2ZP8A

The nature of the trap:anti-trap complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
SDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The nature of the TRAP-Anti-TRAP complex.
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Rna binding protein/transcription
molecule keywords Transcription attenuation protein mtrB
total genus 11
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 2zp8A00
5EEVA 3ZZQA 1GTNA 5EF1A 5EEXA 2EXTA 5EF3A 3ZTEA 1UTDA 1C9SA 3AQDA 4B27A 5EEWA 2ZD0A 1WAPA 2ZP8A 2ZCZA 5EEZA 1GTFA 5EF2A 1QAWA 2EXSA 5EF0A 3ZZSA 3ZZLA 5EEYA 5EEUA 2ZP9A
chains in the Genus database with same CATH superfamily
4ZPTB 4A7QA 4FJZA 3T2LA 8FABB 1GZQB 3KDMB 4K5LA 4MJID 2EE2A 3D87B 2XV6B 4ZUVB 4L4TE 4QKTA 4KOCA 3VXNB 4XO4A 4GI8A 3Q6GH 3D25A 3CFIC 4W4OA 2KPWA 3BE1L 4NQDD 2ZIDA 2WBJA 1KLGA 1XGYL 4OZFG 4MSWA 5HHOE 1ZCRA 2KZBA 2CO4A 3TN0A 2ILLA 4JO3L 3K71B 4K07A 4LBEA 5IB5A 1EO7A 3NJGA 5FOBA 4NWTL 4P23B 4WU5B 1IAIL 4KHTH 2HFFB 4XNYH 2FYVA 2YKLL 1WQVT 3FDWA 2AK4E 4WGVB 3KJ6L 4X6CE 3IFNL 4P2OC 5E6SB 4OJDH 1XF4B 2DQ6A 1LO0L 2HX8A 5C0CA 3KZ8A 3GMMB 3KBPA 5H94B 2YRPA 4PTUA 5E1QA 3KL3A 1GHFL 5IBLC 5L88H 3GC3A 3NOIA 5E70A 4QRBA 3LV3B 2QGDA 4FQJL 2WOBA 2I9LB 2DL9A 4OT1H 2NY3C 2PXYA 3BWAB 2J25A 1ZLSH 1H6FA 3FQWA 1IM3D 3AS3A 3BHBB 3MCKA 5H35A 5IROD 1ETJA 3D07A 4XB3A 1JZ4A 1TETL 2HJLB 4FFYA 2WIMA 2A6JA 1KXHA 3MJ7B 4BFFA 3C60A 4N85A 4FHBD 3VXRA 3UYRL 5AYQA 1GCYA 3P77B 4YDVB 4JZOA 2AQTA 1DJIA 3DETC 1NBCA 4S2SA 3WN5B 2GEQA 2P4AB 3I9AA 4LVHC 3SZKC 3TP4A 2A6DB 1L9OA 1HXYB 1CGSL 3SDCA 1J1PL 3I50L 1RLWA 3IXTA 4U6VL 3M8OH 5FWQA 2IWEA 4LSSL 4KTDL 3FN0H 1JERA 1U8MA 2WLHA 4ZFGH 1IQDA 1PZ5A 4KK8C 2DMKA 4DEPC 3FUJA 5C6WH 4QRRD 1JXJA 3X11A 3HE6D 4FTVE 5L88L 3L9BA 4HZAA 4O5LL 2V2WA 3U1QA 3KD4A 1BEXA 4NZFA 4OGXL 1A6TA 3SJVD 5H35B 4PGCB 4MD5B 4DCQA 3O4OB 1PJ9A 2BZCA 4QJ3B 5DUPH 3QNXA 4QXVA 1F0LA 2PWFA 5G55A 2VR4A 3HNTH 3RWHA 3QO0B 2FATL 5TGBA 2GJ6E 4X5QA 3NJHA 4XPBH 3LKQB 3E6HA 3FQNB 1E3XA 5I6MA 4JKWA 3C5ZD 2ESVD 4JVUA 3NPSB 2DEWX 4UMSA 2XBZA 4BQ8A 5I5JA 1OCZB 1BV8A 2NTSP 1ACCA 4XWGL 5L6YH 3IMTA 3SGKC 3K6NA 4F58L 5D9SB 1TEFA 3MCG1 1Q0XH 2V17L 2AABL 4KV5F 5AALA 4LLQB 3FF8A 3K1DA 5F7EL 1NGYB 4RMSA 2IGFH 2JJTC 3CDFA 1DQMH 3JTTB 3K6SA 3AS0A 3MX0B 1F4WL 5EEWA 5BW7A 5KN5B 4Y19E 1A6UL 4FNLH 2YZ8A 5DDHA 5E9NA 1S7TB 4YDZA 3CSFA 4ZOAA 5LGHH 3PE9A 5HP5A 5GSVA 4N5UA 5TDNB 2NT0A 1DSYA 4M1CD 1RZJC 5CBEA 1KJ3H 5JQ6H 1WFMA 3ZTCC 4PJDE 4AEEA 4F8LA 1YECL 1VESA 4NQCA 4P5RA 1BECA 5F2FA 3D7PA 4XMWA 1QWNA 2PABA 2ED7A 4K55A 1JCKA 3GJEB 3NJNA 5FM5O 2VL4A 4OIBA 3UMTA 4OFIA 1LO0H 5C8JB 2PTUA 2V37A 4P49A 1SZNA 2OZ4L 2YUVA 5EN3A 3S0PA 2IOOA 3T8VA 3EDFA 4JUSA 3VSTA 1W8OA 1FI8C 3G7TA 4TXVB 4WW2F 5CR1A 3GMLA 1EAQA 1YVLA 1F4AA 4I3SL 4PUBL 3UOAB 4NWTH 3DGCR 3O3UN 4N8PA 4YSAA 4I0PC 4WHTB 1OZTG 5CBAA 1NGZA 1M2VB 1KYOJ 3VXMB 1MEXL 4R7DA 3V10A 4ZW5A 3ARGD 5DJ2B 1H6UA 3QIBB 4FQIH 2WVTA 1PIGA 4FQCL 4R2GB 4PJIB 5I6NA 3Q6GL 3MLXH 3MOQA 2QKIB 3ZE1E 1P4BL 1KC5H 2R9HC 4LPCA 4TVPE 2HLFD 3AC0A 5T1LD 1U8JA 3HS0C 1HQRB 1TZGH 4E0RA 4Y4KD 2BJMH 3F12A 1XDTT 4LLWB 5D2LB 3I6GB 1AZVA 3BD3A 3EYFB 2BVEA 3BYTA 5BXFA 2KLTA 3TC9A 3ATFA 4L4TD 1V55B 3HZKB 1GYUA 4TL4A 1VIWA 2VLKA 3T3ME 1QEWA 2W9DL 4LHUD 1IAKB 1NIBA 3GINA 5CJXC 5E5UB 5F6HI 2FLRT 3VYPA 3FO1B 2R1WA 4OD2A 3OLIA 4WU7B 5IJVA 5DO8A 3IXAA 4LIQL 4Y16C 3PL6A 2PPCA 3U7YL 5GZOC 1EEYA 1K6QH 2C3WA 3HNVH 4KQ0A 4KUCF 1MNUH 4G71B 4UDUA 3IFLH 2WIIA 3H55A 4Y2OA 1CN4A 3JZYA 3ETSA 3GRWH 4N5EC 4DP5X 4ODXA 4PJ5D 1T0PB 4U2YA 2XIIA 4H8QA 1L7TL 3OAYK 4NZUL 4KXZI 3BRFA 3NAAH 3TT3H 4GY4A 4LKCB 1FHGA 1U8KB 2ITCB 1W72H 4ZT1A 5GZNC 1J1XH 2YXVA 2YPLD 1TFHA 3KPRB 4OM1H 4PRPA 2BVYA 3GIZL 3QH3B 2O5XH 2JI1A 4DWHA 3RTLA 5EPMB 1H0DB 1VDGA 3OGCB 2WC7A 1KIQB 3JVFC 1KBGH 2WQ8A 2X09A 3NIDF 5GS1C 3DO7B 3OR7A 2X5PA 4GUQA 4JY4B 2G9HB 1Z5LA 2YA0A 2ZG1A 2A73B 3OJVC 1DLFL 3QFJB 3QUMH 5ALCL 1WWCA 5TFSH 3SDDB 2JMRA 2H8PA 2GSIB 5FYKE 3VXQA 4GRMA 5F0PB 1DQDL 3IXAB 1NLBL 1RIUL 1YNTB 3MCYA 1PZDA 1TQSA 4RGMB 5DJ8A 5GZNA 1BJ1H 4BKSC 4MA7L 1NFIB 3K8LA 4CN4A 2VDPB 3PNRB 3OAUL 3IJHA 1X4XA 5F9WB 4YUEL 5I8KH 1JBJA 1DJSA 1FO0B 2VQ4A 1QW9A 3ARUA 4E5XB 1MCBA 2VDQH 4YHLH 5ECGA 2OMWA 1L9RA 1G6RH 2XETA 2YPLB 3N1GC 4WEBL 3MJ9H 1ACXA 4FNTA 5D1QD 1JGDA 3N5AA 5CP3H 2OYKA 5E6IA 4J8RA 4K9EC 3MRIB 2MCG1 4U3CA 2JLLA 3C9NB 5HHVH 4ZW7A 4AXWB 3E6FB 5KUKA 1JPFA 2EDQA 4GMTL 2GI0A 4G7VL 5I19L 3MA7B 4WQOA 1KGXA 1T21B 2EDLA 4DH2A 1B0GB 4JDEB 4AQ1A 5JW5A 1KBVA 3QR2A 4U0RB 4YZFF 2DQUL 1QTYT 3VXSD 4UU9B 4A67A 4H13C 1OAXH 3QIBA 4DQOH 2BM3A 2VMFA 1SJHB 5FA3B 2E8YA 3V6OA 5A2FA 3KCPA 3VD4A 2AXGA 3T0EE 4NDMB 3SPVA 3WTXA 5CN2A 1A3RL 1PJWA 5CSGA 1RZGB 4PJEB 4NI6A 2E6PA 3IDNA 3JWOC 2KQMA 2P47B 5D71L 4J12A 1J0YA 4PG9B 2HT4C 1MJJB 3OKKA 1XGUA 3FTXA 5AW1B 5E1IA 4DNLA 1UD3A 3MRBA 3RRQA 2HSIA 4G11A 4H44C 3FT4B 1N7ML 4NGHH 3U4EB 3ULAB 2I60H 2OJZL 2WAHA 4N0UB 3OKEB 4QY8B 2Z8WC 5CZXC 5DHVA 2FNWA 4JO2H 4XAKD 1MCOL 3U9PH 1NGXA 5CLWA 4CSZA 3OXRB 5F9JA 3KMDA 2WYZA 1MG3C 5DJAB 4DGIH 2UZXB 5EWIH 3II2A 2IEPA 2CJTA 5FW7A 3TZVD 3EJQA 3MX0A 5F9OH 4AY0A 3G6JB 2R69L 3ZT6A 2AQPA 4QNPF 2UX7A 4HJJL 3GBML 3N2JA 4FTVA 2CRIA 3B37A 5EZPA 3V4PA 1U91A 2WCGA 1TUPA 4N0FA 4BFOA 1NM9A 2XV2A 4OM0H 4Z3TA 2IMMA 1EGJA 3SJVB 3Q1EA 4FQXA 5F71A 3EHBC 1F1DA 3K72B 4XN7A 2FECL 4JG0L 2IBZY 3QPQC 3VGFA 3FU6A 4NNPH 4R7NB 2H6UA 5JO5A 2V33A 4RISL 1JV2A 4I3RH 4AGLA 2OYMA 2VLRD 2FHFA 2IH1B 5EPMA 3HG1D 4P2QE 3SYOA 4OZIF 5H2BA 4FC3E 1MHCA 5F44A 1ZPUA 4KPHH 1VFMA 4Q4EA 4LBEB 5LB1A 3SGKA 2JSFA 1U8NB 1HS6A 2K8MA 1NUDA 4N6RB 1IV8A 1SJEA 4LCVA 5HJGA 1TKWB 4Z7VF 3K2IA 4PJEF 1CDHA 1WHPA 1WWAX 4CSPA 2EICA 3NZSA 5T3ZH 5DJXB 5DS8B 1LO4H 2JE8A 4W9ZA 3AREC 3NSDA 3AG3B 3BIKB 4G1MA 1A4CA 3X14A 4JM2D 5DRZA 5D71H 5AW0B 2X28A 1BM3L 3ESMA 3LY6A 4B7IA 4MMYA 2HLFC 4XVJH 1LO5A 1YA5A 5JIPA 3MRLB 2NY0D 1F4HA 1JTOA 4E41A 4PRAA 2RQEA 2YC1A 3EFFA 1TJIH 4ZUWA 3DO3A 2PWHA 5HBBA 3QG7L 4ES8A 4G6AD 1B0WA 2EDTA 1CTMA 4J3WA 5D2NC 3KJ4B 3WNPA 4AVKA 1U8OB 1PKQE 1F8TL 3QUXD 5SWZE 1DBKL 3UCQA 2VXTL 2ZCHH 4LMQE 5BMFL 4NLHA 5KYNA 4A38A 2Q7YA 1VAHA 4K5MA 1FL3B 3MLUH 2TSBA 1Z2KA 3UDWA 3KPOB 3V0WL 3LV3A 5A3ID 4TNEA 3WJJC 3UTPE 5A2KH 1HESA 2IWGA 4PGDA 4JG9A 4W9KC 4R5VA 1Q72H 1QNZH 1QW8A 2F8VA 2GAZA 2DJ4A 1JVKA 5AAWA 3OSKA 1FNGA 3TEZA 1BOGA 4ZMXA 4JE4B 2GB2A 1YPZE 2NY7H 4R0LC 1RJYB 1YEGL 4BZ2H 1FLTX 4LKCA 3DRTB 3NA9L 4OB5H 3BW9B 1EFXD 2CA4A 3LSOB 4NKOA 4DK3A 4X4YB 1CFSB 3S34H 1JGLH 2HFTA 4HCRH 1IZJA 1B4JL 2IH9A 3P4MA 1DQJA 2B1HH 4MHHG 3UAJD 2WBJB 1YN6A 3QIWC 3V5HA 5JUEH 2WWKO 4ODVL 5D7LA 5B22A 2JFCA 1RIUH 2VXTH 2ZCHL 3QJXA 2YEQA 5BMFH 1F45A 5F9JB 2ITFA 2IDQA 2J71A 3IKCB 3QI9C 4KK9C 1RIHH 1CFVH 1WS7A 1TFPA 4L3EA 3H0TB 1F6AB 1B4LA 3ZU8A 1Y0LA 2IPUK 2FJHA 2APFA 4TNFA 4UV4L 4LLVB 1QEWB 1N0LB 2PR4L 3D48R 2XJKA 5DMIL 3ZKXC 1G1KA 1QKZL 2DIEA 3MV8D 4OLEA 4X9FA 3C2AH 4BWWA 1KB5A 3GSQA 4XI5C 1KENH 1YN7B 3R1GL 3UTSB 4GP8B 1VHPA 3HFFA 4I1RA 1HQRA 4UT7L 5B38A 4XVSH 4QPEA 5I0XA 1RERA 1TF4A 1IEHA 3A5VA 1CFNB 3EG9B 3OM3B 2XWCA 3GSWA 5KBMA 1WFJA 5JORB 4M6NL 3IB4A 1UB5B 1E9QA 4LEEA 2W81C 4YPGA 4K15A 3QEUA 5KWYC 4DP7X 1EVTC 1YRKA 4PJAB 2MEJB 2W91A 2D7NA 3EDJA 1FNFA 1CE6B 3TNNA 4X8JA 3IN0A 1MG2C 4PI0A 1J8HE 4GT7A 4CN6A 1Y6MR 1NMBL 2XN9B 5JW3L 1EHXA 3FU9A 4QTFA 5HDWA 1D2OA 4A2FA 1MCDA 1NINA 1NJ9A 1U3HA 2VQ1B 4GUCA 5FR3A 1B2WL 3TIEB 1GZHC 2BW4A 2HN7A 2ZKMX 1CK0L 2MMXA 1F18A 2JB6A 3U36A 2XN1A 3DTDA 1JE6A 2FB4H 1XTLA 3APFA 2BSDA 3EDDA 4AIXA 1CYXA 4TMPA 3C2SA 5ETUB 4V11A 5DJCB 1AE6L 5C3IA 2H2SC 4I4WB 4M7KL 1I8KA 1PZUB 4GQRA 1I8MB 5SX5K 3P73A 3D39A 4FFTA 1BD2E 2Z31C 3ARQA 5C70A 2FDBP 4I88A 4NPJA 5EN2B 4AUJA 3GS4A 1MZYA 1MFDH 3DX6A 4CA4A 3S2CA 3RGBA 1JZIA 4EN3C 3HPLB 1FP5A 4U0QB 2WXPA 4APXA 3D2UA 3LX9A 5IT2H 3VH8B 5CCJA 3N55A 3PNWB 3IGLA 2D7TL 1T0MA 1JMZA 1CB4A 2MPAL 2WBKA 1KEML 3ATAA 4IRSC 4OZFB 3S34L 1AOHA 2GAZB 2FGWH 1MCSA 4ZUTA 4BSWB 5IMMA 3T65A 2OMUB 3OF6A 4UB0L 3TJEL 1AG0A 1IT9H 4G8GD 2VN4A 4RAUB 1N26A 5BVJB 1KGYE 4F9PC 1NAML 4PREA 4LPVA 2ZYIA 4X6DE 4N8VA 3ZIMA 4HHWA 4MNQA 2CKNA 4LCUB 1JF6A 1KTJA 2YRZA 5HGDA 1SVCP 4QWWD 3EGDB 2O5NA 3L7FB 4WTQA 3CK0L 2Z0BA 3D1MC 1UA6L 4IBWA 4DJMA 3LHPH 1K72A 3RAJL 4LEBA 5D1QA 2KPNA 2QV2A 2OM5A 4U7MA 5LGYA 1UZGA 4Y5XB 5D7KE 3EO1B 1ZSHA 4WFGE 1KXTB 4QAMB 2QHRL 3KR3L 1SDAB 4XX1E 1CICA 1FG2B 1RP9A 5EU4B 3AXHA 3ULSB 3G5YA 3QUZC 4Z3FA 5AL8A 2BS9A 3T6VA 4DPRA 5I71C 4J7RA 4N2DA 1BVKA 3MNZB 1WBXA 4G59C 4GSDL 4M61B 1A1MB 3L8QA 4Y8AA 3VXQB 5EA0H 1GS8A 5DJ6B 1LM8V 3BIAX 4LEOA 4BCZA 1L9SA 1TCRA 3D85B 3TEXA 3OJDB 4NBYB 3SBWC 3U83A 1IEBB 4UILL 3VXRB 1LK3L 1XGUB 43C9A 1YEDA 1BX2B 5GGRB 1P7QD 3ME0B 3CFJA 2P5EE 3ZMNA 6PAZA 3VSQA 5ICYA 3MU3A 4EN3D 2DH2A 3OJ2C 2EECA 3OAWA 3SOTA 1H9DA 1LNUB 4JVPA 5LCVA 2B9AA 1SEBA 1TVBA 2VDLL 3OVUB 4HPHA 1JFQL 4KZDH 4ZFGL 5D4JA 2ZG3A 3MREB 3N3EA 3ARFC 1OW0C 5DRWB 4TNWK 1JV2B 1Q0EA 3BKYH 4LK4A 4OGAD 5D72L 2XWTB 5C0DA 1MDTA 3FU7A 3M86A 4G7QB 2FEDD 5HI3C 4L05A 4Z78B 4H0IA 2V3EA 5L2JB 3VFPB 3C9NA 1RPQA 1TTBA 3MZTA 3DX9B 1MRFL 4IU3B 5INCA 1M6OA 2JV6A 4LXFA 1J8HA 3NAAL 4X5PA 3UO8B 5C1MB 5DD6A 4B9FA 6PCYA 1KCVH 5CKAA 3H4FA 3O3DA 4CRPA 2CLVA 1G1YA 4F2FA 1T2QH 4WZ9A 3DDFA 3EOBB 5F96H 3WAKA 1YEIL 3WDIA 1AR1B 4ETYA 1GMIA 2D9CA 1NM4A 5M7QA 4P5KB 4LLWA 4KX7A 1JP5A 4OT1L 2MNUA 3KVDD 3RI5K 5CUSH 4R8WL 1A66A 2DLEA 4X7DC 3C08L 4LSQL 4XP5L 1XD1A 4WJ5A 4P4RA 4PLKD 3MLRL 3IS1X 4YH6A 4LSPH 1CIDA 1Z0NA 1E4HA 3B9KB 5ISZA 3WIAA 2XWTA 2ZX9A 5C0DB 2W0PA 4FYTA 4NAMA 1ZTXL 4NUJB 4PVBA 1KCWA 5ACLA 1NGPH 3OGCA 4IJ3C 4FADA 1QBAA 4JQIA 4CDHA 5FUOL 3LKPA 3VA2C 5LXGL 4F7EA 2R0ZL 1I1AC 1GSKA 3A4AA 3UZEC 3QXTA 4F3FB 3AJ7A 1E3FA 2TAAA 4KROD 2G75A 2D2OA 2K8QA 4HC1L 2XVKA 1E9PA 2Z91B 4JG1L 3GMOB 1E50A 5T33L 5SWSD 3G6JE 5MP6L 4O02A 3DHMA 3J2PA 1SVZA 3LMJH 2VXQL 2ITCA 4YSQA 3ZK0A 5TJWK 1EAOA 4D0DB 5GGSA 3OB0K 1R3KB 4JFYB 4R26L 1IKNC 1BJ1J 3SJVE 3MRCB 4WSGA 5ANMA 4XCCL 1PCXA 3IDUA 3VM5A 2Y3AA 2Z6FA 5IHUL 2QFPA 5EO1B 5FYLL 2XWJB 4OI7A 5FYKH 1G5GA 1AIFA 1QTSA 3T04D 4MJHA 1RK7A 1MXGA 1FAIL 4L5FH 4PJ9B 4JPKL 1XO8A 4NENB 3G6JA 1INQB 1KV3A 4TLSA 2ENPA 4Y9EA 1WZLA 3W39B 2ERJC 1HEHC 5T1JA 1HH6A 3S4SA 3QUXA 2BNUB 2EO7A 5DK2B 4OGYH 3IJHB 4PCTA 5F7DB 3P3YA 3RTQD 3EKCA 1A6WL 3V6FA 5A2CA 2W0KA 4QRFA 1DQQA 4XOCA 4AK2A 3LB6D 2KDGA 4JANB 3C8DA 2EINB 1BZDA 3EIFA 4MJ5A 4J3BA 3PJSB 4OLYL 3PWJA 1S7RA 2Z65C 4P5TB 4Q2ZA 2GTWB 4RFOL 3SY0A 4PPTA 1GZPB 3JZ7A 3KEHA 3FQXA 3L3IA 1XF1A 1RULH 3AUWB 1XH3A 4NYLA 1U8KA 3H42L 1I7TB 5DVKA 2CWRA 3HNSH 1PG7X 1QSEE 3MODH 5TFSL 2RHEA 2CIKB 4TQEH 4APXB 4XWGH 5L6YL 5ID1A 1TOXA 2A9DA 3Q8AA 4OV5B 3F8UB 1AIZA 2B2XL 1NCAL 1HHHA 4PBWD 1MLCB 1SYSA 4ZS6C 1OTSC 5F7HA 1MIML 4NNYB 5D1ZC 2AQ2A 2CKBA 5DQ9A 2QADD 4POUB 2VDLH 5T1KB 4UOW0 1RJZA 3P30L 2I5YH 1AG6A 4OD1L 1QZNA 3MN8A 4YE4L 1P1ZB 2KZ1B 5DJYB 3NN8A 4MJ5B 3BVNA 2YD1A 3QEQD 1DSFL 4X7CC 4R90L 1TQBB 5FCUH 4CVZA 2CZNA 3K5SA 4JFPB 3EHBB 2VO8A 4FKEA 2JB6B 3T0AA 1JXFA 3SQOH 2LOEA 4WNQB 2XYCA 2AJXH 5J9PA 3HNVL 2CRZA 1FO0A 3D4CA 1UOKA 3EGDA 2P8LB 3IMWA 3QR1A 2QVMA 4QLWA 2CK2A 1XAKA 4TUKL 3BSHA 2K7QA 4ZAKC 5CD3B 2CG9X 4F93B 5D2LA 3QDMD 5D6DC 1KLUB 1M2OA 3W11C 3AS2A 4HEPG 1YAIA 2J88H 1A21A 1I7RA 1T2XA 5KYYA 2QZ5A 2O6DA 4FQHB 1KGIA 1KGWA 4NNYA 5BV7H 5FYKL 4YSRA 2IAMD 4QCIA 3U25A 1E5YA 2ATPA 2JCCE 5IB3A 5IHUH 3C75A 1VFUA 1A47A 1XGPB 2V5TA 5K59E 1K8DA 3QUZA 4AMXA 4P2CG 4F33A 4Z5RA 4BJLA 4G8GE 3V4PL 3NT0A 2VXQH 3AQDA 2EIZA 3IETA 5TD4A 4I0PD 3CFUA 5D1XD 1N59B 4XP9L 3APMA 3HKFA 2F61A 4KQ3L 4G8FB 4JJ5A 4IHOA 5IB4B 4AEFA 2X1QA 2ENJA 2GUOA 1IBFA 4PD4K 1WHOA 4DGYH 4NUPA 1T20B 4FQQA 1HXYA 1NC2D 1KBBA 4BQ6A 1CBJA 5HJDA 4TSCH 1G6RA 3IJ8A 4EUPB 3ETTA 1XSIA 2R51A 3BZEA 1AYRA 1GJWA 4HQQL 1OSZB 5F88B 5HYQA 1Y6NR 35C8L 3HRPA 1AO7E 3VX0A 4Z3EA 1B6DA 1W6WA 3C08H 4Z7AA 5BZDB 3U9WA 4YAQB 5DWUH 3DUHA 4TUUA 4YHPA 2BZ7A 3B9VA 1XCWA 4H0GA 4F2EA 2BNQA 3VXUD 4GUOA 3KWXA 3CVHA 2R2EA 1WUNT 1X9UA 1P6FA 4BE6A 2VN5A 4YPGB 2VDLB 5KSAA 5FM8A 1B4RA 1BP3B 3RP1A 3DO7A 4TVPL 4RWYH 4DKEL 4F15C 4ANUA 4HWBH 4HUVA 2RD0A 3MUGA 1WUZA 3DBXB 3WS6C 1BQRA 4BK8A 2WBJC 1Q0YL 4OLXL 2EACA 4CSTA 4PJDB 4Y8DC 5HXMA 2CBMA 3MV01 1W72A 1R4XA 3FFOA 4OD3H 4XHJC 2ZQKA 2PCXA 3BP6A 3LYRA 5IOKA 2FE0A 4X7TA 3CFDB 5KYWB 4FJ6A 4XN5A 1E8WA 3UJIH 2OI9B 2E7LC 2X7LA 4UDUB 3KLDA 3TASA 3QDAA 3ULUC 5C0IA 1WC7A 4M6MH 4FCHA 5F1KC 5C9JB 2Q1EA 4N0YH 4L3FA 3EGSB 3QUMB 2DKSA 3KCWA 4OU3A 5CINH 2NCEA 3D52A 3N50A 5I1AA 1AQKL 1J12A 2GSGB 2G2RB 2HX7A 5EO9A 3SBWA 2EILB 4DEWA 4BZ1H 3PWLB 1XF3B 2FX8L 4KTDH 3WIFB 3WY2A 1OCRB 4QXGL 3BKCH 2J1XA 2A9NL 1BBJB 3M8OL 4DP0X 3DIDA 2BHUA 3LS4L 4OUUA 4PGBB 3HVDA 4W9DC 4E9TA 4XP1L 3KYOB 1SJHA 3WMQA 3IMRA 3S3CB 1WIUA 3Q8FA 3ZE2E 4LRIA 2HFGL 5IEHB 3QORD 2F8IA 2QPSA 3S3PA 2WQVA 5K69A 4DUWA 1J11A 3WIHH 3FFDA 3QEQA 4LCIH 2OXGB 5C08B 4RRPA 2EJ1A 3CC1A 3WS3A 4LCWA 3MLVH 1KGCD 1N10A 3CH8A 3K72A 1OLZA 3G6DH 4TQIA 4M5YH 5GGRY 3O0RL 4ZI8A 1MFBL 1EA9C 1ITCA 4B96A 4HALA 4OCWL 1BFVH 3UTPD 2NR6C 2G60H 3PWLA 4I87A 1EX0A 3TWCL 3WIFA 3UTTE 1ET7A 1X6LA 3DI3B 2AJZB 3QDMA 5EV7A 5FOBB 1H3XA 4HAFA 4HUUB 1WVZA 1BAGA 1MHPL 2XTSA 4LCCB 4NO3A 2PWGA 4IRSA 4ELMF 3HRZC 4K7PH 1Q1JH 4XBPA 3IKCA 3QAZC 4R0LA 2XTJE 3A6BH 2A74B 2YK1H 4L3EB 4YSDA 4KO5A 4DN3H 4OSUL 1F6FB 4TYUA 4YHYB 5HHXL 4LLMB 1GYWA 4N87A 1AHWB 1AGDA 1A64A 1A8JH 1CFSA 1T0OA 1EQWA 4PB0H 3P4MB 3D33A 2R2CA 4PJ7A 1P7KB 5JA9A 1PIFA 2Y22A 2WINB 2A1WL 1U95B 1ED3B 1XVSA 2ZUTA 4OCSL 5HI3D 2RFXA 5DUBB 2XX1A 4PREB 1JMXA 4RA0C 4BSJA 4M5ZL 1RHHA 1WWBX 2EUZA 1RK1A 4L9DA 5KANI 5E6ID 2GCYA 3KVPA 2Y7QA 3QWOB 3S35L 4AM0A 1FZMA 4FXTA 3VD0A 3TCLA 3U48A 4FULA 3GRWA 3T0WA 3LPFA 4L3CA 5GJSH 1U8OA 4UI2A 1E4KA 2E9IA 2DWDB 4Y88A 5DK3A 3PHOA 1X7SA 1CGXA 2W65B 2FL5B 2YPLE 3HW7A 4IMLA 2BOCB 5ERWB 3RZCC 5F7AA 4MHHI 3ARXA 4LCWE 4HDIA 3MXVH 4XPAL 4Y2LA 4Z95H 2XZAH 1J05A 3AXLA 3PHAA 4MSWB 4IK6A 4JRXA 4MNHA 5INDB 2J5LC 1SM3L 5CKGA 4PJBB 1KELL 3K5RA 4JHVA 1KN4H 2R69H 5DFWH 1IC5L 2AZUA 4F7PA 5D7EA 1DQJB 1D5IH 3WS6A 1TQCC 5TQ0L 2JQZA 3SDAC 3SGDI 1KOAA 3REWB 2HKHH 4PJEE 5KJ4A 3VA6A 1ZXKA 2P43B 2OTWB 3VH8G 4P9ML 3ULVL 2E74C 1OGSA 1SJEB 3B3BA 3KPLA 2VSCA 4K9JA 3QI9A 2F7RA 2XRAH 4ZBJA 4JRYD 3MV7B 3NIDB 1C5DB 2AMUA 4ZUUB 1I7UB 3R18A 4JRXE 2J4WL 5I75C 1NKRA 4XNQB 1VKXA 1WWWX 3WTSA 2CBPA 3BP7B 4OUOA 4X6DF 5CZRA 2NR6A 4BZ2L 3O6MH 2WLLB 3PWJB 3D0AA 1OIOA 1KN2H 32C2A 5B3SB 1RVFH 2XWZA 4AYSA 2CRMA 1NFDA 4UT6L 4XMLH 3RDTB 3VFVB 3WD5H 5ISZD 2XWEA 3OR6A 1CLOH 3SGEI 2MJWA 3UROR 2XG4B 2ZAHA 4G7VH 4NO0B 4BUHA 1TTAA 2VXSH 1E4XH 5KBKA 3UEQA 3F7VA 4JKKA 3ZTEA 4ZJ9A 3C5ZB 4FA7B 1QSEB 1FJ1B 4PRHE 2UZIL 1T20A 1CE1H 4ILDA 2NLJB 5DJ8B 3QG7H 3R4RA 1TLKA 2GITA 1WCBB 1E28B 1QABA 2P28B 3DBSA 4P2RB 3KWTA 4AZ8A 1G6VK 4DT2A 1T89A 4HJ0C 1M6UA 3MV8B 3ROOB 1OK8A 4S0TD 3LXBA 4GW1B 1IAII 4PV9B 3U0TA 1A3ZA 4TVSa 3VSVA 2J7LA 2VDMB 3U79A 3U4AA 1UM6L 3DOSB 2BS8A 1OY3B 1Y1UA 5HYSA 1ZY9A 4JZJC 1WAEA 1XQ4A 5AYTA 2W5PA 2EVFA 4G6JL 1MFUA 5I1EL 1Z5YD 3U30B 2A83B 5AOMA 4MAUL 4O9HH 3BRGC 5GGVH 2E27L 4XMPH 3CU1A 3L1FA 4KPHL 3CTTA 4S1RH 4JDEA 1ZHLB 1AZCA 2HG0A 4KTGA 3GPSA 4QHMB 1FYTB 1NC2A 2IG2L 3MRQA 3V0JA 2I32A 4BWUA 3QDGB 5ADOH 1GS7A 1TJXA 1E28A 1KELH 4AZ8B 4HIIB 5LDUA 1UD8A 3CC5B 1QSFE 4NZUH 4PJHE 3SIKA 2X6VA 3ULVE 5J9PB 1RZKC 3B4NA 3VGAC 5J13C 3MXVL 1BQHA 2GSMB 5E03A 3T6QC 3QC5X 1MI5D 1HEZB 1OD9A 2VABA 4PLNC 3L4WA 5IMKA 3FTGB 1KIPA 2DMGA 3GZOA 1G9ML 1BIIB 5L4JA 4N0UA 4G8GB 1H8OA 4ABQA 1ET8A 2BFVH 2VERN 4NERA 2AK1H 3IT8D 3FJTA 2P5EA 3V79C 1CXEA 3WUZA 1MN4A 1X5AA 3AU1A 5GJSL 3PAUA 4L1HA 2R7EA 1N12A 4QHKJ 4IBZA 4KVCH 5I1IH 3MUUA 3V4LA 3F5WB 1NFAA 5IMMB 1RUAH 4M6OL 5CSBA 4ORGA 4PLJD 1WFTA 4K3DL 4NBZB 3KWUA 3ZDXF 3ULVH 3SQBB 2CO2A 3LQAH 2HMIC 3UL4A 3HJ0A 4UQ3B 5FKAB 3FN3A 4TOYL 1HYSD 3SO5A 5IQOA 3DO4A 2Z35A 3KLHD 2VMDA 3IE9A 5E9DD 4QXWA 2TRYA 5BRZE 3FQXB 4FQ1L 2AXHA 3DIFA 2AK4D 2WUBL 4FNUA 4P05A 1IC4H 1QI4A 3B6SA 2DJMA 5D1QE 3MACH 4HJ1A 4FQCH 4DN4H 3L1GA 1RD6A 2WAQA 4GQ9H 4YDLB 1HCYA 4F57L 4G8AC 2NZ9C 2MWCA 2WQRA 2AEOA 3WUWG 4XRCA 3ZO9A 3S37H 1VEOA 3A6BL 1KCRL 3LZQA 2GBAA 5I0YA 3BEVA 4P46A 3PQYA 2VXUH 4J3OC 4J3SA 4XB7A 2I9TA 4ZYKB 4WWID 5CD3A 4J39A 3OLGA 1Q4NX 3CBKB 3VWKD 2XQBL 2GIMA 3A67L 2VC2H 4NJAH 5ADOL 3ULUH 1JL8A 3O9WD 3SDYL 3GUFA 4ADJA 5EU5B 5J7CC 3GSOB 2FX9H 5CLXA 1FZOB 1DVFD 3ZKQD 1YYCA 2EVIA 2FWOA 5BO1H 3D0VB 4M5ZH 3VXUB 3AWGA 3VU2A 1KFAL 1BPVA 1LILA 4HIXH 3QCTL 5IROA 4PGEB 5I6XB 3FN9A 4H4NA 4LFHD 2XYBA 3ARRA 3CNKA 4NQSA 3J8F7 5CGBA 2R29H 4PY8J 4NQED 5JTWA 1M1XB 4QHUA 2D03H 3I74A 2NYYC 4HFWB 3QNXB 4TNWF 3GNMH 3GSUA 3RWEB 3VGHA 2EKSA 4JGUA 4PJDA 3ZDXB 3MBWB 3ZHKA 3IJSB 2Q7AA 4F58H 3CFKA 4YSOA 2H1XA 1KIUA 1LP9B 3QORC 1ROCA 3L1OH 5DUML 3L3OB 4N8UA 4JFHE 3Q6FA 1DN2A 1PMYA 3VFSB 1O6TA 3QIWA 5DI8B 1AY1L 2GTWA 4M61A 4ZXBA 4GAAA 4K7PL 2JCCF 1OB1A 3ILQD 4LF3B 4LPUA 4UTBL 3SBPA 3F00A 3LD8B 1NIFA 2JKSA 4QOKB 4IU2B 4XC1H 4CGTA 1ZKAA 5JHDB 3E80A 5IF0A 4OGXH 3ZPDA 3T2OA 1DJZA 2Y1VA 1XIWD 3BH9A 2R8SL 1YEKL 5I9QB 3T77A 1CD1B 3BPNB 3RJOA 4Q9BA 3UYPA 5FV2A 3ZSSA 3ARFA 5EBMB 1EWHA 5E4EC 2C26A 4YL4A 2WXFA 1HHKA 1UKSA 1F86A 1SN5A 5FUZH 4G82A 1Z5HA 3GZPA 3QUXC 4NZ8A 1FFRA 4KZCA 1Q9KA 3THMH 4XH2B 2ETWA 1QLEH 3O8XB 3V2AR 3DC0A 3T4AA 3UTTD 1LE5A 1GA2A 5ICUA 3L5HA 1NGZB 3FYIB 4NNXB 1PLCA 3RWGB 4L3EE 1CFQA 4K8RH 5CU5A 4ZX5A 3OGOE 4NN7C 3SGJA 1C16A 4QXGH 2XPZA 1T5WA 1XGPA 2XXMB 1CDUA 4E9WA 2XI9A 3WELA 1E4XI 1M7XA 2ZF8A 3PDOB 5D7LE 1FRGH 3O6LL 2WNWA 1J9SA 4HQQH 1YYML 3EO9H 5C0GA 3CZEA 5FM5M 4JRXD 5EWIL 3LIZH 5B8CB 4GKSA 4DUXA 2ICES 2WVVA 3GSNH 2EDMA 3HAEH 2CAKA 3DPBA 4Y19D 4OFDA 5HYJE 3EO1A 3V0AC 3UZEA 4A7GF 5FDYA 2PXYC 3T1WA 3T6XA 1I1YA 2BIPA 1T6BX 2F9BT 1A22B 3VI3A 1OQXA 3CHOA 4PQXA 3HI1A 2IFFL 1HL9A 4XT1C 3L1EA 4YXLL 3HE6B 1TPXC 1L3NA 4AI7A 1ULVA 1YMMD 1I4FA 3EBAA 4E9VA 6FABL 4JHAH 1UT1A 3OKLA 2WV3A 4ZXBD 4WO4C 4P5TD 2NY6C 4MJIE 5JZ7D 2AGJL 4LCWB 5IEKA 2VTFA 1JPTL 2FECI 3BHBA 3MCKB 4MCZA 4WO4A 2X9YA 1XL6A 3HB3D 3BOVA 4AM0B 3MLWL 2Z64C 1O7VA 4A7GA 5HHOA 3WEMA 4BFJA 3V0FA 4G5ZL 1MLCA 1SYSB 4GYBA 4DZ8B 5DD3L 3TN0C 1XIWB 4CW1A 4F8QA 5KVGL 3SDAA 3NPZB 4FTVD 2B16A 3CMOL 1XF5A 3POCA 3TO4D 4KNSA 8CGTA 2MCPH 2DRUA 4XCFL 1TYEB 1DN0B 4ZXBC 2NY4D 2XU9A 2VRKA 3RA7H 4DN3L 3MJ9L 2Z1PA 4B9JA 5FA4B 4HKXA 3NCCB 5H37G 1IQDB 2IANB 3J7HA 3ARGA 1NA8A 1P5VA 3SKJL 2Q8BL 2R69A 4NKIL 5DEJA 3MV7E 1J5HA 5KBLA 1Q9LA 3JWOH 3IM1A 4KQ3H 4HIPA 2CLRA 5C0IB 2AHIA 3GLZA 2AMGA 4QY8A 4IGBA 1MFBH 4QI3A 4GXVH 1AACA 2UWEF 4JX0A 3Q0HA 5CWSA 4X6BA 3GXMA 1BCIA 3CQPA 3QEHB 2GBUA 3KPSD 1RFDL 1CR9H 3LKOB 1ZIBA 3RIFF 3ZQ9A 3G5XA 2Z9TA 1WV7T 2CIIB 1CGVA 2IADA 2DQGL 4I1NB 3GDBA 3MBED 3BGAA 5F3FA 1K8DB 4IOSA 4L3CB 4HIIA 2EDDA 3UTQA 1CIUA 1I9RL 3THML 3P2BA 1KEGH 3PHOB 1JHLH 3T2NL 3VI4E 3C09C 2L8AA 4GI6A 3HAEB 3F04A 1SNRA 4O51A 1IVTA 4WW1B 4KVNH 4WUUD 4QWWC 1F3DH 1KNOB 4UT9H 1DFXA 4HS3B 2KL6A 2DD8H 5F3BB 3MGOB 2Y06H 4GXUM 4ICXA 2KUTA 1JNHA 2J73A 3OD3A 2J5LB 2JIXD 3KYKH 1KPRA 2YXFA 4KQ4H 2PYEE 4K7FB 2W9DH 3HPLA 1U3NA 2WZPD 2DKUA 1FZJA 1Z9PA 4J4PC 1FAIH 4L5FL 1A3LL 2I5YL 2YKLH 3EH3B 5T3XL 1NGXB 2E86A 4LLVA 1V7ML 2W38A 2YD8A 4KI5E 3VSUA 4YK4C 2JCCB 5EBLB 3RE0A 1DDHA 1T6WA 1MIEH 1RIVH 2WQXA 3HC0B 3N1PC 5IW3A 4PWGA 4DKFH 5GZND 4L9LB 2ZOKA 3DV4B 5KYUB 2EDWA 2BWQA 1HHGA 5E7BA 3TA3D 2UWEB 1TZIB 3X12A 3QDGE 4ECNA 2AXFB 1CTNA 1KB9J 4JZOB 5T33H 1DVFB 5CEYA 3ZRSA 4HS3A 4ZNEE 3ARFD 2BWIA 4PHZA 2BSED 3FRUA 1MCNA 4G6FD 2P3YA 3Q05A 2VLKD 3PREA 3BFQG 32C2B 4J6IA 4I7ZC 5HHPA 1UXSA 4B9GA 4AMKH 4NAJA 4NQSB 1S5HA 4Y4FB 2Q7YB 4YDMA 3V4VL 3PL6D 3QA3B 1X9QA 5DWUL 3BJ91 4Z77A 5FFLA 4HMCA 1AS8A 4HH9A 5F6IB 4IBYA 4HPYL 3KXFE 4YFDB 3RWCB 3DUUA 3WKQA 2V5MA 2YUZA 4KFMA 4Y4HB 3EFDH 1NCBH 3D3VE 1U33A 4I8DA 4KX9A 4XZUA 4DO4A 2J8UB 5DYFA 4Y4KC 4P2AA 1IGML 4FFYH 1N2RA 1C5CL 4KO6A 4NQEB 2ZPKH 2ZAIA 4BD4A 4AV4A 4K8RC 3ZRFC 4PY8I 3KL0A 4Q8BA 4FEIA 3MBXH 4UWQB 1WZKA 3M7FB 3FUMA 3L5IA 4GAYA 4LSUL 5IFJA 3OL2A 5DRZB 3F05A 2VDOB 3HR5B 1II4E 1SHXA 4XBGA 4XO8A 4TPRH 3VFNB 1NGWB 5TK2A 1CLYH 3QJFB 1XCQA 2ZP0T 2PW1B 2XZCH 4F7TA 5I15L 3BMWA 4KDVA 2GVYA 4JZJB 5SWZA 1S8DA 4N90E 3GRGA 5CHNB 3QZWG 5AOLA 3TTYA 3C8HA 2CCVA 1QSVA 1KJVB 4W9LC 3FB7B 3PV7A 2OMYA 2GK0A 2RGSA 5DS8A 4WKZB 4QT5A 5I76A 4GXUN 1SDDB 5ENWB 4JQVC 5FYKD 3TTSA 4Z7VE 4OGAC 5K9JH 2EZ0C 2H32H 3RL2A 2DQDH 5DLMH 1NC4B 4F20A 1UASA 4XNUH 3WFCL 2IPKA 3QJUB 1KYUA 2VJ0A 3SDXF 3T4AB 5C2BL 3KLQA 1GZPA 2DJUA 4XNQA 4JM4H 2F58H 4ACTA 4MCZB 4U7KA 3MGTB 4HLEA 3CZFA 4LOEA 4TUOA 4RGOL 4TLUA 4RGOH 3D0VA 1UUSA 4I13B 3VXRE 5DD0L 5IB2B 1DBBL 3MYJA 5F7YC 3SQOL 2RFXB 1UWFA 3V9EA 1ADQL 2AQSA 4L0ZA 2EZ0D 3NFNB 5AOKA 1ES0B 2UY7A 2XICA 1V7NH 1FZKB 1TQVA 1OLLA 2EEAA 4YLBA 1LEIB 3LZLA 3BD5A 4WW2C 2QQKL 3UYRH 4O4YH 3KPMA 5FFOA 1IVLA 2Z8SA 3V8OA 4ANWA 1LP9E 2X9XA 3QRGL 4GO6B 4GBXA 4S1RL 5BV7C 2Q6WB 1W8NA 3TYFB 4EI5A 3EBGA 4X6FB 5F1SA 5B3NA 3OG4B 3OWRA 4EMZA 5E95B 3SO3B 1QATA 4MAYA 1QRNA 4G6JH 3UEZA 1RZGA 1YN6B 4HOXA 3O3BA 5I1LA 2GFBA 2DLFH 2G2NA 4QOKE 3Q2VA 1AO7A 4PG9A 1MHCB 2KBGA 3RVWC 3IJSA 2EEFA 2X6AA 4MMZB 4XNDA 3ECQA 4HK0B 1IAIH 2X1OA 4KHTL 4XNYL 4QRSB 2FIKA 4A55A 4HUWA 2J21A 4C57C 5CCGE 4IK7A 5HGAB 4WFED 1A6WH 1M3IA 2BP0B 4JKMA 5SX5H 5E2WL 3UX9B 2XXGA 1NDTA 2UZIH 4UM9B 4APQA 3OMIB 4GKNB 2H3NA 1E4JA 3KWWA 4MXVF 1D6EB 1KYDA 5F89B 5HYEA 3TYFA 2JKNA 1DZ0A 1SN0A 2G5UA 4AYID 4MZ3A 4RX4A 4JY5L 4PFEA 1J5OL 3IDJA 3UTZA 4RESB 4D9QE 1FVDA 4FOMA 5ICXA 3IU3B 1QLRA 3IVKB 3P4NB 3NCXA 4PJ8C 2AJ3A 2F54B 4BUQA 3M1BB 4H1LG 3OAYH 2XVLA 3N41B 4KOBA 1IT9L 1NEPA 1E67A 3B9KD 1AGCB 3GSRA 4F7MB 2WWNA 2V7HA 3T3PB 1UM4H 3ZKND 3IJYB 4MWFB 1QAWA 2QL1A 3GO1L 3QXWA 4PJFB 1C7SA 3RNKA 2C1OB 2XTLA 4TQHA 1RUKL 3IDGB 1ZDQA 3QORB 1J9TA 1UWGL 1VKXB 2NZIA 2IANA 2G5BA 4P59L 5J8OA 4R2GC 1EJOL 1ZA6B 4GAJL 5C3LD 3L4UA 3GSNL 4R97C 1HAUA 1RURH 1BLNA 2DIBA 1ILUA 2R15A 3OMAB 4DAGH 4KQ4L 1T1XB 1MCPL 4HULB 1U8QA 3O6FC 4PJBE 1A02N 2JKLA 3RWEA 2W59A 4ZOCA 4NOFA 5J6GB 1IB5A 2IALA 5D7JB 5J6HB 2R7EB 4AH2B 3VI3F 1KXVA 4NUMA 4DP1X 3ENEA 2WBJD 4XCNB 5HDBB 5I73C 1IMHC 1X3DA 2NY0C 1BYNA 5GISH 3FU0A 3VXTB 2NY1C 1UJTA 1DQLL 2JIXB 2W95A 4P0DA 5L2KE 3ILDA 4QRRE 4NKQB 1AKJD 2ADIB 1QLEL 1OAKL 2XQYA 5FXCH 5CCKL 3WTYA 4WI7A 2IAMB 2PTTB 1I8UA 4LP4A 5IREA 2BW5A 2VC2B 5EZLB 5AZEL 2A77H 4P3DA 2CLVB 1FPTL 1X5HA 3NSFA 4HAKA 1NJ9B 3NESA 2QGEA 4G7SB 3CC5A 2H47C 3MLYL 4OJFL 5CEXB 1WEJL 2CE6A 3WXVH 4N8VB 2XTJC 4A2EA 2D2CC 5E99L 2WXGA 2V9TA 2Y6TE 3QJRB 4X8XA 3EJUA 4I0PA 1I1AA 2J6WA 2V2TA 4WLCA 2WLLA 2R0WH 1V27A 4ELDA 4QF1A 2EDXA 1E30A 5CS7A 2ZAGA 3LEYL 1H3TA 2ISDA 4H5SA 1ADWA 2APBA 3CSYB 4YPJA 4Z7UE 2A73A 1Y6KR 4TKWA 5DZVA 1MUJB 5SX4I 3IDYB 1UATA 5JW4M 1D9KC 4RGNC 1HINH 1JS4A 5IBTH 3UBXG 1G9MC 2EABA 3WHE1 1IQWL 1N64H 5E8EB 2L3BA 3UZQB 1YNLH 3JV6B 1YY9D 2VDMH 1XTMA 3AM8C 4JKPH 4X6EB 3OJDA 4G43B 2X4TB 4AYFB 1OGTA 4M5TA 2WGNB 3N40F 4ZS7L 2YAQA 5FS5A 3TBYA 3X2QB 1SOQA 3ARDB 4FQPA 1MW1A 2IAND 3HHMA 4LZKA 5DZJA 3GNML 1IFGA 2Z92A 4G8GA 3X13B 3STZA 2EUVA 2P1YA 1CLOL 3I9PA 3FYEB 5IUSA 3CZKA 3IVKA 2YBRB 1ECZA 2YLKA 1IBGH 1OO2A 4I3GA 4AL8H 3KEDA 5A6IA 3NA9H 1N0XH 5CZXD 1UZ8A 1YEGH 2OTPA 4FG4A 4JW3A 3VDBA 2ZSVA 1UQSA 1P6WA 3HG1A 4IKJA 2LQRA 1INQA 4PJGB 4XODA 3ZOAA 1I1YB 3TVMD 3MLYH 4HXAL 2VT0A 4UTAL 4OIAA 1TMCB 3PL6C 3BZDA 4IDLA 2A77L 1YQVH 1ZHLA 3GJFA 1N18A 3MBEB 3VGDA 4KTEL 1T3FB 2WXIA 2KMWA 1PY0A 2QQQA 1AKJA 3F64A 4O51B 3OKKB 5I8OL 1F8TH 5D4QA 3SOBH 1U8HB 3BSZA 4UAHA 3FQRB 1BG1A 2EYTB 2LU7A 2GTZA 2F15A 1MWAH 1T1XA 2DQJL 4B97A 3NZHL 2PTVA 2ICWA 2FX8H 3DHJA 4F57H 1IEAB 2GT9B 1D5IL 4GQ9L 3ZL2A 2YXMA 43C9B 5C0AB 2X87A 1T7XA 1JRHH 2KDYA 4MLSA 3RPIA 1B9ZA 1R19A 1SM3H 1RP8A 3VM7A 4OIFA 3S4SG 4LHUB 3RQ3A 3BLPX 4TTGA 5HGBA 1ANUA 4BDVB 1GGTA 2A3TA 3ARGC 2IGTA 4D9QD 3FOMB 4NRZB 4J4PD 2DM3A 4KJWC 3SGJC 1EDHA 4R9HA 3SPIA 2ATKA 3BWZA 5T3ZL 3DECA 2OX5A 3G5VB 4X0NA 3UO1H 4A6YL 4PIRF 1SYVB 2ROYA 2I60L 2OJZH 4UTAA 5DJDB 3ZN6A 1NMBH 1NUGA 3CHQA 5C07D 2VMCA 3WJLC 1LEIA 4WI9A 1HH6B 3NK4A 3JUYA 5EF3A 5FDWB 1MW0A 4UOZA 4NZRL 4HLJA 1I3RB 5CU9A 4PJGF 1TMQA 4KY1H 4R4FL 2OR9L 5EULV 5JQHC 3WTUA 3BGFC 5IB2A 1O6SB 5HHQB 1PDKB 3F58H 5HPMA 4J2QA 2PETA 3IN2A 2P5ED 1LD9B 2YN3A 5FYJH 3FU7B 1HHJB 2EDYA 5E9DE 2RAMA 3U1SH 4PJFF 4P46D 3LKRA 3KLSA 1IAOA 1BVNP 1EV2E 2FX7H 4N9GA 2A5UA 5J6SA 4AZUA 4XCEB 2CDFA 3GGWB 5KVMC 3ZMEA 1LQBC 3UTSA 5FUCC 2OP4L 1U8LB 5B7MA 5JHDD 4E68A 5EF2A 2E27H 4PJCF 3WKYA 4PWKA 5FO9A 4DVBA 1ZRUA 5IB1A 2IQAB 4EXPX 1IQWH 3BP5B 4NIKB 2ZWNA 4N2MA 3BAJA 2ZSWA 2G9KA 1VACB 5D6CA 3ARYA 3ZQWA 1ZHBB 5DZ9A 3VYNA 4G9FA 1DVFC 1XB6A 2WO4A 4X50A 3SE8H 1DBJH 7TAAA 4WWNA 2E5EA 3E2HC 1YYLL 2MSPA 4GINA 1KTDA 2NY7L 3QIBC 4EDWH 3LS5H 1DE4B 4M43L 4PRPD 3A22A 1U3HB 2VQ1A 3LEXA 2BVOB 3UTTB 1TQTA 2C1PB 4DQOL 4YX2H 5IKCB 2X3BA 3TO4C 3HCVA 1NUFA 3ZE1B 1UT9A 1YEEH 4I77H 1GKOA 3WE6A 4NZTH 1U8PB 4WI6A 3MLUL 2MHAB 1W72L 4PMFA 5INCB 3WO4B 2OXGA 3MO1B 1CURA 1KCKA 3V52L 3OHMB 5JZ7C 4J6RL 3JT2A 5AWNL 1GYVA 4AE1A 3GEWB 3HZYA 5A7BA 1LEKB 2C9PA 4TV3A 5KVEH 2IVFC 1LEGB 2P5WD 2FD6H 2Z4TA 3H2PA 1FL6B 3CFBB 2VDML 1YDPA 9PCYA 4U1SA 1BD2D 3E0GA 4JR9H 5BOZG 3W5MA 3X17A 3VQ1C 1FSKC 2PWEA 1KXVC 4WHYH 3DX7B 5FYLD 1KJMB 2J4WH 1M4KA 2KI6A 3O45A 1FVEA 2L7EA 4I1PA 3O6FA 3TBTA 1S7SB 2BH0A 3ZW3A 3QG6B 4KI5F 4HK3J 2DYPD 5K9JL 2YOAA 1IC7H 1HDMB 1XF2B 3AABA 4HJGB 3K80A 4ZUVA 4Y7MA 3JSSA 3BCDA 2CJ3A 4LIQE 3R19A 1K5WA 3VW3H 2FNBA 3GO1H 5L7XH 5GIRB 4JBSA 5DR5H 1N59A 5LAPA 5GS1B 1RZ7L 3DX4A 4NKOB 1ZLDA 2VN7A 1EXUB 1AGBA 2OLDA 1OAKH 4KDWA 1HCFX 5LG1A 3NGBB 1O75A 2MTPA 5D1XA 4HOMA 2GK2A 4L4TB 4O2CA 1XB8A 3DX7A 3CPLB 4OZHA 1M42A 4GRWE 3KGSA 4FG2A 2YD0A 4FDWA 3A47A 5D9SA 3MRRA 4W70A 1S7UA 2OA9A 4UT9A 4YXKH 3MA7A 3ZMRA 4M48H 3MA9H 3Q48A 4Y89A 5EIIA 4KU1A 4J3UA 5D70L 1MCPH 3WJLA 2IPKB 4FZEH 3DNKA 3U4BH 3MLTA 3ZE2F 1QA9A 4NPYA 5JIMA 1G7HB 1G7MB 1S78D 1ZWIA 1Z3GL 1GGUA 4KI5D 1HOEA 2JELH 3CSTA 4P4KA 2HG5A 4MAUH 3HFMH 5LCVH 3PGCB 4GSXA 5DK0B 4MJIB 5KTEH 3H9SA 3MJGX 1UG9A 2Z31B 5E8NB 1UWGH 5AZUA 4FNLL 5ESAA 3SO3C 5JXAH 2LE9A 3QZLA 1O9WA 4J1UA 5D7IA 5E8OB 2IGFL 3PP3H 4RFNB 3RIFK 4R26H 3EGSA 4NN6C 3MRJB 3AB0B 1A3RH 1U3HD 3V9FA 5F72S 3SDDA 4MAYC 3U1PA 3OAZH 1D5ZA 1UJ3B 1A9EB 3VTAA 2ZKWA 4RRPG 3U9UB 3UCRA 2GABA 1CE1L 2YRBA 3D30A 3C8KA 1A6VH 5T3XD 5IVOA 1GGCL 1ZA3A 1AFVL 2QTVA 2ZCKL 3G3LA 1UWXK 3NSXA 1NGPL 4M9PA 3HHSA 5CIPA 4M93C 1B9KA 4ZUSA 3B5TA 1A9VA 4XC3H 3MGOA 1MCEA 2OULB 3D39D 3P02A 4DPAX 6CGTA 3LDBC 3WEBA 2EXWD 3IK2A 4HOZA 1U8HA 1UC6A 4OQTL 5D93B 2MOGA 2ARJQ 3ES6A 3B2XA 3T0ED 1EJ8A 4CKVX 2OW6A 1G87A 4D0BA 3CX5K 2V2TB 1HHJA 4IIZA 3FN0L 5IHHA 2AEPL 2F74A 4NO0D 3QQ9D 3CGTA 1TG8A 4KKLD 4U7SA 1R1CA 1WRFA 4FFZH 2NCMA 4LLDB 3S2AA 4A6YB 4M62H 2GJ6B 4NRYB 1T4WA 3S36X 2XRAL 5KVFE 3HG3A 3T4YB 4MNGE 3ZZQA 2UWEA 4PJCB 1G7JA 4B9ZA 3SEPA 2AABH 3RJDA 1DVXA 2F18A 4CVZB 2ZOTA 3QQ3A 1MIMH 5E23A 3AU0A 1IM3A 1BF2A 1YY9C 3T0XA 1J87A 3V6OC 4G6FB 4FFVC 4P04A 4IHBA 3K8MA 3C60D 4PJBF 3GBNH 4JO5A 2PP9A 2VZVA 3L54A 1QMUA 2BERA 1EHNA 2R0LH 4G3YH 4KKNA 3RIAK 1FFPB 3HNTL 1YEJL 4PJXE 4KRPC 3SPHA 3FHAA 1RUPL 3LZOA 4HF5L 3RDJA 3ZDZE 5E08L 3ZUNC 1DVTA 2J3SA 4IMKC 3BKML 1HHIB 1L7TH 3LRHA 5CJOL 3ZTNH 3QO0A 2F8OA 3L9RB 3IFNH 1R33A 4RSVA 1OAQH 4ZRGA 3DTXA 2CUAA 5SV3A 1WFNA 2X2YA 4Z7NB 5AVZB 5I73B 3TNNB 1EANA 5EFIB 3AG2B 2VIRB 3V4VA 1BMWA 2V6HA 3D08A 1C5CH 5DD0H 1PY4A 3C5SB 2PLTA 2NY1B 2V9RA 4X8CA 3TCLB 1S9WB 3BP4B 4MA1C 2YARA 4N9GB 4P3CH 4IBLT 3V6BR 4CMHB 3KR3H 4XPTH 1S7XB 3NUKA 1ECYA 5C2BH 3RTQA 2BVPA 1ZK5A 4XCFH 4KKRA 1R5WA 3S3SA 3CAFA 3LHPL 3OB8A 2BY2A 5EC1A 3C60C 4ZK8A 1PDKA 1NDGA 5AW7B 4TQPA 4AYMC 4LU5L 5BRZB 1A6VL 5CBEB 1JYWA 1I1FB 3FQTB 2BSEA 2A1WH 4YHNA 3OMNB 3L4TA 4GEJA 3T8XA 4NWUL 3OTTA 4R4NC 3EFOB 3WHXB 3ECWA 4I18A 4G6AC 4JFWA 4EUPA 5I0ZA 4QRTA 3TPUA 2GHZA 1NGYA 3L3DB 1JOIA 3MOBH 5MP6H 3W81A 5TQ2H 2H3NB 3UBHA 1DHKA 4EPSA 4LCYB 1YUHA 3HG0A 2IGLA 4X4ME 1P5UC 1JZGA 5HGHB 3IAPA 3CCHB 4U1MA 2R0ZH 3TZVB 2Y0SA 2IQAA 3LRGA 1ZJAA 1NCWL 4N1HB 1X9RA 2BMKA 5F21B 1P5UA 5ESQA 4HKBA 4KKCD 4G43A 4HA1A 1SLUA 1UB6B 4JPIB 1RZIA 3SZ6A 2P7TB 2AC0A 5DURD 1TJHL 3JWDC 1TJGL 4A2DA 5IMLA 1U8CB 2WJ5A 1KNOA 4MZ2A 4OV6F 4U31A 2D0GA 3LPOA 4OCWH 2W0FB 5E5MB 2PPAA 3UAJA 1NANI 1NPJA 1K4CB 5D70H 5KSUB 4L8DA 3CXHK 3G9VA 3BE1H 2BPBA 2F19H 3VXUE 4RIRA 1N9PA 4S1QL 3MLVL 1CF1A 5A7EA 2BOBA 1S8DB 4ICWA 5BVPH 4KJPD 4LCIL 5CO1A 5I1CL 1EZVX 4MRCA 3QUYD 1S7WB 3WFHB 4Q6IC 3WE6B 4RBPK 4ABUA 4PBVC 5EU4A 2V5YA 3TFKC 3KPRE 5TDPB 2NQDA 5JW5B 1YMHA 4CVWA 3U6XA 3V4PB 3IJ7A 5DEZA 4PRNB 1NIDA 2B1AL 3EH4B 2IH8A 4L4JA 5F0LB 1FZOA 3TBVB 4QXTB 2Q87A 4HU8A 4L0PB 3U36B 3U6RB 1RV6X 4JG5A 1WLHA 5KBPA 1TJMA 1FGNH 1T2JA 1EMTL 1U58B 3NQKA 1CMOA 2BY1A 3KYNA 4G83A 3GJFK 1CF8H 3GT6A 1RFDH 3CLFL 2FUTA 5AKVA 3FQWB 2WXJA 5D1XE 2OPCA 2X4QB 2P49B 2ZF9A 3BT2H 4DK6A 2F1BA 2ZJSH 3T08A 4AQOA 4FZ8L 1VENA 5SWQA 1V5JA 1JZJA 1YEKH 4U6XA 1NCNA 1O9VA 1TU2A 4MAZA 1ICTA 2J8UE 5FCUL 2OZNA 4Y1SA 5DQ9B 2Y4SA 2ENSA 4FQ2H 2XZZA 3GMMA 5H94A 2APXA 3VG9C 2LABA 1N67A 2VIRA 3KS0H 2BNRB 1NEZB 4UILH 3WNKA 1M71B 3PWNB 3QJZA 1RZJH 2QQNL 2D3VA 3FU5A 3L4CA 3TA3B 3X1BA 5HDQL 1ZA3B 5DRXA 3M07A 2BDNH 5IIEB 1BQHG 3IS0X 3LQAC 1CF8L 5DSCB 2N7SA 2VISB 4CL7A 3RVUC 2SEBA 1A7PH 5GGSY 1S7VA 2L7QA 5EH1A 5CFHA 5KSAB 4XTRC 2D31B 5KVDE 4Q2ZB 3D3VA 2J43A 1FF5A 4QHLB 3QYNA 5DT1L 4X98A 4ISVA 4DKEH 5CZKA 4RWYL 4M8UA 2R29L 5AB9A 1T0NB 4AV0A 3KW7A 5DC9B 3DXAB 2LV4A 1R3IH 1UHVA 4KUZL 2B39A 2XQ0A 5L8KB 1FFNA 1J0KA 3QXDB 4UYQA 4HGKC 2NQ3A 3ETBJ 5IMKB 1BZ7A 1U2YA 3RY6A 5F93C 5DS2A 4I5BB 3QFJE 1PZ2A 4F8TA 3QGVA 4JJHA 1TQUA 4WF7A 1KCUH 4O02L 3D4GA 5F3HB 35C8H 3WFEL 1ZOXA 3H56A 4ZNEA 4FMKA 1NH6A 3BJLA 3I2CL 4OCYL 4WWOA 2ZTBA 3S3DB 5IY5B 3F65A 4UQ2B 2O6EA 4H8PA 2C9AA 4UMGA 1NOAA 4OJEH 1XMEB 2O72A 2YWYA 2BSBA 2H45A 3O3EA 5TGBB 5D7JA 1UD6A 4AGPA 1R3KA 2ICEC 4AQ8A 2BIMA 3FQNA 3RI5F 2AXGB 1MFNA 1T1YB 1O7DC 3HA0A 4ZUSB 1YMMB 4F7CA 1G9HA 4PRHA 2XACC 2EKJA 2J1KA 2OJEB 3TN0D 3BSZL 2WLJA 3TBCA 1H3GA 1VGEL 4ZFZB 4R4BB 4M8QA 5T1DH 5IQ7H 5DD3H 5KVGH 4YSSA 5IQMA 1BIHA 1OSYA 1A6AA 4YHOL 4K8RD 2FJHB 2WBXA 5I5MA 1X9LA 1A4BA 3QIBD 4JCWA 1M56B 1XEUA 5HHNB 3V9CA 3TO4B 5E2JA 5IHZB 4G1MB 4X9GA 1QHQA 1S6NA 1FVCB 3CLWA 4AW7A 2VL5B 3N1QC 1UYWL 4FG6D 3T0EB 3H9HB 2P5WB 1HSAB 1OP3H 4IKLA 2KERA 3EXLA 5KBNC 4HUKB 2AJYH 2WXHA 4HBCL 1I1FA 3FQTA 2MOQA 1QBLL 4Y1AA 1F11B 4P2OA 1SUHA 3IFPB 4AW4A 2GUYA 1ZLUH 5DK0A 2JF1A 3BEVB 3UO1L 4E0RB 1DCEA 1L0QA 2HFEA 3L3GA 4GBXC 1FH5H 1SXAA 1NFDB 3NABH 1F4YH 3S48A 1MCHA 5CEZD 3FPYA 4UT7H 2IQ9L 4ZQKA 3RHWK 2TSAA 4E42A 4J3XA 4QHMA 4L8SA 5KSVB 3QUYA 4TTDD 2DWXA 2GPZA 4TVUA 4R5XA 4ZS6D 1HHHB 4NQVA 4ZUUA 4DGVL 3CFNA 5JLZA 1FH2A 3P9WB 1MRFH 2BP0A 2JJSA 3TJHC 2UZPA 3MO1A 3ARDD 4P23D 1UXWA 4FP8H 2BSRA 2G75B 3V4VB 1ASOA 1ND0B 4HSCX 1JK9A 4YBQD 5JDSA 5FHAH 4KRLB 3RPBA 4YHPB 1MHHA 1UD2A 2H6OA 3GIVA 5KSAD 1UGKA 2NUPB 2OMBA 2Z93A 4KZDL 1WTGT 4OGZA 1XF3A 3BPCB 2ZOOA 4PBDA 1FUNA 4QTHB 2NNAB 3JTBA 1P2CB 25C8L 3VXOA 1OD7A 3MRFB 4N20A 4KRMB 3MRJA 4JO8A 5K39A 3WSQH 1KPVB 4V1DA 3LEVL 2VKWA 4NS0A 4UZUA 3ISWA 4WCYL 4YE0A 5CZVH 5AFAA 4HJGA 3HKZA 1NOFA 4LARL 1BOYA 1KB5L 1QLFA 2FX9L 2FD6L 5LKNA 3EJPA 3SDDC 4OCRH 1ZLWH 1G9NL 2CHNA 4KKBD 2F53B 1MAML 4CC4C 4W68A 4EZLA 2XBDA 4MBOA 5D5MA 5K9QI 4QDGA 1A65A 1I9JL 5EC1B 3T71A 1SXBA 2XX0A 4XN8A 3KHQA 1R3HB 4UTBH 2JK5B 1MHEA 3A4DA 3ECBA 4HS6B 1KIRA 5T5FA 3T2QA 3U7AA 5F9WC 5D7IE 4I77L 5IFHL 3ML9A 1JF1A 4GLRH 1RY7B 2QPFA 5JIKA 2H0JA 2WXQA 3W0WE 3GSNA 1U8CA 1UD4A 2ZX8A 4BQ9A 2OAAA 4MMZA 4Y2DB 2FSDA 1AQHA 1PKQB 1YYLH 3KPLB 1E4KC 2VRQA 3UGXA 2FVNA 3WY3A 4YZFE 5CN3A 4FFZA 4LLMA 5KW9H 3RUGA 3NJIA 5HGHA 2CGRL 2L7JA 4JRFA 2MQ3A 4LGSB 5DJ6A 5GGTA 4Z7NE 3K91A 3IF1B 4JCLA 3ULVD 2BC4B 3HMXL 1WAAA 1N3NA 1AGEB 1MCQA 3CQQA 3FMGH 3LCYA 3KL5A 2GITB 1FIEA 1Q9LB 4NT6A 2COVD 5D1XC 2EVJA 1Z3GH 4KVCL 4QD2E 1FYHB 2WWOA 4LF3A 3Q13A 4PR5B 1Z9OA 3GHPA 2HZHA 2YD9A 4MD4A 4XP6H 4WAFA 2NSQA 5DFVD 3IU3A 1WAPA 1KN4L 1Z9LA 1VACA 1KJMA 2QSCH 4QRPA 1UFGA 5B39A 4X7FC 1A4AA 2X1PA 1VA9A 4JUTA 4RISH 3S5LG 4Q6KA 4YXKL 1OOAA 1R3JA 2X44D 2YSTA 3V0IA 3VWKA 3N06B 2Y36H 3NFNA 1JHTA 3D0LB 2NY3B 5H37A 5HJ3B 2CNZA 1F4YL 3QEGH 1M7IA 4CSSA 4OZIA 3V7AG 5JLZB 1CL7H 3TO2A 4CW1B 3VDCA 4J4PA 4TTDC 2BOLA 2KKQA 3NDYE 4KJYB 4YO0B 4K2UL 1UCBH 1CG9B 3C6LC 3QJQB 4N2HA 5AW2B 1U8PA 4UOJA 4JFEA 2H9GA 4NN5C 1C8PA 1A6ZA 2A38A 3GXPA 1ZANH 4IRZH 4LVHB 3WBDA 3ECUA 1SFHA 4LDLB 3GF8A 5IEKB 3R0MA 4HLZH 4XB8A 3P2DA 3GMNA 3U9PL 4ALAC 4A6YH 2ZKHH 1GYAA 2GFBB 2QTEA 2A6KA 5ID0A 2H0FA 4ZPVB 3R8QA 5EBWA 1GAFH 4HHAB 5I1GH 2HTLD 3QWRA 1AR2A 5IFAL 4XXDA 5A16B 3EOAA 1ZVYA 1E6OL 3EYFA 4OLWL 4JS7A 3AROA 4K23H 2ITDB 5HVGB 1CICB 1FG2A 2Q8AH 5EU6E 3AADB 5EF0A 4KZ0A 2XN9E 4GKLA 1G9MH 2YGPA 2PCPB 3TO4A 2IPTL 3CVIH 3Q43A 3DPBB 3TBSA 5JIHA 3NZHH 1KCLA 2DI9A 5AW3B 2VISA 1KT2B 1AQ8A 3FW6A 1OAZH 3PABB 4UIMB 3HLAA 2QHRH 1U8LA 4MJIA 3HZMB 4J6RH 4JY5H 5AWNH 4XNBA 1HILA 1NAMA 1OT4A 4MQTB 1O7DE 3JWNG 3CZGA 5I8OH 4X5WB 4MB1A 3PDOA 2K45A 4EEEA 4W9FC 3CDGA 2EIMB 4GKZA 4Q4IA 1WSST 2WKLA 4FL4B 1SMDA 1I9IL 1VRSA 4X4ZA 5D8JH 4AK1A 3APCA 3I02B 3WFEH 4IRZA 2JKTM 5F7FA 4YX2L 4HUVB 1P7HL 4WTZA 1H5BB 3GMQB 3SE3C 3I75A 4NC1E 4L8SB 3BUBA 1G7PA 5CZVL 3LOWA 1BZ8A 1HAWA 3PWVB 4ZX4A 4PJ5E 3IMSA 5AKRA 5F1IB 5DK2A 4N28A 1R3IL 2CO1A 3LQZB 5JNYA 1YN7A 4M1CC 2K0RA 3BN9C 1UM6H 1X5FA 1SRDA 3O81A 4GIAA 1NLBH 4LPXA 1NCDH 3TH4T 1NFIA 1LO5B 1Q9WB 5J4MA 3QQNA 1BEYL 1UZ6F 1XR8B 3OKEA 3QRBA 4BK4A 2H6PA 3BVXA 1JPEA 1PGRB 3UZVB 1U42A 3WEXA 1JSYA 5CP7B 3UC2A 1NAKL 3BVDB 3U30C 5IB4A 4MJJA 5J57B 1QRNE 3N43F 5KSUA 3TV3L 2X4SB 4BRJA 4MGXA 3VFWB 3WFZA 5J12C 5IUCA 1MVUA 4L4VD 1GMEA 2DI7A 2CRYA 3V7AE 1MCCA 3O6FD 3QULB 3CDZB 1G7HA 3GRWL 4AKOA 2I7SA 1RQ5A 2DWDA 2P24A 5EDXA 2H3KA 1NEUA 4N24A 1BXVA 1DBBH 3FFCE 4HKBB 4YR6A 4FQLH 1GZHA 1ZS8A 2C9XA 3CZJA 1MJ8H 4MCYA 2F58L 4G8EA 5CAYB 4XXCA 3VRIA 2BNQD 3VGAB 4TNVK 1VPOL 1EO8L 2CBTA 2CKBL 2DM2A 4FI7A 3B8YA 3UMNA 4OLXH 3F7LA 1AKPA 3BDYH 3EZ8A 3LZNA 4WI0A 2HAZA 3MVSA 5H37H 2P5EB 3EOTL 3MRIA 4OCLC 3ZKNC 2WNKA 3EJTA 3QZWA 4BKTC 5KSBA 4X83A 4P2YA 4Y16B 2XN2A 1AGBB 2OXHA 5JW4Q 1KULA 1BZ7B 2OL3L 3EOAB 2VDKB 4P9MH 1TETH 4XVSL 3SGEH 4ZUWB 1HL5A 2F5BH 5IHWA 5AW9B 1PLGL 1F58L 2AJSH 3GHEL 3VGEA 3RVTC 3L7FA 1P4BH 3UH8A 2AERT 4NM4H 1HOCB 3IWUA 5LN8A 4OCXL 4KROB 4U49A 1CLYL 1OB1B 3IDXH 3AVEA 4NCC2 2PR4H 1GHFH 4L1LA 5DYOA 2ZWZA 3X14B 1RKRA 4ZAKA 4U1JA 1KMGA 1C12A 4AYFA 2DQJH 4RMBA 3KBFA 4GI9A 1OE1A 1FHNA 3ARDA 1WZMA 1I8AA 5C0RH 3A0OA 3HPJA 5CEZL 5JIDA 5JMOC 4PWEA 4HFUL 1UOLA 3HG1E 4KMQA 4CMMB 2QR0B 1EHLL 5L2KD 4LEXL 4UZGA 3RFZB 1NCBL 2Y24A 4W9CC 1T04B 2ESVE 3K3QA 4PB9L 1H3VA 4KKCC 4U1SB 1PBYA 1NDMA 3PQYD 4LOUD 2LR4A 3EBIA 3VWKB 4PAZA 1DLHB 4UTAH 2WXLA 3CN2A 1FG9C 1M71A 3ASNB 1JF1B 3PWNA 4YDIL 1E90A 1GC1H 3HI5H 3KPOA 5EN2A 2BCKB 1YUHB 2G3MA 3O9WA 1DEEA 3AM8A 4HKZA 4CN1A 2J2ZB 3NRQA 4K7PY 5IEHA 3RGVA 3GMRB 3RL1A 4OCSH 4XNXH 1LE9B 1J5OH 2FWOB 5DTFB 4G6KH 4AVJA 3Q2NA 2FIRT 4LVNC 4C59B 5CEXA 3BWUC 1KDIA 5ELIA 5JPNB 4AC2A 3IDJB 4YQXH 1G4MA 2K3HA 3G6JF 1KZYA 3P4LA 4JGNA 4NQEA 3SPCA 5JHMA 4UOW1 1FCGA 4IS6B 1T7WA 2IWKA 1JWUB 3B2VH 2QQLL 2PO6C 1JCVA 3UBXB 3B7RL 2YD2A 3BMVA 3EYOB 4LARH 3PLYA 4JFFE 4XPBL 4N8CH 5HDQH 4R83A 5CINL 1H8NA 4JJOA 1SXSA 4YLQT 5I6KA 3MRFA 5F1NB 3NCEB 3RZCD 2QJDA 3L3OC 3BP6B 4KK5C 4BUGA 1S3KL 3BAXA 3VXSE 5I1DB 3ZDYE 3P30H 5GSRA 5DJ2A 4I0KA 1JPST 3L3HA 2EVHA 2R0LL 4G3YL 3Q2LA 5DZLA 4LSRH 5EC2B 1WEJH 3CCHA 4U1MB 4OD3L 3FU3A 1OANA 4WWKA 1U4EA 4J23A 3NJKA 4LEOB 1KXQA 4TULH 1EERB 1EMTH 1FGNL 3HNSL 3DGGB 1XZ0B 4WJ5B 4DP9X 3UP6A 1R9FA 1FN4A 1XFPA 2PW1A 2MKWA 1XR9A 4BGDA 1CCZA 2HFGH 1TZAA 1VGKB 2OS7A 4D9RE 2FR4B 5IR1B 3BPOC 4Y0GA 3GRBA 1TVDA 4IQHA 4J1UB 5D7IB 1V10A 4Z76A 4BHUA 2CUIA 3FBQA 3FRPG 1KUMA 2QFRA 3ZTJG 2G0LA 3TIDA 4KO7A 2PW2A 2UUDH 4CVUA 4UOQA 2VDNB 1DVQA 1EDQA 1NPUA 3GK8L 2HH0H 4FNQA 1SY6L 2NY6D 4URTB 5A2IH 1OM9A 5F89A 2KYIA 5E2VH 5SWSE 4V2CB 2CDGB 5L2JA 1YMHB 2WJ7A 3BUYA 1AD9B 3ASOB 3SDXB 3DARA 4LPYA 5D7KD 1HZHL 1MI5B 2FZ3B 3RWCA 5MENA 4RSYA 5DHDA 4X98B 1ODAA 1RURL 4IBUA 2ZT9C 4BZYA 5DZNA 2VH5H 5BQDA 3CN4A 3WTVA 3RX8A 2CSPA 1AR1C 4FLQA 2FLBT 3PDGA 3RUGF 3E1ZA 5EU7E 1SLWA 1NL0H 4W9EC 3CDCA 3O4LA 1DLHA 1D5XB 1WBZA 3P9LB 3F7YB 1RMFL 4PRHB 3ESOA 1REIA 1RJCA 5A2LH 5E1HB 1BHGA 1E0OB 3D69A 4OIIH 4QYOA 1Q94A 5FB8A 1SOSA 2DTMH 3ZR6A 4BFKA 2R4RL 2FO8A 1BDYA 2YGQA 3EUDA 4Q9CA 1RK0B 4HWBL 3BSZH 4LSTH 1NICA 1PZ5B 1OTUD 4U3XA 1TSHA 1MREH 4NP4H 3RU8H 3MLWH 3HLAB 2ZX6A 2OMYB 3PPSA 5C6PB 3DV6A 4H8HA 3G5YB 4EOWL 4U3SB 1DANU 3D09A 3GXNA 3SB3A 2IDCA 2DLIA 3RVXC 2EUXA 2XPGA 1GW6A 1PZSA 5IHZA 2GJZB 5LCVL 1YSOA 3SYAA 5CJQL 1BVLB 3ESNA 5D7IF 4YWGH 4KKQA 3HUJA 3JUZA 3QHFL 2FLMA 3V5KB 4B53A 4N25A 1AMYA 1WD9A 1BGXH 1WZ1L 4WI5A 5DGQA 4ODUA 1C8QA 5D6DA 2E7DA 3UTZB 4O2FA 1PYWA 1JGVL 2B3IA 3TEYA 2XV3A 3VVVA 2JIXA 2G0KA 2BVTA 3GMPA 2XWJA 5MEOB 4MD0A 1QFHA 4OKVB 3CD4A 3W2DH 2D3LA 1SFDA 4YO0A 4L37B 5FV1L 3CXHJ 4N2AA 1S5HB 4Y4FA 3QZMA 4M1DL 3RPKA 4AL8C 1W8EA 3IPEA 4AJ0A 4RAHA 2ERJB 2NSMA 3FKUS 3JT0A 4A37A 3BRDA 2DBLL 2WN2A 4XN9A 1UWEL 1USQA 2BHYA 3IU4L 1U9KA 2BVQA 3DXAD 4IOIA 5GS2D 3HR6A 4Z7WA 5IK3B 5F6HJ 1NL0L 5LNDA 3LKNB 1WTLA 4BH7B 3DOSA 2ZYRA 2ZOUA 5G2NA 2X6BA 2B59B 1BMGA 5T3XH 4GSRA 2BIIA 3QHZL 1JYVA 3R0NA 3L95A 1RHFA 2EDNA 5MEPA 4JE0A 3IJYA 1ASQA 3VFNA 3HLKA 2YD3A 4P4RB 4ZDHA 4Y5VC 1L5GA 3O4OC 4MKTA 2BNRE 2ATKB 5IM7A 1ADQH 2F7QA 4IW4C 4MKMA 4ZPTA 4L29A 2XUWA 2X3CA 2DD8L 4APQD 3BT2L 4BV1A 1A6AB 1AGEA 2VW6A 5D5MF 1N2RB 5LQBL 3MCLL 3GKZA 4PJCA 2C7UB 4N2KA 4FHJA 3PAYA 1B0IA 4P07A 3ARVA 5C09D 2WD0A 4PW4A 1L0XA 4Z7NF 4YL9A 3KBHE 2DAVA 4WUUA 4GXFA 4Y7OC 5DSCA 4WWKD 2JTYA 4LCUA 3WFCH 1AI1H 4P4KD 3AFLA 2IOMA 2D7OA 1YO4A 4NJ9H 3COOA 4Q89A 1C16B 5DURB 5IVNA 4NN5B 2J8OA 4LLUB 4YE4H 3WNLA 3ZTJH 1B3JA 4A7SA 1G43A 5ILTH 2CO7A 3AGWA 2VJXA 1VJSA 4I48A 1KY7A 1DJWA 2HP4A 1RHHB 5DU7A 1NMCC 3GXFA 2AZAA 4ODWA 4PWJA 5AL0A 1FZMB 3QAQA 4QTIL 5HGAA 1YEWA 4C4UA 3RZCA 3RWFA 3VUAA 1F2QA 3F6IA 4WV1A 4L18A 4TQEL 2OW7A 2WP3T 4HC1A 1U93A 3HI5L 1JWSA 2VW7A 3LMJL 2VQTA 2X41A 2IC2A 2P46B 4U1LB 5C7XH 3H3KA 4GRWB 3I6LE 1VF5C 3VFWA 4OCNC 4PGZA 1OP3K 1N68A 1QTPA 1HSAA 4G72B 5GRVK 4L9LC 5TE7L 4Y4FD 1WBYB 4DW2H 4RFOH 5I6XC 1R47A 1JN6A 3ILPB 4JFPA 3MV8A 3ROOA 3TBSB 1RZFL 5C08E 1GS6X 1ZT7A 3QZBA 1NSNH 4ZAKD 5FYJD 3L9EA 5BO1L 1F4XL 1MKFA 1AMXA 2CBOA 5DMJB 1BZ9B 3ZKMD 5I1JL 1H6EA 4PS4L 4NT6B 2AQRA 4M7JH 4PEEA 4P99A 3M1BA 5BRPA 4HT1H 3FT4A 4H0HB 1OGPA 4G9FB 5TPWL 4BCYA 1MWAB 3RVXD 5AG8A 1PNDA 2H41A 4BSVB 4IRSB 4FL4C 3MLPA 1VFAA 4B3EA 5FO8A 4NJAL 5CUSL 5KAQG 1AE6H 1P4LB 4QR7A 2HT2D 3KBEA 4MZIA 4R4BA 3FUDA 5IV2A 3SCMA 1PFCA 4LLDA 1M57B 1PLGH 1UXWB 2FB4L 2ADJB 3EJYD 3PV6B 3RY4A 5JW4N 1O6VA 4OFVA 5FYLH 3BC9A 4DERA 2ZYSA 3N40P 4B41A 1MCRA 1SOXA 5AAMA 4MZRA 2O30A 3VRIB 1LE5B 1ASPA 3PXLA 4N68A 5B1AB 1KG0B 3DMMC 3CFQA 1S9XB 15C8L 4MBRA 1ZGLB 3MACL 4FNRA 1KPUB 5DR5L 1G9NC 1C12B 1RMFH 1O6SA 1RIVL 1GTNA 1CBVH 2EP6A 2OSXA 5DUBA 5EOCJ 2BP3A 4YHMH 4PP2A 5GGVY 1JFQH 2ZSVB 3GLEA 3HG1B 5I71B 3PPEA 4Z7WE 3ZTDC 2GK0B 2AAAA 5JHLL 1I3UA 3QRLA 3QXDA 3LB6C 1CGTA 2A4EA 4K3EH 3TEWA 4JGMA 2LU3A 1PZCA 5B1CA 4ABVA 4XCYA 3VI4A 4GQQA 3MLRH 4L29B 5HD8D 3EGXA 3VXMD 2EXYC 5E2VL 4UQ9A 1P1ZA 1YHPA 3K2KA 3MROA 5B21A 4D0CB 2OBGA 4BDVA 2ZXGA 2HH0L 5EF1A 2J2ZA 5J11B 4AQ8C 5IB1B 2MNJB 2DI8A 4PJEA 4U6VH 1F1GA 1CGYA 5D4IA 1JZHA 3TJHD 5JOFA 4PJCE 3RY5A 2AI0L 1WE5A 4FKKA 5B8CC 3QFDB 5ES4B 1LO2L 4EZMA 4X4KA 2GKIA 5LN4A 5I24A 4PRPB 1BLNB 3NP3A 4UT6A 3HS8A 3S3BB 4Y2DA 3D9AH 5GS2H 3CK0H 3I84A 5SWZD 1HXMB 2VRAA 5E24E 4LL1A 1CDGA 5HHOB 2Y7SA 1KFGA 5EUOB 3ZL4L 4YDKH 1JZ8A 3DURB 1GPOH 1R5IA 1VADA 3DHUA 2AV7B 2EC8A 2OMXA 3GI8H 1A4KB 2N7AA 4JFFB 4FQLL 4KK5D 2YAMA 3PF2A 2DQTL 1XEDA 1FNAA 1ODUA 2XN9D 3JWDL 3O2WH 4JY6A 5KVDL 5I1EH 3QXAB 4FLSA 4A68A 4YGVB 1ZVSB 3IDMB 1HILB 4RDQF 1HOCA 2FZ3A 1SDDA 2R1WB 2VITB 1KEMH 1SUJA 2WOYA 2NXYC 1XB3A 3KPNA 2F53A 2JB5L 2YS4A 4LGPB 5F88A 5GGTL 2ATAA 1LK3H 3JWNH 4XC3L 5D1ZD 2FHCA 3L81A 3CXFA 5BZDA 3T0EA 3UABA 3VU1A 3QUZD 1HHGB 2AJUH 1IGYA 5J06A 4ONHB 3PFQA 1BJMA 1IX2A 1JDCA 5I1AB 1X5LA 3D05A 3OSVA 1I8KB 1HSBA 4ISVB 4PWHA 5F9AC 1F97A 3W0WB 4LAQL 4ZFOL 1ZE3C 5KVGE 1XGYH 1EHKB 1ZHBA 4P57B 4N1EA 2YEZB 4K3HA 5HVHB 2AV7A 2IJ0C 2BCMA 2YSSA 2FX7L 1RJZB 2AJZA 2H1PL 3RBSA 3IGAB 2XCMC 4PP1C 1TKWA 5GGTH 4YXHL 3ARBC 3FHEA 4KXBA 3F7PC 1ZIAA 2VXQA 3VG0H 4GB9A 1AP2B 1QQDA 1N4XH 3G08A 1CFBA 1X5XA 3MRKB 4XE5B 1E40A 3JV6A 5DUJA 5CMAB 3PP3K 3ZGHA 5BUPA 1C9SA 3BQUA 3K1KC 3HFML 4FF9A 1G7LB 2NNFA 4JFOB 1H6TA 4K5NA 2DDQL 4ZSOA 3QYMA 1LWJA 4JFXB 1T22B 2UYLA 4EVNB 3O6ML 3MV8E 3QDGD 4OQTA 2NZ1A 1ZANL 2ZONA 3EH2A 1R46A 1MI5A 4I48B 3HAEG 2X4QA 4FYSA 4J5VA 2Y1AA 4IGBD 2QEJA 4YC2B 1QG3A 4L2YA 5CCKH 4ODSH 4I9WE 5CP3A 5HHQA 2BHZA 4TS6A 1L9QA 1ZLUK 1UH4A 2Z4QA 3FPXA 2G3NA 1UZ8B 4WWPA 5D1QB 4AQ1C 5DQDL 5DLLA 1UQSB 2HVKB 2GJ6A 2RIKA 4NRYA 2VWEC 3CVIL 7CGTA 3P3RA 3SGDH 3V5DA 3VVWA 5HYFA 3RWJB 2WB7A 4ZOEA 5AAPA 1CLZH 1I85A 1CLZL 4DSYA 4R96B 3L5XL 5JYLA 5JYMA 3QISA 3BCFA