2ZOYA

The multi-drug binding transcriptional repressor cgmr (cgl2612 protein) from c.glutamicum
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
175
structure length
175
Chain Sequence
MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The CGL2612 protein from Corynebacterium glutamicum is a drug resistance-related transcriptional repressor: structural and functional analysis of a newly identified transcription factor from genomic DNA analysis
pubmed doi rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Gene regulation
molecule keywords Transcriptional regulator
total genus 69
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zoyA00
2ZB9A 5GP9A 4M3FA 3VW2A 3G7RA 4MO7A 2VPRA 5FKKA 3BR1A 2ZCXA 2X9DA 3ANGA 2XPVA 3DEWA 2QWTA 3WHCA 5F0CA 2EH3A 5FMPA 1JT6A 2OF7A 2G7GA 3GZIA 3BTIA 2DG8A 4B1RA 3SFIA 3Q0UA 3BTJA 2OPTA 2QKOA 2FJ1A 3KKDA 3VP5A 1BJZA 5F0FA 4NELA 3IH3A 5DAJA 4AF5A 5EZGA 5K7FA 3CDLA 3EUPA 1JUSA 3TP0A 3VVXA 2UXPA 4MK6A 3HGYA 4ICHA 1U9NA 5K7HA 2OI8A 3FIWA 3LSPA 3LHQA 2G3BA 3HTAA 2F07A 1JTXA 3HIMA 3B81A 3VPRA 1RKWA 4I6ZA 3VUQA 2ID3A 3BCGA 3LSJA 5FKOA 2FQ4A 3VOXA 3LOCA 3ZQGA 2UXHA 3F1BA 1SGMA 2GFNA 3ZQIA 5F1JA 5D1RA 4NN1A 5F27A 5EZHA 2D6YA 5K58A 3IUVA 2G0EA 4GFKA 4DW6A 4X1EA 3NRGA 3QBMA 5GPAA 3V6GA 5IOZA 2OERA 2NP3A 3DCFA 1JUMA 3TP3A 4M3BA 3PM1A 2HYJA 1JTYA 2PBXA 2YVHA 4ACIA 3G1OA 3QQAA 3BQZA 2HXOA 5J1UA 3AQSA 3HTHA 2ZOZA 4PXIA 4CGRA 2QTQA 2FBQA 4AC0A 2QOPA 2QIBA 1Z0XA 3S5RA 3BNIA 3BQYA 4D7NA 2NX4A 2O7OA 2IU5A 2VKEA 3ZQFA 3HTJA 3LJLA 3NPIA 3T6NA 3BR6A 3BHQA 1T33A 3KKCA 2HQ5A 1VI0A 2FX0A 4W97A 2XPUA 2XRLA 3MVPA 3VIBA 3PASA 3IH4A 4G12A 5FKLA 3BR3A 3Q3SA 2WGBA 3P9TA 3CCYA 5EFYA 3O8GA 3BR0A 3NNRA 2XGCA 3PPBA 4ABZA 3BT9A 3FRQA 2G7SA 4MXMA 2IEKA 3E7QA 4GCKA 2X6OA 3IH2A 3ON2A 2DG7A 2FD5A 2G7LA 3VOKA 2TCTA 3LWJA 1Z77A 2V57A 4W1UA 2ZOYA 3RD3A 3G1MA 3RH2A 2I10A 3HE0A 3O60A 5IOYA 2XGDA 2ID6A 3CWRA 2NS8A 5D19A 2W53A 5J1RA 5GPCA 3Q0WA 2QCOA 3CJDA 5K7ZA 4JL3A 4M3GA 5FHPA 3G56A 4JNNA 3SDGA 3BTCA 3G1LA 3NXCA 1ZK8A 5CXIA 5F04A 3CRJA 3VW1A 3VW0A 1RKTA 3ZQHA 3BTLA 3C07A 5FGLA 4UDSA 4D5FA 1QVUA 1ORKA 2PZ9A 2XB5A 3AQTA 2RAEA 2HXIA 3BR5A 4L62A 3KZ9A 2NP5A 3NI7A 1UI5A 2RASA 5HAWA 3EGQA 4JYKA 2Y31A 3F0CA 3LSRA 2IAIA 5J1YA 2Y30A 3BR2A 3O8HA 4JKZA 3WHBA 5IPAA 2GBYA 5FKMA 1JUPA 5C4YA 4AC6A 3HTIA 3QKXA 5D18A 3FK7A 3MNLA 5FKNA 2RHAA 2VKVA 4M3EA 2YVEA 2WV1A 3JSJA 3V78A 4GCTA 3VVZA 5CXGA 2HKUA 1ZKGA 3HGGA 2Y2ZA 2GUHA 2ZCNA 2DTZA 2TRTA 2ZCMA 4XK4A 5H9TA 3DPJA 4GFLA 3C2BA 2JK3A 3VVYA 4B3AA 3ANPA 3ZQLA 4GCLA 1RPWA 3BJBA 1A6IA 2UXOA 5J3LA 3BRUA 5IP6A 2HYTA 4M3DA 2JJ7A 5F0HA 3COLA 5HSZA 3B6CA 4YZEA 2XGEA 3KNWA 3ON4A 3FK6A 2NS7A 2XDNA 2UXIA 2Q24A 4KWAA 2O7TA 4V2FA 5F08A 4V2GA 2XPWA 4HKUA 1T56A 2WUIA 5CW8A 2UXUA 5EYRA 3Q0VA 3B6AA 1QVTA 3QPLA 2GENA 4D7MA 5AQCA 4AUXA 4D5CA 2IBDA 5HBUA 2REKA 1UI6A 1U9OA 3GEUA 3QPSA 4ME9A 1QPIA 4I76A 1JT0A
chains in the Genus database with same CATH superfamily
2ZB9A 5GP9A 4OD4A 4M3FA 3VW2A 3G7RA 4MO7A 2VPRA 5FKKA 3BR1A 2ZCXA 2X9DA 3ANGA 2XPVA 3DEWA 4U9NA 2QWTA 3WHCA 2R7VA 5F0CA 2EH3A 3KYLA 5FMPA 1JT6A 2OF7A 2G7GA 3GZIA 3BTIA 2DG8A 4B1RA 3SFIA 3Q0UA 3BTJA 2OPTA 2QKOA 2FJ1A 3KKDA 3VP5A 1BJZA 5F0FA 4NELA 3IH3A 2ZY9A 5DAJA 4AF5A 5EZGA 5K7FA 3CDLA 3EUPA 1JUSA 3TP0A 3VVXA 2UXPA 4MK6A 3HGYA 4ICHA 1U9NA 5K7HA 2OI8A 3FIWA 3LSPA 3LHQA 2G3BA 3HTAA 2F07A 1JTXA 3HIMA 3B81A 3VPRA 1RKWA 4I6ZA 3VUQA 2ID3A 3BCGA 3LSJA 5FKOA 2FQ4A 3VOXA 3LOCA 3ZQGA 2UXHA 3F1BA 1SGMA 2GFNA 3ZQIA 5F1JA 5D1RA 4U9LA 4NN1A 5F27A 5EZHA 2D6YA 5K58A 3IUVA 2R7XA 2G0EA 4GFKA 4DW6A 4X1EA 3NRGA 3QBMA 5GPAA 3V6GA 5IOZA 2R7WA 2OERA 2NP3A 3DCFA 1JUMA 3TP3A 4M3BA 3PM1A 2HYJA 1JTYA 2PBXA 2YVHA 3DU5A 4ACIA 2PFVA 3G1OA 3QQAA 3BQZA 2HXOA 5J1UA 3AQSA 3HTHA 2ZOZA 2R7UA 2R7SA 4PXIA 4CGRA 2QTQA 3DU6A 2FBQA 4AC0A 2QOPA 2QIBA 1Z0XA 3S5RA 3BNIA 3BQYA 4D7NA 2NX4A 2O7OA 2IU5A 2VKEA 3ZQFA 2R7OA 3HTJA 3LJLA 3NPIA 3T6NA 3BR6A 3BHQA 1T33A 5CQGA 3KKCA 2HQ5A 1VI0A 2FX0A 4W97A 2XPUA 2XRLA 3MVPA 3VIBA 3PASA 3IH4A 4G12A 5FKLA 3NS4A 3BR3A 3Q3SA 2WGBA 3P9TA 3CCYA 5EFYA 3O8GA 3BR0A 3NNRA 2XGCA 3PPBA 4ABZA 3BT9A 3FRQA 2G7SA 4MXMA 2IEKA 3E7QA 4GCKA 2X6OA 3IH2A 3ON2A 2DG7A 2FD5A 2G7LA 3VOKA 2TCTA 3LWJA 1Z77A 2V57A 4W1UA 2ZOYA 3RD3A 3G1MA 3RH2A 2I10A 3HE0A 3O60A 5IOYA 2XGDA 2ID6A 3CWRA 2NS8A 5D19A 4DVYP 2W53A 5J1RA 5GPCA 3Q0WA 2QCOA 3CJDA 5K7ZA 4JL3A 4M3GA 2R7TA 5FHPA 3G56A 4JNNA 3SDGA 3BTCA 3G1LA 3NXCA 4IRVA 1ZK8A 5CXIA 5F04A 3CRJA 3VW1A 3VW0A 1RKTA 3ZQHA 2YVXA 3BTLA 3C07A 5FGLA 4UDSA 3SWHA 4D5FA 1QVUA 1ORKA 2PZ9A 2XB5A 3AQTA 2RAEA 2HXIA 3BR5A 4L62A 3KZ9A 2NP5A 3NI7A 1UI5A 2RASA 5HAWA 3EGQA 4JYKA 2Y31A 3F0CA 3LSRA 2IAIA 4C2MA 5J1YA 2Y30A 3BR2A 3O8HA 4JKZA 3WHBA 5IPAA 2GBYA 5FKMA 1JUPA 5C4YA 4AC6A 3HTIA 3QKXA 5D18A 3FK7A 3MNLA 5FKNA 2RHAA 2VKVA 4M3EA 3VTIA 2YVEA 2WV1A 3JSJA 3V78A 4GCTA 3VVZA 5CXGA 2HKUA 1ZKGA 3HGGA 2Y2ZA 2GUHA 2ZCNA 2DTZA 2TRTA 2ZCMA 4XK4A 5H9TA 3DPJA 4GFLA 2B1EA 3C2BA 2JK3A 3VVYA 4B3AA 3ANPA 3ZQLA 4GCLA 1RPWA 3BJBA 1A6IA 2UXOA 5J3LA 3BRUA 5IP6A 2R7QA 2HYTA 2FJI1 4M3DA 2JJ7A 5F0HA 3COLA 4WIBA 5HSZA 2R7RA 3B6CA 4YZEA 2XGEA 3KNWA 3ON4A 3FK6A 2NS7A 2XDNA 2UXIA 2Q24A 4KWAA 2O7TA 4V2FA 5F08A 4V2GA 2XPWA 4HKUA 1T56A 2A2FX 2WUIA 5CW8A 2UXUA 5EYRA 3Q0VA 3B6AA 1QVTA 3QPLA 2GENA 4D7MA 5AQCA 4AUXA 3FHNA 2B3WA 2IBDA 5HBUA 4D5CA 3K8PC 4OD5A 2REKA 1UI6A 1U9OA 3GEUA 3QPSA 4ME9A 1QPIA 4I76A 1JT0A
chains in the Genus database with same CATH topology
2ZB9A 5GP9A 4M3FA 3VW2A 3G7RA 4MO7A 2VPRA 5FKKA 3BR1A 2ZCXA 2X9DA 3ANGA 2XPVA 3DEWA 2QWTA 3WHCA 5F0CA 2EH3A 5FMPA 1JT6A 2OF7A 2G7GA 3GZIA 3BTIA 2DG8A 4B1RA 3SFIA 3Q0UA 3BTJA 2OPTA 2QKOA 2FJ1A 3KKDA 3VP5A 1BJZA 5F0FA 4NELA 3IH3A 5DAJA 4AF5A 5EZGA 5K7FA 3CDLA 3EUPA 1JUSA 3TP0A 3VVXA 2UXPA 4MK6A 3HGYA 4ICHA 1U9NA 5K7HA 2OI8A 3FIWA 3LSPA 3LHQA 2G3BA 3HTAA 2F07A 1JTXA 3HIMA 3B81A 3VPRA 1RKWA 4I6ZA 3VUQA 2ID3A 3BCGA 3LSJA 5FKOA 2FQ4A 3VOXA 3LOCA 3ZQGA 2UXHA 3F1BA 1SGMA 2GFNA 3ZQIA 5F1JA 5D1RA 4NN1A 5F27A 5EZHA 2D6YA 5K58A 3IUVA 2G0EA 4GFKA 4DW6A 4X1EA 3NRGA 3QBMA 5GPAA 3V6GA 5IOZA 2OERA 2NP3A 3DCFA 1JUMA 3TP3A 4M3BA 3PM1A 2HYJA 1JTYA 2PBXA 2YVHA 4ACIA 3G1OA 3QQAA 3BQZA 2HXOA 5J1UA 3AQSA 3HTHA 2ZOZA 4PXIA 4CGRA 2QTQA 2FBQA 4AC0A 2QOPA 2QIBA 1Z0XA 3S5RA 3BNIA 3BQYA 4D7NA 2NX4A 2O7OA 2IU5A 2VKEA 3ZQFA 3HTJA 3LJLA 3NPIA 3T6NA 3BR6A 3BHQA 1T33A 3KKCA 2HQ5A 1VI0A 2FX0A 4W97A 2XPUA 2XRLA 3MVPA 3VIBA 3PASA 3IH4A 4G12A 5FKLA 3BR3A 3Q3SA 2WGBA 3P9TA 3CCYA 5EFYA 3O8GA 3BR0A 3NNRA 2XGCA 3PPBA 4ABZA 3BT9A 3FRQA 2G7SA 4MXMA 2IEKA 3E7QA 4GCKA 2X6OA 3IH2A 3ON2A 2DG7A 2FD5A 2G7LA 3VOKA 2TCTA 3LWJA 1Z77A 2V57A 4W1UA 2ZOYA 3RD3A 3G1MA 3RH2A 2I10A 3HE0A 3O60A 5IOYA 2XGDA 2ID6A 3CWRA 2NS8A 5D19A 2W53A 5J1RA 5GPCA 3Q0WA 2QCOA 3CJDA 5K7ZA 4JL3A 4M3GA 5FHPA 3G56A 4JNNA 3SDGA 3BTCA 3G1LA 3NXCA 1ZK8A 5CXIA 5F04A 3CRJA 3VW1A 3VW0A 1RKTA 3ZQHA 3BTLA 3C07A 5FGLA 4UDSA 4D5FA 1QVUA 1ORKA 2PZ9A 2XB5A 3AQTA 2RAEA 2HXIA 3BR5A 4L62A 3KZ9A 2NP5A 3NI7A 1UI5A 2RASA 5HAWA 3EGQA 4JYKA 2Y31A 3F0CA 3LSRA 2IAIA 5J1YA 2Y30A 3BR2A 3O8HA 4JKZA 3WHBA 5IPAA 2GBYA 5FKMA 1JUPA 5C4YA 4AC6A 3HTIA 3QKXA 5D18A 3FK7A 3MNLA 5FKNA 2RHAA 2VKVA 4M3EA 2YVEA 2WV1A 3JSJA 3V78A 4GCTA 3VVZA 5CXGA 2HKUA 1ZKGA 3HGGA 2Y2ZA 2GUHA 2ZCNA 2DTZA 2TRTA 2ZCMA 4XK4A 5H9TA 3DPJA 4GFLA 3C2BA 2JK3A 3VVYA 4B3AA 3ANPA 3ZQLA 4GCLA 1RPWA 3BJBA 1A6IA 2UXOA 5J3LA 3BRUA 5IP6A 2HYTA 4M3DA 2JJ7A 5F0HA 3COLA 5HSZA 3B6CA 4YZEA 2XGEA 3KNWA 3ON4A 3FK6A 2NS7A 2XDNA 2UXIA 2Q24A 4KWAA 2O7TA 4V2FA 5F08A 4V2GA 2XPWA 4HKUA 1T56A 2WUIA 5CW8A 2UXUA 5EYRA 3Q0VA 3B6AA 1QVTA 3QPLA 2GENA 4D7MA 5AQCA 4AUXA 4D5CA 2IBDA 5HBUA 2REKA 1UI6A 1U9OA 3GEUA 3QPSA 4ME9A 1QPIA 4I76A 1JT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZB9 A;  5GP9 A;  4M3F A;  3VW2 A;  3G7R A;  4MO7 A;  2VPR A;  5FKK A;  3BR1 A;  2ZCX A;  2X9D A;  3ANG A;  2XPV A;  3DEW A;  2QWT A;  3WHC A;  5F0C A;  2EH3 A;  5FMP A;  1JT6 A;  2OF7 A;  2G7G A;  3GZI A;  3BTI A;  2DG8 A;  4B1R A;  3SFI A;  3Q0U A;  3BTJ A;  2OPT A;  2QKO A;  2FJ1 A;  3KKD A;  3VP5 A;  1BJZ A;  5F0F A;  4NEL A;  3IH3 A;  5DAJ A;  4AF5 A;  5EZG A;  5K7F A;  3CDL A;  3EUP A;  1JUS A;  3TP0 A;  3VVX A;  2UXP A;  4MK6 A;  3HGY A;  4ICH A;  1U9N A;  5K7H A;  2OI8 A;  3FIW A;  3LSP A;  3LHQ A;  2G3B A;  3HTA A;  2F07 A;  1JTX A;  3HIM A;  3B81 A;  3VPR A;  1RKW A;  4I6Z A;  3VUQ A;  2ID3 A;  3BCG A;  3LSJ A;  5FKO A;  2FQ4 A;  3VOX A;  3LOC A;  3ZQG A;  2UXH A;  3F1B A;  1SGM A;  2GFN A;  3ZQI A;  5F1J A;  5D1R A;  4NN1 A;  5F27 A;  5EZH A;  2D6Y A;  5K58 A;  3IUV A;  2G0E A;  4GFK A;  4DW6 A;  4X1E A;  3NRG A;  3QBM A;  5GPA A;  3V6G A;  5IOZ A;  2OER A;  2NP3 A;  3DCF A;  1JUM A;  3TP3 A;  4M3B A;  3PM1 A;  2HYJ A;  1JTY A;  2PBX A;  2YVH A;  4ACI A;  3G1O A;  3QQA A;  3BQZ A;  2HXO A;  5J1U A;  3AQS A;  3HTH A;  2ZOZ A;  4PXI A;  4CGR A;  2QTQ A;  2FBQ A;  4AC0 A;  2QOP A;  2QIB A;  1Z0X A;  3S5R A;  3BNI A;  3BQY A;  4D7N A;  2NX4 A;  2O7O A;  2IU5 A;  2VKE A;  3ZQF A;  3HTJ A;  3LJL A;  3NPI A;  3T6N A;  3BR6 A;  3BHQ A;  1T33 A;  3KKC A;  2HQ5 A;  1VI0 A;  2FX0 A;  4W97 A;  2XPU A;  2XRL A;  3MVP A;  3VIB A;  3PAS A;  3IH4 A;  4G12 A;  5FKL A;  3BR3 A;  3Q3S A;  2WGB A;  3P9T A;  3CCY A;  5EFY A;  3O8G A;  3BR0 A;  3NNR A;  2XGC A;  3PPB A;  4ABZ A;  3BT9 A;  3FRQ A;  2G7S A;  4MXM A;  2IEK A;  3E7Q A;  4GCK A;  2X6O A;  3IH2 A;  3ON2 A;  2DG7 A;  2FD5 A;  2G7L A;  3VOK A;  2TCT A;  3LWJ A;  1Z77 A;  2V57 A;  4W1U A;  2ZOY A;  3RD3 A;  3G1M A;  3RH2 A;  2I10 A;  3HE0 A;  3O60 A;  5IOY A;  2XGD A;  2ID6 A;  3CWR A;  2NS8 A;  5D19 A;  2W53 A;  5J1R A;  5GPC A;  3Q0W A;  2QCO A;  3CJD A;  5K7Z A;  4JL3 A;  4M3G A;  5FHP A;  3G56 A;  4JNN A;  3SDG A;  3BTC A;  3G1L A;  3NXC A;  1ZK8 A;  5CXI A;  5F04 A;  3CRJ A;  3VW1 A;  3VW0 A;  1RKT A;  3ZQH A;  3BTL A;  3C07 A;  5FGL A;  4UDS A;  4D5F A;  1QVU A;  1ORK A;  2PZ9 A;  2XB5 A;  3AQT A;  2RAE A;  2HXI A;  3BR5 A;  4L62 A;  3KZ9 A;  2NP5 A;  3NI7 A;  1UI5 A;  2RAS A;  5HAW A;  3EGQ A;  4JYK A;  2Y31 A;  3F0C A;  3LSR A;  2IAI A;  5J1Y A;  2Y30 A;  3BR2 A;  3O8H A;  4JKZ A;  3WHB A;  5IPA A;  2GBY A;  5FKM A;  1JUP A;  5C4Y A;  4AC6 A;  3HTI A;  3QKX A;  5D18 A;  3FK7 A;  3MNL A;  5FKN A;  2RHA A;  2VKV A;  4M3E A;  2YVE A;  2WV1 A;  3JSJ A;  3V78 A;  4GCT A;  3VVZ A;  5CXG A;  2HKU A;  1ZKG A;  3HGG A;  2Y2Z A;  2GUH A;  2ZCN A;  2DTZ A;  2TRT A;  2ZCM A;  4XK4 A;  5H9T A;  3DPJ A;  4GFL A;  3C2B A;  2JK3 A;  3VVY A;  4B3A A;  3ANP A;  3ZQL A;  4GCL A;  1RPW A;  3BJB A;  1A6I A;  2UXO A;  5J3L A;  3BRU A;  5IP6 A;  2HYT A;  4M3D A;  2JJ7 A;  5F0H A;  3COL A;  5HSZ A;  3B6C A;  4YZE A;  2XGE A;  3KNW A;  3ON4 A;  3FK6 A;  2NS7 A;  2XDN A;  2UXI A;  2Q24 A;  4KWA A;  2O7T A;  4V2F A;  5F08 A;  4V2G A;  2XPW A;  4HKU A;  1T56 A;  2WUI A;  5CW8 A;  2UXU A;  5EYR A;  3Q0V A;  3B6A A;  1QVT A;  3QPL A;  2GEN A;  4D7M A;  5AQC A;  4AUX A;  4D5C A;  2IBD A;  5HBU A;  2REK A;  1UI6 A;  1U9O A;  3GEU A;  3QPS A;  4ME9 A;  1QPI A;  4I76 A;  1JT0 A; 
#chains in the Genus database with same CATH topology
 2ZB9 A;  5GP9 A;  4OD4 A;  4M3F A;  3VW2 A;  3G7R A;  4MO7 A;  2VPR A;  5FKK A;  3BR1 A;  2ZCX A;  2X9D A;  3ANG A;  2XPV A;  3DEW A;  4U9N A;  2QWT A;  3WHC A;  2R7V A;  5F0C A;  2EH3 A;  3KYL A;  5FMP A;  1JT6 A;  2OF7 A;  2G7G A;  3GZI A;  3BTI A;  2DG8 A;  4B1R A;  3SFI A;  3Q0U A;  3BTJ A;  2OPT A;  2QKO A;  2FJ1 A;  3KKD A;  3VP5 A;  1BJZ A;  5F0F A;  4NEL A;  3IH3 A;  2ZY9 A;  5DAJ A;  4AF5 A;  5EZG A;  5K7F A;  3CDL A;  3EUP A;  1JUS A;  3TP0 A;  3VVX A;  2UXP A;  4MK6 A;  3HGY A;  4ICH A;  1U9N A;  5K7H A;  2OI8 A;  3FIW A;  3LSP A;  3LHQ A;  2G3B A;  3HTA A;  2F07 A;  1JTX A;  3HIM A;  3B81 A;  3VPR A;  1RKW A;  4I6Z A;  3VUQ A;  2ID3 A;  3BCG A;  3LSJ A;  5FKO A;  2FQ4 A;  3VOX A;  3LOC A;  3ZQG A;  2UXH A;  3F1B A;  1SGM A;  2GFN A;  3ZQI A;  5F1J A;  5D1R A;  4U9L A;  4NN1 A;  5F27 A;  5EZH A;  2D6Y A;  5K58 A;  3IUV A;  2R7X A;  2G0E A;  4GFK A;  4DW6 A;  4X1E A;  3NRG A;  3QBM A;  5GPA A;  3V6G A;  5IOZ A;  2R7W A;  2OER A;  2NP3 A;  3DCF A;  1JUM A;  3TP3 A;  4M3B A;  3PM1 A;  2HYJ A;  1JTY A;  2PBX A;  2YVH A;  3DU5 A;  4ACI A;  2PFV A;  3G1O A;  3QQA A;  3BQZ A;  2HXO A;  5J1U A;  3AQS A;  3HTH A;  2ZOZ A;  2R7U A;  2R7S A;  4PXI A;  4CGR A;  2QTQ A;  3DU6 A;  2FBQ A;  4AC0 A;  2QOP A;  2QIB A;  1Z0X A;  3S5R A;  3BNI A;  3BQY A;  4D7N A;  2NX4 A;  2O7O A;  2IU5 A;  2VKE A;  3ZQF A;  2R7O A;  3HTJ A;  3LJL A;  3NPI A;  3T6N A;  3BR6 A;  3BHQ A;  1T33 A;  5CQG A;  3KKC A;  2HQ5 A;  1VI0 A;  2FX0 A;  4W97 A;  2XPU A;  2XRL A;  3MVP A;  3VIB A;  3PAS A;  3IH4 A;  4G12 A;  5FKL A;  3NS4 A;  3BR3 A;  3Q3S A;  2WGB A;  3P9T A;  3CCY A;  5EFY A;  3O8G A;  3BR0 A;  3NNR A;  2XGC A;  3PPB A;  4ABZ A;  3BT9 A;  3FRQ A;  2G7S A;  4MXM A;  2IEK A;  3E7Q A;  4GCK A;  2X6O A;  3IH2 A;  3ON2 A;  2DG7 A;  2FD5 A;  2G7L A;  3VOK A;  2TCT A;  3LWJ A;  1Z77 A;  2V57 A;  4W1U A;  2ZOY A;  3RD3 A;  3G1M A;  3RH2 A;  2I10 A;  3HE0 A;  3O60 A;  5IOY A;  2XGD A;  2ID6 A;  3CWR A;  2NS8 A;  5D19 A;  4DVY P;  2W53 A;  5J1R A;  5GPC A;  3Q0W A;  2QCO A;  3CJD A;  5K7Z A;  4JL3 A;  4M3G A;  2R7T A;  5FHP A;  3G56 A;  4JNN A;  3SDG A;  3BTC A;  3G1L A;  3NXC A;  4IRV A;  1ZK8 A;  5CXI A;  5F04 A;  3CRJ A;  3VW1 A;  3VW0 A;  1RKT A;  3ZQH A;  2YVX A;  3BTL A;  3C07 A;  5FGL A;  4UDS A;  3SWH A;  4D5F A;  1QVU A;  1ORK A;  2PZ9 A;  2XB5 A;  3AQT A;  2RAE A;  2HXI A;  3BR5 A;  4L62 A;  3KZ9 A;  2NP5 A;  3NI7 A;  1UI5 A;  2RAS A;  5HAW A;  3EGQ A;  4JYK A;  2Y31 A;  3F0C A;  3LSR A;  2IAI A;  4C2M A;  5J1Y A;  2Y30 A;  3BR2 A;  3O8H A;  4JKZ A;  3WHB A;  5IPA A;  2GBY A;  5FKM A;  1JUP A;  5C4Y A;  4AC6 A;  3HTI A;  3QKX A;  5D18 A;  3FK7 A;  3MNL A;  5FKN A;  2RHA A;  2VKV A;  4M3E A;  3VTI A;  2YVE A;  2WV1 A;  3JSJ A;  3V78 A;  4GCT A;  3VVZ A;  5CXG A;  2HKU A;  1ZKG A;  3HGG A;  2Y2Z A;  2GUH A;  2ZCN A;  2DTZ A;  2TRT A;  2ZCM A;  4XK4 A;  5H9T A;  3DPJ A;  4GFL A;  2B1E A;  3C2B A;  2JK3 A;  3VVY A;  4B3A A;  3ANP A;  3ZQL A;  4GCL A;  1RPW A;  3BJB A;  1A6I A;  2UXO A;  5J3L A;  3BRU A;  5IP6 A;  2R7Q A;  2HYT A;  2FJI 1;  4M3D A;  2JJ7 A;  5F0H A;  3COL A;  4WIB A;  5HSZ A;  2R7R A;  3B6C A;  4YZE A;  2XGE A;  3KNW A;  3ON4 A;  3FK6 A;  2NS7 A;  2XDN A;  2UXI A;  2Q24 A;  4KWA A;  2O7T A;  4V2F A;  5F08 A;  4V2G A;  2XPW A;  4HKU A;  1T56 A;  2A2F X;  2WUI A;  5CW8 A;  2UXU A;  5EYR A;  3Q0V A;  3B6A A;  1QVT A;  3QPL A;  2GEN A;  4D7M A;  5AQC A;  4AUX A;  3FHN A;  2B3W A;  2IBD A;  5HBU A;  4D5C A;  3K8P C;  4OD5 A;  2REK A;  1UI6 A;  1U9O A;  3GEU A;  3QPS A;  4ME9 A;  1QPI A;  4I76 A;  1JT0 A; 
#chains in the Genus database with same CATH homology
 2ZB9 A;  5GP9 A;  4M3F A;  3VW2 A;  3G7R A;  4MO7 A;  2VPR A;  5FKK A;  3BR1 A;  2ZCX A;  2X9D A;  3ANG A;  2XPV A;  3DEW A;  2QWT A;  3WHC A;  5F0C A;  2EH3 A;  5FMP A;  1JT6 A;  2OF7 A;  2G7G A;  3GZI A;  3BTI A;  2DG8 A;  4B1R A;  3SFI A;  3Q0U A;  3BTJ A;  2OPT A;  2QKO A;  2FJ1 A;  3KKD A;  3VP5 A;  1BJZ A;  5F0F A;  4NEL A;  3IH3 A;  5DAJ A;  4AF5 A;  5EZG A;  5K7F A;  3CDL A;  3EUP A;  1JUS A;  3TP0 A;  3VVX A;  2UXP A;  4MK6 A;  3HGY A;  4ICH A;  1U9N A;  5K7H A;  2OI8 A;  3FIW A;  3LSP A;  3LHQ A;  2G3B A;  3HTA A;  2F07 A;  1JTX A;  3HIM A;  3B81 A;  3VPR A;  1RKW A;  4I6Z A;  3VUQ A;  2ID3 A;  3BCG A;  3LSJ A;  5FKO A;  2FQ4 A;  3VOX A;  3LOC A;  3ZQG A;  2UXH A;  3F1B A;  1SGM A;  2GFN A;  3ZQI A;  5F1J A;  5D1R A;  4NN1 A;  5F27 A;  5EZH A;  2D6Y A;  5K58 A;  3IUV A;  2G0E A;  4GFK A;  4DW6 A;  4X1E A;  3NRG A;  3QBM A;  5GPA A;  3V6G A;  5IOZ A;  2OER A;  2NP3 A;  3DCF A;  1JUM A;  3TP3 A;  4M3B A;  3PM1 A;  2HYJ A;  1JTY A;  2PBX A;  2YVH A;  4ACI A;  3G1O A;  3QQA A;  3BQZ A;  2HXO A;  5J1U A;  3AQS A;  3HTH A;  2ZOZ A;  4PXI A;  4CGR A;  2QTQ A;  2FBQ A;  4AC0 A;  2QOP A;  2QIB A;  1Z0X A;  3S5R A;  3BNI A;  3BQY A;  4D7N A;  2NX4 A;  2O7O A;  2IU5 A;  2VKE A;  3ZQF A;  3HTJ A;  3LJL A;  3NPI A;  3T6N A;  3BR6 A;  3BHQ A;  1T33 A;  3KKC A;  2HQ5 A;  1VI0 A;  2FX0 A;  4W97 A;  2XPU A;  2XRL A;  3MVP A;  3VIB A;  3PAS A;  3IH4 A;  4G12 A;  5FKL A;  3BR3 A;  3Q3S A;  2WGB A;  3P9T A;  3CCY A;  5EFY A;  3O8G A;  3BR0 A;  3NNR A;  2XGC A;  3PPB A;  4ABZ A;  3BT9 A;  3FRQ A;  2G7S A;  4MXM A;  2IEK A;  3E7Q A;  4GCK A;  2X6O A;  3IH2 A;  3ON2 A;  2DG7 A;  2FD5 A;  2G7L A;  3VOK A;  2TCT A;  3LWJ A;  1Z77 A;  2V57 A;  4W1U A;  2ZOY A;  3RD3 A;  3G1M A;  3RH2 A;  2I10 A;  3HE0 A;  3O60 A;  5IOY A;  2XGD A;  2ID6 A;  3CWR A;  2NS8 A;  5D19 A;  2W53 A;  5J1R A;  5GPC A;  3Q0W A;  2QCO A;  3CJD A;  5K7Z A;  4JL3 A;  4M3G A;  5FHP A;  3G56 A;  4JNN A;  3SDG A;  3BTC A;  3G1L A;  3NXC A;  1ZK8 A;  5CXI A;  5F04 A;  3CRJ A;  3VW1 A;  3VW0 A;  1RKT A;  3ZQH A;  3BTL A;  3C07 A;  5FGL A;  4UDS A;  4D5F A;  1QVU A;  1ORK A;  2PZ9 A;  2XB5 A;  3AQT A;  2RAE A;  2HXI A;  3BR5 A;  4L62 A;  3KZ9 A;  2NP5 A;  3NI7 A;  1UI5 A;  2RAS A;  5HAW A;  3EGQ A;  4JYK A;  2Y31 A;  3F0C A;  3LSR A;  2IAI A;  5J1Y A;  2Y30 A;  3BR2 A;  3O8H A;  4JKZ A;  3WHB A;  5IPA A;  2GBY A;  5FKM A;  1JUP A;  5C4Y A;  4AC6 A;  3HTI A;  3QKX A;  5D18 A;  3FK7 A;  3MNL A;  5FKN A;  2RHA A;  2VKV A;  4M3E A;  2YVE A;  2WV1 A;  3JSJ A;  3V78 A;  4GCT A;  3VVZ A;  5CXG A;  2HKU A;  1ZKG A;  3HGG A;  2Y2Z A;  2GUH A;  2ZCN A;  2DTZ A;  2TRT A;  2ZCM A;  4XK4 A;  5H9T A;  3DPJ A;  4GFL A;  3C2B A;  2JK3 A;  3VVY A;  4B3A A;  3ANP A;  3ZQL A;  4GCL A;  1RPW A;  3BJB A;  1A6I A;  2UXO A;  5J3L A;  3BRU A;  5IP6 A;  2HYT A;  4M3D A;  2JJ7 A;  5F0H A;  3COL A;  5HSZ A;  3B6C A;  4YZE A;  2XGE A;  3KNW A;  3ON4 A;  3FK6 A;  2NS7 A;  2XDN A;  2UXI A;  2Q24 A;  4KWA A;  2O7T A;  4V2F A;  5F08 A;  4V2G A;  2XPW A;  4HKU A;  1T56 A;  2WUI A;  5CW8 A;  2UXU A;  5EYR A;  3Q0V A;  3B6A A;  1QVT A;  3QPL A;  2GEN A;  4D7M A;  5AQC A;  4AUX A;  4D5C A;  2IBD A;  5HBU A;  2REK A;  1UI6 A;  1U9O A;  3GEU A;  3QPS A;  4ME9 A;  1QPI A;  4I76 A;  1JT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...