2ZOVA

Structure of the periplasmic domain of motb from salmonella (crystal form i)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
175
structure length
166
Chain Sequence
KKRMEQSRLNKLRGDLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRAIAPVLNGIPNRISLAGHTDDFPYANGEKGYSNWELSADRANASRRELVAGGLDNGKVLRVVGMAATDAINRRISLLVLNKQAEQAILHENAESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein motB
publication title Stator assembly and activation mechanism of the flagellar motor by the periplasmic region of MotB
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Membrane protein
total genus 49
structure length 166
sequence length 175
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2zovA00
4G4WA 2HQSC 3S06A 2N48A 5EB1B 5EAZA 3S0WA 3LDTA 3TD4A 3WPWA 3TD5A 2ZVYA 2ZVZA 3CYPB 4B62A 1OAPA 4PWTA 1R1MA 3WPXA 3S02A 3S0YA 4G4ZA 5EB0A 2LCAA 4R40B 3S0HA 4ZHVA 2AIZP 4G4YA 3OONA 4G4XA 4ERHA 3S03A 2LBTA 3TD3A 4B5CA 4ZHWA 2MQEA 2ZOVA 3KHNA 2K1SA 3IMPA 4G88A 3CYQA 2KGWA 4G4VA 4ZHYB 4RHAA 2ZF8A 2W8BC 2L26A
chains in the Genus database with same CATH superfamily
1VQ9F 4DRXA 1RLGA 3DC2A 3G6EF 1H48A 1KNJA 3JAKA 3JALA 1W5EA 4TZZA 4U39A 2P6YA 3ESJA 3WJRA 5EIBD 3JATA 5G4UC 2AIZP 2Z1TA 2FC3A 5LP6B 3CPWF 1YI2F 3RYFA 1N8RH 2Z01A 3KJJA 4BVTA 2UYNA 3CC4F 5IYZB 3F6MA 1GZ0A 2OTJF 1X7PA 1VQOF 4U3JA 1W581 3VO8A 1FFXB 5EYPB 5EIBC 3CC2F 4RHAA 3JVHA 4O2BA 2FGYA 1W5AA 2Q1XA 4G4WA 3SIUA 2N48A 3GYQA 4ZHQB 3HKCA 3P10A 1YHQF 3DDNA 2Z1UA 4BVRA 4C4WC 1CLIA 5DCVA 4O4LA 3MDOA 2CW4A 2VAWA 3HKEB 3NVKE 1UI9A 3TD3A 1IV3A 1NMUB 3KHNA 3C8LA 1ZWZA 4IHJA 4IIJB 4B45A 2I6DA 2ALEA 2GLZA 2HRYA 1M90H 3CCSF 3I56F 4O4HA 4BT2A 5FLXM 4X20A 3G71F 5HWEA 3VYTC 4FFBA 3IKEA 1NQ3A 3OW2F 3WGLA 1K8AH 5BMVA 4O4IA 2VGMA 2HP0A 3HKBA 3ON1A 2QTPA 4I4TB 1JFFA 1SZQA 4LNUB 5GANK 5KX5A 3NK6A 3WGNA 5MN4A 2OHWA 1VQVA 3CCQF 3QUWA 3VOAA 3M84A 4ZHYB 2R6R1 2YYEA 5CB4B 4DRXB 1VQ6F 4X1YA 1FNJA 5JCOA 2KTVA 2HQSC 1ONIA 3V4DA 2IAFA 5A2QM 1QVFF 2ZVZA 5GONA 3VMFB 1JN1A 1H7MA 1U3LA 5CA0A 5FJ4C 2GZLA 2Q1YA 3RYFB 5LOVA 4LCKA 1RLUA 2UYNB 3RE3A 1W42A 3VYUC 4U3JB 2H8CA 2HX0A 3O85A 4O2BB 1IV2A 1K73H 2AIFA 2BTUA 2RHJA 3K14A 2H6LA 3F0DA 2Z1FA 3IR9A 1W3EX 3UT5A 2OZBA 3TD4A 3HKCB 3CXCF 5ITZA 3CCLF 1PXWA 3I55F 3CB2A 1FNKA 1COMA 1R1MA 4O4LB 1YJ9F 1Q8RA 2YXZA 2LCAA 5CA1A 1QVGF 1RA4A 3MQWA 4IHJB 4X1KA 2RHHA 2LBTA 4DXDA 1W2BF 3CCVF 1Z5VA 3CPQA 3LWVC 2PHNA 4O4HB 3HKDB 3HJWC 4G4VA 3IKFA 5LXTA 2ZAUA 5LA6A 4E6EA 3AGKA 4FFBB 1KQSF 3LWPC 3RYCA 2CVLA 4TV9A 3RYIB 3V3TA 1VQ5F 3WGMA 4X1IA 3M4SA 4I50A 2CWJA 1JFFB 3HWUA 2B33A 3I7TA 3VOBA 4ZHVA 4HNAB 3OONA 1JJ2F 4ZHWA 2ZOVA 5KMGB 3B6NA 1YQNA 3MCAB 2BTQB 3LMEA 1VQPF 1U43A 3D54A 3EORA 1X7OA 4B46A 3RA5A 3CMEF 1XBIA 3KIZA 3VI6A 5GONB 3S0WA 3KE1A 1M1KH 3VYSC 4EB6B 5CA0B 5JVDB 4BT5A 3ZP4A 4M8IA 4O4JA 5GIOC 1Q81H 4WBNA 4C81A 3C9SA 1W5BA 3JAMM 5JH7A 4BVSA 1W57A 3CMAF 4O2AB 4NUTA 1SA0B 1ODEA 5HY0A 1VQ4F 3N2KA 3C9UA 4NQ3A 4C82A 1TVKB 2L26A 3E22B 3UT5B 3K2XA 1UFYA 5EAZA 5ITZB 3NK7A 1NJIH 2HRUA 3F0EA 3S0YA 5IJ9B 2VXYA 2PMPA 2DT4A 3D01A 1GO1A 4TUYB 1QD9A 5LXTB 3CCEF 2JNBA 3C9TA 4TV8A 4I55A 1E7KA 3GHZA 3WGJA 4F6RA 4YJ2A 2NMUA 4X3LA 3JAKB 3JALB 4I50B 1XRGA 3FFMA 3GTZA 3JATB 5AVMA 1OFUA 3P4EA 2Z1EA 3D00A 1YJWF 2IG8A 1DT9A 3Q8HA 2HP3A 5LYJA 1CN7A 5HY1A 1YIJF 2RB9A 3MBMA 1TUBA 4BT4A 4ZOLA 5EYPA 4C8GA 3CCUF 3K0TA 2RHLA 2KG4A 5IJ0A 3LDTA 3LYBA 1FSZA 3VIUA 2OTLF 3PLAC 1U3PA 4O4JB 3V7QA 4WBNB 1Q82H 4ZHQA 1W5FA 5GINC 5JH7B 5IT9M 3WJQA 3FD6A 1XHOA 2IQQA 4ERHA 3HKEA 4YJ3A 3JARA 1QAHA 4BW0B 2HVYD 3CCMF 5LP6C 5EWRA 1JD1A 4KWEA 1RQ7A 1VHAA 2ZF8A 3LFOA 2WALA 4X20B 1VK3A 3J7AR 3S06A 5EB1B 5HXZA 1QU9A 1W40A 2QI2A 2CZWA 5HY2A 5BMVB 3VTIC 1T0KB 3JASA 1Q7YH 4O4IB 2HP0B 3HKBB 3ZO8A 1CK2A 5KX5B 3LWQC 3S03A 4I4TA 2ZODA 3V7EA 1YITF 2MQEA 4BVQA 5B8FA 2K1SA 3LWRC 3P0ZA 3N4ZA 4I55B 5J2TA 2KGWA 4X1YB 3C9RA 3IEWA 4BT6A 4YJ2B 5CB4A 4EI9A 3CCJF 3SIVA 5HY4A 3OBYA 3RYHA 1PF5A 3PAFA 4BT3A 1XV2A 3RA6A 1Q86H 3CG6A 3IEQA 1GO0A 5LOVB 2R751 1VQ8F 2H8EA 5HXUA 5EB0A 3WGKA 2QEXF 5LYJB 3CD6F 3M1XA 4EI8A 1TUBB 4ZOLB 5HP7A 3E1YA 1VH8A 1W41A 3JCMM 3NVIB 3ERNA 3J80M 2BTOA 1KC8H 5MN5A 5IJ0B 3HAXD 1X25A 3QHDA 3J81M 2BO1A 5JQGA 3OBWA 5GIPC 1S72F 1VQ7F 3LWOC 2HS4A 5EZYA 3WJPA 4C8IA 4ZI7A 1VQMF 3WPXA 2AMTA 5CA1B 4G4ZA 4C8EA 5FNVA 3ELCA 4X1KB 3JARB 2UYJA 4YJ3B 4EI7A 1GX1A 2V9YA 3U0OA 5C8YA 3JAWA 2KTUA 3N2GA 3E20B 3IMPA 3FD5A 5J2UA 1Z5WA 2GVIA 3HTNA 5LA6B 3HKDA 3ZOPA 2UZHA 2RHOA 2LBWA 3RYCB 4TV9B 1IPAA 3F0GA 1IV4A 3I3FA 3JASB 3WPWA 4X1IB 3G4SF 3CYPB 3R0PA 2CHTA 4RQOA 3RYIA 4PWTA 2VAMA 1RQ2A 1VQLF 1X52A 3NMUC 3ZP7A 2CSLA 1U40A 1YGYA 4HNAA 5HP8A 4B5CA 2OTMA 5LP6A 5J2TB 1JY8A 5EO3A 2QA4F 3N4YA 5KMGA 1T0AA 3K12A 3F0FA 2HS3A 3WXMB 5IYZA 1DBFA 2LBXA 1FFXA 3RYHB 3T80A 4NWOB 5MN6A 4B62A 1OAPA 4EB6A 1K9MH 5JVDA 3S02A 5GAPK 4R40B 3S0HA 2EWCA 4BT7A 3CC7F 3CCRF 1IV1A 3N2KB 4O2AA 3QTYA 2CHSA 1SA0A 3CYQA 1J7HA 2I6RA 4IIJA 2HS0A 5JQGB 2W8BC 4ZK7A 1W59A 1TVKA 5EZYB 3MCQA 5G4VC 3E22A 3KJKA 4ZI7B 5JCOC 3L7QA 1SDSA 2G9IA 2ZVYA 3TD5A 2VGNA 4BY9D 2VAPA 5FNVB 2UYPA 2UYKA 1YJNF 1H47A 5IJ9A 5C8YB 4G4YA 3JAWB 4G4XA 3VCZA 3N2GB 3FPIA 4X3MA 5J2UB 2F9ZC 4LNUA 1W55A 4G88A 1KNKA 4TV8B 4TUYA 1VQNF 4XCQA 2DYYA 3BYQA 3FBAA 4F6RB 1KD1H 1VQKF
chains in the Genus database with same CATH topology
4G4WA 2HQSC 3S06A 2N48A 5EB1B 5EAZA 3S0WA 3LDTA 3TD4A 3WPWA 3TD5A 2ZVYA 2ZVZA 3CYPB 4B62A 1OAPA 4PWTA 1R1MA 3WPXA 3S02A 3S0YA 4G4ZA 5EB0A 2LCAA 4R40B 3S0HA 4ZHVA 2AIZP 4G4YA 3OONA 4G4XA 4ERHA 3S03A 2LBTA 3TD3A 4B5CA 4ZHWA 2MQEA 2ZOVA 3KHNA 2K1SA 3IMPA 4G88A 3CYQA 2KGWA 4G4VA 4ZHYB 4RHAA 2ZF8A 2W8BC 2L26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4W A;  2HQS C;  3S06 A;  2N48 A;  5EB1 B;  5EAZ A;  3S0W A;  3LDT A;  3TD4 A;  3WPW A;  3TD5 A;  2ZVY A;  2ZVZ A;  3CYP B;  4B62 A;  1OAP A;  4PWT A;  1R1M A;  3WPX A;  3S02 A;  3S0Y A;  4G4Z A;  5EB0 A;  2LCA A;  4R40 B;  3S0H A;  4ZHV A;  2AIZ P;  4G4Y A;  3OON A;  4G4X A;  4ERH A;  3S03 A;  2LBT A;  3TD3 A;  4B5C A;  4ZHW A;  2MQE A;  2ZOV A;  3KHN A;  2K1S A;  3IMP A;  4G88 A;  3CYQ A;  2KGW A;  4G4V A;  4ZHY B;  4RHA A;  2ZF8 A;  2W8B C;  2L26 A; 
#chains in the Genus database with same CATH topology
 1VQ9 F;  4DRX A;  1RLG A;  3DC2 A;  3G6E F;  1H48 A;  1KNJ A;  3JAK A;  3JAL A;  1W5E A;  4TZZ A;  4U39 A;  2P6Y A;  3ESJ A;  3WJR A;  5EIB D;  3JAT A;  5G4U C;  2AIZ P;  2Z1T A;  2FC3 A;  5LP6 B;  3CPW F;  1YI2 F;  3RYF A;  1N8R H;  2Z01 A;  3KJJ A;  4BVT A;  2UYN A;  3CC4 F;  5IYZ B;  3F6M A;  1GZ0 A;  2OTJ F;  1X7P A;  1VQO F;  4U3J A;  1W58 1;  3VO8 A;  1FFX B;  5EYP B;  5EIB C;  3CC2 F;  4RHA A;  3JVH A;  4O2B A;  2FGY A;  1W5A A;  2Q1X A;  4G4W A;  3SIU A;  2N48 A;  3GYQ A;  4ZHQ B;  3HKC A;  3P10 A;  1YHQ F;  3DDN A;  2Z1U A;  4BVR A;  4C4W C;  1CLI A;  5DCV A;  4O4L A;  3MDO A;  2CW4 A;  2VAW A;  3HKE B;  3NVK E;  1UI9 A;  3TD3 A;  1IV3 A;  1NMU B;  3KHN A;  3C8L A;  1ZWZ A;  4IHJ A;  4IIJ B;  4B45 A;  2I6D A;  2ALE A;  2GLZ A;  2HRY A;  1M90 H;  3CCS F;  3I56 F;  4O4H A;  4BT2 A;  5FLX M;  4X20 A;  3G71 F;  5HWE A;  3VYT C;  4FFB A;  3IKE A;  1NQ3 A;  3OW2 F;  3WGL A;  1K8A H;  5BMV A;  4O4I A;  2VGM A;  2HP0 A;  3HKB A;  3ON1 A;  2QTP A;  4I4T B;  1JFF A;  1SZQ A;  4LNU B;  5GAN K;  5KX5 A;  3NK6 A;  3WGN A;  5MN4 A;  2OHW A;  1VQV A;  3CCQ F;  3QUW A;  3VOA A;  3M84 A;  4ZHY B;  2R6R 1;  2YYE A;  5CB4 B;  4DRX B;  1VQ6 F;  4X1Y A;  1FNJ A;  5JCO A;  2KTV A;  2HQS C;  1ONI A;  3V4D A;  2IAF A;  5A2Q M;  1QVF F;  2ZVZ A;  5GON A;  3VMF B;  1JN1 A;  1H7M A;  1U3L A;  5CA0 A;  5FJ4 C;  2GZL A;  2Q1Y A;  3RYF B;  5LOV A;  4LCK A;  1RLU A;  2UYN B;  3RE3 A;  1W42 A;  3VYU C;  4U3J B;  2H8C A;  2HX0 A;  3O85 A;  4O2B B;  1IV2 A;  1K73 H;  2AIF A;  2BTU A;  2RHJ A;  3K14 A;  2H6L A;  3F0D A;  2Z1F A;  3IR9 A;  1W3E X;  3UT5 A;  2OZB A;  3TD4 A;  3HKC B;  3CXC F;  5ITZ A;  3CCL F;  1PXW A;  3I55 F;  3CB2 A;  1FNK A;  1COM A;  1R1M A;  4O4L B;  1YJ9 F;  1Q8R A;  2YXZ A;  2LCA A;  5CA1 A;  1QVG F;  1RA4 A;  3MQW A;  4IHJ B;  4X1K A;  2RHH A;  2LBT A;  4DXD A;  1W2B F;  3CCV F;  1Z5V A;  3CPQ A;  3LWV C;  2PHN A;  4O4H B;  3HKD B;  3HJW C;  4G4V A;  3IKF A;  5LXT A;  2ZAU A;  5LA6 A;  4E6E A;  3AGK A;  4FFB B;  1KQS F;  3LWP C;  3RYC A;  2CVL A;  4TV9 A;  3RYI B;  3V3T A;  1VQ5 F;  3WGM A;  4X1I A;  3M4S A;  4I50 A;  2CWJ A;  1JFF B;  3HWU A;  2B33 A;  3I7T A;  3VOB A;  4ZHV A;  4HNA B;  3OON A;  1JJ2 F;  4ZHW A;  2ZOV A;  5KMG B;  3B6N A;  1YQN A;  3MCA B;  2BTQ B;  3LME A;  1VQP F;  1U43 A;  3D54 A;  3EOR A;  1X7O A;  4B46 A;  3RA5 A;  3CME F;  1XBI A;  3KIZ A;  3VI6 A;  5GON B;  3S0W A;  3KE1 A;  1M1K H;  3VYS C;  4EB6 B;  5CA0 B;  5JVD B;  4BT5 A;  3ZP4 A;  4M8I A;  4O4J A;  5GIO C;  1Q81 H;  4WBN A;  4C81 A;  3C9S A;  1W5B A;  3JAM M;  5JH7 A;  4BVS A;  1W57 A;  3CMA F;  4O2A B;  4NUT A;  1SA0 B;  1ODE A;  5HY0 A;  1VQ4 F;  3N2K A;  3C9U A;  4NQ3 A;  4C82 A;  1TVK B;  2L26 A;  3E22 B;  3UT5 B;  3K2X A;  1UFY A;  5EAZ A;  5ITZ B;  3NK7 A;  1NJI H;  2HRU A;  3F0E A;  3S0Y A;  5IJ9 B;  2VXY A;  2PMP A;  2DT4 A;  3D01 A;  1GO1 A;  4TUY B;  1QD9 A;  5LXT B;  3CCE F;  2JNB A;  3C9T A;  4TV8 A;  4I55 A;  1E7K A;  3GHZ A;  3WGJ A;  4F6R A;  4YJ2 A;  2NMU A;  4X3L A;  3JAK B;  3JAL B;  4I50 B;  1XRG A;  3FFM A;  3GTZ A;  3JAT B;  5AVM A;  1OFU A;  3P4E A;  2Z1E A;  3D00 A;  1YJW F;  2IG8 A;  1DT9 A;  3Q8H A;  2HP3 A;  5LYJ A;  1CN7 A;  5HY1 A;  1YIJ F;  2RB9 A;  3MBM A;  1TUB A;  4BT4 A;  4ZOL A;  5EYP A;  4C8G A;  3CCU F;  3K0T A;  2RHL A;  2KG4 A;  5IJ0 A;  3LDT A;  3LYB A;  1FSZ A;  3VIU A;  2OTL F;  3PLA C;  1U3P A;  4O4J B;  3V7Q A;  4WBN B;  1Q82 H;  4ZHQ A;  1W5F A;  5GIN C;  5JH7 B;  5IT9 M;  3WJQ A;  3FD6 A;  1XHO A;  2IQQ A;  4ERH A;  3HKE A;  4YJ3 A;  3JAR A;  1QAH A;  4BW0 B;  2HVY D;  3CCM F;  5LP6 C;  5EWR A;  1JD1 A;  4KWE A;  1RQ7 A;  1VHA A;  2ZF8 A;  3LFO A;  2WAL A;  4X20 B;  1VK3 A;  3J7A R;  3S06 A;  5EB1 B;  5HXZ A;  1QU9 A;  1W40 A;  2QI2 A;  2CZW A;  5HY2 A;  5BMV B;  3VTI C;  1T0K B;  3JAS A;  1Q7Y H;  4O4I B;  2HP0 B;  3HKB B;  3ZO8 A;  1CK2 A;  5KX5 B;  3LWQ C;  3S03 A;  4I4T A;  2ZOD A;  3V7E A;  1YIT F;  2MQE A;  4BVQ A;  5B8F A;  2K1S A;  3LWR C;  3P0Z A;  3N4Z A;  4I55 B;  5J2T A;  2KGW A;  4X1Y B;  3C9R A;  3IEW A;  4BT6 A;  4YJ2 B;  5CB4 A;  4EI9 A;  3CCJ F;  3SIV A;  5HY4 A;  3OBY A;  3RYH A;  1PF5 A;  3PAF A;  4BT3 A;  1XV2 A;  3RA6 A;  1Q86 H;  3CG6 A;  3IEQ A;  1GO0 A;  5LOV B;  2R75 1;  1VQ8 F;  2H8E A;  5HXU A;  5EB0 A;  3WGK A;  2QEX F;  5LYJ B;  3CD6 F;  3M1X A;  4EI8 A;  1TUB B;  4ZOL B;  5HP7 A;  3E1Y A;  1VH8 A;  1W41 A;  3JCM M;  3NVI B;  3ERN A;  3J80 M;  2BTO A;  1KC8 H;  5MN5 A;  5IJ0 B;  3HAX D;  1X25 A;  3QHD A;  3J81 M;  2BO1 A;  5JQG A;  3OBW A;  5GIP C;  1S72 F;  1VQ7 F;  3LWO C;  2HS4 A;  5EZY A;  3WJP A;  4C8I A;  4ZI7 A;  1VQM F;  3WPX A;  2AMT A;  5CA1 B;  4G4Z A;  4C8E A;  5FNV A;  3ELC A;  4X1K B;  3JAR B;  2UYJ A;  4YJ3 B;  4EI7 A;  1GX1 A;  2V9Y A;  3U0O A;  5C8Y A;  3JAW A;  2KTU A;  3N2G A;  3E20 B;  3IMP A;  3FD5 A;  5J2U A;  1Z5W A;  2GVI A;  3HTN A;  5LA6 B;  3HKD A;  3ZOP A;  2UZH A;  2RHO A;  2LBW A;  3RYC B;  4TV9 B;  1IPA A;  3F0G A;  1IV4 A;  3I3F A;  3JAS B;  3WPW A;  4X1I B;  3G4S F;  3CYP B;  3R0P A;  2CHT A;  4RQO A;  3RYI A;  4PWT A;  2VAM A;  1RQ2 A;  1VQL F;  1X52 A;  3NMU C;  3ZP7 A;  2CSL A;  1U40 A;  1YGY A;  4HNA A;  5HP8 A;  4B5C A;  2OTM A;  5LP6 A;  5J2T B;  1JY8 A;  5EO3 A;  2QA4 F;  3N4Y A;  5KMG A;  1T0A A;  3K12 A;  3F0F A;  2HS3 A;  3WXM B;  5IYZ A;  1DBF A;  2LBX A;  1FFX A;  3RYH B;  3T80 A;  4NWO B;  5MN6 A;  4B62 A;  1OAP A;  4EB6 A;  1K9M H;  5JVD A;  3S02 A;  5GAP K;  4R40 B;  3S0H A;  2EWC A;  4BT7 A;  3CC7 F;  3CCR F;  1IV1 A;  3N2K B;  4O2A A;  3QTY A;  2CHS A;  1SA0 A;  3CYQ A;  1J7H A;  2I6R A;  4IIJ A;  2HS0 A;  5JQG B;  2W8B C;  4ZK7 A;  1W59 A;  1TVK A;  5EZY B;  3MCQ A;  5G4V C;  3E22 A;  3KJK A;  4ZI7 B;  5JCO C;  3L7Q A;  1SDS A;  2G9I A;  2ZVY A;  3TD5 A;  2VGN A;  4BY9 D;  2VAP A;  5FNV B;  2UYP A;  2UYK A;  1YJN F;  1H47 A;  5IJ9 A;  5C8Y B;  4G4Y A;  3JAW B;  4G4X A;  3VCZ A;  3N2G B;  3FPI A;  4X3M A;  5J2U B;  2F9Z C;  4LNU A;  1W55 A;  4G88 A;  1KNK A;  4TV8 B;  4TUY A;  1VQN F;  4XCQ A;  2DYY A;  3BYQ A;  3FBA A;  4F6R B;  1KD1 H;  1VQK F; 
#chains in the Genus database with same CATH homology
 4G4W A;  2HQS C;  3S06 A;  2N48 A;  5EB1 B;  5EAZ A;  3S0W A;  3LDT A;  3TD4 A;  3WPW A;  3TD5 A;  2ZVY A;  2ZVZ A;  3CYP B;  4B62 A;  1OAP A;  4PWT A;  1R1M A;  3WPX A;  3S02 A;  3S0Y A;  4G4Z A;  5EB0 A;  2LCA A;  4R40 B;  3S0H A;  4ZHV A;  2AIZ P;  4G4Y A;  3OON A;  4G4X A;  4ERH A;  3S03 A;  2LBT A;  3TD3 A;  4B5C A;  4ZHW A;  2MQE A;  2ZOV A;  3KHN A;  2K1S A;  3IMP A;  4G88 A;  3CYQ A;  2KGW A;  4G4V A;  4ZHY B;  4RHA A;  2ZF8 A;  2W8B C;  2L26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...