2ZOYA

The multi-drug binding transcriptional repressor cgmr (cgl2612 protein) from c.glutamicum
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
175
structure length
175
Chain Sequence
MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The CGL2612 protein from Corynebacterium glutamicum is a drug resistance-related transcriptional repressor: structural and functional analysis of a newly identified transcription factor from genomic DNA analysis
pubmed doi rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Gene regulation
molecule keywords Transcriptional regulator
total genus 69
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zoyA00
3GEUA 3SDGA 3NNRA 4NELA 4MO7A 5FKNA 2WV1A 4YZEA 2HKUA 1RPWA 3BHQA 3QKXA 3P9TA 5F0HA 4JL3A 2X9DA 4AUXA 2QIBA 5FHPA 4AC6A 3IH4A 3TP0A 5CXIA 3SFIA 3WHBA 5EYRA 2ID6A 2G7GA 2DTZA 4X1EA 2RASA 1Z77A 5F0FA 2FBQA 5AQCA 3KNWA 3O8GA 2JJ7A 2XGDA 3QPSA 1BJZA 4M3FA 3HTIA 3WHCA 2W53A 3BQYA 3COLA 4I76A 3AQTA 2HXOA 2FD5A 2JK3A 3B6AA 3PASA 3RD3A 2OI8A 3HE0A 3F1BA 4JNNA 3CJDA 1A6IA 2UXHA 5C4YA 3BR0A 1RKTA 1JTYA 5F27A 3BTJA 4D5FA 2XPVA 4ME9A 1U9OA 2XPUA 3LWJA 1JUSA 3ZQHA 3ANGA 4UDSA 2IAIA 5IPAA 2XB5A 3ZQLA 5J1UA 4GFKA 3FK7A 4GFLA 3G1MA 2QKOA 2ZOYA 3BTCA 1JUPA 2TRTA 2QWTA 2ZCMA 3DCFA 5IOYA 3BTLA 4M3EA 5GPAA 3Q0UA 2QCOA 2UXPA 3HIMA 3GZIA 3VW1A 5F08A 5EZHA 2EH3A 2GBYA 3VVYA 3NPIA 2XPWA 2UXUA 3C2BA 3LJLA 4D7NA 5D1RA 5FKOA 2OPTA 3VOKA 3HGGA 3HTHA 3LSJA 3EGQA 2ZCXA 3HTAA 3FK6A 2ID3A 1QVTA 1ZK8A 4JKZA 1VI0A 4ABZA 2NS7A 2OF7A 2DG8A 4CGRA 4ICHA 4AF5A 3BR2A 2G7SA 2WGBA 2ZOZA 3O60A 5CW8A 4B3AA 4AC0A 5F0CA 2VPRA 2WUIA 2RHAA 1T33A 3JSJA 3S5RA 2G3BA 4GCKA 3BRUA 2NX4A 3PM1A 5F1JA 3LOCA 3DPJA 3BR3A 2UXOA 1UI5A 3MNLA 3IUVA 3TP3A 4W1UA 4D5CA 3MVPA 2FX0A 3G56A 3AQSA 3BR6A 2G0EA 4HKUA 3ZQFA 2PBXA 2Y2ZA 3QQAA 4GCLA 3LSRA 2Q24A 1U9NA 5FKMA 3PPBA 5EZGA 5J1YA 5K7ZA 4GCTA 5FMPA 3VP5A 5D19A 2HXIA 2TCTA 2O7TA 5CXGA 4W97A 2HQ5A 3EUPA 5GP9A 3B6CA 3KKDA 4V2FA 4MXMA 5FGLA 5HAWA 1JTXA 3E7QA 4M3BA 2GFNA 3QBMA 5FKLA 4MK6A 2XRLA 3O8HA 4KWAA 3IH2A 4B1RA 4ACIA 1QPIA 3ZQGA 5K7HA 3KZ9A 2XDNA 1ZKGA 3FIWA 3IH3A 2HYTA 4I6ZA 3QPLA 3VUQA 3G1OA 2IEKA 5GPCA 3Q3SA 2I10A 3C07A 2IBDA 2FJ1A 3DEWA 3CCYA 1T56A 2GENA 1QVUA 3Q0WA 3VIBA 2HYJA 3B81A 5F04A 5IP6A 3VVZA 3RH2A 3FRQA 3BJBA 3LHQA 3ZQIA 2PZ9A 3Q0VA 4M3DA 4L62A 3BTIA 2ZCNA 3V6GA 2F07A 3VW2A 2XGCA 2GUHA 3HGYA 1JUMA 2XGEA 2RAEA 4D7MA 2REKA 3KKCA 4M3GA 2V57A 1UI6A 3VOXA 3T6NA 5K58A 2QOPA 2FQ4A 2NP5A 2IU5A 1SGMA 3BR5A 3BCGA 2ZB9A 2DG7A 4PXIA 4DW6A 2O7OA 4G12A 1ORKA 3VVXA 3CWRA 1RKWA 4V2GA 3V78A 3NRGA 3NXCA 5J1RA 3VPRA 1Z0XA 3HTJA 5FKKA 3LSPA 2Y30A 3CRJA 3BNIA 3NI7A 5H9TA 5D18A 3BT9A 5EFYA 3F0CA 4NN1A 2YVEA 5HSZA 4JYKA 3VW0A 1JT6A 2UXIA 5IOZA 3ON4A 5DAJA 2VKEA 3BQZA 2D6YA 3BR1A 5HBUA 3ANPA 1JT0A 3G7RA 5K7FA 2VKVA 2NS8A 2OERA 2Y31A 3ON2A 4XK4A 2X6OA 2G7LA 3G1LA 2YVHA 3CDLA 2QTQA 5J3LA 2NP3A
chains in the Genus database with same CATH superfamily
3GEUA 3SDGA 3NNRA 4NELA 4MO7A 5FKNA 2WV1A 4YZEA 2HKUA 1RPWA 3BHQA 3QKXA 3P9TA 2YVXA 5F0HA 4JL3A 2X9DA 4AUXA 2QIBA 5FHPA 4AC6A 3IH4A 3TP0A 5CXIA 3SFIA 3WHBA 5EYRA 2ID6A 2G7GA 2DTZA 4X1EA 2RASA 1Z77A 5F0FA 2FBQA 5AQCA 4C2MA 3KNWA 3O8GA 4OD4A 2JJ7A 2XGDA 3QPSA 4OD5A 1BJZA 4M3FA 3HTIA 3WHCA 4U9NA 2W53A 3BQYA 3COLA 4I76A 3AQTA 2HXOA 2FD5A 2JK3A 3B6AA 3PASA 3RD3A 2B1EA 2OI8A 3HE0A 3F1BA 4JNNA 3CJDA 1A6IA 2UXHA 5C4YA 3BR0A 1RKTA 2ZY9A 1JTYA 5F27A 3BTJA 4D5FA 2XPVA 4ME9A 1U9OA 2XPUA 3LWJA 5CQGA 1JUSA 3ZQHA 3ANGA 4UDSA 2IAIA 5IPAA 2XB5A 4U9LA 3ZQLA 5J1UA 4GFKA 3FK7A 4GFLA 2R7SA 3G1MA 2QKOA 2ZOYA 3BTCA 1JUPA 2TRTA 2QWTA 2ZCMA 3DCFA 5IOYA 3BTLA 4M3EA 5GPAA 3Q0UA 2QCOA 2R7RA 2UXPA 3HIMA 3GZIA 3VW1A 5F08A 5EZHA 2EH3A 2GBYA 3VVYA 3NPIA 2XPWA 2R7VA 2UXUA 3C2BA 3LJLA 4D7NA 5D1RA 5FKOA 2OPTA 3VOKA 3HGGA 3HTHA 3LSJA 3EGQA 2ZCXA 3HTAA 3FK6A 2ID3A 4DVYP 1QVTA 1ZK8A 3DU6A 4JKZA 2A2FX 1VI0A 4ABZA 2R7TA 2NS7A 2OF7A 2DG8A 4CGRA 4ICHA 4AF5A 3BR2A 2G7SA 2WGBA 2ZOZA 3O60A 5CW8A 4B3AA 2R7XA 4AC0A 5F0CA 2VPRA 2WUIA 2RHAA 1T33A 3JSJA 3S5RA 2G3BA 4GCKA 4WIBA 3BRUA 3NS4A 2NX4A 3PM1A 5F1JA 3LOCA 3DPJA 3BR3A 2UXOA 1UI5A 3MNLA 3IUVA 3TP3A 4W1UA 4D5CA 3MVPA 2FX0A 3G56A 3AQSA 3BR6A 2G0EA 4HKUA 2PFVA 3ZQFA 2PBXA 2Y2ZA 3QQAA 4GCLA 3LSRA 2Q24A 1U9NA 5FKMA 3PPBA 5EZGA 5J1YA 2R7WA 5K7ZA 4GCTA 5FMPA 2FJI1 3VP5A 5D19A 2HXIA 2TCTA 2O7TA 5CXGA 4W97A 2HQ5A 3EUPA 5GP9A 3B6CA 3KKDA 4V2FA 4MXMA 3K8PC 5FGLA 5HAWA 1JTXA 3E7QA 4M3BA 2GFNA 3QBMA 5FKLA 4MK6A 2XRLA 3O8HA 4KWAA 3IH2A 4B1RA 4ACIA 1QPIA 3ZQGA 3KZ9A 5K7HA 2XDNA 1ZKGA 2R7OA 3FIWA 3IH3A 2HYTA 4I6ZA 3QPLA 3VUQA 3G1OA 2IEKA 5GPCA 3Q3SA 2I10A 3C07A 2IBDA 2FJ1A 3DEWA 3CCYA 1T56A 2GENA 1QVUA 3Q0WA 3VIBA 3FHNA 2HYJA 3SWHA 3B81A 5F04A 5IP6A 3VVZA 3RH2A 3FRQA 3BJBA 3LHQA 3ZQIA 2PZ9A 3Q0VA 4M3DA 4L62A 3BTIA 2ZCNA 3V6GA 2F07A 4IRVA 3VW2A 2XGCA 2B3WA 2GUHA 3HGYA 1JUMA 2XGEA 2RAEA 4D7MA 2REKA 3KKCA 4M3GA 2V57A 1UI6A 3VOXA 3T6NA 5K58A 2QOPA 2FQ4A 2NP5A 2IU5A 1SGMA 3BR5A 3BCGA 2ZB9A 2DG7A 4PXIA 4DW6A 2O7OA 4G12A 3KYLA 1ORKA 3VVXA 3CWRA 1RKWA 4V2GA 3V78A 3NRGA 3NXCA 5J1RA 3VPRA 2R7QA 1Z0XA 3HTJA 5FKKA 3LSPA 2Y30A 3CRJA 3BNIA 3NI7A 5H9TA 5D18A 3DU5A 3BT9A 3VTIA 5EFYA 3F0CA 2R7UA 4NN1A 2YVEA 5HSZA 4JYKA 3VW0A 1JT6A 2UXIA 5IOZA 3ON4A 5DAJA 2VKEA 3BQZA 2D6YA 3BR1A 5HBUA 3ANPA 1JT0A 3G7RA 5K7FA 2VKVA 2NS8A 2OERA 2Y31A 3ON2A 4XK4A 2X6OA 2G7LA 3G1LA 2YVHA 3CDLA 2QTQA 5J3LA 2NP3A
chains in the Genus database with same CATH topology
3GEUA 3SDGA 3NNRA 4NELA 4MO7A 5FKNA 2WV1A 4YZEA 2HKUA 1RPWA 3BHQA 3QKXA 3P9TA 5F0HA 4JL3A 2X9DA 4AUXA 2QIBA 5FHPA 4AC6A 3IH4A 3TP0A 5CXIA 3SFIA 3WHBA 5EYRA 2ID6A 2G7GA 2DTZA 4X1EA 2RASA 1Z77A 5F0FA 2FBQA 5AQCA 3KNWA 3O8GA 2JJ7A 2XGDA 3QPSA 1BJZA 4M3FA 3HTIA 3WHCA 2W53A 3BQYA 3COLA 4I76A 3AQTA 2HXOA 2FD5A 2JK3A 3B6AA 3PASA 3RD3A 2OI8A 3HE0A 3F1BA 4JNNA 3CJDA 1A6IA 2UXHA 5C4YA 3BR0A 1RKTA 1JTYA 5F27A 3BTJA 4D5FA 2XPVA 4ME9A 1U9OA 2XPUA 3LWJA 1JUSA 3ZQHA 3ANGA 4UDSA 2IAIA 5IPAA 2XB5A 3ZQLA 5J1UA 4GFKA 3FK7A 4GFLA 3G1MA 2QKOA 2ZOYA 3BTCA 1JUPA 2TRTA 2QWTA 2ZCMA 3DCFA 5IOYA 3BTLA 4M3EA 5GPAA 3Q0UA 2QCOA 2UXPA 3HIMA 3GZIA 3VW1A 5F08A 5EZHA 2EH3A 2GBYA 3VVYA 3NPIA 2XPWA 2UXUA 3C2BA 3LJLA 4D7NA 5D1RA 5FKOA 2OPTA 3VOKA 3HGGA 3HTHA 3LSJA 3EGQA 2ZCXA 3HTAA 3FK6A 2ID3A 1QVTA 1ZK8A 4JKZA 1VI0A 4ABZA 2NS7A 2OF7A 2DG8A 4CGRA 4ICHA 4AF5A 3BR2A 2G7SA 2WGBA 2ZOZA 3O60A 5CW8A 4B3AA 4AC0A 5F0CA 2VPRA 2WUIA 2RHAA 1T33A 3JSJA 3S5RA 2G3BA 4GCKA 3BRUA 2NX4A 3PM1A 5F1JA 3LOCA 3DPJA 3BR3A 2UXOA 1UI5A 3MNLA 3IUVA 3TP3A 4W1UA 4D5CA 3MVPA 2FX0A 3G56A 3AQSA 3BR6A 2G0EA 4HKUA 3ZQFA 2PBXA 2Y2ZA 3QQAA 4GCLA 3LSRA 2Q24A 1U9NA 5FKMA 3PPBA 5EZGA 5J1YA 5K7ZA 4GCTA 5FMPA 3VP5A 5D19A 2HXIA 2TCTA 2O7TA 5CXGA 4W97A 2HQ5A 3EUPA 5GP9A 3B6CA 3KKDA 4V2FA 4MXMA 5FGLA 5HAWA 1JTXA 3E7QA 4M3BA 2GFNA 3QBMA 5FKLA 4MK6A 2XRLA 3O8HA 4KWAA 3IH2A 4B1RA 4ACIA 1QPIA 3ZQGA 5K7HA 3KZ9A 2XDNA 1ZKGA 3FIWA 3IH3A 2HYTA 4I6ZA 3QPLA 3VUQA 3G1OA 2IEKA 5GPCA 3Q3SA 2I10A 3C07A 2IBDA 2FJ1A 3DEWA 3CCYA 1T56A 2GENA 1QVUA 3Q0WA 3VIBA 2HYJA 3B81A 5F04A 5IP6A 3VVZA 3RH2A 3FRQA 3BJBA 3LHQA 3ZQIA 2PZ9A 3Q0VA 4M3DA 4L62A 3BTIA 2ZCNA 3V6GA 2F07A 3VW2A 2XGCA 2GUHA 3HGYA 1JUMA 2XGEA 2RAEA 4D7MA 2REKA 3KKCA 4M3GA 2V57A 1UI6A 3VOXA 3T6NA 5K58A 2QOPA 2FQ4A 2NP5A 2IU5A 1SGMA 3BR5A 3BCGA 2ZB9A 2DG7A 4PXIA 4DW6A 2O7OA 4G12A 1ORKA 3VVXA 3CWRA 1RKWA 4V2GA 3V78A 3NRGA 3NXCA 5J1RA 3VPRA 1Z0XA 3HTJA 5FKKA 3LSPA 2Y30A 3CRJA 3BNIA 3NI7A 5H9TA 5D18A 3BT9A 5EFYA 3F0CA 4NN1A 2YVEA 5HSZA 4JYKA 3VW0A 1JT6A 2UXIA 5IOZA 3ON4A 5DAJA 2VKEA 3BQZA 2D6YA 3BR1A 5HBUA 3ANPA 1JT0A 3G7RA 5K7FA 2VKVA 2NS8A 2OERA 2Y31A 3ON2A 4XK4A 2X6OA 2G7LA 3G1LA 2YVHA 3CDLA 2QTQA 5J3LA 2NP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEU A;  3SDG A;  3NNR A;  4NEL A;  4MO7 A;  5FKN A;  2WV1 A;  4YZE A;  2HKU A;  1RPW A;  3BHQ A;  3QKX A;  3P9T A;  5F0H A;  4JL3 A;  2X9D A;  4AUX A;  2QIB A;  5FHP A;  4AC6 A;  3IH4 A;  3TP0 A;  5CXI A;  3SFI A;  3WHB A;  5EYR A;  2ID6 A;  2G7G A;  2DTZ A;  4X1E A;  2RAS A;  1Z77 A;  5F0F A;  2FBQ A;  5AQC A;  3KNW A;  3O8G A;  2JJ7 A;  2XGD A;  3QPS A;  1BJZ A;  4M3F A;  3HTI A;  3WHC A;  2W53 A;  3BQY A;  3COL A;  4I76 A;  3AQT A;  2HXO A;  2FD5 A;  2JK3 A;  3B6A A;  3PAS A;  3RD3 A;  2OI8 A;  3HE0 A;  3F1B A;  4JNN A;  3CJD A;  1A6I A;  2UXH A;  5C4Y A;  3BR0 A;  1RKT A;  1JTY A;  5F27 A;  3BTJ A;  4D5F A;  2XPV A;  4ME9 A;  1U9O A;  2XPU A;  3LWJ A;  1JUS A;  3ZQH A;  3ANG A;  4UDS A;  2IAI A;  5IPA A;  2XB5 A;  3ZQL A;  5J1U A;  4GFK A;  3FK7 A;  4GFL A;  3G1M A;  2QKO A;  2ZOY A;  3BTC A;  1JUP A;  2TRT A;  2QWT A;  2ZCM A;  3DCF A;  5IOY A;  3BTL A;  4M3E A;  5GPA A;  3Q0U A;  2QCO A;  2UXP A;  3HIM A;  3GZI A;  3VW1 A;  5F08 A;  5EZH A;  2EH3 A;  2GBY A;  3VVY A;  3NPI A;  2XPW A;  2UXU A;  3C2B A;  3LJL A;  4D7N A;  5D1R A;  5FKO A;  2OPT A;  3VOK A;  3HGG A;  3HTH A;  3LSJ A;  3EGQ A;  2ZCX A;  3HTA A;  3FK6 A;  2ID3 A;  1QVT A;  1ZK8 A;  4JKZ A;  1VI0 A;  4ABZ A;  2NS7 A;  2OF7 A;  2DG8 A;  4CGR A;  4ICH A;  4AF5 A;  3BR2 A;  2G7S A;  2WGB A;  2ZOZ A;  3O60 A;  5CW8 A;  4B3A A;  4AC0 A;  5F0C A;  2VPR A;  2WUI A;  2RHA A;  1T33 A;  3JSJ A;  3S5R A;  2G3B A;  4GCK A;  3BRU A;  2NX4 A;  3PM1 A;  5F1J A;  3LOC A;  3DPJ A;  3BR3 A;  2UXO A;  1UI5 A;  3MNL A;  3IUV A;  3TP3 A;  4W1U A;  4D5C A;  3MVP A;  2FX0 A;  3G56 A;  3AQS A;  3BR6 A;  2G0E A;  4HKU A;  3ZQF A;  2PBX A;  2Y2Z A;  3QQA A;  4GCL A;  3LSR A;  2Q24 A;  1U9N A;  5FKM A;  3PPB A;  5EZG A;  5J1Y A;  5K7Z A;  4GCT A;  5FMP A;  3VP5 A;  5D19 A;  2HXI A;  2TCT A;  2O7T A;  5CXG A;  4W97 A;  2HQ5 A;  3EUP A;  5GP9 A;  3B6C A;  3KKD A;  4V2F A;  4MXM A;  5FGL A;  5HAW A;  1JTX A;  3E7Q A;  4M3B A;  2GFN A;  3QBM A;  5FKL A;  4MK6 A;  2XRL A;  3O8H A;  4KWA A;  3IH2 A;  4B1R A;  4ACI A;  1QPI A;  3ZQG A;  5K7H A;  3KZ9 A;  2XDN A;  1ZKG A;  3FIW A;  3IH3 A;  2HYT A;  4I6Z A;  3QPL A;  3VUQ A;  3G1O A;  2IEK A;  5GPC A;  3Q3S A;  2I10 A;  3C07 A;  2IBD A;  2FJ1 A;  3DEW A;  3CCY A;  1T56 A;  2GEN A;  1QVU A;  3Q0W A;  3VIB A;  2HYJ A;  3B81 A;  5F04 A;  5IP6 A;  3VVZ A;  3RH2 A;  3FRQ A;  3BJB A;  3LHQ A;  3ZQI A;  2PZ9 A;  3Q0V A;  4M3D A;  4L62 A;  3BTI A;  2ZCN A;  3V6G A;  2F07 A;  3VW2 A;  2XGC A;  2GUH A;  3HGY A;  1JUM A;  2XGE A;  2RAE A;  4D7M A;  2REK A;  3KKC A;  4M3G A;  2V57 A;  1UI6 A;  3VOX A;  3T6N A;  5K58 A;  2QOP A;  2FQ4 A;  2NP5 A;  2IU5 A;  1SGM A;  3BR5 A;  3BCG A;  2ZB9 A;  2DG7 A;  4PXI A;  4DW6 A;  2O7O A;  4G12 A;  1ORK A;  3VVX A;  3CWR A;  1RKW A;  4V2G A;  3V78 A;  3NRG A;  3NXC A;  5J1R A;  3VPR A;  1Z0X A;  3HTJ A;  5FKK A;  3LSP A;  2Y30 A;  3CRJ A;  3BNI A;  3NI7 A;  5H9T A;  5D18 A;  3BT9 A;  5EFY A;  3F0C A;  4NN1 A;  2YVE A;  5HSZ A;  4JYK A;  3VW0 A;  1JT6 A;  2UXI A;  5IOZ A;  3ON4 A;  5DAJ A;  2VKE A;  3BQZ A;  2D6Y A;  3BR1 A;  5HBU A;  3ANP A;  1JT0 A;  3G7R A;  5K7F A;  2VKV A;  2NS8 A;  2OER A;  2Y31 A;  3ON2 A;  4XK4 A;  2X6O A;  2G7L A;  3G1L A;  2YVH A;  3CDL A;  2QTQ A;  5J3L A;  2NP3 A; 
#chains in the Genus database with same CATH topology
 3GEU A;  3SDG A;  3NNR A;  4NEL A;  4MO7 A;  5FKN A;  2WV1 A;  4YZE A;  2HKU A;  1RPW A;  3BHQ A;  3QKX A;  3P9T A;  2YVX A;  5F0H A;  4JL3 A;  2X9D A;  4AUX A;  2QIB A;  5FHP A;  4AC6 A;  3IH4 A;  3TP0 A;  5CXI A;  3SFI A;  3WHB A;  5EYR A;  2ID6 A;  2G7G A;  2DTZ A;  4X1E A;  2RAS A;  1Z77 A;  5F0F A;  2FBQ A;  5AQC A;  4C2M A;  3KNW A;  3O8G A;  4OD4 A;  2JJ7 A;  2XGD A;  3QPS A;  4OD5 A;  1BJZ A;  4M3F A;  3HTI A;  3WHC A;  4U9N A;  2W53 A;  3BQY A;  3COL A;  4I76 A;  3AQT A;  2HXO A;  2FD5 A;  2JK3 A;  3B6A A;  3PAS A;  3RD3 A;  2B1E A;  2OI8 A;  3HE0 A;  3F1B A;  4JNN A;  3CJD A;  1A6I A;  2UXH A;  5C4Y A;  3BR0 A;  1RKT A;  2ZY9 A;  1JTY A;  5F27 A;  3BTJ A;  4D5F A;  2XPV A;  4ME9 A;  1U9O A;  2XPU A;  3LWJ A;  5CQG A;  1JUS A;  3ZQH A;  3ANG A;  4UDS A;  2IAI A;  5IPA A;  2XB5 A;  4U9L A;  3ZQL A;  5J1U A;  4GFK A;  3FK7 A;  4GFL A;  2R7S A;  3G1M A;  2QKO A;  2ZOY A;  3BTC A;  1JUP A;  2TRT A;  2QWT A;  2ZCM A;  3DCF A;  5IOY A;  3BTL A;  4M3E A;  5GPA A;  3Q0U A;  2QCO A;  2R7R A;  2UXP A;  3HIM A;  3GZI A;  3VW1 A;  5F08 A;  5EZH A;  2EH3 A;  2GBY A;  3VVY A;  3NPI A;  2XPW A;  2R7V A;  2UXU A;  3C2B A;  3LJL A;  4D7N A;  5D1R A;  5FKO A;  2OPT A;  3VOK A;  3HGG A;  3HTH A;  3LSJ A;  3EGQ A;  2ZCX A;  3HTA A;  3FK6 A;  2ID3 A;  4DVY P;  1QVT A;  1ZK8 A;  3DU6 A;  4JKZ A;  2A2F X;  1VI0 A;  4ABZ A;  2R7T A;  2NS7 A;  2OF7 A;  2DG8 A;  4CGR A;  4ICH A;  4AF5 A;  3BR2 A;  2G7S A;  2WGB A;  2ZOZ A;  3O60 A;  5CW8 A;  4B3A A;  2R7X A;  4AC0 A;  5F0C A;  2VPR A;  2WUI A;  2RHA A;  1T33 A;  3JSJ A;  3S5R A;  2G3B A;  4GCK A;  4WIB A;  3BRU A;  3NS4 A;  2NX4 A;  3PM1 A;  5F1J A;  3LOC A;  3DPJ A;  3BR3 A;  2UXO A;  1UI5 A;  3MNL A;  3IUV A;  3TP3 A;  4W1U A;  4D5C A;  3MVP A;  2FX0 A;  3G56 A;  3AQS A;  3BR6 A;  2G0E A;  4HKU A;  2PFV A;  3ZQF A;  2PBX A;  2Y2Z A;  3QQA A;  4GCL A;  3LSR A;  2Q24 A;  1U9N A;  5FKM A;  3PPB A;  5EZG A;  5J1Y A;  2R7W A;  5K7Z A;  4GCT A;  5FMP A;  2FJI 1;  3VP5 A;  5D19 A;  2HXI A;  2TCT A;  2O7T A;  5CXG A;  4W97 A;  2HQ5 A;  3EUP A;  5GP9 A;  3B6C A;  3KKD A;  4V2F A;  4MXM A;  3K8P C;  5FGL A;  5HAW A;  1JTX A;  3E7Q A;  4M3B A;  2GFN A;  3QBM A;  5FKL A;  4MK6 A;  2XRL A;  3O8H A;  4KWA A;  3IH2 A;  4B1R A;  4ACI A;  1QPI A;  3ZQG A;  3KZ9 A;  5K7H A;  2XDN A;  1ZKG A;  2R7O A;  3FIW A;  3IH3 A;  2HYT A;  4I6Z A;  3QPL A;  3VUQ A;  3G1O A;  2IEK A;  5GPC A;  3Q3S A;  2I10 A;  3C07 A;  2IBD A;  2FJ1 A;  3DEW A;  3CCY A;  1T56 A;  2GEN A;  1QVU A;  3Q0W A;  3VIB A;  3FHN A;  2HYJ A;  3SWH A;  3B81 A;  5F04 A;  5IP6 A;  3VVZ A;  3RH2 A;  3FRQ A;  3BJB A;  3LHQ A;  3ZQI A;  2PZ9 A;  3Q0V A;  4M3D A;  4L62 A;  3BTI A;  2ZCN A;  3V6G A;  2F07 A;  4IRV A;  3VW2 A;  2XGC A;  2B3W A;  2GUH A;  3HGY A;  1JUM A;  2XGE A;  2RAE A;  4D7M A;  2REK A;  3KKC A;  4M3G A;  2V57 A;  1UI6 A;  3VOX A;  3T6N A;  5K58 A;  2QOP A;  2FQ4 A;  2NP5 A;  2IU5 A;  1SGM A;  3BR5 A;  3BCG A;  2ZB9 A;  2DG7 A;  4PXI A;  4DW6 A;  2O7O A;  4G12 A;  3KYL A;  1ORK A;  3VVX A;  3CWR A;  1RKW A;  4V2G A;  3V78 A;  3NRG A;  3NXC A;  5J1R A;  3VPR A;  2R7Q A;  1Z0X A;  3HTJ A;  5FKK A;  3LSP A;  2Y30 A;  3CRJ A;  3BNI A;  3NI7 A;  5H9T A;  5D18 A;  3DU5 A;  3BT9 A;  3VTI A;  5EFY A;  3F0C A;  2R7U A;  4NN1 A;  2YVE A;  5HSZ A;  4JYK A;  3VW0 A;  1JT6 A;  2UXI A;  5IOZ A;  3ON4 A;  5DAJ A;  2VKE A;  3BQZ A;  2D6Y A;  3BR1 A;  5HBU A;  3ANP A;  1JT0 A;  3G7R A;  5K7F A;  2VKV A;  2NS8 A;  2OER A;  2Y31 A;  3ON2 A;  4XK4 A;  2X6O A;  2G7L A;  3G1L A;  2YVH A;  3CDL A;  2QTQ A;  5J3L A;  2NP3 A; 
#chains in the Genus database with same CATH homology
 3GEU A;  3SDG A;  3NNR A;  4NEL A;  4MO7 A;  5FKN A;  2WV1 A;  4YZE A;  2HKU A;  1RPW A;  3BHQ A;  3QKX A;  3P9T A;  5F0H A;  4JL3 A;  2X9D A;  4AUX A;  2QIB A;  5FHP A;  4AC6 A;  3IH4 A;  3TP0 A;  5CXI A;  3SFI A;  3WHB A;  5EYR A;  2ID6 A;  2G7G A;  2DTZ A;  4X1E A;  2RAS A;  1Z77 A;  5F0F A;  2FBQ A;  5AQC A;  3KNW A;  3O8G A;  2JJ7 A;  2XGD A;  3QPS A;  1BJZ A;  4M3F A;  3HTI A;  3WHC A;  2W53 A;  3BQY A;  3COL A;  4I76 A;  3AQT A;  2HXO A;  2FD5 A;  2JK3 A;  3B6A A;  3PAS A;  3RD3 A;  2OI8 A;  3HE0 A;  3F1B A;  4JNN A;  3CJD A;  1A6I A;  2UXH A;  5C4Y A;  3BR0 A;  1RKT A;  1JTY A;  5F27 A;  3BTJ A;  4D5F A;  2XPV A;  4ME9 A;  1U9O A;  2XPU A;  3LWJ A;  1JUS A;  3ZQH A;  3ANG A;  4UDS A;  2IAI A;  5IPA A;  2XB5 A;  3ZQL A;  5J1U A;  4GFK A;  3FK7 A;  4GFL A;  3G1M A;  2QKO A;  2ZOY A;  3BTC A;  1JUP A;  2TRT A;  2QWT A;  2ZCM A;  3DCF A;  5IOY A;  3BTL A;  4M3E A;  5GPA A;  3Q0U A;  2QCO A;  2UXP A;  3HIM A;  3GZI A;  3VW1 A;  5F08 A;  5EZH A;  2EH3 A;  2GBY A;  3VVY A;  3NPI A;  2XPW A;  2UXU A;  3C2B A;  3LJL A;  4D7N A;  5D1R A;  5FKO A;  2OPT A;  3VOK A;  3HGG A;  3HTH A;  3LSJ A;  3EGQ A;  2ZCX A;  3HTA A;  3FK6 A;  2ID3 A;  1QVT A;  1ZK8 A;  4JKZ A;  1VI0 A;  4ABZ A;  2NS7 A;  2OF7 A;  2DG8 A;  4CGR A;  4ICH A;  4AF5 A;  3BR2 A;  2G7S A;  2WGB A;  2ZOZ A;  3O60 A;  5CW8 A;  4B3A A;  4AC0 A;  5F0C A;  2VPR A;  2WUI A;  2RHA A;  1T33 A;  3JSJ A;  3S5R A;  2G3B A;  4GCK A;  3BRU A;  2NX4 A;  3PM1 A;  5F1J A;  3LOC A;  3DPJ A;  3BR3 A;  2UXO A;  1UI5 A;  3MNL A;  3IUV A;  3TP3 A;  4W1U A;  4D5C A;  3MVP A;  2FX0 A;  3G56 A;  3AQS A;  3BR6 A;  2G0E A;  4HKU A;  3ZQF A;  2PBX A;  2Y2Z A;  3QQA A;  4GCL A;  3LSR A;  2Q24 A;  1U9N A;  5FKM A;  3PPB A;  5EZG A;  5J1Y A;  5K7Z A;  4GCT A;  5FMP A;  3VP5 A;  5D19 A;  2HXI A;  2TCT A;  2O7T A;  5CXG A;  4W97 A;  2HQ5 A;  3EUP A;  5GP9 A;  3B6C A;  3KKD A;  4V2F A;  4MXM A;  5FGL A;  5HAW A;  1JTX A;  3E7Q A;  4M3B A;  2GFN A;  3QBM A;  5FKL A;  4MK6 A;  2XRL A;  3O8H A;  4KWA A;  3IH2 A;  4B1R A;  4ACI A;  1QPI A;  3ZQG A;  5K7H A;  3KZ9 A;  2XDN A;  1ZKG A;  3FIW A;  3IH3 A;  2HYT A;  4I6Z A;  3QPL A;  3VUQ A;  3G1O A;  2IEK A;  5GPC A;  3Q3S A;  2I10 A;  3C07 A;  2IBD A;  2FJ1 A;  3DEW A;  3CCY A;  1T56 A;  2GEN A;  1QVU A;  3Q0W A;  3VIB A;  2HYJ A;  3B81 A;  5F04 A;  5IP6 A;  3VVZ A;  3RH2 A;  3FRQ A;  3BJB A;  3LHQ A;  3ZQI A;  2PZ9 A;  3Q0V A;  4M3D A;  4L62 A;  3BTI A;  2ZCN A;  3V6G A;  2F07 A;  3VW2 A;  2XGC A;  2GUH A;  3HGY A;  1JUM A;  2XGE A;  2RAE A;  4D7M A;  2REK A;  3KKC A;  4M3G A;  2V57 A;  1UI6 A;  3VOX A;  3T6N A;  5K58 A;  2QOP A;  2FQ4 A;  2NP5 A;  2IU5 A;  1SGM A;  3BR5 A;  3BCG A;  2ZB9 A;  2DG7 A;  4PXI A;  4DW6 A;  2O7O A;  4G12 A;  1ORK A;  3VVX A;  3CWR A;  1RKW A;  4V2G A;  3V78 A;  3NRG A;  3NXC A;  5J1R A;  3VPR A;  1Z0X A;  3HTJ A;  5FKK A;  3LSP A;  2Y30 A;  3CRJ A;  3BNI A;  3NI7 A;  5H9T A;  5D18 A;  3BT9 A;  5EFY A;  3F0C A;  4NN1 A;  2YVE A;  5HSZ A;  4JYK A;  3VW0 A;  1JT6 A;  2UXI A;  5IOZ A;  3ON4 A;  5DAJ A;  2VKE A;  3BQZ A;  2D6Y A;  3BR1 A;  5HBU A;  3ANP A;  1JT0 A;  3G7R A;  5K7F A;  2VKV A;  2NS8 A;  2OER A;  2Y31 A;  3ON2 A;  4XK4 A;  2X6O A;  2G7L A;  3G1L A;  2YVH A;  3CDL A;  2QTQ A;  5J3L A;  2NP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...