2ZP8A

The nature of the trap:anti-trap complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
b'SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein mtrB
publication title The nature of the TRAP-Anti-TRAP complex.
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Rna binding protein/transcription
total genus 11
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 2zp8A00
1UTDA 2ZD0A 5EEXA 5EEWA 3ZZQA 5EF1A 3ZTEA 3AQDA 4B27A 5EF0A 5EF3A 1WAPA 5EEVA 2EXSA 5EF2A 5EEZA 2EXTA 5EEYA 2ZP8A 1GTNA 3ZZSA 1GTFA 1QAWA 5EEUA 3ZZLA 2ZP9A 2ZCZA 1C9SA
chains in the Genus database with same CATH superfamily
2HRHA 1F3JA 3O9WD 2PF6A 5I74C 4R83A 5IJBC 3Q5TA 3DIFA 3BUYA 1FAIL 4KAQH 3HI1A 4X6BA 3B43A 3DV4A 3GUTB 4L0ZA 4L8SA 1TENA 1G87A 3TBWB 4PWEA 1DLHB 3IS1X 1PY4A 3JVGC 4Y1AE 2B77A 4PY7A 3PE9A 1R4XA 1R0AH 1EHLH 1OY3B 4RSVA 5H35A 4ZOBA 4XNZB 1BQHB 4XOAA 1N64H 3KYKL 5IOPA 3TVMA 5AL8A 4AQAB 1TIUA 4ZAKA 2DQDH 5DZLA 2YBGA 1QLRA 3ROLA 3KBPA 2P7TA 3CH1A 1RU9H 2ZXCA 5C9JA 2WQ8A 3LN4B 4BZ2H 4PYGA 4EI6B 5K1NA 1TZIB 4Y4HD 5E4EC 4JFHD 1TJIH 3A5VA 1HI6A 5CZVH 2P8LB 4P2QD 3WSQL 4JVPA 2X9XA 3S3SA 1PZUB 4NQSB 5CEZD 1EEUA 4O2EA 3L2NA 1CLYL 1Q9KB 4A2DA 3V5DB 1JPTL 3CPLB 2J6EA 4BKLB 4A6YH 1HU8A 3OAYH 3RTQC 5BV7L 3W39A 5I73B 3DMMC 4IIQA 1KJ3H 3WJLA 3HA0A 2WBXA 3RNQB 3HAEB 4AYSA 1DVUA 3HMWL 4LSPL 5EU5B 1OAUH 3VG0H 4FNPA 3MMEB 4KVCL 2DIAA 3UG4A 1KTJA 4I3RH 3SKJL 3LZQA 4X0KB 5IT2L 4KU1A 2C9XA 5FS5A 2GT9B 4O5LH 5AW5B 3QI9D 4ACTA 1ASPA 5ANME 4LCWA 5HJGA 1D7BA 1I9JL 2ZKWA 1MHCA 1BOGB 3I6SA 2PO6B 6TAAA 1FNSH 1NFDE 1GGYA 4KKBC 1MAKA 4NC0B 4A38A 2IAMB 5I75B 4NB7A 1ZV2A 2GJ6B 2K3HA 4H8WL 4G83A 2O5YL 4Q74A 3S35H 5INDB 2UZXB 3O2WL 1V3MA 1JMXA 2FYYA 4MB3A 2YD2A 2K9FB 2OMVB 3MLTB 1CK0L 4G9DA 3LKNB 5LBSL 3I74A 5IHUH 2C7UB 1Z0NA 2EDKA 4KHTH 1YAZA 1DCEA 1HZLA 1PD6A 1IM9A 1CUOA 3MRIA 3DVGB 1FE8H 4CSTA 4L5FE 4R4BB 4KKCC 4Q8BA 4YXKH 1WBZB 4ZFGH 4GY4A 5BRQA 4Z7NE 2OZ4L 1BX2B 4FZEL 2NY1C 4MD0B 2LFGA 2NXZB 2J7LA 4AXWA 1BYOA 1GA2A 3IKCA 2O61B 1WFUA 5TQ2H 2MCPL 1S7SA 4B53A 4XCEA 1F4HA 4BZ1L 3K2IA 4OV5A 2OMZB 5CJQL 2WXQA 4DN4L 1M71B 2WZ0A 2FAUA 2FX9H 1G9NL 4I2XA 4O02B 4JKPH 1CVSC 3GSXB 1F6AA 3ZDYF 3WY4A 2DAVA 3E2HC 2WLZA 3QJOA 5G4NA 3RUGE 1SN5A 4HCRA 2MWCA 4FKEA 1Q94B 4LVNB 5ESAB 1WT5A 4XXWC 1AKPA 4GLRH 2PETA 2QVMA 5BQDA 5A3IC 1VKXA 1LEIB 5F7DB 5HGBB 4AGNA 3BUIA 3DRQA 5C6PB 3PQYA 1ZPLA 1BJ1J 1GY2A 2VT0A 3P02A 2R4SL 1J9TA 4APQA 1MRCL 1BIIB 4R7NB 3GI8L 3TEWA 4X6DF 5DFAA 1KXTB 2MCAA 5AKRA 4AMXA 4MVBC 4HK3N 5CSZB 5FOBA 2WTOA 3N91A 1NUFA 4TUOB 4BE6A 1N7ML 1XGQB 3QJVB 3QHFL 3BDYH 3UABA 3O4LD 3T2LA 2DLHA 4HF5L 5D8JL 1DSFH 4QCIA 3VXRE 3BDBA 3QZLA 1Q9LB 3MJWA 5DK0B 1A8ZA 3MLVH 4KK5D 1F3RB 4LXFA 4JPWH 3ZHKA 2NXYB 3B3BA 1FV1A 1RULL 1SLUA 1T1XA 5EOQL 1IC4H 5D2NB 5PAZA 2EDEA 4CADB 2H32A 1NEUA 1LK2A 1O0VA 2GTWA 1OTUC 1VZIA 4Q58C 1NGXB 4S0SD 4YHNA 3RNKB 2AHIA 3ZPDA 5BMFH 1CDJA 3MLUL 3NSDA 4FFYL 4HPHA 5F88A 3TEXA 4M02A 4X9IA 3ES6A 3ZJAA 3D12B 3KR3H 4PCSA 4TNGA 3KCPA 3DVIA 1A6VL 4WW1B 3GS0A 2KL6A 3QR2A 3GLZA 1PEWA 2AQPA 5D1XE 1Q9OB 2H8PA 3CFUA 1D6EA 2HVBA 3G5VA 3BZEB 2VDQL 4W6XB 3PDGA 4F5CE 2YGVA 4GMSH 2D7TH 8PAZA 1T03L 4OZHB 4JHBA 1DQQA 1B3JA 5B1KA 2V5YA 4X8CA 3KYMB 2PYEE 3PGDA 3IETB 1HZHL 4GP5B 3QZPA 4MCMA 1OF0A 1A4KB 4XPBL 1Y7VA 4KDWA 4ZPVB 2HCZX 2F8XC 1MOEA 4WO4A 4YDLC 1J10A 2DN7A 4EUPG 2ZF8A 5BRZE 1T83C 4LF3A 4N8VA 1UGNA 2XJKA 3QDHA 4PJAB 4K94C 4PJXB 3U4BL 3WIHL 2OFQA 2R56L 1ETJA 4AYDC 1YG9A 2GW5A 4X7TB 2XN9A 4NQTA 3CN4A 2XKNB 2P5WA 2W5PA 3KVDD 4B6ZA 5B3SB 4PTUA 4L29A 5FYJL 1AXSA 5F21B 3D33A 4LMQI 4CC0A 1A1OA 3RWEB 4AIXA 4NZJA 4U6YB 1JPFA 4BV1A 4ENEC 2W81C 5EUOA 2WP3T 1SBBA 4KJYB 1FDLL 4RETB 3KPMB 4MB5A 1G7IB 3K6SB 2F61A 1P84J 3K0WA 4Z7VE 1UXLA 5EZLA 1LE9A 1YEDA 2XWZA 1NWOA 3CLWA 1CGSL 4M5ZH 1I3RA 2BVPA 1URZA 1G7JB 3UBXG 3UL4A 1QFWL 1DFBL 1A9EB 4XCFH 1KJ2H 5E95B 2I69A 1AHWC 5CS7A 3ARGD 1WFTA 4U6TA 3CHQA 3OKNA 1XGRA 2ITEA 4FNLH 4LAJH 3PP3H 1J12A 1ZHLB 4DAGH 3LDBB 4WCYL 4B3VA 3MV11 3QDMB 3FC8A 4UQCA 1O7DC 3ESVF 5CJXA 1T80A 2ORBL 1J1OL 5HGGS 5DMJB 1XVSA 3SGKA 5L2KA 2IMMA 3RWIB 3IJSB 1U21A 1EDHA 3E1F1 4HIHB 3DBSA 2CCVA 4KXZH 5EF1A 3FQWB 4C4BA 4NZTH 2X89D 4YHKL 3CU1A 5K9JH 4BDVB 1I53A 1R5WA 1CU4H 1YEJL 4PVMA 4WLCA 1LP9A 5LDSA 4L0PB 5AKTA 5JXEA 5J11B 1A1NA 4JN1L 1NLDH 2WWOA 4D8PB 3S48A 2V9TA 5GGQH 5TFSL 3M8OH 4MA3B 3T04D 2Q3AA 3UADA 5LWYH 5FUOH 1BD2B 2WIMA 4UQAA 2IDUA 3Q2VA 3C6LD 4NAQA 4NNYB 4U1NA 2I9LA 3Q2NA 2MJWA 3MRKB 3N40P 5KVFE 3VE0A 1I7RA 1TTCA 1KC5L 4UDTA 1A7QH 3X13B 4Z78A 3JV5A 4KV5E 3QYCA 3SHSA 3DNKA 4LFHG 5CLWA 1X9RA 5D7JC 4I3SL 4B96A 1OCZB 2YQ3A 3M7FB 3QS3A 4LSTL 5KJ4A 4XO8A 2XOTA 3SO5A 2AK4D 4UTAH 1AGCB 5F7AA 3OAWA 3FU3A 4N20A 3HR5A 4A7QA 2X0WA 5JOFA 1MCEA 1BEYH 1VGKB 1YUHB 4FQXA 1EO8L 4HIXL 3RL2B 3BWAA 4NI3A 1A3ZA 1ETB1 2CXKA 5I1KH 3DXAE 2VR9A 5IROA 2WCSA 1F4YH 2ZYSA 4QKXB 5CUSL 1S9WA 1G7HA 2MHAB 3QGVA 2V8MA 2HRPH 5KSAD 1NMAH 2DBJA 4A2MA 5EZOH 2ZKMX 4JPIA 1SXCA 3MV01 3BCFA 4LNRB 3MHZA 3L9RB 1EZSA 1K72A 4C47A 3G6AA 4F9PC 1IKFH 3SJVD 4FADA 3TEYA 1I1YA 1UA7A 2ZOKA 4KI5C 4XC1H 3RPBA 1IGJB 1ZS2A 5KN5A 1D9KD 1YPZF 1NFDA 1SEQL 1KLFA 1PGRB 2IADB 1FJ1A 2ZXWB 3CN1A 3LKOB 4L37B 2JB5L 3MLSL 1MW0A 3EJUA 4IJ3B 4FNTA 5D7SL 3V9CA 3LVTA 3NJIA 3I9PA 4OLXH 5ABAA 2X10A 2H26A 3ZT6A 4DUVA 1K3IA 5H4ZA 2X2IA 3DDFA 3ILPB 4NQCE 1FFPB 2OJ1A 4WEEA 3ARZA 1DBBL 1DQML 2Q5BA 1KY7A 4FLHA 3VWJB 2FQEA 3GHEL 2J1WA 2GBUA 4KI1A 4ELMF 5JIIA 2BVYA 3EYVB 5JLZB 4KZEL 4PRAA 3RIFF 2W91A 4MD4A 3RWFA 4HFUH 3OJDA 5JHLL 5E5UB 2N1TE 4DVBB 3V0DA 3ZQ9A 4KTDH 3DUUA 4UT7H 2CBPA 1AJ7H 4PBVC 2ZKHH 1UJTA 1OCRB 1EWHA 4ODUB 3T2QA 2WQRA 3MBWA 1NOAA 1B6DA 2P8MB 2DQ6A 4LLQA 1TFHA 3EG9A 3UYPA 3LXUX 5BW7A 3B6SB 1RSFA 2YAQA 3TYFB 3FH5A 1A9VA 1U95A 2ZE0A 4JZJB 4OIFA 4FCHA 5JPNB 1IQWH 3KH3A 1BZEA 4LLDA 1JNLH 4I9XA 4QOKB 3ZE2B 4I88A 2QDWA 3BPLC 4P4KB 1BIHA 1R19A 1CCZA 3NCEB 4MKTA 3ISRA 2C1OA 3QDGB 4NHUA 2J5LC 5CAYB 1A2YB 1UB5A 2NUTB 5IVXA 2O5XL 3H2PA 3BP5A 2OL3L 2HLEB 3ZHFA 5D70L 3P3SA 3EJYC 1QTSA 4NOBA 2H2SD 4Y4FB 1J8SA 2AV1B 1DDHA 1K4CA 4LQFL 4C54A 4ECNA 5DSCB 4DO5A 2IG2H 4FI8A 1R5IA 3O6LL 1DVFB 4DP9X 2LGNA 5HHOD 1ID5I 2BP3A 3EFOB 5LXGL 1HQ4A 2VL5A 3GDCA 4JFFA 3JV6B 3HCVB 3WEMA 3TBSB 1EQWA 3F83A 2H3NA 3DETC 5K9OB 5CFHA 2FATH 5LJYH 2XRAL 1JIBA 2VLKB 3MRQA 1T4KB 4LLUA 5TGBB 1HEJC 1ETA1 2X4OB 4TSCH 3VG9B 5B8CA 4B9KC 4LDLB 4UT6L 6FABH 1FO0L 2CO7B 4D9LL 1INDH 2VDKH 1MEXH 3LV3B 1UXSA 1DBMH 2C9PA 2DF3A 2EIJB 3OLIA 3RKDC 4BUQA 2MNUA 1U8QB 1E4WL 2XN2A 1M1SA 5DYOB 2CUAA 2DRUA 3MXWH 3FQYA 3QS2A 3Q13A 3C5ZA 4L8SC 1R3LB 3FQXA 3PWUA 5DK3A 1SJXA 3WNLA 2I9TB 1ZT1A 4E41E 1M1XA 4IOSA 4XCCL 3TT3H 4OJFL 2QTEA 2UYLA 3UTSB 1E5BA 3WKML 3MLYL 5FCUL 2OR9L 1KJVB 3D6GA 5FGCB 4TVPL 1DVXA 4S1SH 5DDHA 3TVMC 4FFVD 4AGPA 4XBGA 3G6JF 1TQBB 4N24A 4ZAKC 1U42A 3TV3H 2MNJB 5I5JA 3WN5A 5DQ9B 3TU6A 5L4JA 2XXFA 1IQDA 2ZAIA 3WS3A 1R3KA 4L4TA 1OAKL 2Y3NA 4X80L 4YDIH 1M9SA 3CG8A 1VACA 4WNSA 4HMDA 4HUUA 3RI5K 4F80A 4FLQA 3IDXH 4AY0A 3MV8B 1MSPA 1NGYA 2CO6B 3N0PB 4JY5L 4PRHB 3EYFA 3HMXH 5KYUA 5CKAA 1OVZA 2JB6B 4J12A 2BIOA 4IHOA 3LHPL 2PO6D 2GHWB 2CGYA 4JRWA 4OCWL 3GSUA 1GS7A 2IAMD 2VRQA 2GJ6D 2AQNA 3GB7B 1GS8A 2XYCA 3CHOA 3MNZA 4PWFA 1X7QB 4U6XB 5IP4A 3BRDA 4KJWD 4PV9B 2OX5A 2ZWSA 4IIQC 1Z1WA 1K6QL 3HC3H 1KNOB 3D8MA 1CGVA 2BVOA 5ANHA 3MLXH 4NZFA 2X5PA 2XIIA 3BHBB 3F6LA 1EXHA 2VDRL 2HT4D 5B22A 2DWDB 5FO7A 1FVDA 4ABVA 4ZFOA 3VXUE 3F8UB 3TT1L 2LFEA 4FL4C 5CP3H 5LCVA 4NQXB 3BD3A 1MFBL 4CA4A 4NKIH 4CC4A 4IRJC 5E8OA 3NRPA 4PUBH 4L4JA 3T9WA 2NXZD 3ZT5A 1D2OA 1S7WA 32C2B 5KYWB 3JTTA 5I18H 3FF7A 3QXWA 4W4OC 4WNQA 1NFAA 2ZPKH 4Z18A 3QG7H 3ARRA 3QIBC 4JRFA 5CJ8A 4JO2H 1UYWH 2EDOA 4P46B 4P9MH 1E0OB 4QEGA 4XP6H 4WIQA 1MCCA 1P4UA 4X5LA 4OJEH 4JFOB 1R3JA 2X4TA 5DMGC 1OCWL 1MJJB 3BAKA 3E9TA 4FHJA 1E3XA 4XP4L 4HLJA 4Z7WB 3AFLA 5D6CA 3VXOA 3QULA 3UJIL 3QUYB 3UYRL 4PGEA 1EK3A 4HJ0C 2ODIA 5TE6L 4CVWA 1KEML 3LD8C 4ZX3A 4LDEB 1VF5C 2AK1H 4NSKA 4PJHE 4C4KO 4A7SA 1JP5A 3V2AR 1LO4L 3RTLA 3BWZA 3GGWB 5F9OL 4Y8DC 4LKXA 2VITA 3OKOA 3R7RA 1KPRB 1SHXA 2AEOA 4FTVA 2WXOA 5AB9A 1QBLL 3N43F 3A0OA 3MCLL 2AF2A 4KMTH 4LPWA 4HEPA 5E6IA 4XRCA 3KEHA 1G43A 3QCUL 1FI8C 1IC7L 1QFOA 3RURA 2BNQA 4S2SB 1TCMA 2NXYD 4D0BA 3KJ6L 3T65A 4MMYA 3QUZB 1P0SE 1X9UA 1XCTA 3GJFA 1NGWB 3C09B 3MJ7B 2CHDA 2QQLL 4MWFB 3FQ4A 4UZSA 5FV2A 3RDTB 4PGDA 4PRDB 3ABZA 3PWPE 3VFOB 3BKMH 4LLAA 1CQKA 3ALXA 2P44B 3GXIA 2XZCH 4MA8H 3H4FA 5CCGE 3E80A 2NLJB 4PU2A 1GSMA 3GMMB 4Y5VC 3WU1A 5DMIL 4HS3A 4FLRA 1UJ3C 2Y1VA 4M00A 3ISYA 1VERA 2OZNA 3EGXB 4QPEA 2HPTA 2MQGA 5C0AE 1HCZA 2BMKA 3T4YB 1NC4A 2G4EA 4BKSC 4AQ1B 3QQ9C 4KDTC 2BIMA 2EO7A 5KVGE 1CXFA 5LBGA 4R0LC 5LLIC 1QLEL 2R2BB 1RFDL 2LLGA 4ODTH 4OF3A 5KVDE 1ODAA 1IIIA 1X4ZA 1IGTB 1P69B 1BZ7B 4L3EE 4KK8D 3G04A 3DK2A 3KPQA 3HC0A 1UQSB 3LNEA 2NR6D 4NQEA 4ZNEA 1XFPA 3FQNB 5ABDE 2QHRL 4G9FA 4HBQA 2OR8A 2B4CL 3Q8CA 1KBGH 1IAOA 4ZW6A 4AENA 3SOBH 4J3WA 5TDPA 5EU4A 3FTUA 2ZUQC 5A2LH 2Q1EA 4D0DA 3MFFA 1GGTA 1ERNA 2WXGA 4I18B 2JXMA 1IAMA 4ZS7H 1ZEAH 1TZGL 3ARWA 3EYUL 1WC7B 3BX7C 3TF4A 2I07A 4X0NA 1ETZB 1KXQE 1IE4A 4HK0B 2HLFD 4ZX6A 1JWMA 3TS8A 2VTFA 1KFAL 2W65A 3Q48A 5BOZG 2FHCA 2A1WL 1PJWA 3O6MH 3AB0B 4XPAL 1G9MC 2EZ0C 5IB3A 1WD8A 4DP4X 2K8QA 2EUXA 2Z1PA 1KJ2B 1EEYA 3WO4B 1O6TA 4XX5A 1A6TA 1DVQA 1L9MA 3CSYB 2VR5A 3TYGH 1LO3L 4M03A 1YECH 3LX9A 3UOAB 4F3FA 4Y5XA 4LGRB 3QDMD 1TU2A 3SY0A 1SDYA 3CX5J 3G9VA 4PWKA 1TTRA 5FYKD 2O4EA 4QTIH 3WELA 3EOAB 2EIDA 3MNMA 2BJML 1EJOL 3CH8A 1OSZB 1NIDA 2V17H 4KDVA 4P23C 5IGXH 1U92B 2E3VA 4J4PA 1XF3B 4B9CA 1KXVA 3AC0A 1KGCD 1V10A 3F05A 4OR1A 1DL7L 2AKRB 1EAPB 3LCYA 4YE4L 1QFUH 2ZIDA 2QSCL 3IDGA 3WJMA 4XVTL 2DDQH 2NPLX 1PW3A 3QUKB 1ZT7A 1I7UB 4KVNL 1BD2D 1EZLA 3K0YA 4D0CA 3QUXB 3V6OA 4WU7A 3GHPA 4ICXA 3T0XA 2UXVA 3VO0A 1MCIA 1T04B 3LZRA 3DHPA 5IFAH 5E8NA 5GZNC 5LXVA 2XG4B 4DEPB 3P3YA 4MMXB 2A74B 4GMTH 4UU9A 1J0IA 1QRNE 4GW4B 1EO7A 1INQA 5KTEH 3RZCA 3UMNA 4CN6A 3ZTJG 2X4QA 3ZL4H 4H88L 2ADJA 5EC1B 5CD5C 1NEZB 1HESA 2R2EA 4GIOA 4U1IB 3WFDH 3KLHD 5IHWA 3AQYA 5FHAH 3QRGL 3V6ZB 2FEDD 5JO5A 5ESVA 1OB1B 4PGJA 4XODA 4LCUA 2K4AA 3GBDA 4K5PA 4W9KC 1G0YR 4PLOB 2UVEA 3FFOA 4WQOA 1G6RH 5E1GA 5JTWA 2WTPA 3HE6B 3J7HA 3L3OC 3FUHA 3MACL 2VKWA 1RURH 1I75A 4HQQL 1ZJAA 3MFGB 1Y07A 5F0JB 4QHLA 2WOBA 3OF6A 4XB8A 2HWZH 1PKQB 5IMMA 3ARUA 3TZVB 1AQ8A 1XIWC 5GRZA 4N9GA 1TCRB 4PIBA 4IQHA 4K9EL 5DLLA 5AW9B 5FO8A 3NCJH 4AX3A 4LPUA 3DARA 2B8OT 4KKLC 1U4EA 1SXAA 4GRLC 2NW3B 4PI2A 5ITBL 4MX7A 2KH2B 1HNYA 3ZKXC 4BK4A 4PJ6A 3TF7C 3RAJH 2BP0A 3EGSA 1JDCA 1LO2H 1ZE3C 2Q3ZA 3VWJD 5HYQB 3D4YA 2FUQA 3CBRA 1T1YB 5DFWH 4N0UE 1A66A 4QXGH 1HOEA 3IRCA 3QRLA 4OTXH 1BM7A 4IK6A 4H26A 1AKJB 1DQTA 2HTLD 2YRPA 1KB5H 4XP1H 2C9SA 4HS6B 3ARDA 3ZIYA 1SBSL 4J3OD 4DEWA 1Q1PA 5DWPA 2AAAA 2JJWA 3DOSB 3RVWC 1PS3A 4EN2A 4NO3B 4ONOA 5HD8D 1ND0B 4JUTA 3OB0H 2TRYA 4PLNC 1LP9F 4CGUB 4DN3H 1J1XL 3EZ8A 3LNFA 3L5JA 4YVNA 5F7KC 2ITFA 2KS0A 3H0TA 5I1LA 4R2GC 3BSZA 4GYBA 1NCNA 3UO8B 4YXLH 2XPYA 3FT1A 5A7BA 3VGGA 4QOKD 4Z95H 1SNRA 5F0MB 5F6IC 3S2AA 3U2SB 3VTMA 3CSFA 4P4KD 3KLQA 5IMOB 1GHFH 3QDGD 1IFRA 4WI0B 3ZTNH 4OQTH 5I19H 2Y06L 4QHNA 4ZJ9A 2IBZX 4Y4FD 3B2UC 3GLDA 3ULUL 2F53E 3DYPA 3OG6B 9PCYA 3IN0A 2H5UA 4IMLA 3HN8A 3I9GL 3OZLA 3CFDA 3KLAB 3L2MA 1DVFD 4PD4J 2Y2YA 1XB3A 2ZKXA 2XFGB 3FPXA 3HC4L 4IU2A 2VW7A 3ILDA 4J6RH 43CAA 1DUZB 5LGHH 4J27A 4XB7A 3ZE1F 5DC2A 2IVFC 2JCWA 5F3HB 3U9PH 3WDIA 2F74B 4LE8A 1E9QB 3NZ8A 3SGDI 3OR7B 4RGOL 4LASH 1AZUA 2VE6A 3SGEH 1HK6A 2OSXA 4LPTA 4XVUD 1T21A 1IFGA 3RL1B 4M5YH 5IKCB 2VLKD 2XZAL 4OGQC 1IVLA 1NCOA 3ILEA 1PD0A 4MNQA 2FJFB 3O2VH 4APXA 3S5LA 1NFDF 3S35X 1AY1H 2VDKB 3ZZ1A 2HTKC 3C75A 1H3VA 3KPLB 2OAAA 3KGTA 1BJ1H 5GGSB 1QPKA 1NDMB 3BPCA 5KAQF 3WTSA 4GXVH 2VR6A 3BISA 4WU5B 5I6OA 3VA6A 1C5CL 2V4LA 1RZKC 4M8QA 1FL3B 1YZZA 2QV2A 1U8OB 5SWSB 2YBRB 4F8TA 1VGEH 1B4JH 4OB5L 4YBHA 4M93C 5MEQB 3M1OA 2K4WA 1SXBA 3UTSD 2R0WH 4AJVA 2HFFB 3HUJA 1SOXA 5CBAA 5ERWB 1OLLA 2K9UA 4D9RD 1KCSL 5I8EA 4CMHC 1AC0A 2DQTH 4PGBA 3UTOA 1N5YL 4JAMB 4G8GB 4XMLH 5C0CB 3VXMA 3MROB 4KKAC 5CU5A 1U8CA 1MFCH 4Y19A 4JFHE 2OJZH 5FYKL 4P2QE 4OFPA 5E8PB 2XZZA 5CR8A 5CEZE 3QAZB 1HDMB 5E2VH 5I74B 1L5GA 3L4WA 3MV8D 2XXCB 4XWGH 4PRHD 3B5GA 5I24A 3RY6A 5CZXC 3T5WA 1J8RA 2WXFA 2E5EA 2FBJH 5L2JB 1P5UC 4PJCA 3E8VA 3SBPA 1WWAX 1T0MB 4GSXA 4KKPA 5D1XC 1E2VA 1MFEH 5DLML 4PRIA 3QR0A 2CCLA 3KLSA 4XNXH 3QEUB 4Q89A 1O9VA 3P0VL 3K6NA 2VXTL 3R4DA 3V4PA 3D2UA 5ITFA 3NZUA 3WNPA 2AJXL 4PCYA 1AYRA 1MLBA 3WN5C 1KIPA 1NMBH 2VN3A 1FZMB 4P04A 4UAOB 2QV4A 1CR9L 3HNVH 5IVXF 2DWXA 1LGVA 2KBGA 4HJGB 5DGQA 2L04A 4YR6B 5HY9A 3VXSA 4ANUA 3OGCA 1M7DB 4MXWH 5E4EB 1WZKA 2ZOLA 1IU1A 2CIIA 4LO9A 4NRYA 3IDUA 4PLJC 2CQVA 4KK9C 4P5SA 4IOFC 2WZ6A 1WO2A 1T1WA 2BM3A 1E43A 1N2RA 2I5YL 4NC2B 4E9SA 3NH7H 5KSUB 3ZDYB 1GIGH 3N04A 3FBKA 5FDYA 1JHTA 4XHJC 4GUPB 4D9QD 3L6FB 4YO0B 3ZBMA 4C8XA 3PIQB 3TN0B 5B4MD 4C57C 2WC7A 4P46D 1S8DA 3CDFA 3HJEA 3U9WA 4LARH 2KDYA 2VSKB 4NQUA 4ONGL 4H5SB 5I1DA 3P2DA 5MERA 3VI3B 1SXNA 2QPEB 3UCQA 3AWEA 2WO2B 3T3MF 1JPSL 2VB5A 3QUYD 4XNMA 1EDQA 2A0LC 3BH4A 3CMOH 4WFGD 3UIZA 4PRPB 4ONHA 1KT2B 1J86A 2UY7B 3EAKA 2WN2A 3GIZL 2J6EH 4L4VA 3QH3B 4JQXC 1OF2A 1C12B 1CFSA 1OOAA 1CLZH 1F8TH 3S36H 2GAZB 2E8YA 3GPEA 4OD2B 2W88A 2ZXQA 1ASOA 1YO4A 4YBLC 1LILA 5IQMA 4HKBA 2EDWA 2ZYHA 3MR9A 4YS4A 4ZOCA 3INUL 1OD7A 2Y7QB 4DO4A 1G1KA 2EH8H 5JOPD 1QRNA 5DFTA 4M1GH 2B1OA 4EO5A 5JQIB 2MQCA 2GSIB 4M7ZC 1RUQL 4LLMA 5JQHC 1U8PB 5E9NA 4OM0H 4ZO6A 2G30A 2MMXA 3QUZD 2FB4L 4MAZA 2JI3A 5AOMA 1HL5A 1NCDH 1KTLA 4DGYL 1YMHA 2WUCH 1RZJH 1JWSB 3QXVA 4P59L 4PGCA 5ID1A 1Q0EA 3EBAA 3RDTD 3O4LE 3GLAA 2FJUB 5IESL 1JZ8A 5JPMB 2VLLA 3JZYA 4A2HA 2NY2B 3MJGX 5C71A 4IDJL 4RAUA 5J1AB 3E2HB 4GSDH 4UMGA 5BZWA 1B9ZA 3VWKC 2WMPB 4PJBA 1KFGA 5E6IC 5HTSA 1JN6A 3NJNA 2R69A 2ZNWA 3P30L 3BESR 4M9OA 1A14L 3X1GA 1U3ZA 1LEKA 3BH9B 4GS7C 2APBA 5CGTA 4KNTA 4UCFA 2QVTA 1QSEA 4N68A 3CVHA 3GD1C 4UQ3B 1QSFA 1BP3B 3HG1A 3MUGA 2VQUA 4FCAA 2ZOTA 2MOVA 4IBYA 5HYIA 5K9QG 1JF6A 1FVCA 1HH9B 2FH8A 1F45A 1G7MB 2QPDB 1LVEA 3PL6B 4KAQL 2VDMH 4G1EB 1S9KC 3VFNA 2XFXB 5A2CA 3VFTB 3MJ9L 5I17A 2Z91B 4HCRH 1KELH 1TO5A 4F8PA 1ZT4A 4HXAH 1MCSA 3ABGA 1IVTA 1HNGA 3HZVA 1FCGA 3R1GH 2H41A 3L95A 3V0VB 1FYTA 1OSPL 1Y6NR 2BW5A 3OAYK 4JY4B 1NKOA 2CM5A 2PWGA 1ES0B 3LXAA 2C26A 2DQDL 4Q2ZA 5EOTA 1PYWB 3MREA 3TA3C 3P11L 1E4JA 2ICWA 4BUGA 2Q0ZX 4PN6A 4BZ2L 2B0SL 3MV9A 1HHIA 3BC9A 3O8XC 5HI3D 1XL6A 4NM4H 3ARSA 5KYYB 1TJIL 3GNMH 3BKJH 1CB4A 4AT6A 1MFVA 4XVSH 4DQAA 4YFLI 5J57B 1IM3A 1CICA 1FZOB 3QJSB 5IB2A 4P5TB 1HC1A 3B1UA 4ZUSA 3QIUA 4KV5F 4KZDL 3Q2WA 3F84A 5I6PA 2B59B 1MQ8A 3B2PA 1UWYA 4N4YB 5DWUL 1KJ3L 5SX4H 2A6DB 2ZOWA 1VJSA 2VQ1B 3UJJH 4B95C 2X4SB 3VTTA 1OAUL 1YN6B 1BAFH 1XSIA 2H0PA 3RJQB 3W5MA 4RAVA 2BNRA 3C87A 1H5BB 3AAZA 4I77H 4A39A 4W9LC 2G0KA 4OD1L 1BWMA 5AWNL 8FABA 3DPBB 5FUZL 4K0OA 4L2YA 3JT2A 3VAEA 2WLLA 3WHXA 3FFDA 4YDLB 3BZFA 2Q2EB 1HSAB 2DMBA 3NYKA 3OMZA 2WINB 3GSVB 2VZ1A 3ZO0A 1TEGA 1FGVH 3RWCB 2VQTA 3A4EA 2GVYA 4LU5L 3OC5A 3MRNA 1NPNA 1KGWA 2A9AA 4HH9A 3U9UB 3QUXD 5IQ7H 2YQBA 4X4XB 4I48B 5DUPH 3GBMH 1A6WH 1MRDH 2A9NL 1ZS8A 3PHSA 2EYTB 1FE8L 2Z1KA 3IYLW 2CLRA 3AMLA 3MOBL 3UAJA 2OMWB 2YPVA 4DQOH 1ZJBA 1X5IA 4NQDB 4YXKL 1CFBA 1JTOA 2ERJC 3FDWA 5EN2A 2IPTH 2QTVA 1OIOA 1E5UI 3SQBB 4DIXA 1MXGA 4I0PC 5DJAA 4C83B 1A6AB 4TVSa 2BP8B 5IJVA 4HIJA 5CSGA 1MCQA 1LDSA 1EGJL 4FYSA 2ZWYA 5DMKB 5AVXB 3S8FB 1JPEA 2OV0A 2I60H 3MA7A 1YEGL 4D2NA 5C09B 3T0DA 2FX9L 1RZ8A 3UZVA 1E4KA 1NJ9B 1WPCA 3HE6D 3QFJE 4YC2C 4DFIA 3QYMA 3OKEB 1TVDA 2AK4E 1YPZB 3GO1H 2APSA 1MHEB 5CLXA 3F04A 2JJSA 4XHQA 1W8OA 3S98A 1QR1B 3T2OA 1PX8A 3OXSB 3TZVD 5DEJA 1C5DB 3DOHA 4F2EA 4DCQA 2X70A 2H4EA 2LAGB 2IBBA 3UBXA 1MIMH 1MQKL 1CVRA 1GOGA 2AV7A 4U3HA 4U1MA 2J3SA 5EO1B 4OKDA 3H1ZA 3VXPB 2X87A 1T0NB 5T1KA 3BE1L 2CGRL 2VMDA 4GFXA 1RIVL 1TJHL 4JW3A 4Z7QE 4FA7B 1JL8A 5BZDB 4H25B 4AC2A 3O45B 4CAGA 4BSWA 1A7NL 4AQEB 4G8FB 2GK0B 3R0MA 4X83A 5GS1A 1AR1B 3VW3H 4S1RH 2O93L 1NUNB 4P5KB 3SJVE 4MXQC 3MODH 2AJVH 2F8IA 4XO9A 5FDWB 1KB5B 2XQBL 3QIWB 1AKJD 1F4WL 1LL1A 1DSFL 3EIFA 1DJHA 3H3PL 4NAJA 5MP6H 2BZ7A 1ITCA 3NAAH 5EIIB 2KLSA 1MPAH 1T5XB 2NY0C 2ZSWB 5IBTL 5LG1A 2OCCB 5F71A 4RX4A 2J1ZA 2Z93A 4XAKD 4UZUA 5TE7L 3Q2LA 3SO3B 4BHUI 4XN9A 3MRDB 3WNOA 2J8OA 4KXAA 1P7KA 4IGBA 3F85A 3GBLA 1A02N 1N8ZA 4KO5A 4HC1H 1M7XA 5DF0A 3WUWG 2Z34A 5GISL 3MBEB 2X4UA 4MBOA 3VI4E 4MJJA 3WV0A 2C9RA 5JHDA 1HNFA 2NDGA 4EQ3A 5F93C 1RJYB 1PZCA 4J2QA 1H8OA 4FFWD 3SE9L 3IU3A 4TTDD 2HYMA 4UV4L 2QL1A 4LDCA 4WK4B 1F6FB 2JNZA 1HQRA 3TJPA 1HOCA 5ESQA 5E4AA 1G0DA 5CBEA 3WOVA 3BVUA 2V3EA 5I15H 3C5SA 2HH0H 4HLEA 4R90H 3KWVA 4ES8A 4CJ1A 1F58H 5I6XC 2P8PA 5LG6A 1XF5A 2Z35B 4N2EA 3CXDH 2TSAA 2VSMB 4PPTA 2ZKYA 4B9IA 5K59E 4IYKA 4K8RL 3VDBA 4GAJL 1R5VA 4HEME 4M8VA 3SE8L 2L7JA 2W0FA 2OTWB 3BQUA 2NCMA 4FZ8H 3ZDXF 3WN6A 2MPAH 2CKBA 1OP4A 2DM4A 3BAWA 2A77L 4POZD 1KGYE 2ICWJ 4RRPG 5AB0A 3W37A 3FTWA 2VDPH 2A6KA 3MRFB 5IEHB 3BZ4A 4QD2E 5F1OB 1I1FB 3PP3K 5HHOE 4ZUTA 1ITBB 1JS4A 4PIRF 1S7TB 2CRIA 3CBKB 3CDGA 4DO6A 2D2CC 1V5JA 3LIUA 3LEVH 3KWTA 3U4AA 1XB6A 2F1AA 4ZNCD 5LAXA 2A83A 3BAYA 1K5NA 1IEBB 1BZ9B 1EBPA 4HUWA 4HZLA 4MJIB 2DWEB 4HXBH 4QJ5B 3H53A 3T77B 1RMFH 4XXCC 5MENB 4QXTB 5KANG 5SWSD 3DO7A 3PREA 3G6JB 3BO8A 1OGSA 2YXMA 1EZUA 4ZW8A 3BKCH 1IGIL 5TQ0L 1GVIA 2NNAB 4R26L 3CXHJ 2OI9C 1RZFH 2Y7SA 2ADYA 1MCLA 5J89A 4YFDB 3BIKA 1SMOA 2GTQA 3EKCA 4G8GD 5DVNA 5EU6B 5C0CD 1NUGA 2WBJD 2PWDA 1TO4A 2V8LA 4YSOA 4Y9FA 5AOLA 1E5CA 4H8UA 4YHLH 5FA4B 4DVRH 4XBEL 5CCKH 3CSGA 4GXUM 4AQZA 3OKLA 4LCCC 2VXQL 1MFAH 4RA3A 4G6KL 1N8OE 3IMBA 5BS0A 3BW9B 3MBXL 1SF3A 3PV6B 3BP7A 3VNYA 2ITCA 5GGQL 3M8OL 3IVKB 2FBRA 5FUOL 3F7YA 3KPRA 3KJ4B 3MUUA 4LIQE 3JWNH 4JO1H 2E27L 3QC6X 4WWOA 2V33A 5I6LA 3K1KC 3RB5A 5F6HJ 1A7QL 3L7FA 1PNDA 3RU8L 1FFOA 2CRYA 4TTGA 1RIHL 1U3HA 5IFHH 4ZMPA 5LDUA 1JGLL 1F3JB 4WK2B 4PJGA 3DIFB 4OZFG 3BUYB 4XN4A 1WZ1H 2Z31C 3HI1B 4X6BB 4LVHC 4E9VA 3DV4B 4ZMLA 2IDCA 2JKNA 1UHVA 4MDIA 3G9AB 4GSRA 4L8SB 2GJ6E 4CC1A 3ARBA 1ZLDA 4KGLA 1BEYL 2Y9RT 1NMCC 4UT9H 2BXZA 2E6JA 4AL8C 2WQXA 35C8H 1G4MA 4NN5B 4PY7B 5L4FA 3IJYA 5H35B 3EOTH 1DVSA 4YAQA 3X3GH 1UM5H 2GJZA 5IOPB 1U0QA 5I71B 1S78D 1QD0A 1NMAL 1ZKAA 2EO9A 4U1SB 1EPFA 5IR1A 4P2OA 3TN0D 1QLRB 3ROLB 1OPGH 4DUXA 4FEMA 5ES4B 2P7TB 4P4RA 3CH1B 2FBOJ 2Q2LA 5C9JB 3VSUA 1BFTA 3B9KA 3TJEH 3FRUA 4TSAH 2BZDA 3QXAA 1WBXA 2HFGH 1HI6B 4JM2A 5H37G 1EXUA 5KW9H 1ID2A 2ZAGA 4JFYA 4X5XA 5LN8A 4CVUA 1PJ9A 2Y72A 4GO9A 4O2EB 1QBBA 2B5IC 4DZ8A 4RWYL 1GZPA 3FBQA 3HS0A 3J8F7 2OR7A 5IVZA 3ARGA 5DT1H 3V0WL 2DQJL 4PRPD 1MCOH 4OLXL 3U25A 1PLAA 4Y9BA 2XY2A 2QELA 5DHMC 1A6ZA 2BHUA 1FIGH 3HKFA 3LQAC 1OK8A 4G8IA 3W39B 4IIQB 1B4RA 4NWUH 2CM6A 1E9OA 2BO0A 4LL9A 3HUJF 1YVLA 4NWTL 4Q6IA 2K1MA 1BA9A 4OT1L 4HFUL 3T6WA 5E99L 4MS6A 4QO1A 4XNQA 5IV2A 2F54A 2M8XA 4G2AA 4PW9A 4LCWB 4KKCD 2CG9X 4BKTC 2ICES 3L3IA 3CFCH 4MCZA 1OW0C 1RKRA 1GC1H 1VRSA 1CD0A 2E7MA 1L9QA 1TJXA 1WSST 3BEWA 3KPPA 5DEGA 3WY2A 4F7TA 4LVOC 1RP8A 5BV7C 2EEAA 5CJBA 1S7QA 2WN3A 1TQTA 2XICA 3H9HB 2FYYB 3ULVL 4MJHA 1SF5A 2X1QA 4PJCF 5T3XL 5LN4A 4OGXH 4MAYA 3QG6A 3F7KA 4G9DB 3FTGA 2JIXB 3H2QA 2WLMA 3HHSA 2EEBA 3QORC 2NY2D 1IM9B 3GKWH 3FU6A 3SKOA 4OW6A 4ZUUA 1U36A 5DD1L 1PZAA 3QSKB 2XWDA 4N6QA 1RLBA 4XMTA 1CFTA 5DGRA 2CJ3A 4AVIA 5D2NE 4KZCA 5DJDB 2K8MA 1K9TA 3LD8B 1X4YA 4AXWB 3FQ2A 1OP5H 3IKCB 1S7SB 2IG2L 2P5EB 4XCEB 4OV5B 1JRHH 3HB3C 2LTQB 4PR5A 3MLZH 1EUTA 2OW7A 5EBGA 2F1EA 4I2XB 2VDMB 1XHHA 1YQVH 1TYRA 2VJXA 1F6AB 4U1JA 3GWJA 5JMRA 1UCBL 3PL6D 3WS6A 1F4AA 3ZRFC 5C0DA 1FBIH 4N2HA 3DGGB 2YUXA 1QLFA 2CKNA 5DC9B 1WAAE 3CCHA 3ZQXA 1VKXB 4RDQG 2WWNA 1E42A 3C2SA 5GGVY 1VENA 3U46A 2VC2H 1EEZA 1HT6A 1IO4C 1H6EA 1YYMH 3DROA 3DRQB 4AITA 1JK8B 2N7BA 4PVNA 4BRJA 2PCFA 4GW1A 2WXLA 1YNLL 1KPVA 4LSVH 4OZHE 1Z3RA 2UXTA 4G42A 1TJGL 4APQB 3V52H 4M48L 5J1TC 3QWNA 2VDKL 1HVXA 3G7TA 3MGOA 1TT6A 3UP1A 5IJKA 4YX2L 2IH1A 3RVXC 3WJJA 1DSYA 5FOBB 4PJAE 5CXPA 2F68X 4PJXE 3M1CA 1MIEH 1XZ0A 4K5MA 2D03H 1R1CA 1OAXH 3SN6N 4P5TD 4YWGH 4GQPH 4UDUA 5AOZA 5J6GA 2BVEA 3GYRA 2ICEC 1QZ1A 3H9ZA 3SYQA 4AM0A 2BHFA 1FV1B 2ENQA 1TPXB 1D7FA 1T1XB 4AG4H 1GS6X 2CA3A 4PJEE 2F8OA 2V2WA 1VLXA 3WKPA 1MH5A 4JN2A 3TV3L 3DURA 2JKRM 2P26A 2H32B 4OJAA 1LK2B 2GTWB 3GJFH 3QZBA 4TM9A 4FXGA 4QYOA 4YHNB 4TV3A 5DD6A 1GCFA 1N59A 5F88B 4IIZA 3D2TA 4RISH 5L8KB 3ZUCA 5A1AA 1DUYA 1PAZA 2Y07L 3ES6B 25C8H 3KW7A 3SDDA 3NEOA 3KCPB 3SB3A 2ZNXA 3W56A 4RMBA 2CD0A 1A7PH 3ATDA 3GZQA 5DUBA 4CDHA 4DZBA 5GGVH 1IJ9A 4B97A 2H8PB 1OGAA 1D6EB 1NL0H 1JZ3A 3CE1A 2M1KA 3G5VB 1KCUL 5C9KA 4XZUA 3QDME 3HC3L 1LEGB 2ZUQB 4F58H 2LOEA 5J12C 3KXFA 1ZWIA 1DQQB 4QRPA 5FYKE 2XWCA 2XETA 4ENED 2WVUA 2MTAA 1Q72L 3CQFA 4MS8D 3PGDB 4UUJA 4EAEA 2BRRL 3FHQA 4TUKL 5CLTA 1W80A 3PAZA 3SYPA 1DJGA 4GRWH 4Y7OC 3Q7JA 4B0MM 4Z7OB 1KGCE 1UURA 1Y18A 2VDNL 3VRIA 4WO4B 4NQDD 4BM7A 1RJLA 2DICA 1ZTXL 4LF3B 1A9BA 4N8VB 3D0VA 5D1ZA 4I0CC 3FRPA 4LOUC 4HJUA 2JI2A 3TNNB 1GGIH 1I1AC 2XN9B 1BD2E 2DKSA 2P5WB 2Y7OA 4ZMVA 1B0GA 5A7EA 1YEFH 2NUPA 4PTUB 4ODHH 1T2QL 4L29B 3FB8A 1A1OB 2EDJA 1F1GA 3ETSA 1JPFB 4JO2L 4JEGB 5C09D 2BNUA 3O9WC 4MJ6B 4P9ML 4Q4IA 4EIZC 4XP6L 5EUOB 2ZUUA 4GAGH 1NCJA 4YJZL 2VXSL 4OCLC 4X5RA 4AYGA 3C08H 1VESA 3NBNA 3F58L 3Q2CA 3A6CH 5FHBH 1VFBA 5EZLB 5IVOA 1LE9B 1YEDB 3VGBA 1BXUA 3CFJB 3TWYA 1HZKA 1QNIA 1JHLL 1I3RB 2EDDA 3K2UL 4NAMA 1EXGA 4IBLT 4FE9A 1E4XH 1RP9A 3LSOA 2FHBA 3LS5L 5DHXB 4GP4B 4ZUWA 2YWYA 4DGVH 2K7QA 4GKSA 1HCYA 2PXYA 4B27A 1XBRA 2ADFH 1MW3A 3AGVA 3OKNB 1GZQA 1XGRB 2CU9A 3IRZA 5EU5A 3VRLE 3FHAA 2P80A 2FWOA 5F3FA 3M88A 4Y4HC 3GMLA 1AR1D 5E03A 3VH8A 1X5KA 3TV8A 5LNDA 3FN9A 4CU6A 3MUJA 5E70A 5L2KB 2DWYA 5DJXA 3TO2A 4RMQA 4Q0XL 2Z4QA 4WV1C 1VPOH 2DM2A 3QIWD 5BRPA 4F2MA 3DHMA 4KMTL 2X6AA 4NFDA 4A63A 4BH7A 4J5VA 3II2A 1BVKB 3D4CA 1RY7B 2TRHA 4W93A 1R5WB 1BEXA 2ARJQ 1LP9B 1QNZH 1FWXA 1A1NB 4CU7A 3SPJA 1T22A 3W9EA 5IF0B 1J1PL 3CIAA 4JREC 3GMOA 1HN1A 4M7KH 1KCBA 1VZHA 4U1NB 2I9LB 3THML 3VE0B 3IGFA 1TUPA 3OX8A 4FI6A 3NVQA 4AJYV 2R0KH 1I7RB 1B0RA 5BXFA 4UDTB 2O5ZL 4B41A 4FAAB 4Z78B 1MG2C 3QI9C 4GIAA 4MFHA 3GC3A 3ASOB 1T2XA 3MBED 2WJ7A 4DGUA 2GEQA 1SLVA 3KPNA 7FABH 3QYNA 4Q9RH 2YK1H 4WF7A 4LHUA 1BV8A 3HR5B 4MD0A 1KN4H 1P5VA 5I8OL 5JOFB 4JY6B 4FQXB 5FGSA 2HZHA 2HRGA 2O61A 3BWAB 3DTDA 3GMQA 4ODSH 3FU8A 1DZ0A 1ZDQA 3V4VA 2IOIA 4XMPH 1AR2A 1S9WB 4WDIA 1O6SA 1G7HB 3ZE1B 3ARFB 2QQKL 2ZUTA 4UF7C 3I50H 3BN3B 4JPIB 4E42A 3S88L 3EBGA 1RUAH 3VUAA 4QOKE 3ZE2E 2D9QB 1PZBA 2BSTA 1LEIA 3B4NA 1JGDB 1ILUA 3QDGE 1UOLA 1I1YB 2ZOKB 2ITDA 2F58L 2X1PA 1KBGL 5KN5B 5HYSG 3SOBL 1KLFB 1FJ1B 2V5TA 1E90A 2VDPB 1BIIA 3QWOA 1OD9A 2YGNA 3RGVA 1S7VA 4WI6A 2H26B 1I3GH 1O9ZA 2D8KA 5LVEA 5I8KH 4TUOA 4G70B 2QBWA 2RQ8A 2YD4A 3CQQA 3U6XS 4TNVF 3LRSA 4PRAB 4MD4B 3RWFB 4MJID 1HXMA 3STZA 3MNDA 3OJDB 5A2BA 5MEND 4JQIA 1I3VA 3GBNH 2VLKE 4AW7A 1L6ZA 1RQ5A 3DUUB 3FF8A 4N2FA 4H13C 4P5MA 3U1QA 1DCLA 4OVUA 2DI8A 2W92A 3VFSA 3WLBA 3TYGL 4EI0A 1QYGL 1UM4H 5EORH 1V05A 2X6CA 3MBWB 5KSVA 2CRMA 4PGZA 3JV4A 5EU6D 4LLQB 3EG9B 3ESNA 3T08A 1A25A 3UYPB 1RCYA 1B2YA 4JJHA 4HUVA 2WLYA 1U95B 3FTXA 3M6DA 4ZW5A 3MXVH 1GMEA 2APFA 3U0WH 3RX9A 2H9GA 3AQDA 3CLEH 4LLDB 3CHXA 5DHVA 3WTUA 1DLFL 3DX3A 3EFFA 4KK5C 3RDJA 3UTSE 3II3A 3VQ2C 4K94L 1QFUL 1M9WA 1YC8A 5FGCE 2XZQH 2EE6A 4PI0A 3S96A 4B9FA 4DWHA 2C1OB 4D9RE 4NHUB 4ANXA 4OLYH 1UB5B 5IVXB 2LU3A 3BP5B 1T89C 3G5WA 3NCBB 4U6VL 3AWGA 4YL4A 2B08A 1AYOA 1CLOL 1DDHB 1K4CB 3BJLA 1SGKA 1QHPA 3P9LA 2G3ZA 1R5IB 4OLEA 3HLKA 1HFUA 2B1HL 2V9UA 1NGPH 3MV8E 4GMTL 4PRHE 1I85C 1WFNA 4OH2A 4BCYA 4NPKA 5EOCL 1NANI 3UH8A 1HQ4B 2VL5B 3HRZC 4JFFB 4ZFQA 2V3DA 3FMGH 5KTEL 3ZL4L 1I8MA 3FQUA 4JG0L 5DK2A 2H3NB 3WFHA 1CGWA 3LPWA 4LSQL 1JZEA 4TF4A 3NIDB 4ADGA 3WFDL 4HD9A 3CZEA 2HUHA 3MRQB 4LLUB 4XNUL 3SODB 3DX1A 1BQHG 4FQQB 5B8CB 3FUEA 4WTQA 3RX8A 3RIFK 1LDPH 3A3YB 2G3XA 1J0JA 1UXSB 1NANH 1EVTC 2GIYA 5DQDL 5EBMA 3NCXA 3GLEA 4ZW7A 4GFTB 2EXSA 3ZW3A 3C5ZB 3FQXB 3PWUB 3VVWA 1G7JA 1VFMA 5AG8A 1M1XB 2GSMB 3C5JA 4GG6B 2EDRA 2ZCKL 3CLFH 2UYLB 4FNQA 3RY4A 4XOBA 1KBWA 4H20H 4D9QE 2DI7A 4WY7H 1UACH 5F9DC 1G1YA 5DDHB 3K5SA 1JJUA 2PCXA 4XBGB 2LQRA 4HX1A 3SCMA 1ZGLP 3DSFH 4P2OC 3U7WH 3TP4A 2QR0A 1IQDB 3NZHL 4XNAA 3V55A 3HAEG 4FNUA 1R3KB 3E6FA 4L4TB 4W81A 1NCGA 1VACB 1WP6A 2J2ZA 4HUUB 4Z7WE 5EEYA 4OSUH 2YN3A 1JHKH 2BS9A 3RBGA 1NGYB 1UVQB 3EYFB 4LCWD 1RZPA 4WFGE 1AACA 4PJIA 1KCVH 4IHOB 5F9WC 3HS0C 2KLRA 3GSUB 3TLRA 1LO5A 2NZIA 2A73A 4MA3A 4MLSA 3ARGC 1RK1B 3S37H 5F7EH 3US1A 2H1PH 1PG7H 4G7QB 2OYLA 3BD4A 5IQNA 1MCPH 2OX5B 4DN3L 1NBVH 2MCG1 3V4PH 4HH8A 1SUHA 2IH9A 2P52A 3VD5A 2BVOB 2W60A 2JIXD 5JOPE 3TIDA 4KO7A 3CN3A 1M2VA 1M53A 3PABB 1ZLWH 4YXLL 1WICA 1IM9D 5FO7B 1FVDB 4KZ0A 3ZX1A 4ZFOB 4MMZC 4ZOEA 4ESKA 3LB6D 5C0JA 3BN9D 1W0VA 5CR1A 3RL2A 2ZX5A 3IE9A 2PR4L 1PNCA 4PJGF 2B1AH 2X2JA 5E8OB 5I19L 5JA9A 3C6LC 4NZRL 1BLIA 1RK0A 1A7RH 1S7WB 3JTTB 3ESPA 4NCC2 2B2XH 4PREA 4PJDA 1TR7A 2DMKA 2P5ED 2KI6A 1Z32X 4DPAX 5EZIH 2EIZB 1D6VL 3T4AC 3SD2A 2BIIA 2IXQA 2K3TA 1R3JB 2X4TB 1UFGA 4QF1A 4Z3FA 4GQQA 2VC2B 4LASL 3DECA 5B3JE 4M29A 4L2LA 5D6CB 3CSTA 3QULB 3MRHA 3VXOB 1YNKL 1AFVL 4GEJA 4ZMXA 4PGEB 2XTSA 3B2VL 4EN3A 5JOEA 2YSSA 2K0RA 3FU0A 1ZIBA 3F7RA 4NSKB 4MZ2A 5KSAC 5AAMC 1N18A 3MUY1 4GAAA 1I8UA 3N1MC 4APQD 4PJFA 4A04A 2EDXA 4FG4A 2QVFB 2EAEA 4RZCA 5CP7A 4H44C 2Q87A 4ES9A 5E24E 4LKXB 2VITB 3DOIA 3OKOB 2E46A 4U3CA 4GXVL 4FTVB 4CRPA 1F42A 3WS6C 1XEDA 4GUOA 2JV6A 4M6MH 2MIZA 3IJEA 1XF4A 1CG9A 4DJMA 2WB1A 1D9KC 4FKKA 1P4IL 2WIIA 4U31A 5L88H 3TC9A 1N4XH 3QZNA 1U33A 2XXGA 4ZQKA 5E6IB 4XRCB 4HUKB 4ZRGA 3MRGA 4K7PH 2E7CA 4PS8A 2YMOA 4TL5A 3QZWB 2BNQB 4D0BB 2CJSA 1NCBL 2NQDA 2W95A 2DQTL 4MMYB 3T65B 3UDWC 1XCTB 4M62H 3GJFB 4U6HA 6PCYA 5F8QC 5T3ZH 1RI8A 3CC1A 4Y2DA 4ORGA 1CE1H 1MDAA 4HT1L 1XGPA 1G7PA 5E6ZA 2R29A 5GRJL 3ZE0F 2NNFA 1HIML 2BX5A 1KIQA 4KY2A 4N8CH 3JBG7 2YQ2A 4HAGA 4Z0BL 4XWGL 2F5BH 1KBVA 1WG3A 4G1MA 4NOFA 4YSTA 3RI5F 4NZ8A 3B83A 2CSPA 2YZ1A 1RK7A 4WI9A 4HS3B 1UD3A 2NSQA 2P48B 4XNXL 1L3NA 4U0RC 3FN0L 2OSLA 3FW6A 3WYRA 4DP0X 2BMKB 1Z9PA 2WWKO 4PJ5B 4WO0A 1NC4B 5A6IA 1NMBL 1IEAA 3A4DA 3HNVL 4XNYH 1BZQK 1DSWA 1YEIL 5DJ8A 5TPWH 3TPKA 4YEFA 3CVHH 1TQVA 3EYQD 1GKEA 3MC0A 4MXWL 3HCVA 4KO9A 1MW1A 5HVFB 2CMRH 3H9SA 3G04B 4WO4D 3HC0B 4Y9GA 3ZHNA 4UIKH 4EBQH 1U9KA 4NQEB 1OT2A 3FHEA 4G9FB 4X42A 3UAAA 1WTGT 3IBEA 3LPOA 4KHXL 2H2SC 3B9AA 2XN9D 1IAOB 3ZMEA 4AENB 2HG0A 4HMCA 2P5WD 4QTHA 1P84K 5TDPB 4H1LG 3MYZA 5EU4B 2A5UA 5AOIA 1SM3H 3IE4A 3U4EA 3MFFB 3GEFA 2W0LA 4GO6B 1HHKA 4U1HA 3NJVA 1KMGA 2JXMB 1XGZA 1ZCRA 4JPKH 4XN7A 4KITB 1KLGA 2I07B 3WY1A 1OOWA 2HX8A 5H4YA 5SV4A 4XTRD 1HHHA 1X7SA 3DHUA 2WLHA 1RZ7H 2NY5C 1JWMB 4R7XA 2W65B 3E1ZA 3S3PA 1KYDA 2ZWNA 4A6YA 4XNZC 4GXUN 4HUCA 5IB3B 5DJCA 4ABWA 4F24A 2ZWKA 3VI4F 2K7PA 3L3JA 2PNDA 3CPUA 3ZDZF 4ZMYA 1PEZA 1A6TB 3B8SA 4F8LA 4HJIA 4D8OA 5AUMA 1O9WA 4K3EL 4PG2C 5FWRA 2O6DA 5FKAA 3S36L 1K85A 5D1QA 1JPGA 4Y5XB 3LMJH 3SY0B 4DPBX 3MCYA 1MZYA 2YFOA 4LEXH 1PKQE 3WEBA 5L2KD 5HHXL 3UO1H 2Y5TA 2H3XC 4M7LL 5FW7A 3NSFA 4GQZA 1ORQA 4M1GL 5DA0B 3EDDA 1PBYA 1F90H 4YDNA 4G8EA 4AUJA 2WZAA 4JX0A 3ZRCC 2EH7L 1X7QA 4FFVC 5JXED 3JUYA 3WJMB 5K59F 5I73C 4JBSA 4IM8A 2PXYC 1NCDL 1QKZH 3WFCH 1ZT7B 1DJWA 2XNAA 1L7IL 2WUCL 1MI5A 2X2HA 4L0YA 2EC8A 4K3HA 3DX0A 4RVBA 1NTDA 1NIFA 1D5ZA 2P9RA 5E8NB 4P9HH 4Y4KB 4NP4H 1DO5A 5T33H 1PSKH 1OAYH 2VSDA 4UU9B 3JZ7A 5DRWA 5E6RB 4EUPH 1BSIA 2Z7WA 3RZCB 5JIMA 1INQB 2YPVH 2IAMC 1I8KA 5I75C 1MCWW 2X4QB 4XAKE 2ADJB 3U83A 2MRYA 5SX5K 4FQXD 3WUZA 4KJWC 1A0QL 4WHCA 4L1DA 4DP5X 4JK0D 2APWA 2J8UB 2R2EB 4NHCH 1MHPH 4XB3A 5IROD 4YHPA 1B9KA 4QHKJ 5JO5B 5ESVB 2QJDA 4FQLL 3QWRA 4LCUB 2RH0A 5DMYA 3NSJA 3WTYA 2HT4C 3ARFD 1DP0A 3EF7A 3FO9A 4JFOA 1LMIA 3SDXB 3ZDXB 3FOMA 2BVQA 5EWIH 3BZ5A 1LO0L 4HVBA 1QABA 1YYCA 2EADA 4QHLB 4L8CA 3RVVD 5IMMB 3KBFA 1XB8A 1CC3A 5LAPA 5L8JB 2NXZC 4FQJH 5FO8B 3KDMB 1ACXA 5BQ7A 2EDYA 2AJUH 1WV7T 4RCAA 4Q9QH 2MCMA 4CVXA 2NY0B 1L3WA 3H85A 3PHOA 4L9LA 4MX7B 4WI2A 3ZR5A 1EHKB 2BPBA 4E36A 2BP0B 1ILSA 3EGSB 3N06B 1KPRA 1UUNA 4YUEH 3EH1A 2FGWH 4ZUVA 4K73A 4JPVH 1SQMA 2VKXA 4LVNC 4XVSL 1TMQA 4O58H 3FUNA 4HGMA 1X5HA 5T5NF 5TF1L 2GUYA 1FL5A 1IGYA 2ARJA 2V2TB 3NACL 4H26B 5AD0B 1P6WA 4XVJL 3U6RA 1P4LA 3ABLB 1DJYA 1JFQH 3ARDB 4OCSL 4LSSL 5JA8B 1KSRA 3G08A 1W2KT 3SPCA 4J3OG 4HJTA 3L5XH 4R6UA 3UGXA 4UOZA 2WXKA 2VLJA 3IFNL 5TK2A 3ZKMD 1DN0A 2R0LH 5EF0A 3WUWA 4AQ8C 4DESA 5LBSA 3VFOA 3H0TB 4N25A 5I1LB 4JG1H 4WUKH 4AYMC 1JAEA 3GMRB 5F70A 1SY6L 1SMAA 4Y1SA 5GS0H 2FX7H 2X28A 4JFZH 5GRWA 5SWSE 3N3EA 5E5MA 2P45B 2BXYA 5AZUA 1HHGA 2RCSL 4ZG1A 4I7ZC 1RVFH 2PPFA 2NSXA 2NXYC 1IBGL 4M6OH 3V6FA 1GGBH 1ZLEA 1NIEA 1DQDH 2DIBA 2D7MA 4G8GE 4QHNB 5C0CE 3T2NH 1IX2A 3V4UH 1S7RA 5DVPA 3D34A 3AQXA 1RXLA 3VFGH 3KPSB 3ZL2A 3ZO9A 3HZYA 4IMLB 1WGVA 2EDBA 3CFDB 3QXUA 4B9PA 4ICWA 3AUWB 4N8PA 5JIQA 4IU2B 2NNCA 43CAB 4WKXA 5IHBA 4JFFD 3RZWA 3IJHA 3FUDA 2CLVA 5EMYA 3K72A 4PB0H 3NZ8B 3UBGA 1M05A 1E5AA 2VE6B 5CN2A 1YMME 1OT4A 1G9ML 2ARWA 1T21B 3GT6A 2CKBH 3FCTB 3CZNA 4RMRA 2OK0L 3QT2A 4K23L 4QAWA 4MNQB 3U30B 3NIGF 3D25A 2J1YA 3WEXA 4APXB 4YZWA 3S5LB 2IH3A 1DZBA 5GGRY 1VB9A 2G3NA 3O3UN 3II1A 3POCA 2NTSP 2YC1A 2ENYA 4FYTA 3K6FA 2CGZA 4KK8C 3ZUNC 4F9LA 2IPUK 3BPCB 1FPTH 2B15A 4HS8L 5E2WH 2NR6C 5C0GB 4ISVA 4M8QB 4JB9H 2OMUA 3BAXA 2DIEA 3C5ZD 1JGIA 3PJNA 5AYUH 2XTJB 1MVUA 3QZMA 4IOSD 5B7FA 1V7ML 3WXVL 2HT2D 1A3LH 3HI5H 4FG6D 3ZDYE 5IZ7A 2OULB 3HUJB 3EUUA 5CBAB 2XXMB 4J28A 5KBPA 1EBAA 1BZDA 5D71L 1DVTA 5I8EB 4B3EA 4PGBB 1RUKH 3QQXA 1XTLA 4UTBL 2ZUXA 3IT8D 4I9WE 3VXMB 3V0IA 2OP4L 4XO4A 1U8CB 2XWEA 3VI3E 4Y19B 4FFYA 5KVEH 3MODL 2HLFC 2VERN 4L4TD 1ZHBA 4IBUA 2EE2A 4JJOA 1ZVHA 1OAZH 3N2JA 3DYOA 4HPYL 4V11A 3PGCB 4BBWA 3GRWA 1L5GB 1UTDA 1R3IH 3NAAL 4E9LA 5CN1A 4PRPE 2YAPA 3TPUA 4C4KT 1NMCB 3PXHA 4A68A 4PJCB 1SZNA 4CBPA 1JMZA 3V5KA 4PRIB 1AQMA 2XBDA 4WEBL 3LDBC 3V4PB 4BQBA 1WAAF 3D2UB 5ITFB 3SGJA 4BUHA 1FH5L 1MLBB 3UTZA 1KIPB 4EZKA 1BZ8A 4JFDA 4MMXA 2E7LA 2LLLA 5HY9B 3VXSB 3FSOA 2QQNH 4NO5A 3OGCB 2AI0H 2JJTA 2X4NB 1PLGL 1RIUH 2R51A 1HXKA 2EE9A 2CIIB 4NRYB 4WWID 5HDWA 5J11C 3DTXA 2DQIH 5D72L 3FQ1A 4FLOA 4EXPX 1DYZA 2WUBL 4QRSA 4U7MA 2OMXA 2YD3A 2WWMD 3H9YA 2WNKA 5C0RH 1T1WB 5CF3A 1MJ8H 4HP5A 1N2RB 2DL2A 1A6PA 4HLZG 1FFRA 1M6OA 4R90L 5CJ5A 1CI3M 1TNMA 1T6VN 5DUML 1JHTB 1W9XA 5BZZA 3CXDL 1Q8MA 3VRJA 1U3YA 1S8DB 3N50A 3L4VA 4K2UL 3T6XA 1MJUL 5H37A 5I1DB 3AACA 2DD8H 2A9CA 1I9RL 3MLRH 3W2DL 2FZ3A 4OQ1A 1NCAL 3DX4A 4WEMB 2VMFA 3A6BH 4G7YL 1IGMH 4KJPD 3SBQA 1TTBA 3KLHC 4UBDD 2DQEL 2JQZA 3M7OA 4XNMB 2NW3A 5HVHB 2FEDC 1TLKA 3QQ3A 2RFXA 3V5HA 4ONHB 5BOPA 1FNLA 2W9EH 3B3IA 4I1NB 4LVOB 4WENB 5BUAA 4L4VB 4RFOL 3ARVA 2Q8BH 4TQHA 3D05A 1T1YA 1CFSB 1XH3A 3P54A 3IPBA 4FTVD 3OMIB 4G5ZH 3L16A 3MR9B 1BFOA 1X6LA 1NICA 4FQHA 2J88L 1DBAL 4HKBB 4ODBD 4YSDA 4L5FL 3WCYA 4LCIH 3X1BA 4IJ3C 3EO9H 5HYJA 5E6ID 1XMWA 2DPKA 4R4ND 3TASA 1ZLUH 1JF5A 1ORSA 2DM3A 3OJVC 2BNQD 4LLMB 1RZFL 4IKIA 1SN0A 5L7XH 4LLVA 4UQ2A 4Q6KA 2B16A 2ZUYA 3BGMA 4OFDA 4TLTA 1ULVA 3MV7A 5TE4H 1KTLB 3VWJC 4MQSB 3MNWA 1DN2A 1YMHB 3Q6GH 2Y2WA 4K3JL 1BQSA 3HB3B 4LPXA 4PGCB 3ASNB 5ID1B 3VQLA 2HTLC 3UAEA 3GSNH 1V3JA 1JZJA 2VLLB 4GQRA 4E0RA 3Q5OA 5DEZA 4XN8A 2HKFL 4J3OC 4ONFL 3CK0H 1UEMA 4QRTA 3LOWA 2B9AA 1EAOA 4YLQT 5BZWB 4AV4A 4ZSOE 1I3UA 4PJBB 4TSBL 4UQ9A 5CIPH 2GBAA 1BECA 1R6VA 3PAUA 1JN6B 2CBQA 1IE5A 1LK3L 1S3RA 5ICYA 4IBZA 1WZAA 2CA4A 2VDLH 4AMKL 3NESA 5IJDC 4PJ5D 1NC4D 1JK9A 3TFKD 1HAWA 1QSEB 1XGYL 3CVHB 4Y2DC 1MF2H 3DX8A 1QSFB 3HG1B 4HPOH 3MUGB 4LEBA 5DEFA 3V95A 5JPNC 4W9ZA 4IBTA 4N85A 1MNUH 1FVCB 2DWTA 2LABA 3OJ2C 1URLA 4JL1A 4PJDF 4ZS6D 3QDJA 1RZKL 5I17B 3VRLF 4TQ8A 4YVUA 2V7HA 5DJ6A 3VCLA 4NQED 3J07A 1F4XL 3K8KA 35C8L 4G9FD 1HWHB 4L05A 2H0EA 3HZVB 4Y4FC 3L95B 3L5WA 3SEPA 1N6QL 1FYTB 2EVGA 3IFPA 4GAYA 3X3GL 5BVPH 2Z9TA 1UM5L 1TTAA 4MXVF 1DVFC 3QUMA 1HKLL 1FC2D 4X5WA 4Z7AA 5EOTB 1D5MA 3MREB 5HYFA 2R39A 1OPGL 4OD3L 4HWEL 2ICWB 2NOYA 3OKKA 1H0DA 1IRAY 2KDGA 3MV9B 4NQDE 4J23A 4TSAL 2XQYA 3KS0J 4PJFF 2WLNA 4AT6B 5I1GH 4AYEC 2WW8A 2E76C 4XGZA 5KW9L 1IM3B 5JHLA 3UTTA 1CICB 1TVBA 2YPLA 3CX5K 4XVUC 4BFJA 5IB2B 4JRYA 3WIIH 4LSDA 5TDNA 3QIUB 5HDRA 4MB4A 1T66D 3F3HA 3VG9C 1Q0XH 3S7GA 2FX8H 1FIGL 3IU4H 4G8GA 3L45A 5C09E 1GCYA 3GDBA 4K5OA 3H42H 3MN8A 3SOTA 1NA8A 1PX3A 3RX7A 1O7DE 1TETH 1YPZE 2BNRB 3WAJA 3AAZB 1IKOP 5M95B 3HMXA 2QGCA 8FABB 3TL5A 3VFPA 4B5ZA 4QHMA 1UD2A 2W9DL 1S4IA 1FSKB 2GQHA 2WLLB 3FFDB 4GOSA 4J4PD 3BZFB 3T0EA 2IFGA 3HZ3A 5E9DA 1I8LC 2IQ9H 3NK4A 3AU1A 4KXBA 3ZE2F 2WNGA 3GBEA 1TQBC 2OL3A 4Y5YA 1OP5K 1EFXA 1OPOA 3TH3T 2FEEI 4F8QA 4F15B 1XSOA 1T5KA 3MRNB 5FGBC 5D1QC 1HYRC 4HH9B 2PTUA 1E6JL 5SWQA 5DZOA 3CV5A 1DANT 5C97A 4YSPA 4GG8A 2N56A 4Z5RA 4QXVA 1KYOJ 1ZS8B 4F37F 2CLRB 5DTFA 5IHZA 4A7GA 2G60L 1WQVT 3HNTH 4ZFOL 5EN2B 3RZCD 2R15A 3RLSA 2EILB 2CUIA 5LCVL 5JIPA 1FNEA 2VDOH 3MYJA 3SE4C 1TEFA 5DJAB 4FP8H 4GIPD 3T8XA 1IC0A 1FZJB 5IJVB 1JXFA 4HIJB 5KSUA 1KCWA 2COQA 4JHWL 1NEZG 1L0YA 3L6FA 4JPSA 4QRFA 1JRHL 3O2DA 3TN0A 1NCWL 3MA7B 5F96H 1FRGH 4Y7MA 3VFRA 4DP1X 1NSNH 5D6DA 1YQVL 3UZVB 4H5SA 4W9EC 1JTPA 1N6VA 3BP4A 4EMZA 1V8HA 1O75A 5EO0B 5HDBF 4ZXBA 5L0QB 2NY7H 5I5IA 4U33A 3LRHA 2VC2L 4DCQB 1RHFA 3LKSA 3UBXB 2C8NA 4G6JL 2DQCH 3VSTA 2AV7B 4FA6A 3H3BC 4U1MB 4F20A 2NY0D 4D7PA 1L0XA 5T1KB 4DH2A 1YNTA 3NG5A 1MZZA 1HH6A 4P46C 3GJFK 4PG9A 5IQ9B 4BSWB 1GW6A 5KVFL 3S9DB 2DEXX 2F7QA 3D9AH 5GS1B 1WWCA 1IC5H 1A3RH 3EYSL 3ZTCC 4WAFA 4RLDA 4J3XA 4JMXA 3QUYC 1HJCA 2GI7A 1OAXL 1O5PA 1J5OH 4N28A 4EDWH 3ARDD 2ENPA 3HHMA 3KPOA 1N9PA 3EH5B 2DQHL 4X4MA 2Z7UA 3EHBB 4FRWA 1A65A 4P2CG 4HCGA 2Z93B 4L9LC 3EH3B 5CEXA 3KH4A 2KHAA 1LYQA 1CZ8H 3P0YL 1FQ9C 5E2UH 1P7KB 4IGBB 2QADB 1N8ZB 3VDCA 4ZW3A 1OT1A 4MJIE 3OB8A 4PS4H 2ZOOA 1VADA 1ZOXA 2VQ4A 5DRNA 2X4UB 3WENA 5MENE 2XCMC 4WTWA 2R1WA 1R47A 1U8MA 1AD9A 3G6JE 4QXUH 1JGVH 4PD4K 5FB8A 5JHDB 3ZTJH 3JWDH 2HKAA 1AI1H 3CSBA 3PJSA 4FQ2L 3QUZC 1E5YA 3IU3B 4R97B 4HJJL 3V4LA 4JFTA 1HQRB 3F01A 5EU6E 3ZZSA 1HOCB 5ESQB 4U1GB 5CBEB 4DK6A 2YWZA 3MOAL 4P2RA 2VXVH 5DJ2A 4PVBA 1W72L 2YLKA 3P77A 3C5SB 3RDTC 4IBVA 3KPSD 5EIVA 4B9ZA 1HH9A 5D7HA 2P8PB 4YDJA 5JNYA 1XF5B 3BMWA 3Q8FA 1EMTL 1RPUA 4X5PA 1IILE 3LN9A 3VFTA 2BLFA 3LKRA 4N8UA 2KLTA 1R5VB 2J6WA 3CHRA 2CDEA 4NUMA 1G84A 3BQUB 2W0FB 3HFFA 5I28A 1GGIL 1JNJA 4YDMA 3AY4A 3LVEA 2CKBB 4M1DH 3OZ9H 4UZGA 1S5IH 4AQ1C 1YEFL 4Z7WF 4AWJC 4ODHL 3QXTA 2WJ5A 4P06A 2H0FA 4MNQD 2A6KB 3VDAA 3BZ4B 1IKNA 3S37X 2WXRA 3N42F 4ZUTB 5B39G 1PG7X 5HHMB 3CDGB 1E4HA 1IAIH 1B0WA 1HWGB 1WITA 4Z8FL 5F2FA 2ZX6A 3KBHE 5LAXB 1C5BH 2A83B 2DQGH 2LVEA 1K5NB 3APCA 3BUTA 4HUWB 5FCSH 3QPKA 4HZLB 4P5TA 1DBJH 4KTGA 1HCFX 3F65A 2DJMA 1MREH 3AT8A 4EIUA 3DO7B 2XTJD 4OF0A 5F89A 3O0LA 2IDTA 3GUFA 4X9YA 4EKXA 4N0CD 5DJZA 3BT2L 4X7SH 5ADOH 5I30H 1EA9C 2Q7AA 3D39A 4I18C 2FNBA 3BIKB 1LNUA 4G72B 5HI3C 3VXMD 1RERA 4HALA 5DZ9A 4GKNB 4F9LC 4Y19D 2HJLA 3CZKA 3DPBA 4HWBH 1DBKL 1SMDA 1KGIA 2FEJA 3C6EA 3OKLB 2HJFB 1VPOL 4KTEL 1YJDH 2DQUH 2DBLL 1Z66A 5T1MB 3U0TA 5BS0B 3D0LA 4MRCA 1EAQA 5DHVH 4POUB 5LGJA 2IPKA 2Q9OA 4LT7A 4R8WL 3WO4C 1AGFB 2WAQA 1MCFA 3BP7B 2ITCB 3J2PA 3NRFA 4F33A 2QFRA 4AW4A 1IB5A 3JWOH 3GI9H 1FYHB 3PWLB 1CGTA 2BSEA 3F7YB 3KPRB 4PRID 4TULH 4NKOB 4ANWA 5B3JF 3D2UD 5ALBL 4CL7A 1GGCH 1D5IH 1DQKA 2OMNA 4KMLB 4NKQB 4GQ9H 4MA7H 3L7FB 4JCWA 4N1EA 1JFHA 1FFOB 2EICA 2K78A 1N0XH 1U3HB 3FYIB 2OMWA 4RMTA 1DQJA 4LBEB 1OE2A 3VXSD 5J4MA 4LCWE 1J0ZA 1ZGLA 4Q9BA 4PJGB 4MQXD 4J39A 1E5ZA 4LLYA 1QPXA 4YHOH 3O4OC 4QY8A 3GQFA 4XE5B 3ARBB 3MRMA 4MSWA 4FQPA 1YEHH 1QFHA 3LPPA 2J8HA 2VZSA 3IJYB 4S0HA 3BOVA 4YAQB 3QUXC 1G6RA 2WQWA 2GJZB 4XPGL 3WTWA 1DDTA 2R27A 3QO0A 4OAWA 5DJ0A 1PX4A 1NJ9A 1KCRH 4MMXC 5IR1B 5JR1L 3NQIA 5C3IA 2A74C 1RUAL 2DTMH 4P4RB 5IWLC 2FL5A 3B9KB 2CDGA 3FRUB 5DC4B 1Z9MA 3QXAB 3QEQA 1WBXB 2XHNA 4AEFA 1BREA 1NLBL 4JM2B 1EXUB 3N85H 2ZCLL 5E2TH 3A67L 4XPTH 3UP6A 2Y25A 2YN5A 4JFYB 4HZ1A 4X5XB 5DHDA 5AAPA 4TQPA 4DZ8B 1GZPB 3D85A 3HS0B 4DKEH 5IVZB 2XTLA 3LEYL 2P5EE 1BVLA 2AJZA 2VM4A 5IB1A 5C1MB 4P5RA 4NXKA 4G8FA 1A6ZB 1I3GL 2P24A 4L4VD 4YHZL 4I2XE 1UT9A 3M1BA 3HE6C 4G8IB 5I8KL 4YHML 1T20A 2IFFH 1E9OB 3CSPA 3GINA 2R0ZH 3Q8BA 5CINH 5CN3A 2YD7A 2DKUA 4Q6IB 2MPVA 3TZVC 4LSUL 2L0DA 4Z7UA 4FG2A 5IV2B 4QO1B 4XNQB 2F54B 1ZLSL 4GI6A 4JCMA 3GBNL 5IVNA 1TLMA 4PSPA 5GZOA 2CZNA 3ATEA 3PQYE 5CJOL 5HGHA 3L3IB 1Y0LA 4MCZB 4WHDA 3HG2A 1B2WH 3ECBA 1RUPH 3BEWB 3KPPB 5DEGB 4F7TB 2J56A 4UQIM 3ZE0B 2C3XA 5T3ZD 4HSAC 2JKSA 1S7QB 2V5MA 4JRLA 3ZOAA 1UM6L 3PGFL 3DDGA 3GSQA 2FD6H 3HB3D 3TJHD 4MAYB 3QG6B 4N2LA 3GSNB 4OLVL 3MXVL 1P9MA 3BSZL 3HHSB 3V10A 2FIKA 3NFSH 1D5RA 1WCBA 2HFEA 1D2PA 1HHJA 1OM3L 4OQTA 5F0PB 5KJRL 2HLAB 2H1XA 4RMVA 5E08H 4U05A 2CJUH 1CFTB 4S0TD 5IW6A 4QJ3B 1HEZA 1SOSA 4JHVA 3SBRA 2VDLB 1G5GA 3S5ZA 3WG7B 4K71B 2VSCA 1XQ4A 4G82A 4GB9A 3Q01A 3ABKB 1X5FA 5J06A 5G4OA 4N9OB 1QSED 4PV1C 4PR5B 2OCFD 4CSSA 1QSFD 3HG1D 1FG9C 4HU2A 4AE1A 2DEYX 2EXWD 4QNPE 1NM9A 1J0HA 2EINB 1CXKA 4QMEA 4X98B 2NY4B 4U1JB 2WLKA 3KYOA 4ZTPL 3FMGL 2E6PA 3FB6A 3WIFA 4EDXA 5EUKA 5C0DB 2OTWA 4FFWC 2FSDA 2M26A 4TTDC 1QLFB 1WD9A 2ED6A 3CCHB 1IAKA 3H3KA 1EEZB 3U46B 2OA9A 3DROB 3WHE0 5C0FB 1FYTD 2PCFB 2XWXA 4GW1B 2CK0H 1THCA 5ADPH 4G43A 2EXYC 3TONA 1CL7H 1A6UL 3MGOB 3PJLA 2H3KA 4WWPA 1Q0YH 4LDOB 4P3WA 1IEBA 4Z7OE 1TYEB 2IH1B 3KW8A 3MV9D 4MJIA 1DQIA 3AGWA 1SPDA 4XP9H 3RQ3A 2AZAA 3UX9B 4YE0A 1XZ0B 1IM3D 2YAMA 2XN9E 1CICD 3ZDZB 1K8IA 2P5WE 5TDOA 3CLFL 4POZC 4UDUB 2XY1A 3QIUD 5J6GB 1C1EH 1RZIA 4H20L 2OTUA 2PW1B 3IFLL 4AM0B 5KVMC 2V2WB 3DV6A 4PAZA 3G6DL 4JN2B 2EC9U 3DURB 4PJ7A 3KM1A 4MA1B 5EUOE 4QR7A 3OAZH 3BVXA 2X41A 4FXGB 3V8OA 1X44A 5INCB 4R7VA 2BNRD 1KF9B 2WBKA 5DD6B 1XH1A 1FLTX 3ZMRA 4LK4A 5K9QI 5EA0H 2B7DT 1FORH 4HOMA 3OPZH 4M1CD 2YR3A 1DUYB 4LRNH 3RILA 2D31A 3SDDB 3PV6A 1OZTG 1PKOA 4AEIL 1CO1A 5BCAA 3NK3A 5F1IA 5DUBB 1GPOH 3VX0A 4AL8L 4DZBB 1CGYA 5F7EL 2H1PL 2VAJA 3N9GH 3P73A 4XC3H 1OGAB 3RFZA 4OCMC 2J73A 4YHYB 3AUVA 1N19A 1NAKL 2WV3A 3L5HA 4XZUB 2BSCA 2RGSA 1OALA 3AM8A 3KXFB 4LRIA 4ZDHA 3WMPA 4QRPB 5L2KE 5BJTA 3SYAA 2FJHA 3QAZC 4UUJB 3CDZA 1W8EA 2C9AA 1H3UA 5CEYA 5IMLB 1M42A 3UAJD 3VRIB 1Y18B 1KENH 1LP9E 1RJLB 3ROOA 1PG7W 2CBTA 2D7NA 1A9BB 2VDOB 3PCYA 5FYLH 4DW2L 3D0VB 5D1ZB 4X2UA 3FRPB 2B1AL 2CNYA 3IMTA 4NUQA 3LH8A 1EERB 4H1LA 2XDHA 3ORJA 4HUMB 1CXHA 3SBWC 1B0GB 4Q97A 3T6QC 4G6MH 2NUPB 4UAOC 4U1SA 1JG9A 3FB8B 3US9A 3LQAL 5T1DL 1NBQA 1A4AA 5FFGA 4PWJA 4HUNB 1PVHA 2BNUB 5EZIL 5J5EA 3SE3C 5KWYC 1LD9A 4OIIH 1Y1DA 4TPRL 1P1ZA 4FF9A 5I6KA 5DJYA 1NH6A 2OBGA 4RGMB 2NT1A 1VFBB 2DZEA 1BG1A 1PIFA 43C9A 2QMJA 3N55A 3VA2C 2AABH 3VB8A 1BJ8A 3LSOB 5LO7A 1S78C 5ABZA 5J8OA 4HJ1A 5T1KD 3ZE1E 4ZUWB 4GKSB 2PXYB 3HE7A 3TN0C 2BHYA 2BP5M 1GZQB 2VYRE 2Y1YA 4P8QA 4AIOA 1GY1A 1CTOA 4NGHL 5D6DC 2FWOB 1QASA 3ZYJA 4ZMZA 2J1XA 1M3IA 3GMLB 3VH8B 1JZIA 4YXHH 5DJXB 4LL4A 1J7VR 3TO2B 4X99A 1UASA 4PV8A 5KVGH 1H9DA 3D4GA 2Z4QB 2CIKA 4L1HA 1S9XA 4F2MB 2N3JA 2ISDA 3GK8H 4BH7B 2N59A 4K7PL 3KWUA 5MI0B 5E2JA 1I9IL 3SQOH 4CKQA 2EEFA 4N6RA 1XBDA 4XBMA 5E23A 3IFOA 3EHBD 3H9HA 2AXHA 1T22B 3W9EB 4M62L 4RX4D 1JDDA 4XMXA 4HUXA 2HB0A 5LBVA 3KDPB 2PYFA 3GMOB 3PYCA 4HAFA 4RSYA 2WD0A 2R1XA 4IGBD 2JIXA 5DD5L 2QADD 3ECUA 3GTTA 3OX8B 5BXFB 3IDYB 1B0RB 3UZEA 5BO0D 5AZ2H 4UB0H 2FO8A 5GS0D 5IHHA 4N8CL 1JZ4A 3FULA 3MRLA 3KPTA 1MW2A 1K2DA 1I4FA 2YD0A 3SYCA 3KPNB 2E47A 4XCNA 5JHDD 2UY6A 3FQRA 1FAIH 1L0PA 1TQCB 3VD2A 1J05B 3I3BA 4LHUB 3BKYH 1AQKL 5DJDA 1P5VB 3NTCL 1X9LA 2R69L 4Z23A 4FX5A 5B38A 1YEKL 4OGYL 4MNHA 4NUGH 3IDJA 2P5EA 4R4FL 5EV7A 3GMQB 4ILDA 4YPJA 3T1FA 4A7GF 3TCLB 3V4VB 3KYKH 3GSRA 3EXJA 4WDIB 1O6SB 2YRBA 2KMWA 5JPMC 3B1TA 2NY2C 2E4FA 4E42B 1PU0A 1NBCA 2EUZA 2BCKA 1YY9C 1W8NA 3DGGA 2C5DC 3X11A 2YLHA 4DGIL 3ZXAC 1AVAA 4UIKL 1KB3A 2BSTB 4EBQL 2WXIA 2QKSA 4N26A 2DMCA 3NIGB 5IVXE 3BQUD 1JK8A 2ITDB 3VI3F 3WSQH 3UPRA 2UZPA 4G80A 1NGZA 3JWNE 3O6KL 4FQIL 2IANA 4QUOA 1IBFA 2EDQA 1QQDA 4FTDA 2Y22A 1JPTH 3QWOB 1SOQA 1KULA 3RGVB 1S7VB 1SM3L 3D0AA 5IEKA 4MASA 2G4GA 1F11A 4ZMAT 1JNHA 2FO4A 4CMMA 5HHMD 5CD3A 2X3CA 1WIUA 3PL6C 1OL0A 1HSBA 1UWEL 3CXHK 4WGWB 4JPKL 5HJ3B 4JFFE 2FRGP 4J8RA 4LSPH 2GCYA 4X4KA 1T0OA 3LRSB 4KVCH 5AVUB 2YA1A 4RBPH 1KIUA 3SKJH 5FA3A 5IT2H 1RZ7L 5IBLD 4G7SB 1HXMB 3IF1A 4I8DA 5FAAA 3STZB 3CFTA 3NA9L 5CMAA 1KV7A 4JR9L 1I9JH 4WI7A 4JO3H 1AP2A 3LRMA 2MKLC 1ET5A 5EDXA 1C16A 2I24N 3A6OA 3OWRA 4P5MB 3V8CA 2FVNA 4DERA 3DVFA 2WCPA 4F57L 4H8WH 2E8ZA 2O5YH 3VFSB 2YXVA 3WLBB 2PW2A 3S3JA 5KSVB 3F7LA 3T3ME 1A21A 3JV4B 1BVNT 3LMJL 4FMFA 4XN2A 5DS1A 4QGTA 4OU3A 4MZ3A 1CK0H 4DUWA 1MDTA 4WTZA 4HUVB 5LBSH 5EFIA 2DYPA 4P5TC 2H9GB 5DHVB 2EDLA 2PWHA 5BS0D 3EFFB 1WA2X 4LCVA 4B60A 4JQVA 3S96B 4DP7X 2WY3B 1UH4A 2WCGA 1UT2A 2OZ4H 4XMKH 4FZEH 5KBKA 1LEGA 3KPRD 4FMKA 3LNIA 3RJDA 1QVOA 4MB1A 2N1KA 1ZPUA 2YD9A 3FH8A 5I1AA 2MCPH