2ZOVA

Structure of the periplasmic domain of motb from salmonella (crystal form i)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
166
Chain Sequence
KKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATDAINRRISLLVLNKQAEQAILHENAESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
publication title Stator assembly and activation mechanism of the flagellar motor by the periplasmic region of MotB
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Membrane protein
total genus 49
structure length 166
sequence length 175
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2zovA00
2W8BC 4G88A 2ZF8A 4ZHVA 2ZOVA 4ERHA 5EB1B 3S03A 3S0YA 4G4VA 3KHNA 2N48A 3TD4A 3TD5A 4G4ZA 3LDTA 2ZVZA 4ZHYB 2AIZP 3WPWA 3S06A 4G4YA 1OAPA 5EB0A 3S0HA 4B5CA 4B62A 4G4WA 2ZVYA 4R40B 1R1MA 2LBTA 2KGWA 2MQEA 3OONA 4G4XA 3WPXA 4ZHWA 2K1SA 3IMPA 2L26A 4PWTA 3S0WA 4RHAA 5EAZA 2HQSC 2LCAA 3CYQA 3CYPB 3S02A 3TD3A
chains in the Genus database with same CATH superfamily
4C8GA 3KJJA 3HKCB 3CCSF 1RLGA 1SZQA 2AMTA 4YJ2A 4X20B 3F0GA 5HP7A 1W41A 5HY2A 2OTMA 5HXUA 2QI2A 3F0EA 3CCUF 1VQPF 5IJ9A 1W57A 2Q1XA 3I3FA 4I4TA 2LBTA 4G4XA 3OONA 1W5FA 4U39A 3HJWC 1X7PA 2K1SA 3FD6A 4RHAA 1CN7A 2NMUA 2R751 3NVKE 4IIJB 1JN1A 1YIJF 3WGMA 3AGKA 1VQVA 2KG4A 4RQOA 3CXCF 1Z5WA 5FNVA 3VMFB 3F0FA 3E20B 3RYFB 3P10A 1VQ8F 2ZVZA 1U3LA 1X52A 1S72F 3EORA 1VQ4F 4I55B 5GANK 1ZWZA 3MBMA 5A2QM 2IG8A 4LNUA 1W5EA 3IR9A 1VK3A 5LOVA 4I50A 3RYIB 2GLZA 3CCJF 2R6R1 5EIBD 5LXTB 1W55A 2Z1UA 2QEXF 2N48A 3RA6A 5DCVA 5HXZA 1QD9A 4G4ZA 3P4EA 1UI9A 3IEWA 4ZK7A 3ELCA 4EB6B 3E22B 3V7EA 1TUBA 1Q8RA 4YJ3B 1FNJA 3ZOPA 4BVSA 2L26A 1W5AA 4ZI7B 1VHAA 2HQSC 4IIJA 4O4JB 4O4HB 3T80A 1XV2A 3VYSC 1W40A 2H6LA 2JNBA 1YITF 3N2GB 3PLAC 5LA6B 4EI7A 3JALB 4KWEA 5BMVB 3V4DA 3RYHA 2DT4A 2RHJA 2HS3A 1QVGF 4XCQA 3IKEA 1NJIH 4TV9B 4IHJB 5GONB 3K12A 3KE1A 4X1YA 1X25A 4B45A 3RYIA 3RYCA 1YQNA 2UYNB 3JATA 2I6DA 2ZODA 1GO0A 3CG6A 3C9SA 1IV4A 2YXZA 3TD3A 2OZBA 3J81M 5B8FA 1ODEA 3DC2A 4WBNB 3LYBA 2HRYA 4TV8B 5IJ0A 1H48A 1GO1A 2RHOA 5IT9M 4HNAB 1TVKB 5HY1A 4BT5A 4X3LA 2AIZP 3MCQA 2CHSA 3JAKB 1JFFB 4BVQA 3OW2F 2HX0A 2BO1A 3JAWB 2VAPA 4O4LB 4X1IB 1XBIA 1RA4A 2CW4A 3D01A 4BT7A 3CCRF 1VH8A 1CK2A 5LP6A 3NMUC 3NK7A 1FFXB 3KJKA 3S03A 5GIPC 3VYUC 3N2GA 5HP8A 5JH7A 5C8YA 5LA6A 5JQGA 2OTJF 5KMGA 3HTNA 1XRGA 1Q82H 4LCKA 1OAPA 2HP0A 1PF5A 3K14A 3C9RA 2Z1EA 5EIBC 3ZO8A 2RB9A 3M4SA 2MQEA 2H8CA 2CHTA 3PAFA 3CPQA 3WJQA 2BTQB 3CCVF 3S0WA 2LCAA 3HKBB 3IEQA 1T0KB 3HAXD 2CWJA 3I7TA 3L7QA 3CMAF 5EB1B 4FFBA 1NMUB 1JJ2F 2F9ZC 3F6MA 2GZLA 5JCOC 4C8IA 3F0DA 3VO8A 4O2AA 3HKEB 5CB4A 3CCQF 4B5CA 5IYZA 4E6EA 3VOAA 4O4LA 5ITZB 3FPIA 4X1KB 1YJWF 1VQNF 1GX1A 3WGKA 3CC4F 3BYQA 3KIZA 1IPAA 3N2KB 4U3JA 1W2BF 3GTZA 1VQMF 4TUYB 4BVRA 2ZOVA 1FFXA 3HKCA 3RE3A 4G4VA 4X20A 1GZ0A 3TD4A 5FLXM 3CB2A 3ESJA 2HP3A 2EWCA 1DT9A 4O2BB 1VQ6F 3CD6F 3OBYA 4B46A 3CC2F 4ZHQB 2UYJA 1VQOF 5HWEA 4G4WA 1Q81H 3JVHA 3K2XA 5HY0A 2WALA 5EZYB 3ZP4A 3J7AR 3CCMF 2KTUA 2BTOA 1Q7YH 2CSLA 3NK6A 3VTIC 5CA1B 3ON1A 2FC3A 2W8BC 4G88A 5GIOC 1COMA 1SA0B 2AIFA 2HRUA 3S0YA 5JVDB 3JARB 3VI6A 4BY9D 2HVYD 3HKDB 4EI8A 3VIUA 1QU9A 4O4IB 2QTPA 1PXWA 3V3TA 3RYFA 3UT5B 3M84A 1KNJA 2LBWA 4I55A 2Q1YA 2UZHA 5LYJB 1VQ7F 3MCAB 2KGWA 1ONIA 4DRXB 1VQLF 3IMPA 5J2TB 5MN5A 5EYPB 5G4VC 2VAWA 2PHNA 3JCMM 3WGNA 3R0PA 4BW0B 4C8EA 2GVIA 5KX5B 2I6RA 2ZF8A 4YJ2B 4C82A 3WJRA 1M90H 4TUYA 4C4WC 4ERHA 5LXTA 3CMEF 3TD5A 5MN6A 2DYYA 5AVMA 5J2UB 5IJ9B 4ZHQA 3M1XA 3O85A 3G6EF 4EB6A 3E22A 4C81A 4YJ3A 1KD1H 4ZI7A 3VYTC 1IV3A 3CYPB 4O4JA 4EI9A 3JASB 1E7KA 3D00A 4O4HA 4ZHVA 1UFYA 5JVDA 3JARA 1W581 2KTVA 3U0OA 1OFUA 4ZOLB 2Z1TA 3JALA 3UT5A 5BMVA 1IV2A 1Z5VA 1YI2F 3S0HA 1J7HA 1RQ2A 4BT2A 1KQSF 4LNUB 1K8AH 4TV9A 4I50B 1R1MA 4IHJA 2PMPA 3C9UA 5GONA 4BVTA 4DRXA 3MQWA 5GINC 1VQ9F 2VGNA 1U43A 2UYNA 5HY4A 5EYPA 4DXDA 1U3PA 3QUWA 3JAMM 1QAHA 1YHQF 5KX5A 1QVFF 3SIUA 3ERNA 1RQ7A 3QHDA 4WBNA 2CZWA 4TV8A 2H8EA 1VQ5F 3ZP7A 4HNAA 2OTLF 3LWQC 2YYEA 5J2UA 1TVKA 3VOBA 3JAKA 4BT3A 2ZVYA 1JFFA 4NUTA 4NWOB 1TUBB 3JAWA 4ZHWA 1KNKA 3WXMB 5FJ4C 4PWTA 4X1IA 2VGMA 5MN4A 3SIVA 3E1YA 4BT4A 2UYPA 3C8LA 3JASA 2FGYA 3D54A 1W59A 3WGLA 1FSZA 3LWVC 3C9TA 3OBWA 3B6NA 4ZOLA 3RYHB 3Q8HA 3V7QA 3G4SF 3WPWA 3LWPC 1JD1A 2HS0A 3CC7F 5CA0B 1SDSA 2OHWA 4X1YB 5JCOA 3WGJA 3RYCB 3G71F 3JATB 1FNKA 2VAMA 1H7MA 5EAZA 1YGYA 1VQKF 2HS4A 4M8IA 3HKBA 2RHHA 5IJ0B 3K0TA 2G9IA 1K73H 3N4ZA 5GAPK 1W3EX 1JY8A 5G4UC 1M1KH 3IKFA 5EO3A 1W42A 3P0ZA 1CLIA 2P6YA 3HKEA 5EB0A 3VCZA 3DDNA 2Z01A 2V9YA 3GYQA 1Q86H 3FFMA 2VXYA 3CPWF 5ITZA 3RA5A 4TZZA 1T0AA 4X1KA 2LBXA 4F6RB 3CYQA 1NQ3A 5LP6B 5EWRA 1DBFA 3N2KA 1K9MH 1IV1A 5JH7B 5C8YB 3NVIB 3KHNA 5JQGB 2UYKA 3I55F 2Z1FA 3FD5A 3LDTA 5KMGB 3LMEA 2ALEA 3WJPA 2QA4F 4X3MA 2HP0B 1W5BA 4BT6A 4O2BA 3S06A 2IQQA 1U40A 5CA0A 2RHLA 4B62A 1KC8H 4I4TB 3J80M 3QTYA 5LP6C 5EZYA 3CCEF 3S02A 3GHZA 3FBAA 5CA1A 1RLUA 1X7OA 4FFBB 2BTUA 1N8RH 1SA0A 5FNVB 4U3JB 3HKDA 4O4IA 3I56F 4O2AB 1YJNF 4ZHYB 3LFOA 5CB4B 2IAFA 3MDOA 4G4YA 2B33A 4NQ3A 3LWRC 5IYZB 4R40B 5LYJA 5LOVB 3WPXA 1XHOA 3CCLF 1YJ9F 5J2TA 2ZAUA 3N4YA 1H47A 3LWOC 4F6RA 3HWUA 2CVLA
chains in the Genus database with same CATH topology
2W8BC 4G88A 2ZF8A 4ZHVA 2ZOVA 4ERHA 5EB1B 3S03A 3S0YA 4G4VA 3KHNA 2N48A 3TD4A 3TD5A 4G4ZA 3LDTA 2ZVZA 4ZHYB 2AIZP 3WPWA 3S06A 4G4YA 1OAPA 5EB0A 3S0HA 4B5CA 4B62A 4G4WA 2ZVYA 4R40B 1R1MA 2LBTA 2KGWA 2MQEA 3OONA 4G4XA 3WPXA 4ZHWA 2K1SA 3IMPA 2L26A 4PWTA 3S0WA 4RHAA 5EAZA 2HQSC 2LCAA 3CYQA 3CYPB 3S02A 3TD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8B C;  4G88 A;  2ZF8 A;  4ZHV A;  2ZOV A;  4ERH A;  5EB1 B;  3S03 A;  3S0Y A;  4G4V A;  3KHN A;  2N48 A;  3TD4 A;  3TD5 A;  4G4Z A;  3LDT A;  2ZVZ A;  4ZHY B;  2AIZ P;  3WPW A;  3S06 A;  4G4Y A;  1OAP A;  5EB0 A;  3S0H A;  4B5C A;  4B62 A;  4G4W A;  2ZVY A;  4R40 B;  1R1M A;  2LBT A;  2KGW A;  2MQE A;  3OON A;  4G4X A;  3WPX A;  4ZHW A;  2K1S A;  3IMP A;  2L26 A;  4PWT A;  3S0W A;  4RHA A;  5EAZ A;  2HQS C;  2LCA A;  3CYQ A;  3CYP B;  3S02 A;  3TD3 A; 
#chains in the Genus database with same CATH topology
 4C8G A;  3KJJ A;  3HKC B;  3CCS F;  1RLG A;  1SZQ A;  2AMT A;  4YJ2 A;  4X20 B;  3F0G A;  5HP7 A;  1W41 A;  5HY2 A;  2OTM A;  5HXU A;  2QI2 A;  3F0E A;  3CCU F;  1VQP F;  5IJ9 A;  1W57 A;  2Q1X A;  3I3F A;  4I4T A;  2LBT A;  4G4X A;  3OON A;  1W5F A;  4U39 A;  3HJW C;  1X7P A;  2K1S A;  3FD6 A;  4RHA A;  1CN7 A;  2NMU A;  2R75 1;  3NVK E;  4IIJ B;  1JN1 A;  1YIJ F;  3WGM A;  3AGK A;  1VQV A;  2KG4 A;  4RQO A;  3CXC F;  1Z5W A;  5FNV A;  3VMF B;  3F0F A;  3E20 B;  3RYF B;  3P10 A;  1VQ8 F;  2ZVZ A;  1U3L A;  1X52 A;  1S72 F;  3EOR A;  1VQ4 F;  4I55 B;  5GAN K;  1ZWZ A;  3MBM A;  5A2Q M;  2IG8 A;  4LNU A;  1W5E A;  3IR9 A;  1VK3 A;  5LOV A;  4I50 A;  3RYI B;  2GLZ A;  3CCJ F;  2R6R 1;  5EIB D;  5LXT B;  1W55 A;  2Z1U A;  2QEX F;  2N48 A;  3RA6 A;  5DCV A;  5HXZ A;  1QD9 A;  4G4Z A;  3P4E A;  1UI9 A;  3IEW A;  4ZK7 A;  3ELC A;  4EB6 B;  3E22 B;  3V7E A;  1TUB A;  1Q8R A;  4YJ3 B;  1FNJ A;  3ZOP A;  4BVS A;  2L26 A;  1W5A A;  4ZI7 B;  1VHA A;  2HQS C;  4IIJ A;  4O4J B;  4O4H B;  3T80 A;  1XV2 A;  3VYS C;  1W40 A;  2H6L A;  2JNB A;  1YIT F;  3N2G B;  3PLA C;  5LA6 B;  4EI7 A;  3JAL B;  4KWE A;  5BMV B;  3V4D A;  3RYH A;  2DT4 A;  2RHJ A;  2HS3 A;  1QVG F;  4XCQ A;  3IKE A;  1NJI H;  4TV9 B;  4IHJ B;  5GON B;  3K12 A;  3KE1 A;  4X1Y A;  1X25 A;  4B45 A;  3RYI A;  3RYC A;  1YQN A;  2UYN B;  3JAT A;  2I6D A;  2ZOD A;  1GO0 A;  3CG6 A;  3C9S A;  1IV4 A;  2YXZ A;  3TD3 A;  2OZB A;  3J81 M;  5B8F A;  1ODE A;  3DC2 A;  4WBN B;  3LYB A;  2HRY A;  4TV8 B;  5IJ0 A;  1H48 A;  1GO1 A;  2RHO A;  5IT9 M;  4HNA B;  1TVK B;  5HY1 A;  4BT5 A;  4X3L A;  2AIZ P;  3MCQ A;  2CHS A;  3JAK B;  1JFF B;  4BVQ A;  3OW2 F;  2HX0 A;  2BO1 A;  3JAW B;  2VAP A;  4O4L B;  4X1I B;  1XBI A;  1RA4 A;  2CW4 A;  3D01 A;  4BT7 A;  3CCR F;  1VH8 A;  1CK2 A;  5LP6 A;  3NMU C;  3NK7 A;  1FFX B;  3KJK A;  3S03 A;  5GIP C;  3VYU C;  3N2G A;  5HP8 A;  5JH7 A;  5C8Y A;  5LA6 A;  5JQG A;  2OTJ F;  5KMG A;  3HTN A;  1XRG A;  1Q82 H;  4LCK A;  1OAP A;  2HP0 A;  1PF5 A;  3K14 A;  3C9R A;  2Z1E A;  5EIB C;  3ZO8 A;  2RB9 A;  3M4S A;  2MQE A;  2H8C A;  2CHT A;  3PAF A;  3CPQ A;  3WJQ A;  2BTQ B;  3CCV F;  3S0W A;  2LCA A;  3HKB B;  3IEQ A;  1T0K B;  3HAX D;  2CWJ A;  3I7T A;  3L7Q A;  3CMA F;  5EB1 B;  4FFB A;  1NMU B;  1JJ2 F;  2F9Z C;  3F6M A;  2GZL A;  5JCO C;  4C8I A;  3F0D A;  3VO8 A;  4O2A A;  3HKE B;  5CB4 A;  3CCQ F;  4B5C A;  5IYZ A;  4E6E A;  3VOA A;  4O4L A;  5ITZ B;  3FPI A;  4X1K B;  1YJW F;  1VQN F;  1GX1 A;  3WGK A;  3CC4 F;  3BYQ A;  3KIZ A;  1IPA A;  3N2K B;  4U3J A;  1W2B F;  3GTZ A;  1VQM F;  4TUY B;  4BVR A;  2ZOV A;  1FFX A;  3HKC A;  3RE3 A;  4G4V A;  4X20 A;  1GZ0 A;  3TD4 A;  5FLX M;  3CB2 A;  3ESJ A;  2HP3 A;  2EWC A;  1DT9 A;  4O2B B;  1VQ6 F;  3CD6 F;  3OBY A;  4B46 A;  3CC2 F;  4ZHQ B;  2UYJ A;  1VQO F;  5HWE A;  4G4W A;  1Q81 H;  3JVH A;  3K2X A;  5HY0 A;  2WAL A;  5EZY B;  3ZP4 A;  3J7A R;  3CCM F;  2KTU A;  2BTO A;  1Q7Y H;  2CSL A;  3NK6 A;  3VTI C;  5CA1 B;  3ON1 A;  2FC3 A;  2W8B C;  4G88 A;  5GIO C;  1COM A;  1SA0 B;  2AIF A;  2HRU A;  3S0Y A;  5JVD B;  3JAR B;  3VI6 A;  4BY9 D;  2HVY D;  3HKD B;  4EI8 A;  3VIU A;  1QU9 A;  4O4I B;  2QTP A;  1PXW A;  3V3T A;  3RYF A;  3UT5 B;  3M84 A;  1KNJ A;  2LBW A;  4I55 A;  2Q1Y A;  2UZH A;  5LYJ B;  1VQ7 F;  3MCA B;  2KGW A;  1ONI A;  4DRX B;  1VQL F;  3IMP A;  5J2T B;  5MN5 A;  5EYP B;  5G4V C;  2VAW A;  2PHN A;  3JCM M;  3WGN A;  3R0P A;  4BW0 B;  4C8E A;  2GVI A;  5KX5 B;  2I6R A;  2ZF8 A;  4YJ2 B;  4C82 A;  3WJR A;  1M90 H;  4TUY A;  4C4W C;  4ERH A;  5LXT A;  3CME F;  3TD5 A;  5MN6 A;  2DYY A;  5AVM A;  5J2U B;  5IJ9 B;  4ZHQ A;  3M1X A;  3O85 A;  3G6E F;  4EB6 A;  3E22 A;  4C81 A;  4YJ3 A;  1KD1 H;  4ZI7 A;  3VYT C;  1IV3 A;  3CYP B;  4O4J A;  4EI9 A;  3JAS B;  1E7K A;  3D00 A;  4O4H A;  4ZHV A;  1UFY A;  5JVD A;  3JAR A;  1W58 1;  2KTV A;  3U0O A;  1OFU A;  4ZOL B;  2Z1T A;  3JAL A;  3UT5 A;  5BMV A;  1IV2 A;  1Z5V A;  1YI2 F;  3S0H A;  1J7H A;  1RQ2 A;  4BT2 A;  1KQS F;  4LNU B;  1K8A H;  4TV9 A;  4I50 B;  1R1M A;  4IHJ A;  2PMP A;  3C9U A;  5GON A;  4BVT A;  4DRX A;  3MQW A;  5GIN C;  1VQ9 F;  2VGN A;  1U43 A;  2UYN A;  5HY4 A;  5EYP A;  4DXD A;  1U3P A;  3QUW A;  3JAM M;  1QAH A;  1YHQ F;  5KX5 A;  1QVF F;  3SIU A;  3ERN A;  1RQ7 A;  3QHD A;  4WBN A;  2CZW A;  4TV8 A;  2H8E A;  1VQ5 F;  3ZP7 A;  4HNA A;  2OTL F;  3LWQ C;  2YYE A;  5J2U A;  1TVK A;  3VOB A;  3JAK A;  4BT3 A;  2ZVY A;  1JFF A;  4NUT A;  4NWO B;  1TUB B;  3JAW A;  4ZHW A;  1KNK A;  3WXM B;  5FJ4 C;  4PWT A;  4X1I A;  2VGM A;  5MN4 A;  3SIV A;  3E1Y A;  4BT4 A;  2UYP A;  3C8L A;  3JAS A;  2FGY A;  3D54 A;  1W59 A;  3WGL A;  1FSZ A;  3LWV C;  3C9T A;  3OBW A;  3B6N A;  4ZOL A;  3RYH B;  3Q8H A;  3V7Q A;  3G4S F;  3WPW A;  3LWP C;  1JD1 A;  2HS0 A;  3CC7 F;  5CA0 B;  1SDS A;  2OHW A;  4X1Y B;  5JCO A;  3WGJ A;  3RYC B;  3G71 F;  3JAT B;  1FNK A;  2VAM A;  1H7M A;  5EAZ A;  1YGY A;  1VQK F;  2HS4 A;  4M8I A;  3HKB A;  2RHH A;  5IJ0 B;  3K0T A;  2G9I A;  1K73 H;  3N4Z A;  5GAP K;  1W3E X;  1JY8 A;  5G4U C;  1M1K H;  3IKF A;  5EO3 A;  1W42 A;  3P0Z A;  1CLI A;  2P6Y A;  3HKE A;  5EB0 A;  3VCZ A;  3DDN A;  2Z01 A;  2V9Y A;  3GYQ A;  1Q86 H;  3FFM A;  2VXY A;  3CPW F;  5ITZ A;  3RA5 A;  4TZZ A;  1T0A A;  4X1K A;  2LBX A;  4F6R B;  3CYQ A;  1NQ3 A;  5LP6 B;  5EWR A;  1DBF A;  3N2K A;  1K9M H;  1IV1 A;  5JH7 B;  5C8Y B;  3NVI B;  3KHN A;  5JQG B;  2UYK A;  3I55 F;  2Z1F A;  3FD5 A;  3LDT A;  5KMG B;  3LME A;  2ALE A;  3WJP A;  2QA4 F;  4X3M A;  2HP0 B;  1W5B A;  4BT6 A;  4O2B A;  3S06 A;  2IQQ A;  1U40 A;  5CA0 A;  2RHL A;  4B62 A;  1KC8 H;  4I4T B;  3J80 M;  3QTY A;  5LP6 C;  5EZY A;  3CCE F;  3S02 A;  3GHZ A;  3FBA A;  5CA1 A;  1RLU A;  1X7O A;  4FFB B;  2BTU A;  1N8R H;  1SA0 A;  5FNV B;  4U3J B;  3HKD A;  4O4I A;  3I56 F;  4O2A B;  1YJN F;  4ZHY B;  3LFO A;  5CB4 B;  2IAF A;  3MDO A;  4G4Y A;  2B33 A;  4NQ3 A;  3LWR C;  5IYZ B;  4R40 B;  5LYJ A;  5LOV B;  3WPX A;  1XHO A;  3CCL F;  1YJ9 F;  5J2T A;  2ZAU A;  3N4Y A;  1H47 A;  3LWO C;  4F6R A;  3HWU A;  2CVL A; 
#chains in the Genus database with same CATH homology
 2W8B C;  4G88 A;  2ZF8 A;  4ZHV A;  2ZOV A;  4ERH A;  5EB1 B;  3S03 A;  3S0Y A;  4G4V A;  3KHN A;  2N48 A;  3TD4 A;  3TD5 A;  4G4Z A;  3LDT A;  2ZVZ A;  4ZHY B;  2AIZ P;  3WPW A;  3S06 A;  4G4Y A;  1OAP A;  5EB0 A;  3S0H A;  4B5C A;  4B62 A;  4G4W A;  2ZVY A;  4R40 B;  1R1M A;  2LBT A;  2KGW A;  2MQE A;  3OON A;  4G4X A;  3WPX A;  4ZHW A;  2K1S A;  3IMP A;  2L26 A;  4PWT A;  3S0W A;  4RHA A;  5EAZ A;  2HQS C;  2LCA A;  3CYQ A;  3CYP B;  3S02 A;  3TD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...