2ZOVA

Structure of the periplasmic domain of motb from salmonella (crystal form i)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
166
Chain Sequence
b'KKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATDAINRRISLLVLNKQAEQAILHENAESQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
molecule tags Membrane protein
source organism Salmonella typhimurium
publication title Stator assembly and activation mechanism of the flagellar motor by the periplasmic region of MotB
pubmed doi rcsb
total genus 49
structure length 166
sequence length 175
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2zovA00
4B62A 2ZVYA 4G4XA 4B5CA 3S03A 3OONA 2MQEA 3TD3A 4ERHA 3CYQA 3TD4A 2ZF8A 5EAZA 3CYPB 3S0WA 4G4YA 2LCAA 3WPWA 4G4ZA 2AIZP 4ZHVA 2ZOVA 3TD5A 3KHNA 2ZVZA 3S0HA 3S02A 3LDTA 2HQSC 2W8BC 4PWTA 5EB1B 2N48A 4ZHWA 4ZHYB 4G4VA 4R40B 1OAPA 3S0YA 3IMPA 2L26A 2K1SA 2KGWA 5EB0A 3WPXA 2LBTA 4G4WA 4RHAA 4G88A 1R1MA 3S06A
chains in the Genus database with same CATH superfamily
2G9IA 2MQEA 2B33A 1K9MH 3MCQA 5FLXM 5LOVB 1YJNF 3CCRF 3S0WA 4G4ZA 4HNAB 4LNUA 5CA0A 2ZAUA 4ZHVA 1QU9A 2UYJA 1FSZA 1W40A 5LYJB 2IG8A 5CA1A 2W8BC 4TUYA 4O2AB 4EI9A 2L26A 1TUBB 5EO3A 1W3EX 4IHJB 3CCJF 1JD1A 3KJKA 1RLUA 4G4XA 1SA0B 5MN4A 3KJJA 1K73H 3TD3A 5FNVB 1YIJF 3C9SA 1S72F 4NUTA 3JAMM 1KNJA 3HKCA 3OW2F 2KTVA 3DDNA 5EIBC 3RYCB 1M1KH 1QAHA 3AGKA 3V4DA 1H48A 3RYFB 2DT4A 5GONB 1YI2F 2LBXA 5C8YA 3IKFA 5JVDB 4LCKA 1DBFA 4E6EA 3P0ZA 3I55F 5GIPC 5EYPA 2ZVYA 3ELCA 1W581 5HXZA 5ITZA 4ZHQB 4ERHA 3JCMM 3V7QA 1JY8A 3HKEB 3BYQA 4C4WC 2RHJA 5HY0A 5LA6B 5A2QM 5KMGB 3N2KA 4O4LB 2HP0B 1VQ9F 2CHTA 3LDTA 5EB1B 3CMEF 4U3JB 4M8IA 4O4HB 3E22B 1R1MA 3I56F 3WJPA 1DT9A 2VAPA 5CB4A 3CMAF 3CYQA 3MCAB 5IJ9A 2I6DA 5CA1B 1UFYA 2VGMA 3HKBA 4O2AA 3FPIA 2HRYA 5HP8A 4BT6A 3E20B 3KHNA 5LP6C 5JH7B 2Z01A 4I50B 1VQPF 3CCVF 3G6EF 3WGKA 2HRUA 1FNKA 2K1SA 3ZO8A 5EB0A 1IPAA 3PLAC 2OTJF 3N4ZA 2R6R1 3E1YA 4C8IA 4FFBA 2FGYA 5LYJA 4ZI7B 1VQ5F 2IAFA 3QHDA 3B6NA 1COMA 2UZHA 3FBAA 2Z1EA 2UYKA 1W41A 3GHZA 1W57A 1TVKB 4BT4A 3LWQC 1QVGF 2VGNA 1Q8RA 1H7MA 1VQLF 2KG4A 5JQGA 2N48A 5EYPB 3JALA 3ON1A 2HS3A 5LOVA 5GINC 3V3TA 4BVRA 1Z5WA 2OZBA 5DCVA 5B8FA 5ITZB 1K8AH 1VQ7F 3JARB 3HJWC 5HP7A 5G4UC 1ONIA 3VIUA 1U3LA 4DXDA 2OTLF 3RYFA 3IEWA 3F6MA 1CK2A 3DC2A 1SZQA 4TV8B 1X7PA 1VK3A 3M4SA 5LXTA 2CSLA 2H6LA 2Z1TA 2OHWA 1N8RH 3P10A 1VQVA 3CCEF 3D54A 3VYTC 2AIZP 1KC8H 3QUWA 5HY2A 5KX5A 3NVKE 4BT5A 3CD6F 1UI9A 2CVLA 3K2XA 3WGNA 3C9RA 3HKEA 3NK7A 4HNAA 4G4VA 4O4JB 1OAPA 4O2BA 3RE3A 4BVSA 4BVTA 5IYZB 2QI2A 1YQNA 2EWCA 2QEXF 3JASB 3I3FA 5EWRA 3VYSC 4RHAA 1RQ2A 4O4LA 3ZOPA 3WGJA 3VMFB 2PHNA 3K14A 1PF5A 3TD4A 3D01A 3CYPB 3CCLF 5JVDA 3HAXD 3OBYA 3WXMB 1W5EA 2CWJA 5FNVA 1VQ8F 3HTNA 2AMTA 2Q1XA 4YJ3B 5LP6B 3VTIC 1XBIA 3VOAA 3CC4F 1Q7YH 3N2GA 5G4VC 2GVIA 3J7AR 4EB6A 3CG6A 5BMVA 5MN5A 3JAKA 2KGWA 5GONA 2LBTA 4G4WA 2IQQA 3MDOA 3N2KB 1IV3A 4X1IA 2HP0A 2UYNB 5MN6A 4X3LA 3UT5A 4C82A 3LWOC 3CCMF 2ZODA 1X52A 1OFUA 4U3JA 3RYHB 3HKDB 3CCUF 2LCAA 3JALB 3LWPC 4FFBB 4B46A 1NMUB 3GTZA 2BTUA 4NQ3A 3JARA 4BT3A 5HY1A 3S02A 4BT2A 3JAWA 4TV8A 3N4YA 2VAWA 3P4EA 1U3PA 3SIUA 1YJWF 1Q86H 1W42A 5HXUA 4F6RB 1FNJA 1CLIA 2BO1A 3M1XA 4X20A 3JATA 1RA4A 4TZZA 5CB4B 3FD5A 2ALEA 3EORA 2I6RA 3NVIB 1YHQF 3ERNA 2H8EA 1U43A 4PWTA 1FFXA 1IV1A 5LXTB 4R40B 3J80M 3IMPA 1CN7A 3HWUA 3LWRC 4BW0B 3RYIB 3CPQA 3J81M 2JNBA 3GYQA 1KQSF 1U40A 3RA5A 5J2UA 3C9TA 4I50A 2V9YA 1X25A 1GZ0A 1QD9A 4I55B 1SDSA 2Q1YA 4O4JA 5IYZA 4I4TB 5IJ0A 4KWEA 1VQNF 5LP6A 4G4YA 4B45A 2FC3A 2YXZA 3WPWA 3L7QA 2RHLA 2ZOVA 3M84A 4EI8A 4EB6B 5BMVB 2HS4A 2Z1UA 2BTQB 3QTYA 2UYNA 3UT5B 3VO8A 1XV2A 1W2BF 3IKEA 2AIFA 4G88A 3VI6A 5KX5B 1JFFB 3RYHA 5J2TB 3F0DA 3SIVA 3OONA 1W5FA 3CC2F 2DYYA 3N2GB 4ZOLA 4O2BB 2UYPA 1Z5VA 4X1KA 3LYBA 2QA4F 1VHAA 5HWEA 3F0FA 5IT9M 1YJ9F 2CZWA 3G71F 4C81A 4C8EA 2F9ZC 2HVYD 2GZLA 1T0KB 1W5BA 3MBMA 2HP3A 2RHOA 5JCOA 1VQ4F 1XRGA 2RHHA 1JN1A 3IEQA 3JASA 4LNUB 5CA0B 1QVFF 3T80A 3D00A 1M90H 2ZF8A 5FJ4C 3WJRA 4BT7A 3CXCF 4TUYB 1FFXB 2BTOA 4O4IA 1ZWZA 5EZYB 3CCSF 4IHJA 3S0HA 3Q8HA 5J2UB 3ZP4A 3CPWF 4WBNB 3JATB 1GO0A 4X1YB 1GX1A 4ZK7A 4YJ3A 3R0PA 1VQKF 3CCQF 1E7KA 4IIJB 1KD1H 3ESJA 1H47A 4B5CA 3I7TA 2QTPA 3JAKB 3C9UA 1TUBA 4NWOB 4RQOA 1ODEA 3RYIA 2HS0A 1RLGA 4X1IB 3IR9A 4YJ2A 5EZYA 3LWVC 1VQOF 4TV9A 3CC7F 1GO1A 5AVMA 1SA0A 3MQWA 1Q82H 3CB2A 3KE1A 3HKDA 2YYEA 1W59A 3WGMA 4ZHWA 1J7HA 4F6RA 2GLZA 1XHOA 4U39A 3HKCB 4X20B 2HX0A 1NQ3A 1JJ2F 3WGLA 1YITF 1YGYA 4B62A 3JAWB 4DRXB 3VOBA 3VCZA 1T0AA 2CHSA 2VAMA 1VQ6F 3F0GA 4C8GA 3OBWA 5J2TA 5GIOC 3LMEA 4I55A 3ZP7A 2ZVZA 2HQSC 3LFOA 4O4HA 3VYUC 3V7EA 4I4TA 5IJ0B 5GAPK 4X1KB 1IV4A 1X7OA 5EIBD 5LA6A 1VQMF 5HY4A 1W5AA 3RYCA 3S06A 2R751 2NMUA 3S03A 3HKBB 5GANK 5C8YB 1PXWA 4BY9D 3K0TA 5JH7A 2KTUA 1KNKA 3WJQA 3TD5A 1JFFA 3G4SF 2RB9A 4ZHYB 2LBWA 3S0YA 1Q81H 2H8CA 4ZOLB 4ZI7A 2PMPA 4BVQA 3C8LA 3WPXA 1W55A 1VH8A 5JCOC 5KMGA 2WALA 2P6YA 4YJ2B 1RQ7A 3FD6A 4WBNA 1IV2A 5EAZA 4X1YA 3NK6A 5JQGB 4XCQA 4ZHQA 3RA6A 4EI7A 4IIJA 3PAFA 3E22A 2CW4A 2Z1FA 3U0OA 3FFMA 3O85A 4X3MA 3K12A 5IJ9B 2VXYA 3KIZA 1TVKA 2OTMA 4DRXA 3NMUC 3JVHA 1NJIH 4TV9B 3F0EA 4O4IB
chains in the Genus database with same CATH topology
4B62A 2ZVYA 4G4XA 4B5CA 3S03A 3OONA 2MQEA 3TD3A 4ERHA 3CYQA 3TD4A 2ZF8A 5EAZA 3CYPB 3S0WA 4G4YA 2LCAA 3WPWA 4G4ZA 2AIZP 4ZHVA 2ZOVA 3TD5A 3KHNA 2ZVZA 3S0HA 3S02A 3LDTA 2HQSC 2W8BC 4PWTA 5EB1B 2N48A 4ZHWA 4ZHYB 4G4VA 4R40B 1OAPA 3S0YA 3IMPA 2L26A 2K1SA 2KGWA 5EB0A 3WPXA 2LBTA 4G4WA 4RHAA 4G88A 1R1MA 3S06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B62 A;  2ZVY A;  4G4X A;  4B5C A;  3S03 A;  3OON A;  2MQE A;  3TD3 A;  4ERH A;  3CYQ A;  3TD4 A;  2ZF8 A;  5EAZ A;  3CYP B;  3S0W A;  4G4Y A;  2LCA A;  3WPW A;  4G4Z A;  2AIZ P;  4ZHV A;  2ZOV A;  3TD5 A;  3KHN A;  2ZVZ A;  3S0H A;  3S02 A;  3LDT A;  2HQS C;  2W8B C;  4PWT A;  5EB1 B;  2N48 A;  4ZHW A;  4ZHY B;  4G4V A;  4R40 B;  1OAP A;  3S0Y A;  3IMP A;  2L26 A;  2K1S A;  2KGW A;  5EB0 A;  3WPX A;  2LBT A;  4G4W A;  4RHA A;  4G88 A;  1R1M A;  3S06 A; 
#chains in the Genus database with same CATH topology
 2G9I A;  2MQE A;  2B33 A;  1K9M H;  3MCQ A;  5FLX M;  5LOV B;  1YJN F;  3CCR F;  3S0W A;  4G4Z A;  4HNA B;  4LNU A;  5CA0 A;  2ZAU A;  4ZHV A;  1QU9 A;  2UYJ A;  1FSZ A;  1W40 A;  5LYJ B;  2IG8 A;  5CA1 A;  2W8B C;  4TUY A;  4O2A B;  4EI9 A;  2L26 A;  1TUB B;  5EO3 A;  1W3E X;  4IHJ B;  3CCJ F;  1JD1 A;  3KJK A;  1RLU A;  4G4X A;  1SA0 B;  5MN4 A;  3KJJ A;  1K73 H;  3TD3 A;  5FNV B;  1YIJ F;  3C9S A;  1S72 F;  4NUT A;  3JAM M;  1KNJ A;  3HKC A;  3OW2 F;  2KTV A;  3DDN A;  5EIB C;  3RYC B;  1M1K H;  1QAH A;  3AGK A;  3V4D A;  1H48 A;  3RYF B;  2DT4 A;  5GON B;  1YI2 F;  2LBX A;  5C8Y A;  3IKF A;  5JVD B;  4LCK A;  1DBF A;  4E6E A;  3P0Z A;  3I55 F;  5GIP C;  5EYP A;  2ZVY A;  3ELC A;  1W58 1;  5HXZ A;  5ITZ A;  4ZHQ B;  4ERH A;  3JCM M;  3V7Q A;  1JY8 A;  3HKE B;  3BYQ A;  4C4W C;  2RHJ A;  5HY0 A;  5LA6 B;  5A2Q M;  5KMG B;  3N2K A;  4O4L B;  2HP0 B;  1VQ9 F;  2CHT A;  3LDT A;  5EB1 B;  3CME F;  4U3J B;  4M8I A;  4O4H B;  3E22 B;  1R1M A;  3I56 F;  3WJP A;  1DT9 A;  2VAP A;  5CB4 A;  3CMA F;  3CYQ A;  3MCA B;  5IJ9 A;  2I6D A;  5CA1 B;  1UFY A;  2VGM A;  3HKB A;  4O2A A;  3FPI A;  2HRY A;  5HP8 A;  4BT6 A;  3E20 B;  3KHN A;  5LP6 C;  5JH7 B;  2Z01 A;  4I50 B;  1VQP F;  3CCV F;  3G6E F;  3WGK A;  2HRU A;  1FNK A;  2K1S A;  3ZO8 A;  5EB0 A;  1IPA A;  3PLA C;  2OTJ F;  3N4Z A;  2R6R 1;  3E1Y A;  4C8I A;  4FFB A;  2FGY A;  5LYJ A;  4ZI7 B;  1VQ5 F;  2IAF A;  3QHD A;  3B6N A;  1COM A;  2UZH A;  3FBA A;  2Z1E A;  2UYK A;  1W41 A;  3GHZ A;  1W57 A;  1TVK B;  4BT4 A;  3LWQ C;  1QVG F;  2VGN A;  1Q8R A;  1H7M A;  1VQL F;  2KG4 A;  5JQG A;  2N48 A;  5EYP B;  3JAL A;  3ON1 A;  2HS3 A;  5LOV A;  5GIN C;  3V3T A;  4BVR A;  1Z5W A;  2OZB A;  5DCV A;  5B8F A;  5ITZ B;  1K8A H;  1VQ7 F;  3JAR B;  3HJW C;  5HP7 A;  5G4U C;  1ONI A;  3VIU A;  1U3L A;  4DXD A;  2OTL F;  3RYF A;  3IEW A;  3F6M A;  1CK2 A;  3DC2 A;  1SZQ A;  4TV8 B;  1X7P A;  1VK3 A;  3M4S A;  5LXT A;  2CSL A;  2H6L A;  2Z1T A;  2OHW A;  1N8R H;  3P10 A;  1VQV A;  3CCE F;  3D54 A;  3VYT C;  2AIZ P;  1KC8 H;  3QUW A;  5HY2 A;  5KX5 A;  3NVK E;  4BT5 A;  3CD6 F;  1UI9 A;  2CVL A;  3K2X A;  3WGN A;  3C9R A;  3HKE A;  3NK7 A;  4HNA A;  4G4V A;  4O4J B;  1OAP A;  4O2B A;  3RE3 A;  4BVS A;  4BVT A;  5IYZ B;  2QI2 A;  1YQN A;  2EWC A;  2QEX F;  3JAS B;  3I3F A;  5EWR A;  3VYS C;  4RHA A;  1RQ2 A;  4O4L A;  3ZOP A;  3WGJ A;  3VMF B;  2PHN A;  3K14 A;  1PF5 A;  3TD4 A;  3D01 A;  3CYP B;  3CCL F;  5JVD A;  3HAX D;  3OBY A;  3WXM B;  1W5E A;  2CWJ A;  5FNV A;  1VQ8 F;  3HTN A;  2AMT A;  2Q1X A;  4YJ3 B;  5LP6 B;  3VTI C;  1XBI A;  3VOA A;  3CC4 F;  1Q7Y H;  3N2G A;  5G4V C;  2GVI A;  3J7A R;  4EB6 A;  3CG6 A;  5BMV A;  5MN5 A;  3JAK A;  2KGW A;  5GON A;  2LBT A;  4G4W A;  2IQQ A;  3MDO A;  3N2K B;  1IV3 A;  4X1I A;  2HP0 A;  2UYN B;  5MN6 A;  4X3L A;  3UT5 A;  4C82 A;  3LWO C;  3CCM F;  2ZOD A;  1X52 A;  1OFU A;  4U3J A;  3RYH B;  3HKD B;  3CCU F;  2LCA A;  3JAL B;  3LWP C;  4FFB B;  4B46 A;  1NMU B;  3GTZ A;  2BTU A;  4NQ3 A;  3JAR A;  4BT3 A;  5HY1 A;  3S02 A;  4BT2 A;  3JAW A;  4TV8 A;  3N4Y A;  2VAW A;  3P4E A;  1U3P A;  3SIU A;  1YJW F;  1Q86 H;  1W42 A;  5HXU A;  4F6R B;  1FNJ A;  1CLI A;  2BO1 A;  3M1X A;  4X20 A;  3JAT A;  1RA4 A;  4TZZ A;  5CB4 B;  3FD5 A;  2ALE A;  3EOR A;  2I6R A;  3NVI B;  1YHQ F;  3ERN A;  2H8E A;  1U43 A;  4PWT A;  1FFX A;  1IV1 A;  5LXT B;  4R40 B;  3J80 M;  3IMP A;  1CN7 A;  3HWU A;  3LWR C;  4BW0 B;  3RYI B;  3CPQ A;  3J81 M;  2JNB A;  3GYQ A;  1KQS F;  1U40 A;  3RA5 A;  5J2U A;  3C9T A;  4I50 A;  2V9Y A;  1X25 A;  1GZ0 A;  1QD9 A;  4I55 B;  1SDS A;  2Q1Y A;  4O4J A;  5IYZ A;  4I4T B;  5IJ0 A;  4KWE A;  1VQN F;  5LP6 A;  4G4Y A;  4B45 A;  2FC3 A;  2YXZ A;  3WPW A;  3L7Q A;  2RHL A;  2ZOV A;  3M84 A;  4EI8 A;  4EB6 B;  5BMV B;  2HS4 A;  2Z1U A;  2BTQ B;  3QTY A;  2UYN A;  3UT5 B;  3VO8 A;  1XV2 A;  1W2B F;  3IKE A;  2AIF A;  4G88 A;  3VI6 A;  5KX5 B;  1JFF B;  3RYH A;  5J2T B;  3F0D A;  3SIV A;  3OON A;  1W5F A;  3CC2 F;  2DYY A;  3N2G B;  4ZOL A;  4O2B B;  2UYP A;  1Z5V A;  4X1K A;  3LYB A;  2QA4 F;  1VHA A;  5HWE A;  3F0F A;  5IT9 M;  1YJ9 F;  2CZW A;  3G71 F;  4C81 A;  4C8E A;  2F9Z C;  2HVY D;  2GZL A;  1T0K B;  1W5B A;  3MBM A;  2HP3 A;  2RHO A;  5JCO A;  1VQ4 F;  1XRG A;  2RHH A;  1JN1 A;  3IEQ A;  3JAS A;  4LNU B;  5CA0 B;  1QVF F;  3T80 A;  3D00 A;  1M90 H;  2ZF8 A;  5FJ4 C;  3WJR A;  4BT7 A;  3CXC F;  4TUY B;  1FFX B;  2BTO A;  4O4I A;  1ZWZ A;  5EZY B;  3CCS F;  4IHJ A;  3S0H A;  3Q8H A;  5J2U B;  3ZP4 A;  3CPW F;  4WBN B;  3JAT B;  1GO0 A;  4X1Y B;  1GX1 A;  4ZK7 A;  4YJ3 A;  3R0P A;  1VQK F;  3CCQ F;  1E7K A;  4IIJ B;  1KD1 H;  3ESJ A;  1H47 A;  4B5C A;  3I7T A;  2QTP A;  3JAK B;  3C9U A;  1TUB A;  4NWO B;  4RQO A;  1ODE A;  3RYI A;  2HS0 A;  1RLG A;  4X1I B;  3IR9 A;  4YJ2 A;  5EZY A;  3LWV C;  1VQO F;  4TV9 A;  3CC7 F;  1GO1 A;  5AVM A;  1SA0 A;  3MQW A;  1Q82 H;  3CB2 A;  3KE1 A;  3HKD A;  2YYE A;  1W59 A;  3WGM A;  4ZHW A;  1J7H A;  4F6R A;  2GLZ A;  1XHO A;  4U39 A;  3HKC B;  4X20 B;  2HX0 A;  1NQ3 A;  1JJ2 F;  3WGL A;  1YIT F;  1YGY A;  4B62 A;  3JAW B;  4DRX B;  3VOB A;  3VCZ A;  1T0A A;  2CHS A;  2VAM A;  1VQ6 F;  3F0G A;  4C8G A;  3OBW A;  5J2T A;  5GIO C;  3LME A;  4I55 A;  3ZP7 A;  2ZVZ A;  2HQS C;  3LFO A;  4O4H A;  3VYU C;  3V7E A;  4I4T A;  5IJ0 B;  5GAP K;  4X1K B;  1IV4 A;  1X7O A;  5EIB D;  5LA6 A;  1VQM F;  5HY4 A;  1W5A A;  3RYC A;  3S06 A;  2R75 1;  2NMU A;  3S03 A;  3HKB B;  5GAN K;  5C8Y B;  1PXW A;  4BY9 D;  3K0T A;  5JH7 A;  2KTU A;  1KNK A;  3WJQ A;  3TD5 A;  1JFF A;  3G4S F;  2RB9 A;  4ZHY B;  2LBW A;  3S0Y A;  1Q81 H;  2H8C A;  4ZOL B;  4ZI7 A;  2PMP A;  4BVQ A;  3C8L A;  3WPX A;  1W55 A;  1VH8 A;  5JCO C;  5KMG A;  2WAL A;  2P6Y A;  4YJ2 B;  1RQ7 A;  3FD6 A;  4WBN A;  1IV2 A;  5EAZ A;  4X1Y A;  3NK6 A;  5JQG B;  4XCQ A;  4ZHQ A;  3RA6 A;  4EI7 A;  4IIJ A;  3PAF A;  3E22 A;  2CW4 A;  2Z1F A;  3U0O A;  3FFM A;  3O85 A;  4X3M A;  3K12 A;  5IJ9 B;  2VXY A;  3KIZ A;  1TVK A;  2OTM A;  4DRX A;  3NMU C;  3JVH A;  1NJI H;  4TV9 B;  3F0E A;  4O4I B; 
#chains in the Genus database with same CATH homology
 4B62 A;  2ZVY A;  4G4X A;  4B5C A;  3S03 A;  3OON A;  2MQE A;  3TD3 A;  4ERH A;  3CYQ A;  3TD4 A;  2ZF8 A;  5EAZ A;  3CYP B;  3S0W A;  4G4Y A;  2LCA A;  3WPW A;  4G4Z A;  2AIZ P;  4ZHV A;  2ZOV A;  3TD5 A;  3KHN A;  2ZVZ A;  3S0H A;  3S02 A;  3LDT A;  2HQS C;  2W8B C;  4PWT A;  5EB1 B;  2N48 A;  4ZHW A;  4ZHY B;  4G4V A;  4R40 B;  1OAP A;  3S0Y A;  3IMP A;  2L26 A;  2K1S A;  2KGW A;  5EB0 A;  3WPX A;  2LBT A;  4G4W A;  4RHA A;  4G88 A;  1R1M A;  3S06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...