2ZOYA

The multi-drug binding transcriptional repressor cgmr (cgl2612 protein) from c.glutamicum
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
175
structure length
175
Chain Sequence
b'MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
molecule tags Gene regulation
source organism Corynebacterium glutamicum atcc 13032
publication title The CGL2612 protein from Corynebacterium glutamicum is a drug resistance-related transcriptional repressor: structural and functional analysis of a newly identified transcription factor from genomic DNA analysis
pubmed doi rcsb
total genus 69
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zoyA00
3QQAA 4UDSA 5F27A 3FK7A 2FJ1A 2XPUA 2O7OA 1JT0A 2XDNA 5F0HA 3KKCA 2ZOZA 5F0FA 4ME9A 5CXGA 3FIWA 3F1BA 3ON2A 2G7GA 1QVUA 2JK3A 3HTAA 4GCTA 3KZ9A 2PBXA 2QKOA 5CW8A 3LHQA 3CDLA 2FX0A 3VVXA 2UXIA 3IH3A 2REKA 3ANGA 3B6AA 3S5RA 4JNNA 3G1LA 3BNIA 3BR0A 5H9TA 2O7TA 1U9OA 3BTLA 3IH2A 2DG7A 4MXMA 5C4YA 1JT6A 1ZKGA 2HKUA 3BTCA 3EUPA 3BR3A 5EZHA 2ZCXA 3BQYA 3QPLA 4V2GA 2Q24A 5F08A 1JTXA 2X6OA 2NP3A 4ACIA 3B81A 1RPWA 3FK6A 4GCLA 3HTIA 4GFLA 3CWRA 3E7QA 3NPIA 2GFNA 3GZIA 5HSZA 3VPRA 3SFIA 1RKTA 2F07A 1JTYA 3T6NA 2HYJA 4NELA 2VKEA 3HTJA 1T56A 3VVZA 5J1RA 5HBUA 5DAJA 3TP0A 4W97A 4YZEA 4D5CA 3AQTA 2XGCA 2QIBA 5F0CA 5IPAA 2GENA 2RHAA 2OERA 5J3LA 2EH3A 1A6IA 3VIBA 2ZOYA 4G12A 4PXIA 5IOYA 2I10A 2RAEA 5D18A 3IUVA 3VW1A 3C2BA 2IEKA 2OPTA 4GFKA 5FKMA 4JYKA 4AUXA 2V57A 3EGQA 2IBDA 2GUHA 2QTQA 3F0CA 3QKXA 4I76A 4AC0A 4B1RA 3DEWA 5F1JA 3B6CA 3QPSA 2JJ7A 3Q0VA 4ABZA 2GBYA 2QOPA 5EZGA 2NS8A 3BHQA 3LJLA 2HYTA 3ZQIA 3WHBA 4GCKA 3ANPA 2UXUA 3P9TA 3LSRA 3BR2A 4D7NA 5K7ZA 2HXIA 4MK6A 2RASA 3NNRA 2G7LA 3G1MA 3ON4A 4B3AA 1SGMA 5K7HA 2W53A 2UXHA 2HXOA 3O8GA 2DG8A 3V78A 4D5FA 3KKDA 4XK4A 3HGYA 4D7MA 2XGDA 4X1EA 4M3EA 5GPCA 2ID3A 1Z77A 3LOCA 3RH2A 3ZQFA 3LSJA 4M3FA 5J1YA 4I6ZA 3HTHA 3HIMA 2FBQA 1Z0XA 3BRUA 3PPBA 5FKOA 4JL3A 2QWTA 2XPVA 3AQSA 4V2FA 1QPIA 2FQ4A 4AF5A 2YVEA 2ZCNA 3NRGA 4NN1A 2XPWA 3CRJA 1VI0A 3BTJA 4HKUA 1T33A 1UI5A 1ORKA 5FGLA 1BJZA 3QBMA 5FKNA 3VVYA 3O8HA 3PASA 5AQCA 2ZB9A 2NP5A 5GPAA 3NI7A 2UXOA 2WV1A 3COLA 3GEUA 5D19A 3Q3SA 3MNLA 4M3BA 2G7SA 1JUSA 5FMPA 3CJDA 5K58A 3ZQLA 2G0EA 3CCYA 2TRTA 3MVPA 3KNWA 5EYRA 2WUIA 3BT9A 3V6GA 3LWJA 5CXIA 2OF7A 1ZK8A 3BR6A 5J1UA 2QCOA 3RD3A 3C07A 2WGBA 3TP3A 1QVTA 3G1OA 3VW2A 2G3BA 3PM1A 2IU5A 5EFYA 1RKWA 4M3GA 2ZCMA 1U9NA 2OI8A 3SDGA 3ZQGA 3Q0WA 3HE0A 2VKVA 2XB5A 4ICHA 2NX4A 5FKLA 2Y30A 4DW6A 2IAIA 2DTZA 4L62A 5FHPA 5F04A 4JKZA 3BJBA 1UI6A 3IH4A 3VOKA 2VPRA 2ID6A 3BQZA 4W1UA 2XRLA 3VP5A 3BR1A 3O60A 3WHCA 3JSJA 3FRQA 3DPJA 5IOZA 3ZQHA 2UXPA 3Q0UA 3BR5A 1JUMA 5GP9A 3VW0A 2HQ5A 4CGRA 3VUQA 5IP6A 2D6YA 3BCGA 2XGEA 3G56A 3BTIA 2TCTA 2Y31A 4AC6A 5K7FA 2NS7A 3DCFA 4MO7A 3HGGA 3VOXA 5HAWA 2X9DA 2Y2ZA 2FD5A 4KWAA 2YVHA 5FKKA 2PZ9A 5D1RA 3G7RA 3LSPA 3NXCA 4M3DA 1JUPA
chains in the Genus database with same CATH superfamily
3QQAA 4UDSA 5F27A 3FK7A 2FJ1A 2XPUA 2O7OA 1JT0A 2XDNA 5F0HA 3KKCA 2ZOZA 5F0FA 4ME9A 5CXGA 3FIWA 3DU6A 3F1BA 3ON2A 2G7GA 2R7QA 1QVUA 2JK3A 3HTAA 4GCTA 3KZ9A 2PBXA 2QKOA 5CW8A 3LHQA 3CDLA 2FX0A 3VVXA 2UXIA 3IH3A 2REKA 3ANGA 3B6AA 3S5RA 4JNNA 3G1LA 3BNIA 3BR0A 5H9TA 2O7TA 1U9OA 3BTLA 3IH2A 3VTIA 2DG7A 4MXMA 5C4YA 1JT6A 1ZKGA 2HKUA 3BTCA 3EUPA 3BR3A 5EZHA 2ZCXA 3BQYA 3QPLA 2R7UA 4V2GA 2Q24A 5F08A 1JTXA 4U9NA 2X6OA 2NP3A 4ACIA 3B81A 1RPWA 3FK6A 4GCLA 2R7VA 3HTIA 4GFLA 3CWRA 3E7QA 3NPIA 2R7RA 2GFNA 3GZIA 5HSZA 3VPRA 3SFIA 1RKTA 2F07A 1JTYA 3T6NA 2HYJA 4NELA 2VKEA 3HTJA 1T56A 3VVZA 5J1RA 5HBUA 5DAJA 2PFVA 3TP0A 4W97A 4YZEA 4D5CA 3AQTA 2XGCA 2QIBA 5F0CA 3K8PC 5IPAA 2GENA 2OERA 2RHAA 5J3LA 2EH3A 1A6IA 3VIBA 2ZOYA 4G12A 4PXIA 5IOYA 2I10A 2RAEA 5D18A 3IUVA 3VW1A 3C2BA 2IEKA 2OPTA 4GFKA 3KYLA 5FKMA 4JYKA 4WIBA 4AUXA 2R7XA 2V57A 3EGQA 2R7SA 2IBDA 2GUHA 2QTQA 3F0CA 3QKXA 2FJI1 4I76A 4AC0A 4B1RA 3DEWA 5F1JA 3B6CA 3QPSA 2JJ7A 3Q0VA 4ABZA 2GBYA 2QOPA 2ZY9A 5EZGA 2NS8A 3BHQA 3LJLA 2HYTA 3ZQIA 3WHBA 4GCKA 3ANPA 4C2MA 2UXUA 3P9TA 3LSRA 3BR2A 4D7NA 5K7ZA 4IRVA 2HXIA 4MK6A 2RASA 3NNRA 2G7LA 3G1MA 3ON4A 4B3AA 1SGMA 5K7HA 2W53A 2B3WA 2UXHA 2HXOA 3O8GA 2DG8A 3V78A 4D5FA 3KKDA 4XK4A 3HGYA 4D7MA 2XGDA 4X1EA 4M3EA 5GPCA 2ID3A 1Z77A 3LOCA 3RH2A 3ZQFA 3LSJA 4M3FA 5J1YA 4I6ZA 3HTHA 3HIMA 2FBQA 1Z0XA 3BRUA 3PPBA 5FKOA 4JL3A 2QWTA 2XPVA 2YVXA 3AQSA 4V2FA 1QPIA 2FQ4A 4AF5A 2YVEA 2ZCNA 3NRGA 4NN1A 2XPWA 3CRJA 1VI0A 3BTJA 4HKUA 1T33A 2R7WA 1UI5A 1ORKA 5FGLA 1BJZA 4U9LA 3QBMA 5FKNA 3VVYA 3O8HA 3PASA 5AQCA 2ZB9A 2NP5A 5GPAA 3NI7A 2UXOA 2WV1A 2A2FX 3COLA 3GEUA 5D19A 3Q3SA 3MNLA 4M3BA 2G7SA 1JUSA 5CQGA 5FMPA 3CJDA 5K58A 3ZQLA 2G0EA 3CCYA 2TRTA 3MVPA 3KNWA 5EYRA 2WUIA 3BT9A 3V6GA 3LWJA 5CXIA 2OF7A 1ZK8A 3BR6A 3DU5A 5J1UA 2QCOA 3RD3A 3C07A 2WGBA 3TP3A 1QVTA 4DVYP 3G1OA 3VW2A 2G3BA 3PM1A 2IU5A 5EFYA 1RKWA 4M3GA 2ZCMA 2R7OA 1U9NA 3SWHA 3ZQGA 2OI8A 3SDGA 3Q0WA 3HE0A 2VKVA 2XB5A 4ICHA 2NX4A 5FKLA 2Y30A 4DW6A 2IAIA 2DTZA 4L62A 3NS4A 5FHPA 5F04A 4JKZA 3BJBA 1UI6A 3IH4A 3VOKA 2VPRA 2ID6A 3BQZA 4W1UA 2XRLA 3VP5A 3BR1A 3O60A 3WHCA 4OD5A 3JSJA 3FRQA 3DPJA 5IOZA 3ZQHA 2UXPA 3Q0UA 3BR5A 1JUMA 5GP9A 3VW0A 2HQ5A 4CGRA 3VUQA 2R7TA 5IP6A 2D6YA 3FHNA 3BCGA 2XGEA 3G56A 3BTIA 4OD4A 2TCTA 2Y31A 4AC6A 5K7FA 2NS7A 3DCFA 4MO7A 3HGGA 3VOXA 5HAWA 2X9DA 2Y2ZA 2FD5A 4KWAA 2B1EA 2YVHA 5FKKA 2PZ9A 5D1RA 3G7RA 3LSPA 3NXCA 4M3DA 1JUPA
chains in the Genus database with same CATH topology
3QQAA 4UDSA 5F27A 3FK7A 2FJ1A 2XPUA 2O7OA 1JT0A 2XDNA 5F0HA 3KKCA 2ZOZA 5F0FA 4ME9A 5CXGA 3FIWA 3F1BA 3ON2A 2G7GA 1QVUA 2JK3A 3HTAA 4GCTA 3KZ9A 2PBXA 2QKOA 5CW8A 3LHQA 3CDLA 2FX0A 3VVXA 2UXIA 3IH3A 2REKA 3ANGA 3B6AA 3S5RA 4JNNA 3G1LA 3BNIA 3BR0A 5H9TA 2O7TA 1U9OA 3BTLA 3IH2A 2DG7A 4MXMA 5C4YA 1JT6A 1ZKGA 2HKUA 3BTCA 3EUPA 3BR3A 5EZHA 2ZCXA 3BQYA 3QPLA 4V2GA 2Q24A 5F08A 1JTXA 2X6OA 2NP3A 4ACIA 3B81A 1RPWA 3FK6A 4GCLA 3HTIA 4GFLA 3CWRA 3E7QA 3NPIA 2GFNA 3GZIA 5HSZA 3VPRA 3SFIA 1RKTA 2F07A 1JTYA 3T6NA 2HYJA 4NELA 2VKEA 3HTJA 1T56A 3VVZA 5J1RA 5HBUA 5DAJA 3TP0A 4W97A 4YZEA 4D5CA 3AQTA 2XGCA 2QIBA 5F0CA 5IPAA 2GENA 2RHAA 2OERA 5J3LA 2EH3A 1A6IA 3VIBA 2ZOYA 4G12A 4PXIA 5IOYA 2I10A 2RAEA 5D18A 3IUVA 3VW1A 3C2BA 2IEKA 2OPTA 4GFKA 5FKMA 4JYKA 4AUXA 2V57A 3EGQA 2IBDA 2GUHA 2QTQA 3F0CA 3QKXA 4I76A 4AC0A 4B1RA 3DEWA 5F1JA 3B6CA 3QPSA 2JJ7A 3Q0VA 4ABZA 2GBYA 2QOPA 5EZGA 2NS8A 3BHQA 3LJLA 2HYTA 3ZQIA 3WHBA 4GCKA 3ANPA 2UXUA 3P9TA 3LSRA 3BR2A 4D7NA 5K7ZA 2HXIA 4MK6A 2RASA 3NNRA 2G7LA 3G1MA 3ON4A 4B3AA 1SGMA 5K7HA 2W53A 2UXHA 2HXOA 3O8GA 2DG8A 3V78A 4D5FA 3KKDA 4XK4A 3HGYA 4D7MA 2XGDA 4X1EA 4M3EA 5GPCA 2ID3A 1Z77A 3LOCA 3RH2A 3ZQFA 3LSJA 4M3FA 5J1YA 4I6ZA 3HTHA 3HIMA 2FBQA 1Z0XA 3BRUA 3PPBA 5FKOA 4JL3A 2QWTA 2XPVA 3AQSA 4V2FA 1QPIA 2FQ4A 4AF5A 2YVEA 2ZCNA 3NRGA 4NN1A 2XPWA 3CRJA 1VI0A 3BTJA 4HKUA 1T33A 1UI5A 1ORKA 5FGLA 1BJZA 3QBMA 5FKNA 3VVYA 3O8HA 3PASA 5AQCA 2ZB9A 2NP5A 5GPAA 3NI7A 2UXOA 2WV1A 3COLA 3GEUA 5D19A 3Q3SA 3MNLA 4M3BA 2G7SA 1JUSA 5FMPA 3CJDA 5K58A 3ZQLA 2G0EA 3CCYA 2TRTA 3MVPA 3KNWA 5EYRA 2WUIA 3BT9A 3V6GA 3LWJA 5CXIA 2OF7A 1ZK8A 3BR6A 5J1UA 2QCOA 3RD3A 3C07A 2WGBA 3TP3A 1QVTA 3G1OA 3VW2A 2G3BA 3PM1A 2IU5A 5EFYA 1RKWA 4M3GA 2ZCMA 1U9NA 2OI8A 3SDGA 3ZQGA 3Q0WA 3HE0A 2VKVA 2XB5A 4ICHA 2NX4A 5FKLA 2Y30A 4DW6A 2IAIA 2DTZA 4L62A 5FHPA 5F04A 4JKZA 3BJBA 1UI6A 3IH4A 3VOKA 2VPRA 2ID6A 3BQZA 4W1UA 2XRLA 3VP5A 3BR1A 3O60A 3WHCA 3JSJA 3FRQA 3DPJA 5IOZA 3ZQHA 2UXPA 3Q0UA 3BR5A 1JUMA 5GP9A 3VW0A 2HQ5A 4CGRA 3VUQA 5IP6A 2D6YA 3BCGA 2XGEA 3G56A 3BTIA 2TCTA 2Y31A 4AC6A 5K7FA 2NS7A 3DCFA 4MO7A 3HGGA 3VOXA 5HAWA 2X9DA 2Y2ZA 2FD5A 4KWAA 2YVHA 5FKKA 2PZ9A 5D1RA 3G7RA 3LSPA 3NXCA 4M3DA 1JUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQA A;  4UDS A;  5F27 A;  3FK7 A;  2FJ1 A;  2XPU A;  2O7O A;  1JT0 A;  2XDN A;  5F0H A;  3KKC A;  2ZOZ A;  5F0F A;  4ME9 A;  5CXG A;  3FIW A;  3F1B A;  3ON2 A;  2G7G A;  1QVU A;  2JK3 A;  3HTA A;  4GCT A;  3KZ9 A;  2PBX A;  2QKO A;  5CW8 A;  3LHQ A;  3CDL A;  2FX0 A;  3VVX A;  2UXI A;  3IH3 A;  2REK A;  3ANG A;  3B6A A;  3S5R A;  4JNN A;  3G1L A;  3BNI A;  3BR0 A;  5H9T A;  2O7T A;  1U9O A;  3BTL A;  3IH2 A;  2DG7 A;  4MXM A;  5C4Y A;  1JT6 A;  1ZKG A;  2HKU A;  3BTC A;  3EUP A;  3BR3 A;  5EZH A;  2ZCX A;  3BQY A;  3QPL A;  4V2G A;  2Q24 A;  5F08 A;  1JTX A;  2X6O A;  2NP3 A;  4ACI A;  3B81 A;  1RPW A;  3FK6 A;  4GCL A;  3HTI A;  4GFL A;  3CWR A;  3E7Q A;  3NPI A;  2GFN A;  3GZI A;  5HSZ A;  3VPR A;  3SFI A;  1RKT A;  2F07 A;  1JTY A;  3T6N A;  2HYJ A;  4NEL A;  2VKE A;  3HTJ A;  1T56 A;  3VVZ A;  5J1R A;  5HBU A;  5DAJ A;  3TP0 A;  4W97 A;  4YZE A;  4D5C A;  3AQT A;  2XGC A;  2QIB A;  5F0C A;  5IPA A;  2GEN A;  2RHA A;  2OER A;  5J3L A;  2EH3 A;  1A6I A;  3VIB A;  2ZOY A;  4G12 A;  4PXI A;  5IOY A;  2I10 A;  2RAE A;  5D18 A;  3IUV A;  3VW1 A;  3C2B A;  2IEK A;  2OPT A;  4GFK A;  5FKM A;  4JYK A;  4AUX A;  2V57 A;  3EGQ A;  2IBD A;  2GUH A;  2QTQ A;  3F0C A;  3QKX A;  4I76 A;  4AC0 A;  4B1R A;  3DEW A;  5F1J A;  3B6C A;  3QPS A;  2JJ7 A;  3Q0V A;  4ABZ A;  2GBY A;  2QOP A;  5EZG A;  2NS8 A;  3BHQ A;  3LJL A;  2HYT A;  3ZQI A;  3WHB A;  4GCK A;  3ANP A;  2UXU A;  3P9T A;  3LSR A;  3BR2 A;  4D7N A;  5K7Z A;  2HXI A;  4MK6 A;  2RAS A;  3NNR A;  2G7L A;  3G1M A;  3ON4 A;  4B3A A;  1SGM A;  5K7H A;  2W53 A;  2UXH A;  2HXO A;  3O8G A;  2DG8 A;  3V78 A;  4D5F A;  3KKD A;  4XK4 A;  3HGY A;  4D7M A;  2XGD A;  4X1E A;  4M3E A;  5GPC A;  2ID3 A;  1Z77 A;  3LOC A;  3RH2 A;  3ZQF A;  3LSJ A;  4M3F A;  5J1Y A;  4I6Z A;  3HTH A;  3HIM A;  2FBQ A;  1Z0X A;  3BRU A;  3PPB A;  5FKO A;  4JL3 A;  2QWT A;  2XPV A;  3AQS A;  4V2F A;  1QPI A;  2FQ4 A;  4AF5 A;  2YVE A;  2ZCN A;  3NRG A;  4NN1 A;  2XPW A;  3CRJ A;  1VI0 A;  3BTJ A;  4HKU A;  1T33 A;  1UI5 A;  1ORK A;  5FGL A;  1BJZ A;  3QBM A;  5FKN A;  3VVY A;  3O8H A;  3PAS A;  5AQC A;  2ZB9 A;  2NP5 A;  5GPA A;  3NI7 A;  2UXO A;  2WV1 A;  3COL A;  3GEU A;  5D19 A;  3Q3S A;  3MNL A;  4M3B A;  2G7S A;  1JUS A;  5FMP A;  3CJD A;  5K58 A;  3ZQL A;  2G0E A;  3CCY A;  2TRT A;  3MVP A;  3KNW A;  5EYR A;  2WUI A;  3BT9 A;  3V6G A;  3LWJ A;  5CXI A;  2OF7 A;  1ZK8 A;  3BR6 A;  5J1U A;  2QCO A;  3RD3 A;  3C07 A;  2WGB A;  3TP3 A;  1QVT A;  3G1O A;  3VW2 A;  2G3B A;  3PM1 A;  2IU5 A;  5EFY A;  1RKW A;  4M3G A;  2ZCM A;  1U9N A;  2OI8 A;  3SDG A;  3ZQG A;  3Q0W A;  3HE0 A;  2VKV A;  2XB5 A;  4ICH A;  2NX4 A;  5FKL A;  2Y30 A;  4DW6 A;  2IAI A;  2DTZ A;  4L62 A;  5FHP A;  5F04 A;  4JKZ A;  3BJB A;  1UI6 A;  3IH4 A;  3VOK A;  2VPR A;  2ID6 A;  3BQZ A;  4W1U A;  2XRL A;  3VP5 A;  3BR1 A;  3O60 A;  3WHC A;  3JSJ A;  3FRQ A;  3DPJ A;  5IOZ A;  3ZQH A;  2UXP A;  3Q0U A;  3BR5 A;  1JUM A;  5GP9 A;  3VW0 A;  2HQ5 A;  4CGR A;  3VUQ A;  5IP6 A;  2D6Y A;  3BCG A;  2XGE A;  3G56 A;  3BTI A;  2TCT A;  2Y31 A;  4AC6 A;  5K7F A;  2NS7 A;  3DCF A;  4MO7 A;  3HGG A;  3VOX A;  5HAW A;  2X9D A;  2Y2Z A;  2FD5 A;  4KWA A;  2YVH A;  5FKK A;  2PZ9 A;  5D1R A;  3G7R A;  3LSP A;  3NXC A;  4M3D A;  1JUP A; 
#chains in the Genus database with same CATH topology
 3QQA A;  4UDS A;  5F27 A;  3FK7 A;  2FJ1 A;  2XPU A;  2O7O A;  1JT0 A;  2XDN A;  5F0H A;  3KKC A;  2ZOZ A;  5F0F A;  4ME9 A;  5CXG A;  3FIW A;  3DU6 A;  3F1B A;  3ON2 A;  2G7G A;  2R7Q A;  1QVU A;  2JK3 A;  3HTA A;  4GCT A;  3KZ9 A;  2PBX A;  2QKO A;  5CW8 A;  3LHQ A;  3CDL A;  2FX0 A;  3VVX A;  2UXI A;  3IH3 A;  2REK A;  3ANG A;  3B6A A;  3S5R A;  4JNN A;  3G1L A;  3BNI A;  3BR0 A;  5H9T A;  2O7T A;  1U9O A;  3BTL A;  3IH2 A;  3VTI A;  2DG7 A;  4MXM A;  5C4Y A;  1JT6 A;  1ZKG A;  2HKU A;  3BTC A;  3EUP A;  3BR3 A;  5EZH A;  2ZCX A;  3BQY A;  3QPL A;  2R7U A;  4V2G A;  2Q24 A;  5F08 A;  1JTX A;  4U9N A;  2X6O A;  2NP3 A;  4ACI A;  3B81 A;  1RPW A;  3FK6 A;  4GCL A;  2R7V A;  3HTI A;  4GFL A;  3CWR A;  3E7Q A;  3NPI A;  2R7R A;  2GFN A;  3GZI A;  5HSZ A;  3VPR A;  3SFI A;  1RKT A;  2F07 A;  1JTY A;  3T6N A;  2HYJ A;  4NEL A;  2VKE A;  3HTJ A;  1T56 A;  3VVZ A;  5J1R A;  5HBU A;  5DAJ A;  2PFV A;  3TP0 A;  4W97 A;  4YZE A;  4D5C A;  3AQT A;  2XGC A;  2QIB A;  5F0C A;  3K8P C;  5IPA A;  2GEN A;  2OER A;  2RHA A;  5J3L A;  2EH3 A;  1A6I A;  3VIB A;  2ZOY A;  4G12 A;  4PXI A;  5IOY A;  2I10 A;  2RAE A;  5D18 A;  3IUV A;  3VW1 A;  3C2B A;  2IEK A;  2OPT A;  4GFK A;  3KYL A;  5FKM A;  4JYK A;  4WIB A;  4AUX A;  2R7X A;  2V57 A;  3EGQ A;  2R7S A;  2IBD A;  2GUH A;  2QTQ A;  3F0C A;  3QKX A;  2FJI 1;  4I76 A;  4AC0 A;  4B1R A;  3DEW A;  5F1J A;  3B6C A;  3QPS A;  2JJ7 A;  3Q0V A;  4ABZ A;  2GBY A;  2QOP A;  2ZY9 A;  5EZG A;  2NS8 A;  3BHQ A;  3LJL A;  2HYT A;  3ZQI A;  3WHB A;  4GCK A;  3ANP A;  4C2M A;  2UXU A;  3P9T A;  3LSR A;  3BR2 A;  4D7N A;  5K7Z A;  4IRV A;  2HXI A;  4MK6 A;  2RAS A;  3NNR A;  2G7L A;  3G1M A;  3ON4 A;  4B3A A;  1SGM A;  5K7H A;  2W53 A;  2B3W A;  2UXH A;  2HXO A;  3O8G A;  2DG8 A;  3V78 A;  4D5F A;  3KKD A;  4XK4 A;  3HGY A;  4D7M A;  2XGD A;  4X1E A;  4M3E A;  5GPC A;  2ID3 A;  1Z77 A;  3LOC A;  3RH2 A;  3ZQF A;  3LSJ A;  4M3F A;  5J1Y A;  4I6Z A;  3HTH A;  3HIM A;  2FBQ A;  1Z0X A;  3BRU A;  3PPB A;  5FKO A;  4JL3 A;  2QWT A;  2XPV A;  2YVX A;  3AQS A;  4V2F A;  1QPI A;  2FQ4 A;  4AF5 A;  2YVE A;  2ZCN A;  3NRG A;  4NN1 A;  2XPW A;  3CRJ A;  1VI0 A;  3BTJ A;  4HKU A;  1T33 A;  2R7W A;  1UI5 A;  1ORK A;  5FGL A;  1BJZ A;  4U9L A;  3QBM A;  5FKN A;  3VVY A;  3O8H A;  3PAS A;  5AQC A;  2ZB9 A;  2NP5 A;  5GPA A;  3NI7 A;  2UXO A;  2WV1 A;  2A2F X;  3COL A;  3GEU A;  5D19 A;  3Q3S A;  3MNL A;  4M3B A;  2G7S A;  1JUS A;  5CQG A;  5FMP A;  3CJD A;  5K58 A;  3ZQL A;  2G0E A;  3CCY A;  2TRT A;  3MVP A;  3KNW A;  5EYR A;  2WUI A;  3BT9 A;  3V6G A;  3LWJ A;  5CXI A;  2OF7 A;  1ZK8 A;  3BR6 A;  3DU5 A;  5J1U A;  2QCO A;  3RD3 A;  3C07 A;  2WGB A;  3TP3 A;  1QVT A;  4DVY P;  3G1O A;  3VW2 A;  2G3B A;  3PM1 A;  2IU5 A;  5EFY A;  1RKW A;  4M3G A;  2ZCM A;  2R7O A;  1U9N A;  3SWH A;  3ZQG A;  2OI8 A;  3SDG A;  3Q0W A;  3HE0 A;  2VKV A;  2XB5 A;  4ICH A;  2NX4 A;  5FKL A;  2Y30 A;  4DW6 A;  2IAI A;  2DTZ A;  4L62 A;  3NS4 A;  5FHP A;  5F04 A;  4JKZ A;  3BJB A;  1UI6 A;  3IH4 A;  3VOK A;  2VPR A;  2ID6 A;  3BQZ A;  4W1U A;  2XRL A;  3VP5 A;  3BR1 A;  3O60 A;  3WHC A;  4OD5 A;  3JSJ A;  3FRQ A;  3DPJ A;  5IOZ A;  3ZQH A;  2UXP A;  3Q0U A;  3BR5 A;  1JUM A;  5GP9 A;  3VW0 A;  2HQ5 A;  4CGR A;  3VUQ A;  2R7T A;  5IP6 A;  2D6Y A;  3FHN A;  3BCG A;  2XGE A;  3G56 A;  3BTI A;  4OD4 A;  2TCT A;  2Y31 A;  4AC6 A;  5K7F A;  2NS7 A;  3DCF A;  4MO7 A;  3HGG A;  3VOX A;  5HAW A;  2X9D A;  2Y2Z A;  2FD5 A;  4KWA A;  2B1E A;  2YVH A;  5FKK A;  2PZ9 A;  5D1R A;  3G7R A;  3LSP A;  3NXC A;  4M3D A;  1JUP A; 
#chains in the Genus database with same CATH homology
 3QQA A;  4UDS A;  5F27 A;  3FK7 A;  2FJ1 A;  2XPU A;  2O7O A;  1JT0 A;  2XDN A;  5F0H A;  3KKC A;  2ZOZ A;  5F0F A;  4ME9 A;  5CXG A;  3FIW A;  3F1B A;  3ON2 A;  2G7G A;  1QVU A;  2JK3 A;  3HTA A;  4GCT A;  3KZ9 A;  2PBX A;  2QKO A;  5CW8 A;  3LHQ A;  3CDL A;  2FX0 A;  3VVX A;  2UXI A;  3IH3 A;  2REK A;  3ANG A;  3B6A A;  3S5R A;  4JNN A;  3G1L A;  3BNI A;  3BR0 A;  5H9T A;  2O7T A;  1U9O A;  3BTL A;  3IH2 A;  2DG7 A;  4MXM A;  5C4Y A;  1JT6 A;  1ZKG A;  2HKU A;  3BTC A;  3EUP A;  3BR3 A;  5EZH A;  2ZCX A;  3BQY A;  3QPL A;  4V2G A;  2Q24 A;  5F08 A;  1JTX A;  2X6O A;  2NP3 A;  4ACI A;  3B81 A;  1RPW A;  3FK6 A;  4GCL A;  3HTI A;  4GFL A;  3CWR A;  3E7Q A;  3NPI A;  2GFN A;  3GZI A;  5HSZ A;  3VPR A;  3SFI A;  1RKT A;  2F07 A;  1JTY A;  3T6N A;  2HYJ A;  4NEL A;  2VKE A;  3HTJ A;  1T56 A;  3VVZ A;  5J1R A;  5HBU A;  5DAJ A;  3TP0 A;  4W97 A;  4YZE A;  4D5C A;  3AQT A;  2XGC A;  2QIB A;  5F0C A;  5IPA A;  2GEN A;  2RHA A;  2OER A;  5J3L A;  2EH3 A;  1A6I A;  3VIB A;  2ZOY A;  4G12 A;  4PXI A;  5IOY A;  2I10 A;  2RAE A;  5D18 A;  3IUV A;  3VW1 A;  3C2B A;  2IEK A;  2OPT A;  4GFK A;  5FKM A;  4JYK A;  4AUX A;  2V57 A;  3EGQ A;  2IBD A;  2GUH A;  2QTQ A;  3F0C A;  3QKX A;  4I76 A;  4AC0 A;  4B1R A;  3DEW A;  5F1J A;  3B6C A;  3QPS A;  2JJ7 A;  3Q0V A;  4ABZ A;  2GBY A;  2QOP A;  5EZG A;  2NS8 A;  3BHQ A;  3LJL A;  2HYT A;  3ZQI A;  3WHB A;  4GCK A;  3ANP A;  2UXU A;  3P9T A;  3LSR A;  3BR2 A;  4D7N A;  5K7Z A;  2HXI A;  4MK6 A;  2RAS A;  3NNR A;  2G7L A;  3G1M A;  3ON4 A;  4B3A A;  1SGM A;  5K7H A;  2W53 A;  2UXH A;  2HXO A;  3O8G A;  2DG8 A;  3V78 A;  4D5F A;  3KKD A;  4XK4 A;  3HGY A;  4D7M A;  2XGD A;  4X1E A;  4M3E A;  5GPC A;  2ID3 A;  1Z77 A;  3LOC A;  3RH2 A;  3ZQF A;  3LSJ A;  4M3F A;  5J1Y A;  4I6Z A;  3HTH A;  3HIM A;  2FBQ A;  1Z0X A;  3BRU A;  3PPB A;  5FKO A;  4JL3 A;  2QWT A;  2XPV A;  3AQS A;  4V2F A;  1QPI A;  2FQ4 A;  4AF5 A;  2YVE A;  2ZCN A;  3NRG A;  4NN1 A;  2XPW A;  3CRJ A;  1VI0 A;  3BTJ A;  4HKU A;  1T33 A;  1UI5 A;  1ORK A;  5FGL A;  1BJZ A;  3QBM A;  5FKN A;  3VVY A;  3O8H A;  3PAS A;  5AQC A;  2ZB9 A;  2NP5 A;  5GPA A;  3NI7 A;  2UXO A;  2WV1 A;  3COL A;  3GEU A;  5D19 A;  3Q3S A;  3MNL A;  4M3B A;  2G7S A;  1JUS A;  5FMP A;  3CJD A;  5K58 A;  3ZQL A;  2G0E A;  3CCY A;  2TRT A;  3MVP A;  3KNW A;  5EYR A;  2WUI A;  3BT9 A;  3V6G A;  3LWJ A;  5CXI A;  2OF7 A;  1ZK8 A;  3BR6 A;  5J1U A;  2QCO A;  3RD3 A;  3C07 A;  2WGB A;  3TP3 A;  1QVT A;  3G1O A;  3VW2 A;  2G3B A;  3PM1 A;  2IU5 A;  5EFY A;  1RKW A;  4M3G A;  2ZCM A;  1U9N A;  2OI8 A;  3SDG A;  3ZQG A;  3Q0W A;  3HE0 A;  2VKV A;  2XB5 A;  4ICH A;  2NX4 A;  5FKL A;  2Y30 A;  4DW6 A;  2IAI A;  2DTZ A;  4L62 A;  5FHP A;  5F04 A;  4JKZ A;  3BJB A;  1UI6 A;  3IH4 A;  3VOK A;  2VPR A;  2ID6 A;  3BQZ A;  4W1U A;  2XRL A;  3VP5 A;  3BR1 A;  3O60 A;  3WHC A;  3JSJ A;  3FRQ A;  3DPJ A;  5IOZ A;  3ZQH A;  2UXP A;  3Q0U A;  3BR5 A;  1JUM A;  5GP9 A;  3VW0 A;  2HQ5 A;  4CGR A;  3VUQ A;  5IP6 A;  2D6Y A;  3BCG A;  2XGE A;  3G56 A;  3BTI A;  2TCT A;  2Y31 A;  4AC6 A;  5K7F A;  2NS7 A;  3DCF A;  4MO7 A;  3HGG A;  3VOX A;  5HAW A;  2X9D A;  2Y2Z A;  2FD5 A;  4KWA A;  2YVH A;  5FKK A;  2PZ9 A;  5D1R A;  3G7R A;  3LSP A;  3NXC A;  4M3D A;  1JUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...