2ZP8A

The nature of the trap:anti-trap complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein mtrB
publication title The nature of the TRAP-Anti-TRAP complex.
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Rna binding protein/transcription
total genus 11
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 2zp8A00
5EF0A 3ZZSA 4B27A 5EEZA 5EEVA 1QAWA 2ZCZA 1C9SA 2ZP8A 5EEUA 1UTDA 3ZZLA 2EXTA 2ZD0A 5EEXA 2EXSA 3ZZQA 5EEYA 5EF1A 5EEWA 5EF2A 1WAPA 5EF3A 3ZTEA 1GTNA 1GTFA 3AQDA 2ZP9A
chains in the Genus database with same CATH superfamily
5I15H 5IBTL 5IFAL 1XL4A 2ATKA 3FRPA 4XCEA 5ALCL 4ZO6A 1RZJH 3MOAH 3H9SE 3MLVH 2Q7NA 2XRAL 1E0OB 3C5ZA 2AS5M 4MYWB 5DS1A 1IKFL 1KENL 1AR1C 1U41A 1GIGL 2OL3H 2ZOTA 4XAWL 1S3KH 1YQ2A 1BM3H 2LFGA 4HJGA 2XTSA 3QPQD 4NO0D 2YD9A 3T0EC 2NUPB 4IKNA 5E9DE 2P1YA 2NXYD 4ODBD 4P46B 1MAJA 2HN7A 3KYMB 1CLZL 3FU9A 1OPGH 4QHMB 2D7TL 1PD0A 2XXCB 3KYKL 3L1OH 2YGQA 5C3IA 3CUPB 1A25A 4W70A 4WWID 1VDGA 4JGMA 4BK8A 1EEQA 4GSRA 4FQIH 1FNLA 2LU7A 1CGVA 1JNHB 3EF7A 1N5AA 1NEUA 2D7NA 2R0ZH 5CLZA 5FA4B 3HS0C 3WXVL 1EDYA 2YAOA 4IGBC 3MACH 3S35X 3KGUA 4Y2DB 5ICXA 4PUBL 3RWGB 1TFHA 3PXJA 1DBJH 3IMVA 1AGDB 3PG2A 4OAWA 5BUAA 1ZWIB 3SO3C 1S9XA 4W1TA 3PPSA 1DBML 4BRVA 3JTTA 3UMTA 5I19H 1OWRM 3OAZH 4DCQA 4BV1A 3KNBA 4LCWE 4NNXB 3WFHA 1CR9L 2VN7A 4PWEA 1G4RA 5E99L 4LVEA 5CEZH 3VX0A 4BZ2H 1H19A 1IGIL 2NZ9D 3IPEA 4UILH 1UZ6E 2HFTA 4HKBB 5H35B 3HRZA 3SJVB 1CF8H 2A2QT 2OW7A 5DVPA 1KCSL 3FH5A 3SBWA 3WLBA 3K71B 1XH1A 2VTFA 3CFBA 3ZDZF 5LXVA 3P30H 2GIMA 1NCAH 2OI9B 2YAFA 4XCNA 2ZKHH 3T2LA 4BWWA 1F02I 3PHQB 1LK2A 2DMHA 4QT5B 2DPKA 1DVFB 3PWPE 1UM4L 3BZDA 4Q6IA 1NTDA 1CDCA 4IMLA 3P11H 1J1OH 3RVTC 4PJFB 2F2HA 5BQDA 1KTJA 4GAYB 3U30C 4XP6L 1PCSA 4QMEA 3PWPB 2X09A 1XB8A 2G60L 3P3YA 4Q7DA 1TZAA 1UB5B 5GIRA 3DGDA 1Z5HA 4YZFE 1KB5L 4XBPA 3SCMB 4M43H 3BSHA 4IJTA 1Z5LB 4AV5A 2JIXA 4DN3L 3IU3A 3MNMA 3SIKA 5L2JB 4WNQB 3ZJAA 1WF5A 1ORQB 2CK0L 3ORJA 4HWZB 3H85A 1S7TB 1LM8V 4UOZA 1X5ZA 3WFBH 1NM4A 2SODB 1HILA 3ARDD 3BQUD 3TWCH 1RHHB 1U36A 1Y1DA 4OFYA 4WWKC 2Y69B 2PCPA 2Q3XA 3LH8A 4PS4H 4EIZC 4MDJB 4CN4A 1G84A 1UB6B 4FZEL 2YBRA 3NA4A 1RZGA 2FAUA 4V11A 1TEYA 3BSZA 3V6OA 4H2CA 3BVTA 4PN6A 3NFNA 3ZZQA 1XIWC 2F68X 3T4YA 4AXWA 1I9RH 4QJ3B 2W65A 1MW2A 3GHBH 2BSDA 3NSDA 5DHVB 3SDXA 1P7QD 1N9PA 3MX0A 4RAHA 2C9SA 5EZJA 1L9TA 4WGVB 3RRQA 3T8XB 3U6XA 4PLNC 1GL4B 3PP4L 8CGTA 1FORL 3U2SB 2XWDA 2NY1B 4RGND 3N1FC 2F8OA 3AT9A 2I27N 2PYFB 2LAAA 2XYBA 2X4QB 1J05A 4LCUA 3O9WA 4PJXF 1F86A 4O58L 4AY0A 2OSLB 4G3YL 2FHFA 1H5BA 1T2QL 3VNYA 1BAFH 2DQEL 3DJSA 1YY8A 4QOKA 4ZUVB 3X11A 3MFGB 2ZWSA 4QO1A 3F3HA 3S8WA 4QNPF 2F5AL 1WP6A 4G8FA 4NZRL 4ZPTB 4V2CB 1I8MA 5D4QA 1XGPA 4P3DA 4ZQKA 1Z3GH 1QEWA 1Q9WB 3BUTA 3D51A 4CN6A 5C07D 1CFBA 2Y7QA 3EDJA 2W07A 5JPNA 1VKXB 5IB4B 4JQIA 2VRQA 1W8NA 1KPRA 3IPBA 1RU9L 4NQDB 2R69A 1S9YA 2CMRH 1D9KC 3BVXA 3GBNL 4JFEE 2P5EB 4K8RL 4RGOL 4W6YB 5J13C 1FVDB 1EA9C 4JLRA 3B9DA 4OCYL 5FR3A 2GBUA 4HBCL 4GQRA 3WU1A 2WLMA 5E94B 2Z4QA 1KIRB 3ARBC 4KAQL 2IC2A 2ZUXA 4LCYA 5MEQB 3SE4C 4PYHA 4MLSA 3EO9L 4PJEF 3LKOA 1L9NA 5KVFH 3BSGA 1N59B 5FW8A 5E2WH 4KY1H 4XCYA 2EJ1A 3LH9A 4L3CB 4P2RE 5DJ2B 3BCFA 1HHHA 3P0GB 3H2PA 1SXBA 1K8IA 3VI4E 2UUDH 1M7DB 5K9KA 4HQQH 4RX4A 1D5IL 2BRRH 2EC8A 1VEOA 4NNYA 3APDA 1JZIA 1I3UA 2F58H 5DA4A 2HFGL 2OMVA 5EORL 1MCKA 1MJUH 2DQUH 3VYOA 2H1LM 1YEJL 5ESQB 5F72S 3WKPA 4X6EA 4P2YA 3IDGA 4K3GA 1FFPA 1S7XA 1QSVA 5I5IA 5IB5B 2VO8A 4PGCB 2JKNA 1YUHB 2TAAA 3UJIL 1W80A 5AWNL 4ZUUB 2FTAA 1BQKA 5D7KD 4OF6A 1SXZA 4HJJL 5KVEH 4U6VL 1QLEL 3Q3GB 4B9KC 4PJCF 5KBLA 1E4XI 5K59E 2IOMA 4DN4H 1SDYA 3LS5H 2MMXA 3GSNA 3WFZA 5CR8A 3QQ3A 3EW3B 4I0PD 2CJSA 1ILSA 3EXJA 1NMAH 4PRPB 5JW4M 2V7NB 3MLUH 3HZKB 3VFRB 4JDZB 3KLAB 2X87A 1ZSDB 2WOYA 1AXIB 4YDIH 2XZZA 2R0WL 5LQBL 3ZUNC 1NCDH 1EIBA 2FEDC 4JS7A 4IEFB 3UBHA 4OW6A 1ND0B 1YDPA 1CT8A 4IBZA 3CFNA 1UHVA 4WO0A 3X1NA 1HSBB 2K9FB 4N9GB 3LRSA 1KLUB 2DV6A 2HLAB 2PWGA 2XV2A 4QXTA 4BSJA 3UDWA 1PBYA 1S6NA 1I1YB 3UAEA 4QGYA 4YK4B 2PCXA 4Z3TA 4N9OB 2AXGA 2VSKB 3IMSA 3GLEA 4WFFD 3U4BH 3FRUA 3EG9B 5IJKA 3VRIA 1KTRL 2H32H 5IY5B 5GZOD 2QQKL 4WW2B 1QHOA 2A83A 1BMGA 3PV6A 2CHXA 4GB9A 2DWXA 4DP7X 3D25A 2I7OA 5AOLA 2VZ1A 3SE8H 4DQOL 1SMDA 1LHZA 1EHLL 3KLLA 2LV4A 2ZX7A 1LL1A 4WU7A 2FR4A 3CZUB 2AV7A 3CVCA 5J5EA 1V05A 3MR9B 4KZDL 1ZTXL 2FSEA 4QD2E 1T4KA 4AV4A 3TWYA 4YXKH 5DVMA 3S4SB 1V7NH 4KTEH 5D7SL 4QTFA 1U3JA 2GSIB 2PO6D 2JLPA 5D72L 5KSBE 1PZDA 4NAQA 5DK0B 1JWUB 2GC4C 1AI1L 4OT1H 4ADGA 4E42B 1HN1A 5ITFA 4JFZH 1SHWA 1AGBA 3LHPH 3PGCA 3CBRA 5EO9A 4UM8B 4FXTA 2APBA 1RUMH 1R3KB 4LHUG 5D2LE 3VJ6A 2B08A 5EN2A 3I3BA 3Q8EA 5BRQA 3NEXA 2BSEA 4OLEA 5E6SB 1OK8A 3WSQL 3ZX1A 1GXEA 5I8CA 4QRTA 1GJIA 2ZOLB 4YGAB 3TCXA 1Q90A 3FFCE 5D2LB 3IFPA 4WI7A 3HG0A 3QZWA 3SQBB 5CU9A 3BUQA 2WTPA 3VXUB 2EYTB 3HE6C 1QACA 4XCCL 1PG7H 4WZ9A 5JDSA 4NM8H 4MZIA 2VXQA 2JK5A 2GBVA 5D2NB 2HTLD 1KIQA 3DTXB 3IGLA 3BEVA 3QNZB 3F6IA 1CGSH 3AY4A 1DQJA 3O6FC 4D7PA 1V3MA 1SEQL 4K3DH 2FL5A 5B3SB 4Y4FB 3E6HB 4BD4A 1WZMA 1BW8A 3D08A 3C5JA 4R5TA 4EJ1C 1S7VB 5DRNA 3D18A 4PP1C 2BIMA 3MGOB 4Z0XB 1I85A 3TIEA 2UXGA 4YHNB 2FBRA 2W60B 3FB6B 4E41D 3L95A 3BLKA 5H4ZA 4FQXB 3LD8B 3T65A 5DEFA 5IQ9A 2X89D 3TEWA 3TN0A 4P9ML 1KOAA 3BI9X 1CL7I 2VLRD 3IBEA 4KNSA 1SY6H 3FSOA 5KTEH 2IWEA 2MCAA 2C3XA 2GTQA 2CLRA 2XLLA 3WUWG 1EAPA 4UT9H 3S37X 4ESKA 4P5RA 1SLVA 1TFPA 1TLKA 2CQVA 3NJKA 5I1DB 1U8NB 1FNEB 3HC3L 1OGAD 4R90H 4MKTA 5LNGA 3EJTA 5IBTH 4PJ7A 2OYPA 5IFAH 4M5ZL 4HT1L 3U7WL 4MDIA 3TYGH 2DBJA 5ALCH 3S36L 4J3VA 3RTQA 5GGVH 2YC1A 2XRAH 1AHKA 3VXSB 2B39A 2BOCA 2EDTA 3HBZA 3ILPA 4K8RC 1IKFH 2A4EA 3IJ8A 2YUVA 1GC1C 1GIGH 2ZUYA 3LYRA 4XAWH 4E5XB 3N42B 3MLSL 1S78C 4MX7A 1T6VN 4FQJL 4NUQA 5E8DL 4XVJL 4HUKB 2APVA 3MRPA 5CBAA 1KN2H 2MQCA 4XPAH 4NUGH 2VIRB 2ADIB 2P47B 3ARSA 5I8OL 3ESNA 1LGVA 4X80L 2R7EA 1CLZH 3UBXI 5I6XC 2YPLE 3PHOB 2ZUWA 1BJ1J 1DBKH 1JGLH 4OGYL 3O41A 4IOFD 4ZG1A 3MRLA 2W80C 3BP7B 5HY9A 4JAMB 3Q13A 4NO5A 1F58H 2V8MA 4YSRA 4YJZL 2BFGA 4O2FA 4UZSA 3SYPA 3RVVD 2XKNA 2Y4SA 1VZIA 1XO8A 3WXVH 2X9ZA 1PSKL 5T1KA 3RYMA 1WBXB 2QJDA 4PUBH 3MREB 1FFOB 4HUCA 1G9HA 4GXFA 4OLXL 4FQLL 3ELAT 2BNUA 2DQGL 5EU6B 1DBMH 1DUYA 1RUKL 3ZDYE 3A4AA 2WIIB 2G5BA 4AQ8A 2VAAA 2CR6A 4GRLC 5E99H 1SYSB 2FE0A 5IJVA 3FO0L 4NPYB 1IGIH 3PCYA 4MJ5B 3QEUB 4JFFA 1ZTMA 3LH2H 3QNXA 4ZUTA 4EI5C 2J5WA 4FXGB 2DWSA 4JRYB 1X5KA 4OV5B 3I9AA 1MNNA 1GY2A 3BAXA 1IC5H 4LP8A 4EUPG 3CNKA 5IV2B 1CFVH 1KCSH 2FQDA 3QI9A 4LKCA 4X9GA 4ZT1A 4HEPA 1MJJA 1Z1WA 5F9JB 2WVSA 3HAEG 2NXZB 3LRGA 3SDAC 4Z1PA 1UM4H 2XG4B 3FUIA 1ZGLA 1IU1A 3UP6A 2J8HA 2NY2C 4LCIH 2Z8RA 3RWHA 1E9PA 4H8WL 3HBGA 1FNFA 1NCGA 5HYSG 1JUFB 1RP8A 1XGUA 3QDGA 3TEUA 4XP6H 4CADB 1NGXB 2Q9OA 3L1GA 4AYGA 4ZRGA 1MIML 2G60H 4NCC2 3RFZB 4OM0H 1XGYL 3TJHC 1M7IA 2DTSA 1KB5H 3MJ8A 1KUMA 3CN2A 1YNTB 1CB4A 1M05A 4DN3H 4OF7A 2I9TB 4Z7WF 2CK0H 3C5ZD 3ZK0A 1A1MB 1S7RA 3CFDA 2VDNB 3MV11 3H4FA 1XMEB 3B9VA 3SODB 4MD4A 2GSMB 5SV3A 4FZEH 2D3JA 3K81A 4Y5YC 3SPCA 2N7SA 4I3RL 2Q7YB 3LKRA 3L45A 2APTA 3MRQB 4FEIA 4J3XA 1KLFB 3W11D 1AZVA 2AJZB 2PW2B 4AV0A 4FI8A 4JN2B 4XNYL 3RVUC 3WN5A 3QUGA 3MA7B 5ITBL 4APQC 3BKML 1YEGH 1B9KA 4L3ED 2J57A 1JSYA 4P8QA 1LE5B 2AMGA 3ABZA 4O58H 4L8CA 1QSZA 4G3YH 4KXCA 2AJUL 1UKTA 2QPDB 2DQEH 1CE1L 2BRQA 4HW6A 5IG7A 3NSXA 4OZ4A 4PRAB 2XQYK 4X5QA 4FLSA 4NZRH 4M4RB 5I9QB 3BX7C 1MFAL 4JY4B 4BKLB 2ZP0T 4UAOB 3BWUC 4NUPA 4XNZB 1DVSA 1RU9H 2OMTA 3KYOA 3GBNH 5AD0B 1YPZB 4XO9A 5F9AC 4KQ0A 3ZDWA 4UQBA 3K3QA 2P8MA 3QPQC 4K8RH 3R7RA 1GC1H 1S7UA 2YMTA 4OCYH 4A39A 4Y19A 6PCYA 3B1UA 2E6PA 4R7LA 4KAQH 1WCQA 5B4MC 1D5XB 4BSWB 1YEDB 1I1RA 1GH7A 1NMBH 1U3HA 1ZHBB 2FJGA 4KTGA 1WBZA 1BD2B 2X5PA 1IB5A 4RDQF 3IE4A 1MNUL 2WLYA 2ZNWA 4H26B 2A6JA 2VDLB 3TA3D 4Y2LA 4F8LA 1LNUA 5TE7L 3TEYA 4AM0A 1BXVA 5EU3A 3FT4B 5L2KB 1IQDB 3EYOA 4MBRA 5IUCA 4U1GC 4XXWA 4A2DA 5BZWB 3CBJB 1D5IH 4R4BB 4F2EA 1JF6A 2DL2A 4X0KA 2HFGH 4ELDA 4ZMLA 2DQMA 1YEJH 2XN1A 5C0IB 2JIXD 4XODA 1FNAA 5LG6A 1M6OA 1IBFA 4LSQL 1OE2A 1MAKA 3UJIH 5FGBC 4PGDB 1WBYA 4OFYD 2Z92B 4NCC1 4HJJH 1E2ZA 1QLEH 2KH2B 2NZ9C 3EHBB 3IGUA 3QIWC 3HS9A 4DETA 4H44C 5ABAA 3KD4A 4YBLB 4W6XB 3FAWA 3EYVB 2K8MA 5IR1A 2NTFB 3SDXF 4TMPA 2DM2A 1UVQA 4DQAA 2RAMA 1XCQB 1NL0L 3DV6B 3ULSB 4UDUB 4X7CC 1IBYA 4O2EB 2FH6A 5DFVD 1CLYH 5CCGE 1JZ2A 2IH1B 4F33B 1T0NB 1Y0LB 4ONOA 4GAJL 4LK4A 2R0WH 5LQBH 1UOLA 3O9WD 3EFOB 4LP5A 1ET8A 4ZTPH 2XZQL 3H9SA 1SQMA 2NUPA 4QOKD 3T71A 1EO8L 4HMEA 3C87A 4WWPA 4JO5A 4PJ9B 3KYMA 5DF0A 3C08H 4YPGB 5AZ2L 5ADOL 2XHNA 3FUHA 1F4YL 1G7MB 2QVKA 5CD3B 5E9DA 3TOPA 4P3CL 1JNHA 3P69A 1AQDA 4HC1L 5FA4A 2QQKH 2Z7WA 4PCTA 1JWSB 4Y2DA 5LGYA 3RWGA 5AVUB 1YEHL 3JTSB 4HV8A 5F71A 3NH7H 4WWOA 2EVJA 3FFDB 2BO0A 3AABA 4PTTB 2XWTB 2WPGA 4KZDH 1CXEA 1MG3C 3S3JA 5F7HA 2EDHA 5D1ZC 5D7SH 2YMXL 2V9QA 3PGFH 3RL2B 4HCRA 5D72H 1IAMA 2NSMA 3NSFA 4N2LA 4E9LA 1AI1H 4ODTL 4H8WC 1NIDA 2VXTL 1RPQA 3VFUB 3T4AC 5F1NB 3KYNA 3WEOA 1A9EA 4HKBA 5GGRB 2JKLA 3SDCC 5H35A 3OGOE 4X99B 3SJVA 1E5CA 3LS4L 3VGDA 4MJIE 3K71A 4Z76B 3FU7B 2VZOA 5KS9B 3WSQH 2A6DB 5DZOA 4QT5A 3PHQA 2H9GA 1BVNT 4KO7A 4GIOA 5IMMA 1DVFA 4TQPA 2IH9A 5IJBC 4H0GA 3MRJB 4EIBA 2YEVB 1ZV2A 3VA2C 3DXAE 4XO3A 3C6LA 3O8XB 4XVUD 3UTPE 4GAFB 4PJFA 2YOAA 2XC8A 5KANI 4HG4J 4GAYA 4XCCH 4YSUA 2O6DA 1CLCA 1HXYB 3P3RA 1NC4B 5EC2B 3V0AC 4AW7A 2ED7A 1FF5A 3BP6B 3PWPA 1B0IA 3FHAA 1UB5A 1HE8A 1BHGA 2E7CA 4UB0L 1E50A 1RZFL 1Z66A 4JFQB 3WNLA 4D9QD 4WLCA 5HJ3B 1SEQH 3LN9A 3SCMA 3GHPA 1BQRA 4A2GA 2X4PB 3B4NA 4L9LB 1Z5LA 4IRJB 1H3VA 4KRPD 5DD0H 5KN5B 3LVTA 4WNQA 5BRPA 4HWZA 1S7TA 2DS4A 4YFLF 1RHHA 3GXNA 4P9MH 3P4MA 3IB4A 1JGVL 2XTJE 4MDJA 4AENA 3M46A 1IAKB 1W16A 3UTSB 4AE1A 5I66B 5J1TC 1ROCA 1UB6A 4QHUA 5C08D 4OTXH 4MHHI 1JGUL 2Y1YA 4GOSA 5JIDA 1WAEA 5DWUH 3TGXA 1YEIL 3S96B 3KPSB 3SYOA 1I1AC 4K3JL 1MEXH 1NMCB 3GSXB 3HC3H 5DHVA 5I1EH 1E5AA 3TESA 3T8XA 3QARA 1I8IB 4F9LA 4HT1H 3U7WH 4U7KA 3S36H 35C8L 3U2SA 1YMHB 5DD3L 3L3JA 2PYFA 1R75A 3LOWA 3P77B 1PDKA 5C0BB 4HK0A 4F57L 2FQEA 2W0FB 5T3XD 1J87A 3SPIA 5LWYL 2WB1A 4FQJH 4XVJH 1QHQA 4ZUVA 1UM6L 1CVSC 2LT9A 3OLIA 3HBQA 5F89B 1P2CB 4Z5RB 5DRZB 2WQSA 1CBVL 4X80H 3LKQB 1ILUA 2AJXL 1Q9WA 4UZUA 4OGYH 2WV3A 1VKXA 5IB4A 5L9DH 5FM5M 3ALXA 3SZKC 3RGVB 4NQDA 4DP2X 1JCKA 5AVYB 1ROWA 1FVDA 3DJRA 2C3HA 1PSKH 1MLCB 2BSED 1QR1B 1KIRA 3QDMB 5MEQA 5F7YC 3V10A 4OLXH 4R96B 4FQLH 4R4FH 2DQGH 3TLRA 3VW3L 3S6CA 1RUKH 4GI8A 4BK5A 3VDAA 4JKPL 1MI5B 1N59A 2WSDA 3KLDA 4L8DB 2FATL 4L3CA 2EXTA 1F4WL 3UG3A 2WY3B 3FULA 4QHLA 5D7IB 5GZOC 3QG6B 4KOBA 4RH4A 1XSJA 3VSQA 2PR4L 1A7PH 4N2DA 3LRMA 1IM9B 3WJJC 4XMZA 5B8CC 1Q9OB 1D7CA 1X4ZA 1PFCA 4ZFGL 4Z7VE 1JK9B 3TFBA 1GYUA 4W9DC 2EC9T 2DW5A 1UWGL 5IB5A 3CZEA 4PGCA 1J9RA 1YUHA 3JUZA 4K3HA 5KJRL 2IMNA 3D7PA 3FO2B 4ZUUA 3NJIA 2Y23A 3TN0D 3WYRA 4J3OF 1GA2A 3GMLB 4MB3A 2X4UB 4KZ0A 4Z7VB 5CCJA 1W8EA 2IVFC 3CHXA 3Q3GA 2GTZB 3MV7E 4PGZA 1HINL 3F01A 1I3RA 5C3TA 2J2ZB 2EE0A 4J3OD 2ZTBA 5CZVL 1B2YA 4NN5C 2ZKMX 3OLEA 2GJJA 5GGVY 2DN7A 2AJ3B 4PJ7F 3HZVB 3WMPA 3VH8A 3KPLB 4JANB 3L5XL 4PRPA 5F9DC 3VXRD 1MIMH 1UEYA 4OCNC 4EEEA 3EYUL 3VGAC 4K9EL 3UJJL 1XGYH 4GRWH 3EAKA 3KWUA 2V7NA 4ZX3A 4JDZA 3VRLE 1V55B 3MRIA 3V4VB 1DYZA 1ZSDA 1F2XK 4H13C 1B90A 3ZO9A 4JFYB 1R17A 2YHGA 1B0WA 1KB9K 3BH9B 1OTTD 2EXWC 2YEZA 3QBTB 1A1OB 4FULA 1C16A 2CO2A 1HH6B 4IEFA 3NPSC 5JMOC 4D9LL 4A38A 2YAQA 2HTLC 4KMTL 1RPKA 2JWYA 5DQJB 1F97A 2CUHA 3D09A 5G4NA 2JI2A 4LZKA 1OANA 2KZWA 3BUPA 1HSBA 1U8CB 4EZKA 4N9GA 1DVTA 1KLUA 5F96L 1JNLL 2ENQA 3MRFB 2AXHA 5EN3A 4I3RH 2J6EA 4KK9D 5FUCC 5HHNB 3TA4D 5GXBB 1A8JH 5DJAB 5CWSA 1EXGA 4JPKL 2ZWNA 3B2UD 4X5XA 4ISVA 5LDUA 3E1ZA 3IYLW 3N06B 3BKMH 2B59A 4IBYA 2VM9A 3DGCR 4WW2A 5FWQA 5I75B 3WDJA 1UTDA 3FCBA 3G9AB 4S1SL 3VWJB 4L2LA 3WTUA 1B9ZA 1NBZB 3FYIB 2IWFA 2YD3A 2AJUH 1RZ8A 3MR9A 3QHZL 2PLTA 1KTCA 1PLBA 3FQ4A 1CE1H 5CMAB 3TM6A 3ETBF 3L3IB 2F0CA 3S4SA 3WKNA 1GOFA 2GSIA 1ECZA 2F19H 4OLZL 4F9PA 1BZ7B 5DK0A 3RLSA 1JWUA 4DO4A 1TITA 1E6JL 1NH6A 2C4XA 4E42A 3P4OA 5GHWL 3NJFA 1MFAH 2HWZH 1N7ML 4RLDA 4JFFD 1M7UA 5INDB 4YNYB 4UM8A 1R3KA 2B1HH 2EXSA 1XT5A 5HVFB 1EO5A 1FGNH 3FCUB 3AQXA 3CFUA 1ZA6A 2WWNA 2Q2LA 4AEFA 3P40A 4Z3HA 2ZOLA 5FPIA 3I6GB 3H9YA 3HI1A 5D2LA 1YAZA 2RJMA 3MXWL 2ZUSA 1FCGA 2GBTA 4D94A 3SQBA 3MCG1 2GABA 1U3YA 4U1LB 3VXUA 2EYTA 4LB8A 1A4BA 4TRPH 1EJFA 2AAAA 4PJBE 3QDGD 2KHAA 5D2NA 4XNXL 3DTXA 2WLJA 3FFCA 3QQNA 3QNZA 5FHBH 2VN6A 3DVGB 1R34A 3CDFA 3DUSB 4Y4FA 3E6HA 1HK6A 3K6FA 2GUOB 1S7VA 4YHNA 4B7IA 4Z0XA 1KLGB 3MGOA 4HLJA 3UG4A 2W60A 4LSQH 2J44A 4FQXA 4WY7L 3TT1L 4LEOB 4G9FD 3MRHA 1ZLUH 4JQIL 4TQ8A 2OCJA 2FWLB 1U21A 1QFWI 2R69L 3Q9PA 3GLAA 3NFPB 2B16A 1VEMA 3PL6C 4PV8B 4WV1C 4YSCA 2DD8L 4WDIB 1H3PH 4XB7A 2ZCHH 4DPRA 1FFTB 3P4LA 1GGIL 2CLZB 1A7QL 5DEJA 3LNHA 5I1DA 2JXMB 1NL0H 1FNEA 1UKQA 4L1LA 4NWTH 5F7UA 2VUYA 1A3RL 1KGYE 2DM4A 5CCKH 1GPOL 4ZW3A 2XZCL 3O2DA 2P45B 4GQQA 2F1AA 1KB3A 2B3IA 3VXSA 4GAJH 1P4IL 5CGYD 3K8LA 2EEXA 4Z7IA 4X4YB 3ZKXC 1KCUL 2OMXB 5DUPL 1J0JA 2DBLH 3AQZA 2XZQH 3JUYA 5HYIA 3OXSB 3IJYA 5D71L 1EO8H 2VR8A 1I1CA 2VIRA 3EGXA 3LXUX 4CJ0A 1G1OA 1IJ9A 2YA0A 3HUJE 3V5KB 5JYLA 3G5XB 3JQOB 2ZP9A 1KCLA 5AZ2H 3NCCB 3DO7A 3BP7A 4XN9A 4R5XA 1F4YH 2VDOB 3DHPA 4J8QA 4JAMA 5SX4H 1N6QL 3IFLL 4G7QB 3B37A 4P3CH 4HC1H 5DMIH 2JJTA 3HLKA 3DO4A 3GSNL 2ZXGA 1WBXA 3MREA 1YEHH 1FFOA 3BLBA 3I6LD 2BH0A 4XC1L 5B38B 3NZ8B 4LVHC 3QWRA 1U3HD 5BZZA 5EU6A 3L2MA 5EIIB 4CSPA 3O2VL 3IWUA 4LPVA 1J12A 3LVEA 1JPST 2QLYA 1BZDA 1B88A 2JQAA 2YMXH 1FZKB 3U9WA 4U2YA 2XIIA 4FXLA 1TVBB 2YPVA 4IRSB 2MEJB 1EZSA 4NPYA 3Q2NA 5INCA 4MJ5A 3QEUA 5DEZA 4OLVL 5I30H 1KCKA 1UT1A 3BT0A 4JRYA 1K8DB 4OM1L 3F12B 2B8OT 1TOXA 2YKKA 5IV2A 2V2TB 4U0QB 2P46B 3BESR 3EBAA 5F9JA 5F7WC 1NBQA 4JFTA 1YSOA 5FYLE 2ILLA 2YA2A 5E00B 5HDBE 1H0DB 1TEFA 2R2HA 1BJ1H 5HI4C 3SYQA 5CCHE 1EHNA 4BQCA 1JF5A 3NA9L 1BQUA 1JUFA 4Y4KB 3HRZC 3CVHB 4CADA 5AVSB 5HP5A 1NGXA 1QSEB 1QBBA 4HIPA 2IF7A 5IEHB 5IBLD 3RFZA 4XWGL 5D1XE 5T3XL 4O51A 1RZFH 4QJ4B 5CINH 3AG2B 2AF2A 2H1XA 4OCLC 1CLVA 3HAEB 1YNTA 3S3SA 1JYNA 3OR6A 1DQVA 1KJVA 2I9TA 3Q1SH 4UM9B 4Q6IC 3N44B 1A1MA 2ZCLL 1Y18B 2OMNA 2E3VA 2CKBB 5G5DB 4U1IB 4TVPE 1WPCA 1JGVH 3D48R 4KX8A 3H9SD 4QCIB 3UTTB 5HI5D 2W9EL 5E5MB 5J6GB 4RSVA 3WJMB 2IPKB 4P2CG 1JGUH 2Q7YA 1JF1B 4TF4A 4YX2L 1TTCA 3MRQA 2B4CL 3GK8L 1KLFA 1MCDA 2PW2A 1YEIH 1X5XA 3C9NB 4JN2A 3K91A 4K3JH 3D3VE 5HVWA 3BVNB 3MA7A 3LEYL 4FJ6A 3U36B 2QBWA 5DMGD 1JHLL 3HMXA 1KFGA 4J2QA 4KO9A 3MVSA 4G42B 5AW2B 35C8H 1BXAA 5DD3H 3T6WA 3X1BA 2IANE 1LE5A 4Y2DD 2WWKT 4C4KT 2BJMH 4F57H 3S5LG 2XT1B 3OC5A 3GXTA 2R4SL 5LWYH 3KMDA 1ZPUA 4MMXB 2WINB 2R4RL 1MW1A 2IANB 4M7LT 4PLOB 4PRAA 4BSVB 1B4TA 3GMQB 1NUFA 1CU4L 4ADIA 2V33A 1CBVH 4M4RA 4XOBA 2EEBA 2QV4A 2GTWB 3FSVA 5AW6B 3EFDL 2P80A 2OR7A 4JY4A 2CCWA 3ABKB 1XTMA 3CJJA 3O9WC 4UYPA 1L7TL 2OS7A 4HIXL 5IREA 1YPZA 2MIZA 4WHDA 3SJVD 1EK3A 3V52L 5CGTA 3GSOA 3HKZA 1E8ZA 2F1BA 4PWIA 1ZRUA 2BXZA 3QYMA 1AR2A 1KF9B 1DCEA 4BEIA 1D5XA 4BSWA 1YEDA 5FECA 3A4FA 4PJFF 3GJFK 1DVFD 3U83A 2R59A 3VW3H 4H26A 3C6LD 1USZA 4PJ8B 3T3PE 2VR9A 3L4CA 4FMFA 3NFSL 2FATH 3ES6B 1F4WH 3L9YA 5FUOH 3FT4A 4JJHA 3T09A 3PWPD 2VL4A 5AB0A 5BZWA 4DH2A 1TF4A 4R4BA 3UGXA 3VXME 2XQ0A 1BQ5A 3SCMD 3A21A 3IFOB 4ZFGH 5C0IA 3GRWA 2ZCKL 4AT6B 5EOCJ 4PLKD 1UWGH 5AG9A 4PRIB 3GM0A 5KJRH 3LEVH 4PJGE 2COVD 4PGDA 3S3PA 4EKJA 4NKOA 2CA3A 4KQ3H 2ZWKA 3ZMNA 4BQ9A 5CJ5A 4ZODA 5C0GB 1HINH 2GEEA 3KW8A 2QSCH 4FQPA 2VDRL 1QX1A 1MZYA 1AG0A 4WQOA 4F15B 3EYVA 1LYQA 2NTFA 4PJGB 1HFUA 1IBGL 2YFOA 1BVLB 3T6XA 2Y6SC 3L5XH 1IM3A 3WXWL 3DV6A 3ULSA 3EYUH 3MDJA 4MA7L 4UDUA 4FFZA 5ID0B 5TTRA 3ABLB 2WLLB 4A2HA 2NY1D 2A0LD 4F33A 3KPOA 1G7QB 3ARRA 3QK0A 2WBXA 1K85A 2E74C 3CXHJ 3F6LA 5FDYA 3OQ3B 2VKWA 2P42B 3EFOA 4JL1A 4D9LH 4N8VB 2BP5M 1UCTA 2ICEB 4AQZA 1EANA 4HH9B 4PWJA 4QTIL 5FV2A 3SKJL 2FECI 2FYYB 4PJ9A 4IKIA 1J11A 2FEEI 3KGTA 5E8OB 3UZEC 1HZHH 4YPGA 4JPKH 4RVBA 2NY6C 2VDPL 1U91B 1G7MA 5DEGB 5CD3A 1H8OA 4AX3A 2RBLA 4QKXB 2JVUA 5SWZE 4NQDD 3UO1L 4QTHB 3Q2CA 3L3KB 2P5ED 3ENEA 1JWSA 2WQAA 3F6JA 4S1SH 1JPSL 3DRQB 3FN0L 4XNUL 3MBEB 3CVBA 1OTUC 3S7GA 4KVPA 3FFDA 4N2CA 2K8QA 3RU8L 1CQKA 3UDWC 4PTTA 3LY6A 3QHZH 1P0SE 1QYGL 1P5UA 4GKNB 4M93B 3RL2A 5C0NC 5IJKC 2IO5A 4Y8AA 1E6JH 4Y2OB 2H8PB 3DDGA 5GHWH 3QIBB 1N7MH 3LZOA 3VFUA 3LZPA 5EBLB 2XVLA 4WUUE 5F1NA 1AS7A 5GGRA 4AZUA 3L4VA 3MNWB 3PNRB 1KGCE 2NR6C 4XCFL 3RKDC 4B9ZA 4N5UA 4O02A 3Q2LA 1QBML 4Z76A 3FU7A 3RURA 2WBKA 3D4ZA 2QKIB 2LLLA 1VCBC 1E3XA 1AHWC 3NP4A 3MRJA 3VYPA 3MXWH 3GS0A 4HUWB 4MD5B 3O8XA 2V2XA 4L4VB 2VSDA 4ZMZA 2HVKB 1HXYA 4D0CB 5EC2A 2Y1ZA 4L4JA 4XNXH 3B7TA 3BP6A 4ELME 2EIZB 3QJRB 2AI0L 2VR7A 4ORGB 1JERA 4PRPD 4MQXD 3G6JE 3WKQA 1U8KB 2B4CC 3JV4A 2QQNH 4JFQA 4A7SA 5AG8A 2A4ZA 5HJ3A 3FUNA 4OQTA 2X4PA 2YQ2A 4YEFA 4N2HA 4QJ5B 1J8HE 4HWBA 5HVHC 4ONFL 3GIZL 3THML 2CXGA 3OPUA 4BFIB 3E80A 4XPFL 4X8JB 3QJHB 3HVDA 2B3RA 2DH2A 3G08B 3NCYS 3TT1H 3I74A 4OGXL 4JQIH 1IAKA 2WSPA 4KI1A 4RWYL 3AWGA 5I66A 2R69H 4X0NA 5IMOB 3RZWA 1WTGT 4AC4A 2DQDL 4ZO7A 5EEYA 5BV7B 2DD8H 4EQ3A 2CPUA 3S96A 2H2SC 2H7WA 1DVUA 2GG1A 3KPSA 3QQ4B 5F6HI 1GGIH 2J55A 1A7QH 5E1IA 4P2OB 2WZ6A 4XOAA 3VFNB 4WW2F 3FUMA 3I3DA 2X9YA 3VXPB 1I8IA 1FO0L 3LZFL 1A3RH 2XOTA 5JOEA 3N1MC 1GPOH 2ICWJ 3AS0A 3QUYB 2XZCH 1ZLVH 4Q8BA 1S3RA 5CHNB 2N7BA 3TO2A 3P77A 4M7LL 1I82A 2W38A 3WTXA 1ANUA 1PG7X 2W0FA 4ZS6D 1KCUH 4PJIE 5DUPH 5IROC 1EDHA 1YN7B 2AQSA 5JIIA 1B0RB 2KS0A 5L4JA 1TVHA 1D5BB 5D71H 1IBZA 1P2CA 4Z5RA 2OJEB 4CSTA 4LBEA 5DRZA 1XGRB 4ENZA 1RJYB 3LKQA 1QWHA 4X6BB 1D2PA 5D4HA 5DS2A 2EEFA 3RTQC 1IQWL 1OTTC 2O6FA 2JV6A 4N8CL 3RGVA 4Z7NB 1HU8A 4PJ5B 3F8UB 1N6QH 3IFLH 3W39B 4JGUA 4FNRA 4HF5L 3PV7A 2JCCB 3GSNH 4WU5A 4RA3A 1ID2A 1H6EA 1MLCA 4Y5XA 5D2LF 5FW6A 4B97A 1QR1A 3E9UA 2BDNL 2LU4A 4XC1H 3LN5A 4KK9C 5ELIA 1OZTG 3KBHE 1EWHA 4R96A 5MEOB 2Y5EA 4EQ2A 1F45A 4HVBA 1ZLWH 4L23A 4N1EA 1TTBA 2MOQA 32C2B 1S7WB 2NQDA 4L8DA 3VXUD 4XVOA 1A14L 1F3JB 1FL5B 1QUNB 3PQYE 2EUWA 3CHQA 4QLRA 3D06A 4G5AA 4F37F 1EV2E 1GZHC 5D7IA 1LVEA 3QG6A 3AY2A 1TQBC 4FGMA 1FFQA 4HGMA 1LE9B 3RGHA 5JZ7D 4YZWA 4OLVH 4NRYB 1IM9A 2ZUVA 5C0AE 3IGAB 1Q9OA 4LCCC 3DX3A 1N6VA 4FI6A 2IPUG 4Y4FD 1JK9A 3VSUA 4KMQA 4LDCA 4L8SA 4AYFB 1OAXL 2ZX9A 3M88A 5KBDA 3S9DB 4OCWL 4FQXD 3FSZA 4PBVC 3V0FA 4A55A 4QXUL 5DYFA 3L8QA 4AQ8C 3GMLA 3NIFB 2X4UA 4Z7VA 2WP3O 4MNGE 2GTZA 2ZWYA 2J2ZA 1T66C 4JHAL 4OFDA 3I75B 5EZOH 2BSBA 4AMKL 2AJ3A 2WAHA 3ZYJA 3HZVA 3LNIA 3KPLA 4JANA 1X5HA 3QI9C 2NX5B 1OTSD 4XWGH 5T3XH 3V0VB 4ZMQA 1DUZB 2V9RA 3U6XS 1KXQA 3V4VA 4GW4B 1HNFA 5HDRA 4NQEB 5C70A 4P2QE 4JFYA 4XMLH 3UPCA 4B95C 2O1AA 3N42F 4HCRL 5AB9A 4U3CA 1D3CA 3VXSD 4D0DA 3MC0A 2X1XR 1A1OA 4OJDH 1BZQK 2ZCLH 1HH6A 1XAUA 4AEEA 3OAUH 4TSAL 3GD1C 3FQTB 4M5TA 1SOQA 5CLTA 1P9MC 5DQJA 3S34L 3X3GL 3ZKND 5A2FA 3OC8A 3CVIL 2W9EH 3C6SB 2E0PA 3MRFA 3CN4A 3ZGIA 3JWDL 4YAQA 2B4CH 5F44A 5EOCL 2XA8H 1XF3A 2DWEA 1K4DB 1RZ7H 3LNDA 3Q2VA 1T2XA 1T1YB 4M9PA 2WCGA 3OHMB 5DZNA 5I1GH 3EBHA 3LEYH 4Y5VB 4A6YH 1JHLH 3EH3B 1HL4A 1UJTA 2JKWA 3EGDB 4UMSA 3BUBA 3CSTA 3FK3A 1S5HA 3BRDA 1A6ZB 3A6BL 3GSUB 4QWWC 4TKWA 1Y07A 4N3TA 3QWRD 2C9AA 1BEYL 2R4SH 4LMQI 4PCYA 5EU6D 3VAEA 4B9CA 1RPUA 2R4RH 3WLWD 2X05A 1VGEL 1GR7A 1P7KA 2NDGA 3L3IA 5J7CC 5JXEA 1F6AB 2O6PA 5E9AA 5I1KH 5DO8A 3T3MB 4G83A 4YHZL 1MCCA 1O7DE 1HT6A 1KJ2B 3MJ7B 4WIQA 5I2IB 5LCVA 4JJ5B 4IMKA 4KROB 3EFDH 3P2BA 1AQKH 2D03H 4YDJB 1FLRL 3L54A 5CGYC 5INDA 4YNYA 4JRYD 3M7OA 4N2GA 4WNSA 5BS0E 4GRMB 1QWUA 3CK0L 4HIXH 2SEBB 4KPHL 1N18A 2NY4C 1KT2B 3QZPA 4U1MB 4LEBA 3RBGA 3OKLB 3UADA 1RXLA 4U1KA 5KVDE 2CA4A 2NXZD 3BD4A 2V2WB 3I6GA 4HIQA 3VVWA 5C9JA 1N4XL 5A2CA 4V1DB 4ATWA 2DEXX 5I16B 2E86A 3CLEL 5KZCB 1EJ8A 4U1LA 3EIFA 2AXJA 5DD6B 5EO1B 4PD4J 5F7NC 3VGFA 4AYEC 3NFSH 1KJMB 1M9SA 2R1WA 2XFXB 3X17A 3UZVB 3U1QA 3CSFA 1F90H 2YUZA 4OJFL 4WFGD 5HXMA 1UXLA 2PXYB 1YNTF 4GG6B 3FTVA 3MOBL 1MPAL 1DLFL 1BLNB 3DVGA 3MZGB 3DUSA 3NVQA 4N2IA 2RQ8A 1U3HC 2GUOA 2ZCKH 1KLGA 5T33H 4MXVF 2HMID 4OJEH 4AMWA 1DQIA 1Z5YD 2C9UA 3O81A 1NA8A 4KY2A 4L48A 5AVQB 4G8GB 4LEOA 5CF3A 1IGFL 4GBXB 3ECWA 1AHMA 1RL1A 3AWFA 2AQ2A 5IB1A 5KAQF 1BJ8A 5GSVA 1MRDH 1VLXA 4XGZB 4M7ZB 1CGWA 2Y1AA 3DPDA 4U6XB 4PV8A 5H37G 4IJ3C 2W95A 3CZSA 1PY0A 4X9HA 3T0XA 5IMLB 3GRBA 3H55A 4NOBA 1IBGH 3VD2A 1OARH 2CLZA 2GJZB 3ESUF 3MBXH 2JXMA 2VM4A 3GYRA 4MA7H 5TDNA 1HEJC 2XWRA 3WE6B 1KGIA 2LLGA 4UT6A 4Y8DC 1QLRB 4UQ3B 4B9YA 3TO4B 3MRBB 1E7UA 2BHZA 1ZVHA 1TLMA 4YSAA 1ET7A 4JQVC 1EO7A 2G2NA 4XBMA 1W0YT 3C60B 4QTIH 4FS0A 3SKJH 1VZHA 4DK5A 4FNTA 4K71C 5AYUL 3V5KA 5D93C 5J1AB 1FA4A 1UM5H 1WS8A 3N91A 3TH2T 2FLBT 1YPZF 2VDPH 4HX1B 3QUKB 1GHFL 1AQMA 3EJUA 3Q06A 4GLRH 3KPRE 3UO1H 1X9RA 1R5IB 3VSVA 5IUSA 5FEBA 1VHPA 4IU2B 2J12B 5SWSB 5EOQL 2WZPA 3TEXA 1L0YA 3HG4A 3FN0H 1B3JA 4XNUH 3NPZB 5B38A 1WWAX 1QKZH 2EUXA 1NANH 4Y1TA 4UIMB 2N7AA 3NZ8A 3ARUA 3HLAB 4WEBH 3A47A 3PGDA 3H1ZA 5EIIA 3HOGA 4XMXA 3MV9E 3OAZK 4QYAA 1E5ZA 1AOHA 2HG0A 1QYGH 1TSHA 3T8MA 1FZKA 2EKSB 4AGQA 2BIPA 5ETUB 4DVRH 3UC0L 1QPKA 1TVBA 4IRSA 3H0TA 1XH2A 4GMSH 3HMWL 1XL6A 4Y2DC 3FQNA 3BT2L 3BZFB 3T9WA 3P73B 3ULVF 3F12A 3SPVB 4UOQA 2IADB 4XCFH 4YDMA 3J8F7 5CLWA 1AANA 5C0DB 1QBMH 2J6EL 5B22A 4X7TA 4EUPH 3ULVD 3VGEA 5D70L 3SKMB 1HL5A 3DTDA 3INUL 2R29L 4C58B 3KL5A 1UOVA 3KJ6L 5E00A 3NJLA 1H0DA 1WCBA 3EHBD 3MO1A 5IEKB 5IQMA 4HH8A 3DIDA 2Z91B 1ZT4B 2IQ9L 4GKZB 4Y4KA 1KSRA 1A6UL 1QSEA 4GSDL 1BOGB 3QWOB 1AVAA 1YAIA 4F93B 5IEHA 2AI0H 3T2NL 2AEPL 3W2DL 3GMPB 4R6UA 2VR3A 5JW3H 3ARXA 1DTUA 1MW0A 2OK0L 4CBZA 3OPZL 1KPVA 3DHJA 1NCBL 5D9SB 2O26U 2PTTB 3OG4B 3KLHD 4ONFH 4RRPA 4UM9A 3GIZH 3THMH 1TYEB 3HI5L 1WEJH 3QZBA 1MJ7H 2NLJB 3C6LC 4JKLA 3AC0A 4XPFH 1QZNA 1CZ8L 5HGGS 3V6ZB 2CKBA 4U1IA 3WS6A 4OGXH 5C8JB 4RWYH 3UTTA 2DICA 4KUZH 5J6GA 4NQSB 2DQDH 2IPKA 1KV7A 5AOIA 1JF1A 4PJ9D 1MCOH 5K9QG 1D2OA 3B2PA 2D7PA 2WD0A 2YLKA 3C9NA 1O75A 3DIFB 4HISA 4LVNC 4PLKC 4RMWA 4WSKA 5JHMA 3VFMB 2OJZH 4Q9QL 3BVNA 3H54A 5FLUA 1U8OB 3UBXG 3U36A 1HOEA 3HG2A 1T1ZA 2FO4B 1FO0H 4G42A 2F5BL 5KVGE 1UD6A 1AJ7L 4HU8A 1FFRA 3IWVA 3R19A 2Q20A 2DEWX 4Q97A 3VG9B 4M7LH 3WG7B 3WFEL 1QQDB 1XX9C 3APCA 4EO5A 5J57B 5IFJA 1K3ZA 1J8KA 4MMXA 4PM1A 2G9KA 2CU9A 2C1PA 1WAAA 4FRWA 2IANA 4QHKI 1CC3A 4ANWA 3OZLA 4BSVA 2ED6A 4GI9A 1IIIA 3GMQA 4RISH 3H42L 4PG2A 5IZ7A 2GTWA 3BE1H 1S5IL 5JOPD 5FKPB 1RH8A 5FYJH 4AKPA 3EOTL 4PR5A 5A7BA 2ENYA 4N8CH 3DBSA 2UZIL 4YBHA 1FGVL 4HIIB 1IGYB 1MFEL 1OAYL 4HOWA 5A43C 1BBDH 4WKZB 3ZE0E 3WIHA 43C9A 5E8NB 2BMKB 3QRGL 2FB4H 3BWAA 1MQ8A 3ECBB 2BDNH 4YSTA 2VDQH 4GXUN 5C2UB 1P4LA 3TBYB 2DM3A 3IJEA 5E8EB 3FFOA 3QYCA 4FNLL 4UV4L 4BFRA 3O8XD 3GKZA 4HZ1A 2DQJL 4PJ8A 2QDVA 3A67L 3O2DL 4M03A 4QRQB 4WGKA 3ZVVA 1FL3B 2VLKE 2AABL 2Z4TA 3ES6A 5KSAB 4ABUA 1NC4D 1EUUA 1FVEB 2IV9A 3S36X 1P4BL 4HKZB 4M48L 2UUDK 2BY1A 3DMMC 4D9RD 4F7KA 1HH9B 1AFVL 3QO1B 5DT1L 3H6JA 1QFUH 4JM0A 1YMMB 2CNYA 2YD1A 2RR3A 3IFOA 2UWEB 1WC7B 4IRJD 1ZK5A 3QUZB 4LVOB 2ITCB 5G55A 2WNKA 3U2JA 4Z78A 4KUCF 1T03L 4BK5C 4R0LC 3TEZA 1OAXH 4PRIA 1GJUA 2UY7B 3OZKA 4XN4A 3W9DB 4OCWH 4XMVA 4YN3A 1G7JB 4CVZA 4QXUH 2BNRB 4KUCD 3TBWB 3O3EB 2F8VA 3DSNB 2LGNA 3COOA 5C0GA 3UTSD 4FTVE 4OIFA 3O4LE 1X4YA 4JHAH 5SV4A 3ZDXB 5HYFA 1HKFA 4BIKA 5I0VA 4LNRB 1GGYA 5ESAB 4PJGA 1E28B 3B3IA 4BFEA 1BVLA 2X2UA 3IGFA 3KPSD 4C4UA 4WK0B 2Z8WC 4G7VL 4I2XE 4J3BA 4X5RA 2DWTA 2EO9A 1BVOA 5ID0A 1WWWX 2J5LB 4NKMB 4WUKL 3ZHLA 5J1SC 3PJLA 4K7FB 1G7HB 5DO2C 1R3HB 1WFMA 4RGMB 4UF7C 2TSBA 2F1EA 5D7JB 4ONGL 4YC2B 1A7OL 4NERA 4HCRH 1UGKA 1WUZA 4FABL 2YPVL 4ATTA 4FQ2L 4OD1L 1R3JB 1PY4A 4JPVL 2I25N 4N8VA 4IKJA 4TSAH 1IBBA 3BISA 4BM7A 4ICXA 3MUHL 1L9RA 2IWGA 2ICEA 3X3GH 1SGKA 1JPGB 3DLQR 4X4XA 2BP8B 5E6IB 3CVIH 3D05A 4ZBJA 2PYEB 1TJXA 3V9EA 3F00A 2WTOA 1VFUA 2G75A 5E0QA 2FYYA 1T7VA 4J3UA 3OKNB 4FADA 2CCLA 5EOCH 4XRCB 4NRXB 3HG3A 1F6LL 3DV4A 3GZQA 1PVHA 1U91A 5DEGA 1ESOA 1LTXA 4O4YL 3RGVD 4KZCA 1TCMA 1V7ML 3D39E 3L3KA 1G0YR 3PPEA 2Z8VC 2BNQB 1E5BA 3BVUA 4GG8B 3ZHKA 1UADC 3DRQA 4W9KC 3TIDB 5HGHB 2IALB 5EBMB 4N5ED 3MBEA 3QDMD 4KJWC 3A6BH 2P24B 4KHXL 4H8HA 1VFMA 1BEYH 3MLPA 1A22B 4M5YL 2BW4A 1OQXA 4K23L 4YK4C 5D7IF 4Z8FL 1VGEH 1MI5D 3N0PB 3EBIA 1RERA 4YBQD 3TZVB 4GKNA 5GRJL 1XB6A 1ZTXE 2E9BA 4YHZH 3H3PL 2H8PA 4Y2OA 4BA0A 2VDNL 4D2NA 1G43A 2VLJE 5LUMA 4G59C 3QIBA 1IM9D 1FLRH 1Z9LA 2ZE0A 1RSFA 4F8PA 1HXKA 5DFTA 2GCYB 3CK0H 3MNWA 3ZKMD 3C8KA 2MKLC 4KPHH 2J1WA 1X7QA 2MQGA 4LPXA 5AAPA 1H15B 4J4PA 1Q9LB 1O6TA 2VLJB 3CLFL 2C9XA 3CXFA 1YYCA 4Z7VF 1QI3A 4MNQB 4ODVH 2QKIA 1ETZB 1OCRB 1Z3RA 4ENEC 1N4XH 4HUWA 3HMXL 2FBJL 4MD5A 3CLEH 2Z7UA 4JJOA 4KRLB 4L4VA 4NZJA 3QJUB 1VPOL 4U3SA 4UNIA 2HVKA 2IMMA 2XXMB 4PBDA 2WWMD 1Q1JL 5IHUL 3GBEA 2EIZA 3MROB 4DAGL 3LTVA 4ORGA 5KG9B 4OJFH 4I4WB 4J3WA 1U8KA 3C09B 5AVXB 1MPAH 1OT1A 1DLFH 1AZUA 2OTPA 1DVZA 4YE4H 4Z9KB 1QTYT 1NGPL 5JMRA 2KQMA 4LRNH 2IBZY 1J1PL 1OLZA 3CN3A 3SE3C 3ZE2B 1VACB 4BFIA 2FLRT 4X8JA 3G08A 1MFVA 3R4DA 1UACL 1IGFH 3KPNB 3IJ7A 1AMYA 5IMOA 1NIFA 2WKLA 4R8WL 1OE1A 4KWUA 4WI8A 4ES9A 1LO0L 1WO2A 3QQ4A 2VT0A 3SGDI 4P2OA 3VFNA 2I07A 3SY6A 1SHMA 4P5KB 1AO7B 4OCRL 3FCSB 3RIAK 2VDLL 1SF3A 2MQ0A 3OQRA 3QUYA 4X9FA 4F2ME 3VWJD 5IIEB 3QH3B 3N85L 5CHNA 1YJDL 4ZOEA 4C54A 1VADB 1AMXA 3AM8A 2EVFA 2XQYA 5HGBB 3TF4A 1YN7A 5F7BA 1JPEA 1U9KA 1B0RA 3FXIC 3JV5A 3LNEA 3WNIA 4KNQA 4B60A 3GRWL 2OJEA 1OAQL 3ZT5A 5JXED 1YY9D 3OB0H 3B9KB 2DTML 3ULVL 1RJYA 5AYUH 4PJIA 1PPIA 5DDHB 3D0VA 4X6BA 5EPMB 1BBJB 3ISYA 1MCPL 2X53A 4NEHB 3VFPB 4TL4A 1GHFH 4PJ5A 2QPEB 2YQ3A 4JZNB 3MBWB 3GJFB 4EPSA 1H9VA 1UYWL 2XNAB 3OR7B 5EOQH 1FE8H 4JO1L 5IQ7L 4C4BA 2NPLX 2QHLA 3LXBA 2GPZA 4FFZL 5MEOA 3U0WL 3RWCB 32C2A 1S7WA 4LPUA 4DP8X 2FX9L 3PNWB 1QUNA 1FL5A 3F83A 2RQEA 5HYQB 1QFPA 1A0QL 2A74A 2VITA 4MB5A 3T2OA 3HMWH 4NRYA 3VFGL 3W9EA 3PWJB 5I5RA 1LO3H 1I3GL 1Q94B 4TQEL 1CFSB 3SYCA 4JFHE 2J6EH 2PTVA 4GIPD 2MWCA 2FGWH 5D70H 1J8RA 2R29H 5SX5H 3KJ6H 2I9LB 1TQUA 3H2WA 2DLGA 3QNYA 4AUUA 1OAJA 2BVPA 3N1QC 2C4FT 3I75A 2IQ9H 1G6RL 2YN5A 1J5OL 1A5FL 3QXDA 4LLMA 4MCNA 3WAJA 3EH1A 3KCPB 1P84K 2Q7AA 4MHHG 3RTLA 4HU2A 3HW7A 2NW2B 2NX5A 4RGNE 3T2NH 3V0VA 4NM4L 3W2DH 1DUZA 3WHE1 1CD9B 4I9XA 1HI6B 4ZFOL 5A7EA 1CWVA 5A6IA 1OSPL 4CDGC 2OK0H 4I1RA 1NCBH 4GW4A 4GQ9L 1WA2X 4HUUA 4EIUA 3ZYIA 1E9OB 1T80A 4NQEA 2WLKA 5HDQL 4PJXE 5KSVB 3HI5H 4X98A 5E24E 4M62L 1QUPA 3KPPB 4WHYG 4PY8I 3B9EA 1CZ8H 1F00I 2X6MA 5DA0B 1KEML 5FYJU 3LX9A 2MOGA 5IHBA 2N3JA 5TJWK 2VZ3A 1U33A 5C07E 4RAUA 4DZBA 4QNPE 4TOYL 4W9IC 3NJNA 4DO6A 3C6SA 4HCGA 4O02L 4CC4C 4OZHE 3WKMH 5FYKD 3Q8BA 1NAML 5FV1L 5BVPL 4I9WE 4OB5L 1K4DA 2B2XH 3P4NB 2HMIC 4Q9QH 3RBSA 5DJXB 2YKLH 4Y5VA 4TYUA 1CS6A 1JYWA 1LEIA 2F5BH 5DQ9B 1AJ7H 1OALA 3EGDA 3LKPA 4F5CE 1MRFL 5IW1B 1AACA 4A2EA 2X3AA 4X6CE 2WZPD 3UX9B 4PV1C 3GSUA 4PJEE 3GUFA 3TNNA 5IW6B 1Q72L 2ZWZA 4TVSa 5BJTA 4P5TC 1AKPA 4ANKA 5GS1C 4OQTL 5LN8A 4K73A 1SLXA 3QORB 4HWBL 4UMGA 3CLWA 5KOMC 4X6CB 3K6SB 1YEKL 1F6AA 1PZ2A 3O3AB 1INDL 3H42H 5EBWA 2HX7A 1KJ2A 2YFNA 3MJ7A 5ABDE 1S5IH 4IRSD 4JJ5A 5DUML 5I2IA 5IB2B 1FH5L 1OB0A 1KIUA 4M3JA 4DP5X 4Z77A 3AWEA 2UZIH 2SEBA 1FGVH 1T83A 1MFEH 4FQCH 3Q5TA 2PMZA 5D7KE 5AKVA 2VW7A 1IJNA 3RNQB 3OKLA 4OJYA 1A4JB 3VB8A 3L4TA 3NDYE 3DX0A 4PJCE 3GXMA 4V1DA 3OWEA 2WK2A 2ZCZA 3DX9B 3FT2B 3MLZL 5I16A 3LPGA 4M5SA 4HD5A 5DD6A 5BO1H 5EO1A 1IE5A 2DQJH 4TSBL 3QFDB 4KXDA 5EFIB 3VGHA 1KJMA 4Y4KD 2XFXA 5FYLD 3O0LA 2X70B 5HHOB 1JIBA 1QSED 1P4BH 4M48H 2OAAA 1J0ZA 5EIVA 4NWUL 2PXYA 1VFOA 2VUOA 4GG6A 1AFVH 5DT1H 4FNUA 3US0A 1I53A 3N44F 1CDIA 2OA9A 2QQLH 4G9DB 2K45A 3W1ZA 3FBKA 4AQOA 4TSCL 4UM9D 1OHZA 4WFHD 3OVUB 5J9PA 1T03H 2QTEA 3GLZA 2VZSA 1U4FA 3BP5B 4G8GA 4UYQA 2GY5A 3CVDA 3EJPA 3L13A 4PGEB 3FU3A 4GBXA 1YJDC 3LJ3A 2AMUA 5I1AB 3UTTD 2NNAB 1JXGA 2G4EA 3MYJB 4XGZA 3MJ9A 5E1AB 4U6XA 3KVPA 4WFFE 1F11B 5IMLA 4N2AA 2GJZA 1RIHH 4Y9CA 2CAKA 3OSVA 5DHDA 1X3DA 4N90E 1WFIA 3ZTCC 4LAQL 4AVHA 4WUKH 4DEPB 4XMPL 1HIML 1I9IL 2GBAA 1QRNE 3IJHB 4EZLA 1QLRA 4UQ3A 3X12B 2O5NA 4JRFA 3MRBA 4ONGH 5CIPB 2VDKH 3TO4A 1A7OH 4HJEA 5BVJB 4HWEL 1MFMA 1LJMA 3GMRB 3DVFA 3H7BB 4IDJH 4M6NL 4U1SB 4FQ2H 1WAAF 3SB3A 1HEZB 4JPVH 4BZ1H 5M7QA 1F4HA 3KEHA 4HAGA 4WEMB 5HDWA 2PNDA 1TTRA 1XEDA 2WXHA 2Z7ZA 3C60A 3IF1B 3IDJB 2IAND 3VI3B 4PJAB 1D5ZB 1NCHA 1NPJA 2HT4D 3IMUA 1J8SA 4B41A 2ERJB 3X1EA 5AL0A 3KPMA 3LZLA 3LQZB 1BIIB 4Y7MA 5ANME 5J1AA 2AJVH 3CH1B 3KLHC 3K46A 3DUHA 4HX1A 3F05A 3U9PL 5GGSB 3QUKA 3CFTA 4O4YH 1IGJB 5A2IH 2YXVA 5GSRB 1R5IA 2QSVA 5ANMB 4P9HL 2EO1A 1R1CA 5SWSA 4IU2A 2CRIA 1MCSA 4XNQB 1UWYA 5DVNA 4CL7A 3ZBMA 3TBVB 1V5JA 2COQA 2Z35B 3HC4L 5F1IB 1KBBA 1RJCA 3HLAA 2E9JA 3KPRA 4KHXH 1LP9E 2FJHB 3FB8B 1DEDA 3V4VL 3BPLB 4K23H 2G9HA 4PJ8D 4CVXB 4Z8FH 5E2JA 1E30A 1KYUA 5FLVA 2EKSA 1T3FB 4JHVA 5GRJH 4NP9A 1OCWL 3H9HB 1SFHA 5ETUA 4F7TB 1SYVB 1ODAA 3H3PH 2NYYD 4J3SA 5DJZB 5AVWB 1LP9B 5B39G 2E9IA 3T8VA 3MV9A 4LMQE 4HOZA 2RIKA 4R84A 4E41E 3P73A 4L3AA 4U1HB 3SPVA 1BAWA 2IADA 3T0VA 1R6VA 4XN1A 2VLRE 2DLFH 5C0DA 4YFDB 2WO2B 5F88A 2GITB 4AK1A 4PRID 4QY8B 1U3ZA 4POUB 2DLEA 5F6IC 1P5UC 1CPUA 3WL9B 1NLBH 2P7TB 5EC1B 1PG7W 1YN6B 3W0WB 3HMXH 5IEKA 1REIA 2FBJH 3R1GL 1WZAA 4PJGF 4B0MB 3PFUA 4AKOA 1VPOH 4AK2A 1OGAE 2AITA 2Z91A 1ZT4A 4GKZA 1A4CA 1AQHA 4F7MB 1Q1JH 3MUY1 1BOGA 2CHZA 4DAGH 4P05A 3CX5J 3OKEA 1MCEA 2R83A 4J28A 4W9ZA 3GMPA 1DP0A 2Z31B 3EADA 4L5FL 4D0BB 1U3NA 4MZ2A 2UXVA 2VR5A 3CCHA 2LLNA 1PKQE 2P5PA 4Z7UB 4F8QA 2WQWA 4X5PA 2H4EA 2BZ7A 3JVGA 4ALAL 1J1PH 1TKWA 2NLJA 3OHXC 2QPFA 5LCVL 3V6ZA 4U3XA 1UACH 2ROYA 2J8OA 2MCPL 5C8JA 4PB0L 2NDFA 3B5GA 3RB5A 1CXIA 4NCDA 3ZTNL 3VXTB 5T3ZD 3OKYA 1HHIA 1MVUB 3GSRB 3WOVA 4NQSA 4RAVB 4R8WH 2WTRB 4LGSB 4GP8B 1LO0H 2ZIDA 2FH8A 3DIFA 3BW9A 3VFMA 1UZGA 5BPPA 1UQSB 5I17B 1U8OA 4MSWB 4ZSOB 4M1DL 2P49B 3FQXA 2BY3A 4CJ1A 1NEZG 4Z95H 1WFJA 4S2SB 4PW4A 3N85H 3D69A 3GXIA 1YJDH 3OKKB 3U6RA 1XEUA 1QW8A 3MBED 1R5WB 1YEFL 4H4NA 4FNQA 5GISL 4CMMB 2XY2A 1C8QA 1RZIA 3H3BC 2XTJC 4HZLB 1NMCC 2ESVB 3P3TA 1QVOB 1IE4A 4KTDL 3HE7B 5DWPA 3HG1B 3GRWH 1AIZA 5J3HC 1OAQH 5JHLL 3QO0A 1HTYA 3R18A 3HN5A 4JQXA 3DYOA 4K94L 4KDTA 1T1XB 4L1HA 2FQGA 4JZJB 5FKPA 4JPIB 1PYWA 2F9BT 3PWNB 5D1QE 3QIBD 4JVWA 5J0BA 1MCPH 1ML0A 1DJHA 3CDGB 2EXYD 4G80B 4HAKA 3WNKA 4HIIA 3RZCC 3NAAL 5L88L 5EULV 1IGYA 2YXWA 4H88L 3EH5B 4WKZA 1JHTB 3HHSB 5CD5D 5GZNA 5PAZA 1TETL 3KJ4B 2BMKA 3MA9L 4J4PD 1UYWH 1VENA 1NCCL 3ECBA 3PDDA 4JO1H 2YQBA 3IDXH 5IQ7H 1SN5A 4HUNB 2J7LA 1KGCD 2XVGA 5E8EA 3H56A 4UT6L 4OZFB 4L4VD 3NBNA 2A9DA 3ZL2A 3ZTEA 4QRQA 3IT8D 5KSAA 4ZPVB 1FVEA 4E9WA 1ASPA 1CDBA 4HKZA 1A0QH 1JMXA 5I73B 4CMHC 2BS71 1HH9A 3BN9D 3QO1A 3D0AA 4Y5XC 5EG6C 4ZMTA 5C71A 2EACA 1YMMA 1RUPL 4OCMC 4ZMVA 1I3GH 1X9LA 2XBZA 2UWEA 1WC7A 4N20A 4Z7WE 3QUZA 3VXNB 2ITCA 3WKYA 4TQEH 3RX7A 3IDIB 5AOJA 1JN6B 2VXVH 4NQQA 4FQHB 3HR6A 5FYKL 5T1LB 1G7JA 4LU5L 2Y36L 2V8LA 3TBWA 1RJZB 3B2VL 3O3EA 4E9VA 5IKCA 3DSNA 2VDOL 3ESMA 3DK2A 4H7VA 1UGNA 3BHBB 4N87A 4AEHL 4LXFA 1V10A 3KS0J 4HXAL 5EU5B 2N0KA 4LNRA 5ESAA 1G6RH 4HFWB 1E28A 2MSPA 2WLIA 3X14B 1MFCL 3QYNA 3VG0L 1T22B 1AP2B 4P2OD 5EWIL 5JQ6L 4L8SC 1XGQB 4FTVA 3AJ7A 4L3EE 4YQXH 5I5MA 3CFCH 2WKGA 3D1MC 3F04A 2BP0B 3ARFA 4X9YA 3MYZA 5EEXA 4XAKE 3PU7A 4GQ9H 2ZWLT 3QUYD 3TT3L 4W9EC 3UG5A 1G5AA 2ENSA 4I2XA 2Y2TA 2VABA 5EIQA 1R3JA 3RWDB 1M56B 2WWMC 1KEMH 3ZGHA 3BMVA 1SRDA 2CBTA 4XX1E 1H6TA 1JPGA 4IIQB 4PJIF 4TOYH 2PYEA 1S7SB 1XCTB 2EDMA 3GLDA 2H0PA 4XHQA 3S88L 3QFJB 4HYTB 4O02H 3VFVB 5JPMB 2R2BB 3OKNA 5LBSA 3DX6B 3T6VA 5EUOB 4QXWA 4Z7NF 1MHPL 1DDHA 4XRCA 1NAMH 4NRXA 3ELQA 3M17B 4OB5H 1Z9PA 4CDHA 2BVOA 4Y4HB 5I6MA 1NGQL 1W91A 3RA7H 3RY5A 3NRPA 3RDJA 2JCCF 1G9NL 1OSZA 2WQUA 4KV5F 4PJ5D 4FJZA 3JV6B 4ZNCD 3L1FA 5IVNA 2IAMA 1CMOA 3ARQA 1MF2L 5HGHA 2QR0B 4GG8A 1XBDA 3FJTA 3TIDA 5FYLL 2IALA 1U93B 3VWKC 4P4KA 1EZUA 5I24A 3OLGA 1SEBA 3EOBB 3MCLL 2BOBA 2P24A 1KBKA 4PRHE 3AVEA 2V17L 5DJCB 1J9QA 4FFWD 5E7BA 1GKEA 2A6IB 4O00A 4UV7L 1HZKA 3G6DL 4HWBH 1ZAGA 2DJSA 2D2CC 1FP5A 4HLZG 3QUXB 3TZVA 4J23A 1INDH 5JIKA 2Z64C 5I75C 1JV2A 4NQCB 1KXTB 5DUMH 1KTLB 3ZQXA 3K2KA 1FH5H 3RI5K 1N3NB 4MMZA 5J11B 3K6OA 5D55A 4C56B 1B3IA 2IJ0C 2GCYA 1ZJAA 3RJOA 2I26N 1IC7L 4E2OA 1NLDL 1W8OA 4PWFA 4RFEA 2DF3A 3LZQA 1XF5B 1H15A 4Z3EA 3W3BA 2VLJA 1Q9LA 3NIFF 5JIHA 3FN3A 4MNQA 5F0LB 4ZX4A 5JXEC 1ETZA 2HFFB 3OB8A 3N1GC 2BY2A 4EZJA 4KK6D 1L9PA 3V6OE 4LOUC 2P8LB 1UC6A 5E6ZA 1TNNA 5EU7E 1Z7JA 3BZ4A 3PP3H 4N2MA 4TSBH 2TRHA 4TTDD 4YXLL 4NS0A 3OMNB 2E7LC 2O93L 1PIFA 2JQZA 3MROA 3P2TA 1LILA 3NDZE 5KG9A 3HVNA 4I4WA 2NX5D 4NWUH 5C0CB 1RP9A 2Z34A 4S0HA 4B27A 4S1QL 3L4XA 3KLKA 3RNKB 4WTXA 3TPUB 1U8MA 4NQED 3CIAA 5DLML 4TSCH 5CBEA 1U4EA 1JJUA 2DLHA 1XMWA 4I87A 1VACA 1I7ZB 5HYJE 3L7FB 2X6AA 2A9MH 1ITBB 1TCRA 3H9ZA 2BY0A 2GSGB 4PWHA 2X4NB 3KPNA 2M26A 2EVIA 4QRPB 3I9GL 1ET5A 2A3TA 4NO0A 4RFOL 4G6MH 3MJWA 3WIHL 4MB4A 4ZTEA 2WBJC 2JJWA 1FRGH 3Q01A 4N0CD 3QDJB 2MNWA 5AYQA 4EOWH 3EJRA 3CG8A 2EDKA 4K94C 4LL1A 4P5KA 5DHMC 1AO7A 2VSMB 2X2YA 3WJLA 1HIMH 3MHZA 3CGTA 3U1PA 4AUYA 1U8HB 3L2LA 3RDTC 5AALA 4L0YA 2ITDB 5D6CB 1WFNA 2CCVA 2X88A 4PBWD 5F7EH 3QH3A 2HX9A 3GBLA 4HWEH 3LQAL 3UMNA 3PWLB 3SDDB 1WZLA 1NCUA 5HGBA 3NT0A 1SF5A 4L2YA 2G3NA 1ZPLA 3T3MF 5GRVK 4XPHH 5CUSL 4UBDD 3DPBB 3IRCA 3MJGX 5E4EB 4HOXA 2C9RA 4HCFA 5BRZB 1BGXH 2WXOA 5DDHA 4EI6A 3QXVA 1A4KA 5EPMA 4LHQB 1FBIL 1YZZA 1AR1B 3BPNC 2JCWA 2WLHA 1Q0EA 3U9PH 3VFPA 5A6LA 1MQKL 4Q9CA 4WTZA 3U79A 4JZNA 3MBWA 3GJFA 5LNDA 4H8UA 4O5LH 2ETWA 2ZOKA 1RFDL 4H1LG 4X9BA 1E5YA 1WZKA 3OR7A 2EYSB 1CBJA 4PLJC 4GI6A 5CZXD 1GSKA 3Q1EA 1UG9A 3D4GA 3HC4H 3U46A 9CGTA 1L0QA 3WFCL 1ZMYA 4Z7OB 1I1FB 2CDEB 4V1DD 3GUTB 3V4VH 4MS6A 4D9QE 3HS0B 3WAKA 1DO5A 1LXMA 1IAII 3BKCH 4IS6B 2AEIT 4IGBB 1HQRB 5K39B 4GG6F 2ROXA 1OCWH 1QSFB 3KDMB 4HPOL 5HYQA 1E65A 2PXYD 3AZUA 3TH3T 4F7EA 3PWJA 4J8RA 2WYHA 3BKJL 5T3ZL 4XC3L 4HS8L 4OZIB 1Q94A 2WM0A 4XXDB 3TNMB 1IC4L 4C47A 3IN2A 1CXLA 5EZIL 3DX2A 5C08E 5EF0A 2E47A 4G8GD 3WO4C 1W0VB 4GBXD 1GS7A 2OTWA 2P9RA 4OIIL 4YDZA 3D85B 4IRSC 3UH8A 4EN2A 4V2BA 4NXSA 3RPKA 1BQHG 3R1GH 2X1WL 3NMEA 2EH8L 1BVKB 3SBQA 1XBRA 3EF4A 4KGLA 3UIZA 4H1LA 3KCPA 5J8OA 3TFKC 1OQOA 2WXMA 2NW2A 4HXBL 2EZ0C 4DK6A 2A9NL 4NBYB 3QB7C 3RPIB 5EO0B 4OUOA 5IM7B 1GOGA 4NP4H 1F0LA 1OAKL 1ADQA 2PKDA 4PS7A 5DZVA 2A73B 4ZOAA 3GKWL 4Q0XH 1W72B 1E9OA 3BUDA 2K6ZA 2WXLA 3KL0A 3TO4D 1G9NC 1FUNA 3U30B 4A67A 1CLOL 3US9A 3KPPA 2NYZA 5LCVH 5FGCE 4WI2A 1SUHA 4N2NA 5T1MB 5ALBL 5DQDL 2MCPH 3ASWA 3GXPA 1KCBA 5AFAA 3QRFM 2JB6B 1KY7A 3GB7B 3C60D 3O4OC 2ITEA 4P5MA 2DIBA 2RACA 5EF2A 3PJNA 2PF6A 2X1OA 2H32B 3J7HA 4ANVA 4KKAC 1M53A 1GYWA 3P4NA 4LCVA 5DJXA 4G82A 5D1XC 1QBAA 1XGTB 1Z9SB 4M1DH 1P7BA 4HJ1A 3IN0A 5DURB 1ZSHA 2DQFB 5TF0A 5DQ9A 4OZHA 1D6VH 1E7VA 5IW1A 1BQHA 1ZXKA 5SWSD 5GGQL 2Q86B 1MHHB 3ZLQC 2AK4B 4BFNA 4EBQL 1XIWB 3VFTA 2IPTL 2KPWA 4K7PL 1O6VA 1YEFH 1X44A 4MQSB 4UQ9A 5IW6A 2ZYSA 2DJ4A 4PHXA 5JYMA 2F54B 5F70A 3QORA 4KTDH 1XH0A 3K6SA 4X6CA 4LLVB 1ZDSA 2JKTM 3O3AA 3DHUA 5EUKB 1X5AA 3MRGA 3AG4B 1BIHA 2A99A 5JHLH 2Y9RT 3GMNB 4K94H 5EA0H 4PVMA 5CNHA 4ETYA 4R7NB 3NCJL 3MV9D 4CN1A 1KGJA 4PJHB 1TTUA 3RX9A 2HZHA 2D0GA 1IX2A 2BHFA 5F0JB 5L88H 3NAAH 4XN5A 3F7RA 4H88H 1S9WB 3GT6A 4FKHA 4M02A 4MMXC 4DKDC 3FUEA 1TETH 2YD5A 1ETA1 3MA9H 3RNQA 1QHPA 4D7BA 1A4JA 2LTQC 4FOMA 1NCCH 4FP8L 4Y7OC 4XB3A 5F21B 2W92A 4GAGL 5HHMB 1XZWA 4KO5A 4PG2C 3F58L 1WLHA 1HS6A 3DX9A 3FT2A 3VXRE 3DGGB 4K55A 4UT6H 1D9KB 1DE4B 4G6KL 2DH3A 5EFIA 5J13B 2WANA 1P4UA 4PJ7E 5HHOA 2X70A 1R46A 3ARBB 2FX8H 5IF0B 1E4XH 1N0XL 3MCYA 3PHSA 1RUPH 1BYNA 3LXAA 3MQIA 3APMA 4G9DA 3OJ2C 4UWQB 4AGPA 2FEJA 4JX0A 1HDMA 4Z18A 1SM3L 3AXLA 5AYTA 1KULA 4PJ8C 1ZIBA 3BP5A 3LZNA 3EYQC 4PGEA 2Y36H 3CDZB 1TZHB 3B2VH 5I1AA 2FJSA 1O9VA 4KTYA 3MYJA 1I75A 1DHKA 3CQPA 5DU7A 4ECNA 4AEHH 1S7QB 3JT0A 1TJHL 1F11A 2HLFC 3D50A 3SBRA 1MFCH 2YD2A 5DGRA 4K5MA 4R4NC 5JQ6H 4LPYA 3VD9A 2UYLB 1TYJA 4G5ZH 5K9OA 1E27B 2WSKA 5DGQA 4WO4A 3IJHA 1Q0XH 3SKOB 2P5WB 1EAOA 2OMZB 1XCWA 1U6AL 4L4TB 3V7AE 4XWOD 3FF7A 3X12A 1J9CT 4NXKA 1LEKB 2D7QA 5BVJA 2CUAA 3HKFA 4U1SA 2JKRM 4XNDA 5HD8C 1YEWA 1XH3B 2RB8A 1HEZA 1QRNA 1JZDC 2XVKA 5HTSA 3L3HB 1QRKA 3L81A 2V5SA 3QUML 3IDJA 2QSTA 1FSKC 3VI3A 5BUPA 4PJAA 4U6YB 1CDHA 1D5ZA 2KUTA 2BFVL 2I24N 3S35L 1EQWA 1BZ8A 1RULL 2JKIS 3LQZA 1BIIA 4JHZA 2J1KA 5I8KL 4X7FC 4Q6YA 3L3OC 2F7RA 2J8UE 1NGQH 1IGJA 2XKSA 5GSRA 1G9NH 5ANMA 1LMKA 4G7YL 1IEHA 1MF2H 4JM2C 5GZND 2YQGA 2NY3C 3BZ5A 4XBEL 4N0UB 5FYLH 3TBVA 2J8UB 3PDOB 5FFGA 5F1IA 2J3SA 2Z35A 3ZE0F 3MCLH 4AMXA 2ZX8A 2AQNA 1WICA 2V17H 3WIFB 2NY7L 2EH7L 2FJHA 4ZUSB 3FB8A 4LSVL 1U58B 4UCFA 3Q5YA 1H3GA 4CVXA 3G6DH 4K5PA 4MWFA 2ADJB 1T3FA 3MTRA 5LAXB 3V9CA 3H9HA 5KSAD 4X6FB 3N43B 4F7TA 1SYVA 4F8TA 5DJZA 1LP9A 2X28A 1MHCA 4OGAC 2R23B 2UWEF 3CWGA 4OQ1A 5F8RC 5B1CA 2NUTB 4P4RB 4Z23A 1YMMD 2VWEE 4G9FE 1IC7H 1JOIA 3DJ9A 1URIA 3OJVC 1THAA 2OCCB 1FL6A 1W0WB 3QUZD 3QJXA 4QF1B 3U0PB 4AITA 4I88A 1UUNA 2GITA 4QY8A 4TVPH 3IVKA 3B5HA 3WL9A 1XZ0B 4MVBC 5ISZB 2P7TA 2X89A 3BWSA 4M6ML 5EC1A 1YN6A 4BUQA 1EZLA 4OF3A 4MXQD 3MLWL 1O6SA 2NQCA 3OMIB 2WZ5A 1KB5B 5C9KA 4Q4IA 4F7MA 3FOMB 2IWKA 4HZAA 4TUJB 3I6KB 1CL7H 4X42A 1ETB1 5CGMA 4AIZA 2Z31A 3CAFA 3N9GL 5AVZB 4PP2A 4ZD3L 4Z7UA 4BFGA 4D0BA 3QR1A 2UZXB 2WXNA 3ARFD 3LV3B 4OZGB 4DKEL 2QKIC 4S1QH 3UAJA 3FH7A 1YC7A 3HE6B 1JVOA 1JI1A 4PRBB 1NBYB 2XY1A 4MRCA 3FB7A 5T5NF 1IBDA 4HMCA 3VMPA 4MQTB 3MV01 2CR0A 5GS0D 1XHHA 3O6FB 4TLTA 3CV5A 4LLWA 4FYRA 1LD9B 4ZTOL 1NCIA 3VXTA 1NJ9B 1MVUA 1UA3A 3GSRA 4LPWA 3B7YA 4MMYB 4RAVA 2XFGB 1SJXA 2PYED 1ZHKB 4JO4L 4MKMA 1NQBA 2RCSL 2WTRA 4JZOB 4NYLA 4RFOH 1IVLA 1XSOA 4WJKB 3WIHH 4HCIA 3X13B 2OKMA 4X2UA 2JB5L 5I17A 4ZSOA 3DUUB 5AKRA 3L3GB 5EOTB 1NGZB 5C1MB 3QEGL 3I6LE 4UUJB 4JFDB 2IAMD 3D0LB 3VM5A 4S2SA 5KVDL 4P4KD 3U82B 4HG4K 4OLYL 1HX0A 1EFQA 2BERA 4KITB 4CMMA 3F5WB 2G5RA 2R1XB 3BO8B 4JCWA 3FRPG 4HZLA 2ESVA 3ZE1B 2LHAA 2YSSB 2RTTA 3HG1A 2KQNA 2W88A 3TZVD 1PD6A 1G7IB 3S8GB 1FJ1B 3WY2A 4JZJA 4JGNA 3PLYA 1FC2D 2HKHH 3PWNA 2BSTB 4KQ4H 1Q38A 1OM3H 3CZNA 3CDGA 4G80A 3R7QA 1CURA 1MQKH 3FT9A 3EOAB 3GINA 4PW9A 1KTDB 3HHSA 1RFDH 5DHXB 1TJMA 2WO4A 3JZYA 2VLJD 5D1QA 5I6XB 1A65A 5JHBA 2EDBA 4MNQD 3L6FA 4IBTA 4APXB 1R3IL 4JRXE 2WUBL 3WFCH 5I8EB 3V5DB 1PF3A 1SOSA 1FH2A 4R97B 4KVNL 1ZLWK 3VXOB 4OZFA 3N2JA 5C3LD 1Q4NX 2MNJB 1TR7A 3TBBA 1DVYA 4DKFL 1ZEAL 4HPOH 5FO7B 1WT5C 1OP5H 3QJSB 4KNTA 4GW1A 1IRAY 5JHDB 4XNMB 5JNYB 4BQ6A 43CAB 2BC4B 3TBTB 3LKSB 5HPMB 4XC3H 2VLMD 2L4OA 4HS8H 1OIOA 2F61A 3IDIA 4ODWA 1JN6A 1IC4H 1QLEB 2FT8A 4FFWC 4FQHA 1MCLA 1F8TL 4UOJA 5FHAL 4XX1G 5DCCA 5EZIH 1MREL 4RZCB 3B8SA 4S11A 2XG5B 1T21B 1NCNA 2X0UA 4Z7WA 2A74C 4XN7A 5C6WH 1XB3A 3BHBA 2EH8H 4M9OA 5EF1A 1TJIL 2ZOWA 5D7LB 4ZMYA 3ZT6A 1QABA 3X14A 1SMOA 1OAZL 1QMUA 4RMVA 1T22A 5GGTH 1WQVT 4HXBH 2HT3C 2A9NH 3SDAB 3II1A 2BP0A 1EHXA 1AO7D 1OAKH 1E6OH 4Z0BH 2NY2B 4KK6C 3GKWH 1U2HA 1KY6A 1OCCB 4RDQG 5I0DA 3M1CA 4XMTA 4R2GC 1AOZA 3M07A 3TV3H 2YK1H 1CLOH 2NZIA 4OKVB 4L3EA 5DRWB 1DQDH 4HKJB 1NDMB 3RWDA 4N2EA 2R2EB 4GO6B 4MCZA 1HHJB 1M71A 1N64H 4I3SL 5ALBH 5DQDH 2XWBB 2W1NA 2ZUQC 3NG5A 4BBWA 4TNGA 3TURA 4IIQA 4H20L 4NC0B 1S7SA 1FIGL 4W9LC 3VFVA 5JPMA 3F2LA 3ZQWA 1JAEA 3B9KD 4CILA 2R2BA 3ARGA 3DX6A 5EUOA 2GT9B 3SJVE 3QR2A 4JN1L 4Y4HA 3G3LA 1F42A 4N0YL 4HIJB 1EEZB 4DF9A 3JV6A 2PP7A 2LAGB 2DJMA 2P43B 4WKXA 1BX2B 2QR0A 4KKPA 4QRAA 4TPRL 5GGQH 1AXTL 3K2IA 4PJFE 3EOBA 2IPTH 3EDFA 3KS0H 4NHCL 4XT1C 1T04B 4K7PH 1A1NB 4FG6C 1U8JA 1JDCA 1AS6A 3GNML 1OD7A 1GS6X 2A6IA 5DVOA 4APQB 4F20A 2FNBA 2W0LA 4L37B 3G04A 4YIQB 5E1GA 3R4RA 4U1NA 1QO3B 3QUXA 4JFSA 3TA3A 1PAMA 1MFDH 3QUHA 4PRHA 1HCZA 4NQCA 3RL1B 1CFNB 1KTLA 3MFFB 4BUGA 1DLHA 3EUDA 1NSNH 5LAPA 4GIAA 3HC2A 3WE1A 3EDEA 2IDQA 3EH4B 1KN4L 2X1PA 4NUMA 1DQML 2XVBA 2MNUA 4FNSA 4CGUB 4UBDC 3RUGB 4P2AA 2HFFA 1CICC 4FP8H 1RAMA 3AREC 5IOPB 3GMOB 2P8LA 4S1DC 3F58H 1EHKB 4HJ0D 2C9VA 5E2VL 4JFHD 1BQLH 3A4DA 4G6KH 3SE6A 3R0NA 1ZA3B 3LIZH 4S0TD 3WENA 4GXVL 5GPRA 4FDWA 4LL9A 4QHPA 1XXFC 4LLDB 3RPBA 1O7DC 1QFWL 4HLEA 5C0CA 1JNJA 5KVGL 1N0XH 15C8L 1E8XA 1WA0X 3DOHA 3MUGB 3BUYB 4B6ZA 2G2RB 2OXGB 3JZ7A 1A7BA 4AQEB 3VACA 2WYIA 3ALPA 5AW3B 1I7ZA 3VDBA 3L7FA 2NMSA 2KKQA 4U1GB 2GSGA 3OJDB 3TCLA 3BGFC 4TXVB 1MLBB 2F74B 2ICES 2CBQA 3EDDA 3Q0HA 3CZJA 4QRPA 1QWNA 4WSGA 4H5SB 3LB6C 5DZLA 4A2MA 3KLSA 3E8UL 5HYJA 4HUVB 2EIBA 1RIUL 4B9JA 2QHRL 3REVB 3ATEA 4NQDE 3IMBA 2Q2EB 2DM7A 3QDJA 1D6EB 2GEQA 2P5EE 5HDLA 5CJQL 4OZHF 3I84A 5C6PB 4GO9A 3STLB 3QIWB 3UZQB 12E8L 4WCYL 4GKOA 4UDTB 1U6AH 1U8HA 4IKKA 2ITDA 3N40P 4FZ8L 3K2UL 2IAAC 5D6CA 1A3QA 3MV8B 4I9WD 2PWDA 4M7ZC 2JI3A 2AV1B 1XQ4A 2EIJB 3PWLA 3SDDA 4CUCA 3STBA 4X6CF 5CP3H 4XPBH 2GK0B 2CO7B 2A1WL 1RUAL 1MRCL 4FCHA 3M7FB 1HVXA 2NOYA 3QUMH 3QORD 3WFDL 3ZDZB 3DPBA 3IEAA 4W4OC 1Q9KB 5BRZA 4DEUA 3S35H 5E2TL 4I1NB 1JNNL 1RULH 4PVNA 1Z9NA 5TGBA 4BH8B 5I8KH 1JYXA 4GUPB 1HXMB 3L4ZA 2ZUTA 4MASA 1OLLA 4IBWA 3FUKA