4X8CA 5T3ZE 1PZSA 3TT3L 3V52H 3K46A 2WXHA 5FPIA 4Z7UE 4PJFA 5E8PA 4F8TA 2YXVA 1Q0EA 2WCGA 3OM3B 1L9OA 1MNNA 2VRAA 3L2LA 4MXQC 1OPGH 5A16B 1JF1B 3ASWA 4WHTB 2WQSA 1WV7T 3UC0H 4XPHH 4HOZA 4Z3JA 4MHHI 1QR4A 3UTQB 2MHAB 4XMKH 3VXRB 3LEYL 1N64L 4BKLA 3CGTA 3T1FB 2NUPB 4E5XA 3WXVH 1GGBL 1P6FA 1HS6A 5F7FA 4F3FB 5LXVA 3NFSH 2YD1A 3MJ7B 1JI2A 1BVKB 1E4XI 1PKQA 1BBJB 4NN6B 5CBEA 2WTOA 4ENZA 5EF0A 3RX5A 1Q9OB 4IKJA 5F1SA 1BD2B 4WEBL 3UGEA 4CDHA 4OFVA 1CQYA 1RJYA 2PWHA 2VOTA 5DHYB 1UG9A 1MJ8L 4Z0BL 4P05A 3EHBB 2P3YA 5IJDC 4L8CA 3MRNA 5DHVH 2VLJB 3UZQB 3FL7A 2P43B 3G6AB 4OGXH 3WGUB 3ZE0B 3RTQA 3IMBA 4Z5RA 2C9QA 1UC6A 2VABA 2ODHA 1SDDB 3HAEA 1K6QL 3GSVA 4JVUA 5DVMA 4R4FL 4G6JL 4HKZB 2X41A 5F7DB 3RFRA 1DQDH 2VW4A 4B7IA 3NBNA 1U58B 1X4XA 3OSVA 1F4HA 3MV8E 3G6DH 4PIRF 1AXSB 4PJXA 4ZFFA 4LDLB 5C3IA 4HQQH 2VSKB 2NYZA 4ELKB 1D6VH 5F88A 3SN6N 2JCCB 5CZXD 2Z35B 2FTAA 1QFWH 1SOQA 3O8XC 1FZJB 3V4VL 1UGNA 3ZPDA 4Z78A 2EH8H 2UZYB 4G1MB 3SDCB 5E51A 2VN7A 4RFOL 1CLZL 4JO8A 2QV4A 3HNTH 1QPXA 3SOBH 5I1LA 1BA9A 5H2BB 4HHWA 4ZRGA 3NABL 2F8VA 5GS0D 4IRSD 1NAMB 1RUPH 1TYJA 3OKOB 4QXGH 4NQDE 2VR5A 2CO7B 3QPKA 5ESAB 5DLLA 4AW7A 5I75B 3GLDA 1IBGL 5I9QB 1WZMA 3AU0A 1D5BB 2NNCA 2DMCA 1T1XB 4LIQE 5EZOL 4LZKA 2NY2D 4Z7VB 3HMXA 3B9DA 4D3CL 1XSIA 2OAAA 4XNUL 4S1RL 4HJSA 3CFQA 3HUJE 1JGLL 4JANB 4IJ3B 3WKMH 1KBWA 4HIQA 4QXUL 2Z91B 3V0AC 3GMRA 4U3SA 4N1EA 4ZSOA 4RVBA 3IMTA 3ZQ9A 4KVCH 3RWIA 3HI6L 7PCYA 2A9NL 4HKXA 4OLWH 4U1IA 1IE5A 2ESVA 3TYFB 2D9CA 3RL1B 3BOVA 1U8OB 1UJ3B 3DOHA 4JFPA 4KZ0A 2GBTA 4FQ2L 3RA7H 3ARBC 1WWBX 1OTTC 2YAMA 3QS2A 4FNUA 2ZOKB 1YEKH 3KLHC 3MLRH 4ZX4A 4APXB 4JY5L 4AM0B 4L4VB 4QAWA 3EF7A 4P2OC 5F96L 3WHE1 1X5IA 1MOEA 1AZRA 2QELA 4GRLA 2ZQKA 1NOLA 1ZLWH 4UIKL 1O5DT 4YXHL 3FT2B 1NEZG 5ISZA 2BJML 3GSXA 3SCMB 4NUJA 4R7VA 1EDHA 4XNQB 2FUQA 2CWRA 2WZ0A 2UWEE 5EDXA 1HH9A 1NGXA 4UQ3A 2QPDB 3BI9X 4N2BA 2WSDA 1LO2L 4JM4H 1DR9A 3GB7B 2P8MA 1KGJA 2R9HD 1NUGA 1AZUA 3UIZA 1O0VA 3AB0B 2VCOA 4HWZA 2XQYA 3R8QA 1MAJA 2AI0H 2P42B 1Y1DA 2I07A 4JL1A 1JERA 3GDCA 5JXED 1FZKB 3IPEA 2IH8A 4JKPH 4EE2A 2PN5A 4M5SA 3MX0B 3H0TB 2QDVA 4HKBB 1OE2A 4RMQA 5KYNA 3FO9B 3ILPB 1OWWA 2AK4A 2NX5E 1A0QL 4AQ8A 4F91B 5FK9A 2VDPB 4XCYB 2YRPA 5C7XH 1XT5A 1WBXB 1I3UA 4FLRA 4H88L 1A9EA 3V6OA 2W9DH 4P59L 2CJUH 4M8RA 3ZDWA 1S6NA 5JHLA 1NANH 4R97B 3KBEA 3D3VE 5F1KC 1HKLH 2XWTB 3U79A 3UAJC 1SOXA 4OLUL 4JHAH 2Y07L 43C9A 1H15B 5HD8D 2IOIA 4Y2DD 4NENA 1B6UA 2VXUH 3QR1A 5EULV 1HEJC 3NCJL 1TMCB 2BWDA 4H8WL 4KK6D 3KJ4B 5C07A 5KVEL 4MFHA 1JPGB 4F7EB 4UIMB 5IY5B 3TTSA 3NJLA 2JELL 1KYOJ 1UOWA 3RX7A 5HI4C 5E03A 5DD0H 3BEVA 4XBEH 2ZCLL 3AGVA 3WIIH 3UTTA 3SDYL 2JSFA 5D5ME 1EUTA 2EDLA 2VSMB 3DTXA 3MCKB 3O6FB 3K71A 1QR1A 1FL5A 1UM6L 1T0NB 4X6CB 1G7LA 1OK8A 1UYWH 3C9NB 3DPDA 3F65A 3PXLA 4M9PA 4N8VB 3OMZA 4GT7A 1N3NB 2F1BA 3CWGA 4V2CB 3I6KA 4C8XA 3QUKB 1M2VA 5HHXH 1XEDA 3LZQA 2VXSH 2X4NA 3E2HC 2EDKA 2IWFA 2WYZA 3IFOA 1MWAL 4LKXA 1KIRB 4X2UA 5GHWH 1NGQH 3DV6A 3VXSB 2VISA 4F7KA 3CD4A 4LOEA 4PRHE 3TU6A 3KH4A 4G5ZH 3QUMB 2YEZA 3L4XA 4G7YL 1NL0L 4G72B 4X5WA 2OTUA 2VIRA 5I26A 3MLWH 3GSQA 1TJXA 4FULA 3MRHB 1NC4A 2PXYD 5KOVC 3VFTA 5F1IA 2CO6B 1ET5A 4CU6A 2RQEA 3MRGB 1E9PA 1K4CB 2JB6B 4PRPE 3B3IA 4JFTA 2V17H 3O3DB 2BSRB 4MRBA 5TH2A 1LEGB 4P9MH 4ZMNA 2DQHH 4M1DH 1PEZA 4JGMA 3PWPE 4U4IA 1X5KA 5TE6H 2H3NB 4WFED 2WKLA 5DEFA 3RZCB 5DURD 2LOEA 4MD0B 4S1DD 5IW6A 2CIKB 3NCMA 4MD5B 2UZIL 3MOBL 2XU9A 1NFDB 2VXQL 3B37A 2BNQD 5AYUL 5CCHE 2R0KL 4M5ZH 2DLIA 3OKMA 4NSKB 3L16A 1TZHA 1MFEL 3NDYE 4AV4A 3FU6A 3H6AA 3JTSB 4YHLL 4ZG1A 4ONHA 3CPLB 3DI2B 4G80A 3IDMB 1J12A 4BDVA 2IDCA 2IDFA 2CRZA 4WK0B 1JWSB 3AQDA 1SJXA 3QIWB 3DIDA 3BX7C 4LSUL 4O2CA 1J8HE 2YN5A 5F9JB 4JM0A 2ZUTA 4ACPA 3US9A 3ILQD 1S5IL 5HBBA 4DUVA 3IVKB 3IFNL 1QI5A 5EO0A 4LEBA 2WINA 5I74B 3APCA 4KXCA 5DJXA 1ORSA 3ME0B 2HJKB 5HJ3B 2I32A 1PTZA 3FQWB 2ZOLA 1AO7A 2TSBA 3GBMH 5SWZE 4DGVH 1U8MA 1AR1C 2NXZC 3EJZC 4XNXL 2BVEA 3AWGA 2EUVA 2AJXL 5DUML 2BP8A 3P9MA 2D03H 3BAWA 3FQNB 4FJZA 1G7QA 4A6YL 3MCG1 5IMKB 3QAZC 4JPIA 3I6LD 3T6ZA 1WRFA 4IDJH 3BAEH 5T5NF 3AACA 4YC2C 3DRQB 4ABVA 4FABH 3GMPA 2BERA 3T6WA 1B6DA 1H0DB 2WZPD 4KJQC 2QQNH 1ODAA 3KGUA 4HUMB 3SSGA 3UYRH 3VGBA 4Y5XA 3TBCA 4X0NA 2CGYA 2VDLH 2F7OA 2XACC 1IGIL 5SX5H 4EOWL 1C5CH 3A4DA 4NAQA 2ORBL 12E8H 2XXFA 2AEIT 5FYLD 5KSBF 3K0YA 1SEQL 3UJJL 1GGIL 2G2RB 4UB0H 4GSQA 3CLWA 3CC5B 1YEIH 2FQGA 1L7TH 1UFGA 2A74A 2YJQA 3D9AL 2GBAA 3FT3B 4G8FA 4FG6D 4CVXB 4UM9A 1G94A 4ZNCD 5L4JA 3PXJA 1IBBA 3L4TA 4R3SB 4CNIA 3GTTA 1VFAA 3OC5A 3FFCD 5I8CB 4OFDA 1N2RA 2ZKHH 3ARRA 4QRFA 4M7KL 2IPKB 4ATTA 3UIYA 1MVUA 3LN5A 4A7SA 4M7ZB 1Y07A 3R1GH 3G08B 4QGTA 4PGEA 4NQED 1ZLEA 3L5JA 4QY8A 4HMDA 4M5YH 3H55A 4GG6A 3MSPA 5GGTH 3SGJC 3X1EA 3KPOB 4JQIL 1RSYA 2Y7QB 1EV2E 3NIGB 1FLRH 1RZJH 1OTSD 4LLYA 4ZK8A 1X7SA 1XH2A 4ZYKB 5IJKA 1A6TA 1M3JA 3IGFA 1QI3A 4OF5A 3QJTB 4JN2A 5A7BA 3F8UB 2ILLA 1D9KA 3DO4A 2NZ1A 4X4XA 3O4LE 1T5KA 3BDXA 3LN9A 4H0LC 3HZKA 3SGEI 3EOBA 1AQ8A 3NK4A 2GABA 3LVTA 3OKNB 3GSNB 3US1A 2AHIA 4N9OB 4NQQA 3RU8H 3NSYA 4IBYA 2XN0A 1FO0L 2F9BT 4OGAC 3VGFA 4CN4A 1KLGA 5FDYA 5E2TH 1KT2A 3B9KC 4LEOA 2IG2L 1L6ZA 4DK5A 4F1ZA 5C6TL 3SEPA 1K8DB 4XHJC 4OZIB 1NKOA 5B21A 3LB6D 4RMVA 4R0LC 1VADA 4Q9CA 1S7TB 2XG5A 4GO9A 3P2BA 5I1AA 4LL9A 3KAAA 5F9DC 2ZX7A 2WP3O 2ITDA 3FNKA 3IDIB 1WF5A 5HYSA 1ZAGA 4Z7QF 4RESB 2O6EA 1BQKA 2NPLX 1USZA 4YR6A 4BFOA 5TDNA 3ETBF 3NSDA 5TQ0H 3NJNA 3IMSA 2RIKA 4M7JL 5LBSL 3SPIA 5AAWC 2EIEA 3HLKA 1I1FB 2DJUA 1NCCH 2G4EA 5ICZB 4P9HH 3KLLA 4KGLA 1MELA 3KVDD 1XAKA 3KGSA 4Q0XH 3RVVD 4DW2H 4GRMA 1BF2A 2BOBB 5C86A 1EMTH 4JDVA 4LCCB 1NGPH 1BZEA 3PIQB 2OMZA 4KDTC 2OTPA 2XN2A 5FA3A 3FOMA 4PPTA 2YEVB 4Z3GA 3ULUH 1BQLL 5HDQH 2FZ3B 4R2GC 3QUHA 2V3FA 3GFUA 2AZUA 2I60L 4K0OA 5D7EA 3Q05A 2HN7A 3FCUB 1OE3A 4EIZC 1LE9B 1JZJA 3MQIA 5DUPH 1WA1X 4O02L 5J89A 1OQOA 2ADJA 3ZKMD 3P40A 2GC4C 5BS0E 5INDB 2CE6A 3G5YA 5EFIA 3MUHL 4PP2A 3OHMB 4ZUTA 1GC1C 5FV1L 2R8SL 1VCAA 4U3HA 4AMWA 1ZGLP 5FWQA 5F9OL 1OIOA 1FGNH 4N86A 3RDTC 1WFUA 5B3JF 4JFYB 3UPRB 1B0IA 5FM4A 1JGEB 3W5MA 3QJOA 2J4WH 1E50A 1U42A 4ADJA 4G6FB 1J05A 5JYLA 2C26A 4BFRA 4M8VA 4I5BB 3AS1A 4BK5A 1JNLH 2W9EH 5GISH 4M48L 1E40A 1S5HB 2IBZY 1IKOP 5LVEA 4F5CE 2Q5BA 4LCIL 3H4HA 3TN0C 1YPZA 4FQXC 2CBPA 3WE6B 1CG9B 4QR7A 1KACB 5KBKA 1OD9A 2BCMA 3AUWB 1ZANL 2HTKC 4N2AA 4J1UA 5MEPA 4OGZA 2CO7A 4LHUA 5ACZA 4E9YA 3KDPB 3BDYH 3LPFA 1R75A 3JVGC 2EDTA 3TA3B 1NCBH 3GMOB 4YPGB 3MA7A 2X4QB 4XP5L 3BKCL 2VDLB 4LSSH 4IJTA 4EKJA 1MIEL 4EUPA 4EI5A 5AL8A 4D7PA 3P4MB 4OLVL 4TTDD 4AJ0A 2CO1A 5DMKA 3HRZA 2R51A 1SJEB 2EDMA 4HJGB 1H3TA 3PP3H 5IKCA 4OJYA 4F93B 2NT0A 4JN1L 2QJDA 1RURL 2F19H 1R3KA 4CMHC 1AD0A 5E9DB 1SVBA 3BN3B 4PBDA 1DBAH 2YFOA 3LN4A 4JFED 4WWPA 4AJVA 5AB2A 2A6JA 3UBXA 4LCYA 2H1PL 4IRJA 2IO5A 1HEZB 4LEEA 1V27A 4X6BB 5I6XB 1XGRB 3D05A 3MREB 2WXRA 3GZQA 4YGVB 1LNUA 1AHKA 2GQHA 3F3HA 4LSPL 4N8CH 2V2XB 4QJ5B 3GI9H 4DGIH 3V7AG 3TYGL 1FZKA 3U4KA 1FSKC 4Y1AA 1EXHA 3L1OH 1LHZA 2G3ZA 4XWGL 4MAUH 4RAUA 1FQ9C 4R7DA 1NKRA 1OAYH 3H0TA 4ONGL 5TE4L 2BRRH 3AT9A 4TXVB 4XAWH 4BJLA 2AV7A 2E47A 4AE1A 1OAZH 1YC8A 3MBXL 4ZAKD 4A2FA 1E4XH 3N85L 2L7QA 4XP4H 5INCB 4ODSL 4QTFA 2EUXA 1LQBC 2OP4H 1IC7L 4TSAH 5IVZA 5FYJU 3T04D 2ARJB 1SBSH 5IFHH 3FS9A 4KTGA 4ODXB 4CJ0A 4K7PL 2J6EL 3QPQD 4H20L 5FYKL 5T5FH 5GS0C 3VI3A 4HJJL 4IRSC 1UM5H 4WSKA 4W4OA 3CFJA 4YS4A 2KPNA 1F4XH 4NWUL 3BQVA 1U92B 1L5GA 5KSBE 1FN4A 3QIUA 3CVIL 2NY2C 4YMPA 4LFHD 4NQVB 1CMOA 2ICWJ 3ZKXB 4LHJB 5E2WL 3QPXH 2NYKA 1U3HD 3DUSB 4YDVA 4KKPA 2B8OT 3L7EA 3QA3A 1N5YH 3WTYA 3NPSC 3DDGA 5JIPA 4FI8A 2MOVA 1IQWH 1UD3A 1R3LA 3CH8A 1L9MA 5HHMD 35C8H 3Q43A 1AS7A 2NNRA 4DHLA 1GZQB 5C3LD 4B95C 3F85A 1G9NC 3JTBA 4KI5D 4JRXE 3FU7A 4Q4EA 3E7JA 3VMPA 2YA2A 5EWIL 2H2PC 1GGYA 1FG2A 1JXGA 1B90A 1WEJL 2GJ6D 3MRKA 3QUMA 2RJMA 1DJHA 2EIKB 4M5TA 1DJSA 3WIFB 2BY1A 5JIKA 1ZHNB 1XR9A 3IU3B 5IHUH 4MMZC 5L2KA 2Y1ZA 4HIIA 2O6PA 1NC2A 2DI7A 5C0CD 1OTUD 1F13A 2R9HC 5TD4A 3T71A 5CCGE 1VGKA 4FA8A 5EC1A 4XHQA 1QUNB 1BQRA 4O2FB 4J3OD 3V9FA 1PGRB 4ODHL 5TF0A 3D69A 4HGWB 4FOMA 3PDDA 3EO0A 4IIQB 1DHKA 4JM2F 4WSJA 5CZRA 1DZBA 1VEMA 4OIIH 3JWNG 4X9GA 4G9FB 5EC2A 4ZDHA 2YLKA 4NBYB 1JUFB 5SWQA 3HNSH 5PCYA 1W72A 3IJHA 4PCSA 1RK0B 3MRRB 3V4PH 4UINL 5I1HL 2EDXA 5LB1A 1D5IL 3E9UA 3TNMA 5I8EB 4Z7QE 3WKNA 1TJHH 1DVQA 2DEYX 2NY6C 4YHNB 5JPNA 2OSLA 4GQ9H 1TTCA 3UBGA 1UCBH 1U9KA 5H4YA 2APWA 3ULVH 3RL2A 4QD2E 1YDPB 4I1NB 5B7FA 1UOLA 2OBGA 3GEFA 3CSPA 4JCLA 5K9OA 2OMUA 3SGDH 1F1AA 4Y2DC 4Z3IA 1PLBA 3WFHA 4KK6C 5BRQA 4WSGA 4D0DB 3ZKQD 5IJVB 4XX5A 3IN2A 3WY4A 2JV6A 5GRZA 1U36A 1B9KA 4KTDH 2HFGL 2ZP8A 3IPFA 1KWKA 4JEGB 1UHVA 3MA9L 5D2LB 3BIKB 5EOQH 1Z9LA 2Y25A 5FLVA 4BUHA 3KYKL 2FK9A 2OMVB 1M9SA 2J8UA 1LEIB 3HMXH 4OCSL 3W56A 1T5WA 4NN7C 1RVFH 1PS3A 1PJ9A 2RH0A 4AIZA 1A7NH 1UZ6F 2IMMA 3KBPA 2WBXA 3LHAA 5C0GB 5E1HB 5T1DL 1MRCL 5DD6B 3CHPA 2BM3A 2OCCB 4MMYA 2FR4B 3IXAA 3AXLA 4WUKH 4G8AC 3DSFH 3VO0A 5KS9B 3MLSH 4F57H 3LD8B 3EYFA 4NNPL 1PNCA 2Q3ZA 2VLMD 4QCIB 1GPOL 1RP9A 1LO5A 5CZVL 1Z5YD 2YPVA 4MJ5B 4G8EB 4OF7A 4WFEE 3GMLB 3ARWA 4FTVD 5J13B 5B3JE 4UT7L 2JJSC 4MASA 1PG7W 3EH4B 5DK0A 5AKVA 4JMNA 3VWJB 5FO9B 1U8PA 3LS4H 2CDEA 4HWBL 4I3RL 5F7BA 4KQ4H 3REWB 1AG0A 2PXYC 4L3ED 2PTUA 5HSFA 1W6LA 1BAFH 4IK6A 5T3XL 3K2IA 2BW5A 2JF1A 3B6SA 4TNWK 4RZCA 3G6JF 3V7MA 2OSWA 1L9SA 2NY0D 1JG9A 2D0FA 5HDRA 1OGSA 4JPVH 5T1LD 2P28B 5FYKD 3LXBA 1E3FA 3FQUB 4XP6H 1HXYB 1KGCD 1EBAA 3IXTB 2HUEA 1HAWA 3KPRA 4MNGB 5JIMA 2KC0A 3DBXB 3VWKB 3VG0L 2WYIA 1FZMA 1MPAL 4Y9FA 1B4JH 5DD1L 5KZCD 2LAGB 4X4YB 4NFDA 3KL3A 2CRIA 1RP8A 2AGJL 2ZF9A 2QDWA 1GYWA 3QZNA 4ZOAA 3PNRB 2PW1B 4U1MB 1MWOA 5BO1H 1MHPH 1KN4H 2DWTA 4Y88A 1EGJL 2BMKB 5MI0B 1AVAA 1UWXH 3N5AA 5JHLH 1OT2A 4OD3L 4Y9EA 4QOKD 3I6LE 1FRGH 1WCBA 1ZCRA 2G3MA 2VL5A 4MA8H 4CBPA 5MEOB 4NUGH 4OCYL 2AFNA 2YAQA 4XO3A 2EYSB 3BZFB 3WJJA 5DC4B 1IILE 4FQHA 5DVOA 4X6DA 1VGEH 1M71B 4NHCL 2X9XA 1ND0B 4YIQB 4JGUA 2GT9A 3CPUA 3LRLA 4OCRL 1R3HB 4K8RH 4PWIA 4QTIH 4XODA 1JZDC 1R3JA 4YOKA 4I8DA 5J5EA 1MXDA 4JFZH 2J7LA 4PW3A 5FYLE 4FNLL 2YKLH 1T4KB 4P2OB 1YEWA 3UZVB 2H3KA 3OKEA 4H0IA 1WBZA 2QHRH 3HUJB 4RDBA 3IDIA 2R23B 4IOSD 3EBGA 3I85A 5GGRA 4CVWA 3LKNA 3CSGA 1AAJA 4JDZA 4P49A 2WOBA 3FFCE 5D7HA 1WP6A 4GAGL 4UNIA 4Y2LA 4BH7B 3GSUB 4GT0A 5IMOB 2HKAA 4F33A 5EU6A 2PCYA 4XMVA 2V4LA 1CFVH 4G6AD 3PWVB 2GTQA 4FFZA 1SOSA 1CFSA 1F90L 1TXKA 2CHDA 1ZA6A 4JDTL 4NNXB 4H8QA 2ZWKA 4AK2A 4AENA 1GCFA 1KTLB 2QKIC 2TRYA 2VE6B 5CGTA 2QKSA 2Q3AA 1ET8A 5KSAD 1A7PH 3BKYH 3VX0A 1SPDA 4FNTA 1HHJA 2YSTA 1RMFL 1W0YT 1QYGH 2UWEB 4JO4L 5JW5B 4GKSB 3ATFA 3B56A 3V4PB 5IB3B 1AGDA 1J1XL 3P30H 1SFDA 1F6AA 2AJVH 4JFDA 3FQ4A 1QMUA 4H8WC 3M8OL 1FNFA 4AK1A 2AEWA 4WNQA 4F2MA 4TLTA 3S34H 3NFNB 3GZOA 2YARA 5B1BB 1CDJA 1DVXA 1NSNH 4HK3J 3P3TA 1OTSC 5AVYB 4MQXD 5G4MA 3S37L 4XMZA 4L18A 3QXUA 3T3PF 1R3IH 5ICXA 3PPEA 5AQ0A 5IJBC 5FHAL 2O5XL 5JA9A 2O61B 4ORGB 3W2DH 3EYSH 3EJCA 4WWKD 5E4OA 3CSYB 5JORB 4BZ2A 3LHPH 1WTGT 1DFBH 5DQ9B 4E41B 4OQTL 5HHNB 3P4NB 1WFTA 2XKNA 5D7JD 2CGRL 4OZFA 1E8XA 2MNWA 5FCSH 4PJGA 2VDRL 4QRUB 3DKHA 5GSVB 1DQQA 1PNDA 3L3OA 4PRIA 3ARYA 1I8LC 4WFFD 1CI5A 3LB6C 4EDXA 2B3IA 5A2BA 1IIIA 1HL9A 3EOAA 1X7QB 3CXHJ 1EBPA 3SPHA 2GFBA 4AYSA 1FF5A 4JDEA 4Z9KB 2UY7B 2DDQL 2ZXQA 2D3JA 4K55A 4S0HA 5T3XD 1OF0A 1KLUA 1MG3C 1QLEH 2QMJA 4PJHA 1NDMB 1T7WA 4B0MB 4K5LA 2Z0BA 2WLIB 1G1KA 4QXTA 2VMCA 1N7ML 4IS6A 4UILH 1IV8A 3D4GA 2WTRB 1SN2A 3W39B 4PJ7A 2P24A 3DSNB 1Q72H 3RDJA 4NRYA 4WCYH 5EU4A 1CLOH 1PFOA 3RVVC 4JFFD 4ELMF 1A6WL 1MCHA 5E9DA 5FV2A 4NB7A 4FQCL 4FXGB 4PRHB 3EJSA 4NZDA 3B2PA 4H5SA 3FB8B 2VDMH 3PABB 2AK1L 4EN3A 1NH6A 2MCMA 4Z95L 4OLZL 3ZL2A 1MUJA 2H0JA 2COVD 2VDNH 4GW4B 4MVBD 3SY0A 3ML8A 4X98A 2Y6SD 1JPTH 3EJYC 1KLFB 4JHVA 4HIHB 2DI9A 4ZW7A 3KPNA 5TDPA 1AQKH 1A9BA 3HC0A 5FGRA 5E6SB 5DRNB 2R69H 3R06B 3JWDH 3BZDA 1E3ZA 4AZ8B 2V2XA 3EO1B 1LE5B 3W9DA 4UQEA 4L4JA 3DURA 4YBLC 1W6WA 2AXFB 1R5VA 4RAVA 3EOTH 3Q7JA 5F0JB 5J11C 1AIFB 3LKOB 3U4EA 1PD6A 1U93A 1YRKA 2FNBA 5ABAA 1UZ6E 3VSUA 2WWNA 1D5RA 5HGHA 4Y4KC 3VAEA 1VHPA 1DLFL 3T2NH 5J4MA 1BGXL 3BLPX 1GSMA 1U8JB 1VSCA 3MRQB 5H37A 4CW1B 1VKXA 4QRPB 3LRMA 3MGOB 4KDWA 4KPHL 3WL9B 3NUKA 4I18A 3TBTB 4G3YL 3TVMB 4RBPH 4H8HA 3SKNA 2VLKA 3P0VH 1JHLH 5HYFA 5FB8B 4C58B 4F7MA 1HHGB 2WXQA 1FCGA 1G6RB 4S1QH 1ZK5A 2Q2LA 1MI5E 4RMWA 1AE6L 1M6UA 2A3TA 1I53A 3KPSE 3X13A 2DQ6A 3FT0A 1A02N 1YQ2A 1UD8A 3D0LB 4QUOA 4PJDF 1MCLA 4LNRB 3HB3B 4MZ3A 2B15A 3G6JE 3MBEA 1YYLL 2FGWH 4LLMA 4TTDC 4KTEL 2D2OA 4J39A 2QPFA 3HKZA 4FYQA 3U2SA 5AW4B 3IGAB 2XN1A 4EI0A 3VFPB 4J3WA 2JCWA 1T5XB 4DUWA 3DPBA 1H5BC 2XWRA 3QW9A 4UQ9A 5D71H 5ID0B 3IJEB 1AQHA 1T20B 1RZKL 1B0RB 2Z7UA 3KH3A 3VGHA 2EDOA 3DROA 2AEQH 1QNZH 1QSFE 2B2XL 2VJ0A 2DLGA 2IAND 1VFMA 3MACH 4I0PB 4L37B 5E5UB 3T0XA 3B2VL 2EYTA 3SHSA 4WWNA 4KZDH 5HYJA 3A6CH 2FX8H 3CJJA 5T1MB 3Q6GH 2CO2A 2YGPA 4N90D 3X11A 3QQ4A 4MCZA 3RWFB 4MA1C 3O3AB 4Z77B 1R5IA 4PWHA 3O0RL 5A6MA 1BFOB 4X7TB 2O5YL 4X7SL 1K2DA 5FXCH 1WT5A 4POYA 3CZEA 1DQJA 3CZNA 1UA6H 2DQEH 3GD1C 4PYHA 2NDFA 3GM0A 1FL6B 1RHHB 3LPWA 3QCVH 4H0GA 2X0UA 3LQMA 1UWGL 4LQFL 4XNYL 3CV5A 4KMTL 25C8L 1KIUB 3HNVL 2B1AH 5IQ9B 5IB5B 1U8LB 5J1SC 4LPXA 3TIEA 4FG4A 4W6WB 4P07A 4AEHL 1G7IA 4KHXL 1HNGA 4Z7WA 4UTAL 2HWZH 1ZLUH 3ARPA 1QACA 2GK2A 3Q2WA 2EKJA 3KHQA 2WXGA 4ZAKC 1HDMA 5LWYH 2P5WA 5EBMA 1X4YA 3JTTA 4GAJL 1IM3D 3W38A 4N0FA 5KVFL 4IBWA 2CBQA 1JWUB 1UD4A 3PWJB 4ZPVA 4Y9CA 1AS8A 3U0WH 2F1EA 3C87A 4GXUM 3CFDB 3T2QA 5AUMB 3QPQC 2XXCB 2F58L 3FCTA 1DQMH 3FUNA 3V6FA 4QRQA 5CWSA 1SXSA 3O4LB 3NZ8A 1X5FA 4UQ2A 4F8PA 4NO0D 1U8IB 4LVNC 4WI5A 1IAKA 3S5LA 1JGVL 1OSZA 3TS8A 1CK0L 1FG9C 1N0LA 5MERB 4ADGA 3FYIB 1Z5LA 4K5MA 4A04A 3HZMB 4FQ1L 5CU9A 1U3HC 5IFJA 1AIZA 2GJ6E 3K80A 4ONOA 1KB5L 3F7VA 1J7VR 3JZYA 4Y8DC 4E42A 3FQXA 4F80A 3BKJL 4TYUA 4Z7UA 4DN4H 4JZNB 5D7LD 1CICA 3ARFB 4EUPH 3E1ZA 1XH3B 5BVJA 4PTTB 2GITB 5I66A 1UFUA 5I1GH 3RVTD 4AIOA 4HIXH 4R2GB 3PJSA 5CJ5A 2OR9L 3OC8A 1CGWA 1WD9A 3TBVB 4JZOB 3QWOA 3QXAB 4RA3A 4APQD 1QBML 2DYPA 5EB9A 3O9WB 4YFLF 3T3PE 3BISA 3FB6A 3ZDZF 1I8AA 4CA4A 4BK8A 4N1CA 3LMJH 5KVGL 3GMNB 5FO9A 5EU7E 1OTUC 4UUJB 3X14B 4G1EA 3WTTA 1B0GB 1FBIH 3TZVD 3GO1H 1PMYA 1IGYB 2IV9A 4P3WA 4GKNB 1LD9A 4LPTA 3CFCH 5DFWH 5KANG 5BJTB 1HXYA 1TZIA 3OVUB 3O8XA 4NGHH 1JZ3A 2I9LA 3B1TA 5KTEH 3L17A 3RFZA 2G0LA 1X9UA 2JK5A 2E4TA 2VAJA 1DE4B 1LDPL 1YVLA 1GJUA 5B38A 4ODVL 2CU9A 5D96C 5EU7C 4OM0H 2IAMB 2WKOA 5IMLA 3PAVA 1CR9L 3MV8A 2P4AB 5DUJA 1ZGLA 2QGCA 4TQEL 3VD9A 1VRSA 2G3XA 3VQ2C 1NJ9B 4FQQB 2VLRE 4DESA 3BPLC 4XO4A 3IAQA 4HK0B 5J6HB 3WENA 3PPSA 4IIZA 5AKSA 1T2JA 4D7BA 7FABL 4ELME 5A2IH 2CH8A 2WO4A 1T03H 2RB8A 3OAZH 3U0TB 4O2EB 4BELD 1S9XA 2VLME 4X5RA 2B7DT 1AD9B 2FE0A 4NQDA 2ATKB 3ARBA 4FTVE 1JGIA 5IG7B 3WE1A 4CMHB 2I25N 1HINH 1IGCH 1TZAA 2XWCA 4BQ8A 5ANME 3UP6A 4IU3A 5ADOH 3CUPB 3H9SD 2VDOL 1KC5H 3B2XA 4GBXB 4P2OA 3O6LL 3INUL 2O6FA 5FCUL 2EE2A 4NKDB 4UT9L 2VQ1A 3VFOA 5ACMA 4OLYL 2X6MA 4YDZA 4JZJA 3VGAB 3DHMA 4BV1A 5JHBA 3BH9B 3QULB 1YNTF 3NZHH 5FYKE 3BP5B 3UXFA 1A4JB 3EGDA 1UXWA 1KGCE 1IUZA 1SYVA 2WNGA 5EIVA 4YSAA 2Y7LA 3QBTB 3ZK0A 3LSOB 1AGFB 2NRDA 3MOAH 4ODTH 4LCWD 3UX9B 1ZKAA 5C0ND 5K1JA 3L45A 4NAJA 3V4UH 4FCAA 3U9PH 1FPTH 1PG7L 4AQEA 4AT6A 5AD0B 5F9WB 3CK0L 3FQRA 1MHCB 2NTFA 1GMEA 1CFTA 3HR6A 3U25A 4HEPG 3X1BA 4TOYH 5I18H 2LU7A 2NY0C 3BPNC 5ETUA 4AVJA 2EC9T 3GJFA 1KPUB 3RKDD 2NY7H 2IH1A 3SDXA 1L9PA 1IC5L 3FSWA 1UD2A 3U46A 4PG2C 1D5XB 3PNWB 2ARWA 3QIBB 1GL4B 5IIEA 2ED9A 1BAGA 3BYYA 5E1GA 1TQWA 4LSTL 3UC2A 43CAA 2EVHA 1ZHLB 3IDGA 3UAJA 3EDFA 3QUGA 3OB0H 3QEUB 4NXKA 4TSBL 1W72H 2FCBA 5F8RC 4AL8H 5J1AB 1MQ8A 4R90H 2BFVL 2NY5H 3L3DA 4ES8A 3IJYA 5I1EL 1T1YA 2ZUXA 1ZVNA 4WLCA 4RX4A 2NX5A 4JPQA 4FXKC 3Q5YA 5EOTB 4J12A 5EIIA 3OJDB 3KS0H 4JJ5B 1JCKA 2ZX6A 3NPSB 1YMMB 2H32A 1GOHA 4AGLA 4BWTA 1S8DB 2DQGH 3H42H 3LKQA 3D3VA 3IRPX 4PVBA 1XR8B 3RTLA 2E8ZA 1U2HA 3ESUF 1ZA3B 3WY2A 2WCPA 5DMIH 3TA4D 4HDIB 4TRPH 5ANHA 3N44F 1I3GL 2WBJA 2PWEA 5KSBB 1T6VN 3LPPA 1OSEA 4BUGA 2PR4L 1FFOA 1ZEAL 3LRKA 1WZ1L 5GXBB 2Y7OA 4NS0A 3U2IA 2X2JA 5DMYA 3EXJA 2X70A 4IBTA 3QQDB 5D5MA 3TF4A 1P4BL 4DP5X 4QMEA 1JK8B 3ZZQA 2Y69B 1J8SA 2E74C 4UTBL 2BSED 1RV6X 5AW6B 3H7BA 2PTTB 1IE4A 3E8UL 3VB8A 4DVBB 3CLFL 4G6AC 4UOZA 2WTRA 2N0MA 1U3ZA 2DWSA 4JRXB 3BWUF 2IPUG 2IPTH 5EBWA 5A3ID 4K3EH 2PKDA 4RQQB 1BOGB 1JZFA 4MMXB 3HS0B 4U31A 4XXWC 5KSAC 3UTSB 1AGCB 2P5EA 4KROD 5IT2H 2TSAA 2F7QA 4W6XB 2BFGA 2EQDA 3D4CA 4PJEB 1ZRUA 5CJOH 3CQPA 4WVRA 4K7FB 2HX8A 4ONFL 2NY6B 1KJMA 4G7VH 4YO0A 3V0WL 3GGWB 1X44A 2F5AL 2W8CA 4F92B 4P5SA 3TURA 4NJ9L 8FABB 5I15H 4PRPA 1ZE3H 2FO1A 2JVUA 3VA6A 1OT4A 4CADA 3HCVA 1U3JA 4ZODA 4AMKL 3AU1A 4FHJA 1A7QH 3CDGB 3BGMB 4HJ0C 3SKJL 4HAGA 1T6WA 3WUWB 1N59A 1S46A 3EJRA 3PWPA 4MQXC 4WFFE 3BE1L 3UMTA 2L04A 3MXWL 3WGVB 5IVXB 1IBHA 3NA9H 2B4CC 3QZWA 4MLSA 4YFLI 4RMSA 4WDIB 5IM7B 3WSQL 4BM7A 4AUYA 4X80H 4GSXA 2V9RA 5A2JH 1I1AB 4D9QE 5BZWA 3VD7A 1MFNA 4WWKC 5T3XE 1QLFA 3OWEA 2PCFB 3D39A 5HI3D 3D52A 4N9GA 1QPPA 3N1PC 4N68A 5D7JC 4YDJB 2OMXB 4DKFH 4P3CH 1J1OH 1H3XA 4BSVB 4P04A 1EAPB 2K4WA 3TJEH 1J8HA 5F7UA 1QG3A 3ZDZE 2F7PA 5BV7C 4JFFE 1PZDA 2AJYL 4ZW5A 5C2BH 1WISA 3WTVA 3O2DA 3F7YA 4PRAB 2GY5A 3ZTCC 1JHKH 1N6QL 5LBGA 3H9HB 5SWZA 5DJ0B 5DJ6B 4MX7B 2X1XR 3EBIA 5IVOA 1E7UA 3FHQA 2OL3H 1Q9WA 3CNKA 4YSCA 2MCPH 3PWLB 1Z3GH 3ABMB 1UACL 2JQAA 3DX8A 2FX9L 3CDZB 2JJVA 2DEXX 4XO9A 4Y2OB 1JGUH 4XZUB 2F18A 2XVKA 3MGTA 3P54A 1KCRL 4KO6A 3HR5B 4QRRB 4RH4A 4YN3A 2E76C 1AYRA 3RGVD 3SDAD 1TNMA 1B0RA 3JWOL 3UH8A 4MDJA 1OM3L 1AKJD 1M1SA 5C1MB 3N0PB 2OPCA 3HZVB 1OCWL 4YZWA 3O2WH 2Y2YA 3I2CL 1MIML 5BOJA 1P5VA 4KO7A 3L2NA 3MODH 5AB0A 1TMQA 1Q9LB 4MVBC 3IMWA 3SGJA 3R4DA 2LAAA 2Y6SC 3ILEA 4QHLA 1HCZA 2OSYA 4GKOA 3DO7B 4HCGA 3I6GB 4OM1L 1CFNB 4EQ3A 4OKVA 2WVUA 1BLNA 4XP9H 4HC1A 3T4YB 4GP8B 4P57B 2WIMA 4C4KO 1T04A 2P9RA 4LKCA 3G5XA 4RISH 3B7UX 2Y23A 2JTDA 2J5LC 2HT3C 1IM9B 4L0YA 1QEWB 1AZBA 1ES0A 3PJNA 3AY2A 2X89D 1XQ4A 3GLAA 2IGFH 1B2WH 1MLBB 1SY6A 4J6IA 1A64A 1VZHA 3HE6D 5DC9B 5EPMA 3RLSA 3TWCL 4YBHA 3VXMB 1ZTMA 3B9KA 4PGDB 2MRYA 5E8NA 2B9AA 2NQDA 4MDIB 2ZOTA 4R0LA 3PQYD 4WTZG 1ETJA 1A3RL 1G1CA 2Q2EB 2XPZA 4ZUUA 3WBDA 1I1RA 5F0LB 1FVCA 2NMSA 2FLMA 4ZPTB 1NCWH 4G9DB 1VZIA 3I9IA 4GG8B 5FM5M 1H8NA 3U9UA 4OZFH 1QBLL 2DQTH 2P48B 3MV9E 3O4LA 1EFQA 1U41A 4C56D 1FP5A 2CBOA 2NW3B 3GUTA 3OG4B 1NGWA 1T0MB 2FL5B 2XBZA 4NUMA 5JDSB 1E5UI 2IANE 1J9QA 5AAWA 3BVUA 3CXDL 2Q86B 4PV8B 3OF6A 4M62L 3SD2A 4ZUWB 4PJ5E 4GUCA 4KX7A 4WI9A 1QO3A 4POUB 3MRBB 5IBUB 4J7RA 1A6VH 3WELA 3QEQB 2KI6A 4WEMB 4XPTL 3B5GA 4YE4H 2XVGA 4U6YA 5L88H 1KFGA 3QCUL 5E8EA 5B39G 4PCTA 5IB2A 5J12B 1ZHKA 1A65A 1YN6B 3HMWL 3MROB 3F7PC 2AXJA 2BLFA 4IU2B 2IBGA 1KPVB 1TETH 3DETD 4HH8A 4KDTA 3SE3C 3NIFB 1HVXA 2DOCA 2YRLA 1MDTA 3FT4A 3R0MA 4YUEL 3DGGB 1T2QL 4Q9RL 5BRZB 5K1NA 3QFDB 4QKTA 3WHE0 5E94B 2XI9A 3DUUA 3D2UA 3X3FH 4NKMA 1OVZA 4PVLA 1SJVA 3U36A 2PYEA 1DQKA 1MZZA 1DEEA 2K6WA 4NT6A 1CXHA 1IKNC 2BP3A 2C3VA 2WUCH 4HUWB 2CIIA 4HUKB 3RDTA 2DM3A 2GPZA 4Y5VA 2OK0H 4I1RA 3PDOB 4HS3A 1CT8B 3WD5H 2OMTB 4WJ5B 4P48A 1XB6A 5ESQB 3H7LA 3B7RL 5I6LA 1MWAB 2PP8A 3UYPB 3ZVVA 3FU3A 4OFYA 4Q2ZB 4UU9B 5MENE 3EIFA 4DZBB 2EDNA 5BQ7A 1LXMA 5BS0A 2A6DB 3BPCB 4FQXA 3FT9A 5GJSL 3TN0A 3P77B 5IV2A 5F70A 2A9CA 3Q1EA 4KWUA 2PO6C 5E8DL 3NFPB 4OCWH 1OL0A 4ZX3A 1BZ7B 5HVGB 5KYYA 4GMSL 4TUKL 1KY6A 3DIVA 4K9EC 2GHZA 2FEDC 2L8AA 3C6LB 3G3LA 3N40F 4FNQA 5H37H 3JVGA 4HHAB 4LOFA 5H8DA 2R56H 3D0VA 1GKEA 1T21A 2ODIA 3C09C 4P5TD 4Y4HD 3B2DC 1AHWC 4HK0A 4YK4B 1I1CA 2VZUA 5D8JH 1B9ZA 1NMBH 2FSEB 2OL3B 4WUUD 4F5CA 5JQIB 4KK9D 4KMLB 7CGTA 4CC4C 4YAQA 6PCYA 1KFAL 1S7XA 2RBLA 5C0DA 4B9JA 5GGUB 5ICUA 4D8PA 5DJDA 3GBDA 2YGQA 2WMPB 3GMMB 4HV8A 2BZDA 2GUOA 3T8XA 4N5ED 2GAZA 4KJYA 4N6RB 4WV1B 2R4SH 4HOWA 5D4JA 4LAQL 3OLGA 4DGYH 2Q76B 1RUML 1WWCA 4XC3H 1IEBB 1UB6A 4XT1C 3RVTC 3BWUC 1MLCB 3FUMA 2C4FU 2LFGA 3AUVA 1KEGL 1ZK9A 2ZAIA 4JM2B 4KY2A 2WIIA 1MRFL 5AB9A 2MKLC 2DF3A 2R0ZL 1U8HA 3IRZA 4HLZG 1MCPH 4U33A 3CMOH 1NA8A 2BVOB 1AZNA 1ADQL 2QPSA 4JRLA 5JOFB 2CM6A 1D6EA 2FWOB 1TQCC 3BQUB 1KBGL 3FONB 1IRAY 1PX3A 3PHOA 4RFEA 4CU7A 3MV7B 5EHFA 3JWNE 1L4IA 5J11B 3F12B 3PU7A 4PTUA 2AXGB 1LP9A 1PQZA 4YHML 1I1YA 1U21A 2G60H 3RNKA 1VEOA 2NY1C 1NBVL 2R29L 3ABGA 4ZFZB 4A6YB 2DM2A 4FFVD 3TZVC 2ENQA 4OY9A 4Y4KB 4LOVA 1I9JH 3WLBA 1NAKL 2OTWB 5I30L 4RRPG 5KVMC 1XF5B 1R5WA 1IGFL 2VR9A 3FUJA 3HZYA 5FEBA 3CLEH 1K5NB 2UUDH 3O4OC 1T89C 2X4SA 4MS6A 3EFDL 3WAKA 4L2YA 4GPVA 3WDIA 1EDQA 3VG9B 5DTFA 4JB9L 2DICA 2W92A 4M6MH 3WFDL 2F5BL 1GW0A 2BNUB 2E59A 1ZLDA 3KYNA 4IRSA 5EZJA 3MUUA 3KE0A 3VFUB 5CJQH 4AYBA 3NJXA 4QLWA 3CFKB 2NW2A 4OF8A 5J1AA 3X1NA 3JWNC 3O3BA 1MRDL 1PJWA 1SUHA 15C8H 3A47A 1SJMA 2JKIS 3RWGB 3KR3H 1QVOA 1KXTB 2CG9X 2WVVA 3HE7D 3PWUB 3SE8H 3ZHDA 1UWFA 2VITB 1FGVH 1NOAA 4FKEA 3BZ5A 3MLVH 1MSPA 3CSTA 2B39A 1WCQA 2R2BA 2GSMB 5DDHA 4C47A 1DJYA 4R7LA 3K1DA 3IJ8A 3K2UH 1Z9SA 5DT1H 5C0IA 4YDLC 1NIEA 4MNQD 1I7ZB 4MA7H 4FQLL 3V0VA 1M1XB 4BFGA 1S9KC 5D7IF 1GYAA 2FO8A 3NTCH 4LCWE 1MI5B 5G4OA 3AW5A 1NCAH 1O75A 5I1DB 4QHNB 1SUJA 5FUZL 2OKMA 3KPSB 3QNZA 4W81A 1FAIL 5DFVC 1G5GA 4YSOA 3KLKA 5KVFE 1UKTA 1EEYB 2I26N 2R0LH 3E6FB 3MNZB 4WWID 3G6JB 3RWCA 2ZWLT 2H3XC 3FF7A 4P46C 3ZTJH 4MA1B 4NQSB 2XRAL 4HPYH 4AYID 5ADPL 2YS4A 2WNKA 1CBVL 4LRNH 4TVPL 1FUNA 4JR9L 4E2OA 1J88A 4XC1L 1P5UC 2PABA 4MMZA 2G75A 3D12B 5FHBL 3PAUA 1J1PL 2A73B 2DMBA 2F54D 2XWJB 3M17B 5C0NC 1A7OL 3GXIA 1E5AA 1QSFB 1AO7D 1CLYH 1SHSA 2XWBA 5HYQB 4NPYA 5DSCB 4RGMC 3Q6FB 1S9WB 4YGAB 3IETA 5FGSA 5IROC 3RWDB 4P3DB 3NIDE 4ZO8A 2BHUA 5C6PB 3R4RA 4BFNA 4ZFGH 4Y19E 3TV3H 4MTMA 1N67A 2WB1A 5AALA 4HF5H 2XA3A 1XEUA 3D2TA 1AZCA 3FSAA 3BH8A 3GJEB 1P1VA 3J8F7 3M1OA 1NCUA 1HIML 4JQXC 3GHBL 2V9TA 3PRZA 2GJZA 3FFDB 4JRFA 2UYLA 1OAJA 1XTLA 1BEYL 4OZHF 1TO4A 3TIDA 3RB7A 3DX6A 1OAUH 2A77H 3NRFA 3HZ3A 5I73C 2Y4SA 1Y6KR 1KCVH 3KWUA 1HX0A 3JV0A 5IFAL 4Y2DA 3U0PB 4NJAL 2XQBL 5AVUB 2YD3A 4OZ4B 4CC0A 2ADYA 2YA1A 2KZWA 3QUXD 3BT2H 4PJAF 5KVGE 1ZVSB 3HG1D 4O4YL 3FMGH 2AITA 5DI8A 2BIPA 4NKOA 5DYOA 2APVA 2X7LA 1QRND 5K9JL 3BFOA 4URKA 5KG9B 1MEXL 4O58H 4ZD3H 2DYRB 5AZ2L 4XMPH 3SDDB 3CSFA 1YY9D 1G9MH 4PS4H 3Q01A 4DPRA 2JKXA 4HHGA 2ICWI 3BMVA 3K4DA 4B9CA 4NZRL 2WW8A 4N2CA 4O02B 1JV5A 5D6DC 4B9IA 1BYPA 3QZOA 1D2OA 4U1NB 3H3PL 3L95A 2ICEB 4RAHA 1CDYA 4GI8A 3VSVA 1X5GA 1MCOL 3HVDA 5IEHB 4I87A 2C7FA 4NP9A 3LDBC 1NCHA 1OK0A 1VPOL 2DWDA 4PBWD 4LP5A 3WXWH 2JJSA 3AREB 1KN2L 3LZNA 1R0AL 2FH6A 1EO8H 3LPGA 1Y0LB 1BDYA 2QV2A 3H2PA 2PXYA 2B5IB 4I0CC 4IBLT 2E7CA 2R1YB 3FQYA 3V4VA 4PMEA 3QNXA 4UNVA 3IBEA 3ZIMA 3WJMB 1NEZB 1C1EL 1E9OA 3FO1B 4PR5A 3T0BA 2QFRA 2R2CA 2HKHH 5KYXB 1BM7A 4KK5D 5A3IC 3EH2A 1A9VA 3AZUA 2CUMA 5FECA 3FQTA 1CE6B 3WDJA 1H3VA 3EYQD 1KCSH 3RWEB 3T3PB 1SGKA 3GKZA 3DOSB 5T8IA 1LO4L 4KROC 5D1XB 3KG5A 3NACH 1VACA 4RWYH 4FLHA 2GCYA 4OT1H 2A7BA 4YDKH 5DZVA 4R5TA 2DQJH 1N0XH 2CDGA 2AS5M 1A1NB 1GOFA 2VXVL 4IMLA 1DCEA 3GJFH 1XGPA 3AAZB 1K9TA 1T7ZA 3I6GA 1IGMH 2VZVA 3V52L 5K39A 2V9QA 4QF1A 3VXRD 3JUZA 3NCWA 1INQB 1G6VK 3BZEA 1FFPA 1OXYA 2GEEA 1TEGA 3N42F 1OQXA 5C0FA 1OPGL 2OXHB 3KPMA 4XPHL 5EF3A 2O30A 4LBEA 1WYJA 5C0EA 1UGKA 4MD4A 4XTRD 4QXVA 2E0PA 5E5LA 4XMKL 1QLRA 1BD2D 1HYSC 3UEZA 3PP3K 4JO2H 4PJBF 1NEPA 4G7QB 3WXVL 3BO8A 4KXBA 2C9AA 3QDJE 5HI3C 1BREA 1E2VA 3NFSL 3OKLA 2YXWA 1VIWA 2W65B 4ODUB 4PI0A 2BOCB 4W93A 3UTZB 5F6HI 1S78D 3EHBD 1O7DE 2ADFH 4OFQA 2VLJD 3IFPA 3MRMA 2H32H 3Q1SH 3QEGH 3VXNB 2VLRB 3ZBMA 2X4RB 3CIQA 3FSZA 3HBPA 1F11B 1MJUH 2E27H 3X12A 4H8PA 2D4DA 3EYVB 4OGXL 3GEWB 3D48R 3ZMRA 3GS4A 1FA4A 4F2EA 4DQAA 3OHXB 4KDVA 3QQNA 5DD5H 1A4BA 4LVHB 1WBYB 3PGDB 1O7DC 2X4TA 3MUGB 1BJ8A 1DQDL 1JPST 1XIWB 2VUKA 4GIOA 2QKIA 1RZ8B 2BP5M 1XCQB 1DVFB 4DP7X 1SN5A 3SOTA 3G6DL 3SDCD 1UVQB 4NZTH 3F7KA 5CINH 1P4LB 3LYRA 4YSRA 3OXSA 2XWDA 3FFCA 3B7SA 1I3VA 4E36A 1Q9KB 3SDAC 3RGVC 4HQQL 2LGNA 2NZ9C 4D9RE 1F4YH 3LH2H 1NBYB 1D6VL 1M42A 4GAFB 3A6OA 1UA3A 1NGZA 4HUCA 4L8SB 3F7QA 3AM8C 1QFWL 4TLKA 5JIQA 1K72A 4K94C 4YQXH 1GA2A 5E2UH 1QQDA 3HNTL 3SOBL 3QHTC 4H1LA 4P23C 1WAAF 4UMSA 1ED3A 3TASA 1RUPL 3MU3A 4QXGL 4NO2B 4WFGE 4AQAA 3OQ3B 3SQBA 3CCHB 1PAMA 1SFHA 5B8CB 4B97A 4I89A 1EEUA 1FH2A 1CTOA 1DUZA 3PDOA 1QTYT 5AEAA 5CMAA 4JHWH 3O6KL 1XF2B 5F72S 3HFMH 3QXWA 1U8KB 5D7IE 4W1TA 5F1NB 4H2CA 4OV5B 4WHCA 4BGLA 2AJZA 3WKML 4IGBB 2XPGA 1RLWA 4Q6IC 4CAGA 1JNNH 3Q2LA 3HE6C 4KVCL 2WBKA 4L4VD 3DVIA 4OLWL 4DZBA 5A6LA 3L5XH 4KXZH 4PJDB 4EVNB 1D7BA 3INOA 2WBWB 2YA0A 1H3GA 1I8LA 3RA7L 4PJIB 4HUUB 3IAPA 2LU3A 1YEKL 4AUJA 3MLRL 2LQRA 3HBZA 3BUYA 5D7KD 1KDJA 4U7MA 4I48A 1QABA 1E5BA 5FLUA 4G8GB 1GJWA 4PN6A 2TAAA 5GRVL 1RIHH 4N0UA 4W70A 5IK3A 3HG3A 4PY7A 4EZJA 2CKBA 5CJXC 2QPUA 4JM4L 3FUDA 3TONA 4ZT1A 2CR3A 5DFAA 2ENPA 4AQZA 3O2DH 2EEFA 3SZ6A 3U9WA 3G5ZB 3FUEA 5HY9B 2AI0L 4ETQA 1Y6NR 3MJ8B 3WEMA 5AOMA 1ZMYA 3IDJB 2OX5A 4JKPL 3IDYB 1IL1A 2C8NA 3DETC 4CSZA 1EPFA 3WYRA 4QRSB 4UWQB 4OZHE 3BGFC 1IEBA 4WO0A 2CCVA 1T1WA 3B3BA 3HPLA 1C7SA 4BZ1H 3VXPA 1MFCL 2RTTA 1BG9A 5C7XL 4KRPB 5D93B 2Z31B 1NBZB 3SBRA 1ZT1A 4HX1A 2W9DL 3GSRA 2CJUL 4AYMC 4H26B 1C8PA 1CFQB 4LB8A 3K0WA 2BVPA 4PRDB 3L6FA 4LEXH 3LKPB 5EN2B 4PJAE 1HKLL 2C4FT 2P8LA 2W95A 3LQAC 4JHAL 3EGXA 3UERA 1Y7VA 5DJ2A 3P69A 3GQFA 5FA4A 3REVA 3BPOB 3NYKA 2VXUL 3W1ZA 3ABZA 3CH1B 4FERA 4P5KB 4TQ8A 2D3LA 1U3YA 3I75B 5F7HA 2H45A 3LIUA 1E4KC 4MJIE 1JS4A 4XN8A 4HC1H 4ZUSA 5HGDA 2QADC 2J44A 3RNQB 5GGVH 3LNEA 1KIPA 2BWQA 4XBEL 4XN9A 5DD0L 3WIIL 2YRBA 1D7DA 3X3GH 3GSNL 5FO2A 3ECUA 1UYWL 1RULH 4D8OA 2R7EB 2F1AA 3VXSD 1ITBB 2OZNA 5HHXL 3MRJA 5GJTH 1SY6H 4G6MH 1UENA 2VXSL 5E99H 3DA0A 2Q8BH 2P7TB 3PF2A 4XPBH 4BH8A 3AS3A 1KIQA 1A2YA 1BZ8A 1LWJA 2DJMA 4JY4A 3H3KA 2D3VA 5GHWL 4LSQH 1FFNB 5CLYA 4ALAH 4P5TC 4G5ZL 4JJHA 4Y4HC 4MQ7B 3RVXD 2JH2A 5HHQA 2X4PB 4KJWD 2ATAA 2C9RA 3GTVA 1EXUA 4KK9C 1HOCB 3OWRA 3MLWL 1I3RB 2G9HA 3P1VA 4TSCH 1KSRA 3JWOC 3C5ZC 2XFXA 4XXCC 3NEEA 2CLRA 3PV7A 4X7EC 5TPWH 3QG7H 1H5BA 3RZCD 1RUKH 5HJGA 4KRLB 4DP1X 4GRWH 5JPMC 5D1ZI 3CQFA 4N5EC 1OKEA 3FO2A 2V17L 3H6JA 2B0SH 5JIHA 3Q3GA 3C2AH 3KPSA 4P9ML 1A6AB 5DZLA 3M86A 2DQHL 4M1DL 3VXOB 1I8MA 5DEGA 2VZSA 5TE6L 4OAWA 1TTAA 4U6HB 2XY1A 2EADA 5DCCA 1P4IH 1DDHA 1L0XA 2IADA 1KPRA 2CUHA 3MUJA 1CD0A 1HQ4A 2X4OA 3QIWD 6FABH 3LXCA 1MW3A 1HEHC 1MY5A 4F7PA 1IMHC 2A99A 5CUSH 2WGXA 3AC0A 4M5ZL 5I5JA 3WS3B 4U1GC 1J0ZA 4E5XG 1RJLB 3QEHA 5KOMC 1MVFA 1FO0A 2C1OB 4HIJB 3P73A 3T8VA 4PJBE 3KM2A 5EMYA 2KMWA 4NZJA 2GTWB 4WTXA 2EH7H 4ZBJA 4XP1H 1MG2C 1CIUA 1XB3A 4HXBH 1GC1H 2HKFH 4JRYB 1XTMA 4IBUA 2XHNA 4DF9A 3JV4A 4Z7VF 4ZAKA 4ERSH 3UPAA 5F1OB 4XOEA 1NM4A 3GBML 4DGVL 1RJZB 1N12A 3BD5A 1KJVA 3LNIA 4HSQA 3DGDA 3ZX1A 4JHZA 2D03L 5I19H 1WG3A 4IBSA 4MNQE 1H3WM 1S7SA 4MRCA 1ZXQA 1NCJA 3DWTA 3E9TA 1OARH 3WUZA 4IDJL 3BAEL 4B41A 1CGTA 3ZZ1A 2QTEA 4RGOH 5BXFA 1Z5HA 4FABL 3GPSA 5DQJA 3HE7C 3RG1C 3VD5A 4BA8A 2QQNL 5DRXB 1U3HA 3UYRL 1U95A 3SPJA 1R1CA 3PREA 1OOAA 2ZT9C 2VDLL 3QB7C 3CN4A 1C5CL 1FV1A 12E8L 4V1DE 4LVOB 1PZAA 1JJUA 4UB0L 5JOPD 4ZNEA 3RURA 2D2CC 2Y9RT 3H1ZA 1YEIL 3MV9B 1L7TL 3MFFA 1TJGH 1DUYB 2JKLA 3L4CA 4I0KA 4PD4K 2K0RA 3GWJA 4HULB 5EUKA 4L8BA 2Y1YA 1ZTXH 2BY3A 4AEFA 2I9TA 3MRFB 1WAAE 2UXTA 2NXYB 1K85A 3UJIH 3AT8A 2ZKHL 4PJ5B 3DXAB 1Y18B 3F00A 5C08E 4EXPX 1Q0XH 2ZPKH 2J71A 4YHIB 3FB7B 1QWHA 2JXMA 2D7MA 2GJ6A 4FQJH 4HSCX 2JIXB 3MRCA 1FVEB 2LLGA 1HTYA 1I7TB 1SJHA 1R33A 3R1GL 4WKXA 4CVZA 4Z1PA 4BD4A 1E28A 1OSPH 4M5YL 4GW5B 5GGTL 1IAIM 4HU8A 5G2NA 5C0CA 3EW3B 5GS2D 1FLRL 1RZJL 3K5RA 3N91A 3QZMA 3BP4A 4U0RC 2FYYB 1AGBB 2A38A 4KC3B 3C8KA 1KJ2A 2VDRB 1JDAA 3ALXA 1UQSA 5FM5O 3WIHA 1TCMA 1UUSA 2CNZA 1KDIA 1DLHA 3IWUA 3TBSB 3FXIC 5BCAA 1INDH 3EJPA 1AP2A 3N40P 2NY4B 4XMXA 2JE8A 4FJ6A 4MJHA 1EHXA 3RU8L 4DTGH 1T3FA 2OYLA 5ICYA 3HG1E 4KUCD 4PRBB 2JKJA 2P45B 5E2TL 4XPGH 2PO6B 3U7WH 2ZCHH 1QRNE 5EU3B 2FJGB 5IEKB 4UV7H 2EIJB 4HCIA 5AW3B 4X6CF 2G30A 3DX9A 2GSGB 4NRXB 5J6GA 3IF1B 2XQYG 2YGNA 3V6ZB 3L3HB 4TULH 5EU6D 4Z6AT 1ZT4B 3OSKA 3R19A 4PHXA 3VH8A 2HH0H 1A4KB 1JAEA 2OMYB 2X38A 3N44B 5GS0H 2AEPH 5IUSA 4R4BB 2DWEA 2PR9A 2L4OA 5CKGA 3ARDB 5MENB 1Q38A 3GC3A 4PJ9B 4N2KA 3ZR5A 2HT4D 3QUXC 5TQ0L 1QAWA 1GMIA 3L5HA 4GAYB 3MR9A 4H0HB 4HJIA 4XVJH 3QH3A 1MFVA 1UOKA 3HPJB 3COOA 2A6KA 1BBDH 1NCCL 1U8NB 5MEQB 3GS0A 3Q0HA 4P9HL 4Y5YB 3QDME 4U1KA 3SJVE 1WIPA 4Q0XL 3S35H 5HGAA 4DW2L 1WC7A 5D1QE 1YY9C 3CDYA 1EMTL 5JHDB 1N26A 1DANT 2FH8A 1NGPL 3O45B 1ZWIB 4LLDA 3SPVB 1MF2H 2AAAA 1OALA 2QQLH 2WHVA 1HU8A 2YSSA 5B1AB 2NR6D 4YFDB 4ELMA 1Z2KA 3ZE2B 4HFWA 4HIEB 1I9EA 3ULUL 4X6EB 1G9NH 4APXA 5HDQL 4JPWH 1VFBB 4S2SA 4DKDC 4ZMYA 1ZHBB 1IBDA 2L7UA 2D8KA 3E38A 4FTVA 4HT1H 1V3LA 3K81A 5CJ8A 3N6YA 5DUPL 4OSUH 2WLHA 3Q8FA 1UZGA 3CQQA 1JZ5A 1URLA 1D5MA 4WNSA 1NFDF 5ANMA 4BUQA 5C2UB 5D1QC 3VFGH 2CJSA 4E9WA 4G6FD 1BZ9A 2Z7ZA 4L3EA 4ANWA 2NY1B 2C7UA 3OBAA 5IR1A 3BZ4A 1FGNL 1DVTA 1ANUA 3L1EA 5T1LA 1JPFB 1TSRA 3VXRE 4KK5C 2MTPA 1JYVA 2DQFA 2EKSA 2J4WL 2Y3AA 2PYFA 4MWFB 4POZD 2UY6A 4PG2A 3NN8A 4G8IB 3W0WB 3EYQC 1XB8A 1JNLL 1CDIA 2ED6A 2W9EL 4NQCB 5GISL 4AXWB 4KU1A 1KF9B 3MLPA 3DHUA 1A66A 1BD2E 1TKWB 3RWJB 4GH7B 3L3JB 4NO3B 1FCCA 3TA3D 1ORQB 2AV1A 4YL9A 1SLXA 4Y4FB 3HI1A 3OPUA 1UXLA 4YX2H 2J88H 5FO7B 3ROLB 4FXKA 4LDOB 3TBWB 2VLJE 2F7RA 3BDYL 4YVNA 4HUVB 4IBVA 2AC0A 2A83B 4QOKA 3IS1X 3RPBA 3DX2A 3H2WA 1TZGH 4L5FE 1N5AB 3T0WA 3TV8A 1NCBL 3TEXA 2EUWA 3MLYH 2CMRH 2GBUA 3FTGA 4LSSL 2LU4A 4OV5A 4NN6C 5E9DD 4HZLB 2GB2A 3FHAA 4XTRC 1LK2B 3LQZA 3L9RA 1S2EA 3ZZSA 1YUKB 3A0OA 4R84A 4O5LH 1ZS2A 2EIZA 3HBGA 2XDHA 3P4OA 1INEH 1BWMA 4L0PB 3BUIA 5CR1A 1N4XH 5F97E 5F0MB 3DNKA 1SEBA 2WC7A 5DEJA 3QR0A 4LLUA 1X5JA 2F19L 3OZLA 1S78C 3EHBC 3QR2A 3HHSA 5ITFA 1JGDA 1PZ5B 3MOQA 3U30B 4F7CA 1G7HA 1DBAL 2HJLB 1RIUL 2GTZB 1EEZA 2WLLA 2AKRA 4P46B 2WXMA 2W0FB 4IOSA 5KSVB 2Y0SA 1O6VA 3L4ZA 3P4LA 4YHYC 3GBEA 3QO1A 3FC8A 3EFFA 3DVGB 3EADA 1M7DA 4I9WD 2NYYD 2P47B 4ZMLA 2VDKH 4JW3A 3U2JA 4HUXA 2B1HH 3QNYA 9PCYA 1I85C 3ES6B 4FHBD 3NGBB 1SM3H 4N8CL 2QSCH 5EO9A 4Z7VE 3APNA 4RIRA 4X4ZA 3DJSA 3GI9L 3ULAB 4DGIL 5L8JB 4C59B 2YUXA 3L1OL 4XXWA 5KSAA 4MAUL 3GZKA 4AVIA 1OAYL 2BRRL 3H9ZA 4XAWL 5BZXA 5L2JA 2V8LA 3PDGA 5LG1A 4B27A 1OAZL 2DD8H 2TRHA 1E4XL 1I7RB 1YUHB 4XP4L 1HQRA 5I75C 4TM9A 3NABH 2OP4L 3NOIA 4TSAL 1W16A 5I9QC 2HVJB 2QPEB 1SBSL 3RGHA 3JSSA 4WRLA 5IFHL 3LRSA 4ZX5A 2YD5A 4XBPB 1FIEA 1Z9MA 5T5FL 2ZUWA 1E5CA 4JAMA 3MLUH 1G0XA 1KB5B 4HCRA 1UM5L 3D09A 4U05A 4Y19B 4IJ3C 4FF9A 1F4XL 1E8WA 4QT5B 5KYWB 3BGAA 1NOFA 4QRTA 4WQOA 1Q90A 5HYEA 1TCRA 4JMXA 3QXDB 3S36H 1XL4A 1D5ZA 1UJ3C 5I24A 3QPXL 2W94A 1YMHB 4WWKA 5BZZA 3MYJB 3OKDA 4OCLC 3ZE1B 1N5YL 2QVTA 1QRKA 5E1AB 3SZKC 1HE7A 1JPSH 5D7JA 2O26U 2FATH 1IQWL 4K9JA 1B4LA 3BHBB 4ZZKA 3H4FA 3ATEA 35C8L 1FNGA 1YEHH 4QRBA 4G42A 3QARA 5F0PB 4N2DA 3B9EA 2X88A 2GJRA 3SCMC 2FWUA 1AFVH 1WICA 4EDWH 5KJRH 1U8CA 4MGXA 1KZQA 3DBSA 3JV6B 3LDBB 1X5LA 1FC1A 3AB0C 2VM4A 2O5NA 1DJZA 3ESMA 3UADA 1XF3B 4HLJA 3DUHA 3ZHLA 3KPTA 2G5RA 3GRWA 3VRJB 4DEWA 2V2WA 4G9FD 4PV9A 2E9JA 3ZN6A 3BUTA 3MAWA 2ZSVA 2FQFA 3BEWA 4AQ1B 3KHOA 4WJKB 2XX1A 4JFFA 4EEEA 5JLZA 5H94A 4ES9A 2K1MA 4FJYA 2YAFA 5GSRA 4JE0A 3OQRA 3K4ZA 1BQSA 5FYLH 5JR1H 1A6AA 1A3LH 4OIIL 4QWWD 3DJTA 3W3BA 3HNSL 4R97C 2GJPA 4X6CE 5D9SB 4CJ1A 1EGJA 2GI0A 2ICWB 4YSUA 1BIIA 5DJAB 2ENYA 3V4PL 2GIYA 4ICWA 5F9AC 2QGDA 3NH7H 5IF0A 3TJPA 1TJHL 2YC1A 4ZUVB 2EYRB 3KJ4C 2CQVA 4GQ9L 3D5OF 3S3CB 1UCBL 5IB4B 1RJLA 2EDDA 4M61A 4YZFF 3NCJH 1E27B 3RP1A 3L3GA 1FLTX 3ULVL 2Q0ZX 3VQLA 4ZMPA 4UT6H 4P2RB 1G7MA 2HT2D 3BVWA 4H1LH 3O11A 3O6FC 4JY6A 3WEBA 3V5HB 3RPIA 2IVFC 1QFWI 2VDOB 3RQ3A 2J55A 1TT6A 2V7HA 4H2AA 2X2UA 4KTDL 3MRPB 3POHA 4MAYB 3EO9H 5EOQL 4LASH 5GIRA 1J5DA 3HMXL 2ZXWB 4QHMB 4AKQA 1RVFL 1SZNA 5DZAA 4PFEA 3MRLB 2NLJB 3VI4A 1S7WB 3PP4H 1A7NL 3HC3H 4KRMB 2KT6A 3KYOA 5TDOA 4QHPA 3P3UA 1YEJH 2CDFA 1AOZA 1ONQA 2XOTA 5DGQA 1G7JB 2CR0A 4LDCA 3PAYA 1X5MA 4WUKL 1H8OA 3DSFL 1KNOB 1NFDE 4L3CB 3VWJD 3FH5A 3CZFB 1WK0A 3MLSL 3ULSA 4F57L 3VXUE 5JOEA 2XIIA 3F62A 3HLAB 5T1JA 1JZHA 4R96A 2JI2A 3RVXC 4KJWC 4NHUB 1YNTA 3JXAA 1W0VA 3RE0A 1W91A 1YEDA 3LS4L 4L23A 1BQHA 4KQ4L 4ZFOA 3SE3A 4EN2A 1BAFL 1VDGA 3VWKD 4HOXA 3CHOA 3RZCC 2CKBH 3K72A 3KJ6L 4ZW8A 3OR6B 2DMGA 3KLAB 3SKOA 1KEMH 1M3IA 4JPVL 3N1GC 3CN0A 4XP6L 2IANA 4LHUG 3PG2A 3KCPA 2AXWA 3ZU8A 1WHPA 2DQIH 3DJ9A 5C0BE 3ZY7A 5DK2B 3ARGB 4NI6A 1B4JL 2YMOA 3LZPA 4D0BA 3S2CA 5CHNB 1A3QA 5ALBH 2MTAA 4EUPG 5CFAA 1HJBC 3QIWC 1D3CA 3BSHA 5GGSB 3NJIA 1IKNA 3EF4A 5D6CA 3S0PA 2FIRT 1CD1B 2H5UA 1KTRL 4OJCA 4HK3N 4WJG3 2Z92B 5EOCH 3QUYC 1LEKA 3PY9A 1XDTT 4OQTA 5TE7H 4PGCA 3TO4B 3B34A 2L7JA 5I74C 1MHPL 1KN4L 2FYYA 4K5PA 5BO1L 2ZSWA 5JHLL 1P84K 1CIDA 1OCOB 3U4AA 5FF6A 3QUZB 5KN5B 1BMWA 1FRGL 4MA8L 4ZTEA 3S48A 1FVDB 4NUGL 3S37X 3UBXG 3VCLA 5CP3A 1O6TA 3RWHA 3CFEA 4HAKA 3ATDA 2DZEA 4P2OD 1NANI 1VGEL 4A38A 4UYQA 5ID1A 5F89B 1KB3A 5HHPA 4HVBA 3QVAA 3QQXA 1IM3A 1LO3H 4QTIL 4K8RL 4JFZL 3ISRA 2CM5A 3IGKA 4LXFA 3RYMA 1Z32X 4DWHA 4ZQTA 2YKLL 1MFMA 1YJDC 4MXVF 1BX2B 1FNLA 2CO4A 3L3HA 5D7IB 2X10A 4Z76A 1ZT4A 2QHRL 3KWWA 4NNYB 5F7LB 5JW4M 4NO0A 2J1KA 1AHWA 4ZTOH 3KGRA 4XGZB 2YLHA 3EOYG 2E9GA 3QG6A 4KKAC 4P06A 2Y5TB 1IGIH 2NUTB 4R26H 3ULUF 3K6SA 4CC4A 1BECA 1QATA 2IC2A 3VTTA 3BCFA 3A4EA 5FKPB 2Z1PA 1CFVL 4XCEA 5EEUA 4BA0A 1T2XA 2HLAB 2HX9A 3IMVA 3OZ9H 4DQOH 1OB0A 1OGAB 5D7LA 1A1MA 3WUWG 4FZEH 2NNAA 4XB7A 3UG3A 4W9EC 3V0HA 3TBYA 1XAUA 3KYMB 1PZBA 3BGFB 2EVFA 3TPUB 1A7PL 3BKYL 3IFLH 4M7ZC 3TO2B 2W91A 1EZUA 4EKXA 2O5ZH 1QYGL 4EJ1C 4LCUB 4OIFA 2HXAA 3ULVD 2UZXB 5AW7B 4APQA 3P30L 4JLRB 1UATA 2AJVL 4X9YA 4OZIE 4JFXB 5F93C 3F6IA 2BS71 1RZIA 1FDLH 4KVPA 1JRHH 4JBSA 2OV0A 5C9JA 5J57B 2YJLA 1EJOH 3S34L 4C83B 2OJ1A 1O7SA 3MNVB 2I7SA 3E6HB 1NSNL 4R7NB 2WLZA 1F1GA 9CGTA 3C60B 1RK7A