2ZPBB

Nitrosylated fe-type nitrile hydratase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpbB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpbB02
2ZPEB 2CZ7B 2PVDB 1UGPB 1IREB 4ZGDB 2AHJB 3X26B 3A8HB 3LW5E 4OB2B 4XK8E 3A8OB 3QZ9B 2ZPGB 2CZ1B 3WVEB 1V29B 2ZZDB 2PUKB 1DJ7B 2PVGB 3X20B 2WSEE 2PVOB 2ZPFB 3QYGB 3VYGB 2ZCFB 1UGRB 2DPPB 3X28B 3A8MB 5L8RE 1PSEA 2ZPIB 2DXBA 2DXCA 2CYZB 2WSFE 3A8GB 4OB1B 2D0QB 2DXCB 2DD4A 2DD5A 1GXIE 4KT0E 2WSCE 1QP3A 3X24B 1AHJB 2PU9B 1PSFA 2QDYB 1UGSB 2CZ6B 2DXBB 2O01E 4L6V5 3WVDB 4ZGJB 2PUOB 2ZPHB 3VYHB 3HHTB 1UGQB 3QYHB 3A8LB 4OB3B 3QZ5B 2ZZDA 4FM4B 4ZGEB 1QP2A 4Y28E 2CZ0B 4OB0B 4RKUE 3QXEB 2DD5B 2DD4B 3X25B 2ZPBB 1JB0E 3VYGA
chains in the Genus database with same CATH superfamily
1RAFB 1UNGD 3EG1A 3OSVA 5HNBB 4Z89A 3GOXA 2DTIA 4LOCA 1JJ2S 4HNTA 3OS1A 1VIEA 2DIGA 3X26B 4FU6A 1S72T 5GAN8 4C92B 4RTTA 5HKCA 2X4JA 1ZA1B 3S6WA 2CKKA 3HZJA 4JJBA 4Y72B 1E9HB 3CC2Q 1M90C 3CCJQ 2CZ1B 1X6GA 1YWOA 2HBWA 1OI9B 3HKSA 5KCHA 4O6JA 2WSEE 4N0AA 2EIFA 1ZBXA 2SEMA 4BI4A 3QYGB 2M16A 1BU2A 1N6AA 3DDQB 4OMFB 3LH5A 3CPFA 3G4SQ 1Q82U 2RHZA 4M7AB 3THKA 1G83A 4HNVA 2QEXQ 1IRXA 4JRPA 2EYWA 3H9NA 1T0JA 3CC7Q 1OPKA 4EMGA 1VQ5A 1JEGA 2DXCB 2RQVA 2DD5A 3ZEHA 1KC8R 3QPHA 4CFWB 1Q7YR 1R8OB 1M1GA 4J8OA 2MIOA 4CC7A 1OI1A 3MEUA 4BCNB 1UJYA 3JCMf 4UC4A 1NYGA 3MJXA 4WCIA 4AKHA 2NUPB 2B8AA 2PUOB 4F6WB 4N4HA 3PE0A 3JB9F 3MP6A 4C5IA 2VWFA 1VQ9Q 3CCQT 1HXDA 4BCND 2V8KA 3CD6T 1QCFA 2Y90A 4HT9A 1PD0A 2M0OA 3SD4A 4EMKC 3NDQA 4KGZB 3V8LA 2YDLA 5DLOA 1H8KA 3OMCA 2HSPA 1YI2T 1MUZA 5GAN5 3EGDA 3PIOA 3OMGA 1NJIR 4TTHA 1H3ZA 5LJ3h 2OAUA 2LC4A 3PVLA 8ATCB 1AZGB 1VQLQ 4PJOC 4C0ZA 3CBPA 4JRKA 1VQOT 1JSUB 4C8QD 3EGXA 5D6YA 2CZ7B 1PRLC 4ZN1A 4BI3A 3CCLA 4RCCA 2FHDA 2X9HA 1H4LD 3BLHB 1ZQ1A 4MIMA 2AHJB 1QVFS 4FSSA 1SSFA 3ME9A 3CC2A 5GMKl 3ULRB 1LCKA 2DMEA 1VYUA 1ZX6A 2LQWA 3CCJA 1RAHB 3JSCA 4MDWA 1WHKA 2LX9A 2QQBA 2EW3A 1FYNA 4IKFA 1GFCA 1Q7YU 1WJQA 4Z02A 2L3QA 3E2UA 1NBEB 1OU9A 2EPDA 2CSIA 2DEQA 3RKYA 2EVRA 2HAXA 1WNLA 5FRNA 3MEVA 2ZCFB 1H92A 1E6GA 5FU6C 4OGRB 3X28B 2QEXA 4BUGA 4BY1X 4MFDA 2KR6A 4X9DA 4Y91A 1U1TA 4L5GA 3CCJT 1FMWA 2G6FX 1YITQ 1TXQA 2CP3A 4A4EA 4JJNK 2DE0X 1NE8A 4KUIA 3WXMB 2VVKA 3TVTA 1RI0A 2OJ2A 2PU9B 3PNWC 5HQ0B 3UPUA 4J7FA 3DL1A 4EOQB 2DILA 2DERA 1YJWT 2O01E 4ELLA 1M30A 4N0AC 1WXTA 1JXMA 2V1RA 3CEYA 3PGGA 2BE7D 1QWFA 3OBWA 2AZVA 4FYYB 1QW1A 4CI0C 5DM7R 4RUGA 2DKGA 3E9GA 3TNWB 3M0PA 2JZ2A 1OL2B 2C5OB 2KAFA 1GUXA 4JRQA 2KSSA 3DDPB 5IAYA 1GH6B 1BI3A 4LUDA 2KR3A 3MPUB 3S3MA 2WMBB 1OIYB 4Y28E 3NMZC 4E7HA 4X9CA 1X2QA 2OI3A 4V2SA 4E7ZA 3O0GD 4HCBA 2E6ZA 2JMCA 4RG8A 2J6FA 2L3PA 3NTKA 2A08A 1GBRA 4OMNA 3QYEA 4KRCB 2E5QA 2PMIB 1Q81R 3M4GA 4M7DA 2EQIA 4E7SA 3M9QA 4IUUA 3BHUB 4M75E 2C0OA 3I55T 3JRZA 2FZGB 4FYWB 1D1CA 5LMKB 2CCIB 1Q86U 4C92C 3A1PA 2HEQA 4Z88A 9ATCB 4FW1A 2R5MA 1JSTB 1WXUA 1D0YA 2C4GB 4BCQB 3QDFA 2IIMA 1MNDA 4BY7X 1WLPB 5CIUA 4EOIB 2I53A 4C5HA 3VS3A 2AIRB 3OYCA 1UE9A 2KT1A 5FU7C 2UZDB 4BCQD 2J05A 1JJ2P 1AZEA 2UZEB 4IUPA 1H3HA 3EFOB 1JRIA 1YI2A 2D8JA 1RAIB 3MY1B 5HY6A 2KGTA 1VQ7Q 1W4SA 2EUFA 1YJNA 2KNBB 2HCKA 4M7AF 5GAMd 1I07A 2RI3A 2DBKA 1D3UB 4HL4A 2DK3A 1KQSS 3M03A 2CH4W 4XAXB 4XTXA 1KIKA 3CCST 1H27B 4F7LB 1B34B 3WVDB 1ZHIA 3GBQA 3ZBDA 3HTRA 2RJCA 3HBLA 1IHWA 4QW2A 5GANf 3OSSC 3JB9J 1NJIU 4IMYB 3EG0A 5IH2A 4M7AD 4PK4A 2J6OA 2HQHA 1YHQT 4BCHB 4IIOA 1D1BA 5KH6A 3JCMd 1XO2A 2LDMA 5CCAA 4CC4B 2RK2A 4A4KA 2E3IA 1PRMC 1JO8A 3LGFA 2KY9A 4QKUA 3HRUA 2JW4A 4M7AG 1UJ0A 5I21A 1G5VA 1PNJA 2XD0A 3FDRA 1VQ6A 1TTHB 2F1LA 3OYFA 2ZPEB 3F5XB 5CKFA 2X4WA 1X69A 2VUBA 4TVRA 4A54A 1UGPB 1QVFA 2O9VA 4OR5B 2EQKA 4ZGDB 3H0HA 2L3RA 4CC2A 1K8AU 4LDWA 3QHRB 2E41A 4A4GA 3CPWA 2RPNA 2QA4Q 5LJ5d 4BCIB 2K2VA 1MMDA 1M9SA 2EQJA 2EYYA 4C8QG 3I56A 1YFNA 3BE3A 3RBBB 1WX6A 1I1JA 3NHNA 3RERA 4A53A 1GY3B 1RAEB 2V22B 2V26A 1P92A 4BDZA 2F2CA 2LNVA 1OKWB 2IW9B 4M4ZA 1SF9A 1YJWQ 3G71Q 2LCCA 4JX4A 4JZ3A 4E47A 2RF0A 1UNLD 1GBQA 3VKGA 1YJNQ 4BCFB 2A3LA 3DLLA 4IUQA 1F5QB 1I5OB 3QSUA 2HSEB 3CCVT 2MF2A 4LDXA 2PQWA 3QO3A 3FJPA 2NUTA 4F7JB 3OS0A 1X2KA 2QQSA 2HL3A 4R0KA 2LQKA 2KBTA 1SHFA 1AHJB 2KEAA 1PSFA 3RUXA 3QKJA 1VQ5T 2EGEA 5GANe 4RMOA 2K6DA 1WIEA 3EH1A 4XU0A 1GFDA 4HCCA 1TD6A 3PIPA 3H4CA 2FPFA 4RTXA 3L2VA 4J9IA 1M1FA 2RI2A 4J9DA 1TUGB 3OS2A 2X51A 5IN1A 5GMKj 2XIDA 1UECA 2GCXA 1QKXA 2UZBB 1XOVA 2RMOA 4F6SB 1X6BA 1M8MA 1X6OA 3CCUQ 2PK9B 1ARKA 2BUDA 5LJ5e 4DA4A 4BCPB 2QQRA 1FVVB 4CRLB 2OX7A 4HLQA 3X25B 1Q86C 1VQ6Q 4M78A 2GGRA 1CSKA 5FWCA 1YCYA 4MFEA 3M4YA 1BI2A 3LX7A 4ANJA 2O4XA 2A37A 2PVDB 1VQNA 2WPAB 2CGHA 2YLBA 1OQKA 1KC8C 3H6ZA 5KE3A 2H3EB 3I56Q 2XDBA 1TSFA 5LL6S 4JLGA 4F7NB 2NYSA 2J06A 4CFNB 2KT8A 3MIAB 4DEYA 2DL3A 1LNXA 2ZPGB 2MK5A 4LUEA 2LT4A 3NTIA 3C94A 4C8QF 4EMKA 1WYXA 5GAOq 1QCOA 1MMGA 4BACA 2VB6A 2KMTA 1DJ7B 3TNHB 1V76A 5D7UA 3IQLA 3TNIB 2YRCA 1YHQQ 1UFFA 2EYZA 2XI9A 5GANd 4BD3A 1HD3A 3CCEQ 2YUOA 3G6ET 2MI6A 3EH2A 3QWXX 2DXTA 3HO8A 3CC7A 1OX8A 4J83A 3ER0A 4D8KA 3JB9D 1VQKA 1H1PB 2LQNA 3X24B 4FX3B 2CP7A 4J6WA 1GL5A 4QVZA 5A2QE 4N4GA 1X27A 2EQUA 4RTWA 4KGXB 3TREA 3KHIA 2COWA 2KRMA 4A63B 4Y92A 1QMCA 4M78G 4ATOA 5CR2A 3CXCP 4QVCA 3H0IA 3INZA 5I5ZB 2QXFA 1KQSP 4FM4B 3ZL7C 3K7AM 3M54A 2XKOC 3TSZA 2WHBB 3DKMA 4E6RA 1OYXA 3EOCB 4PJOA 3GTMS 3J7AF 3VYGA 1ABOA 3CCLQ 1G8XA 1KJWA 1PD1A 4KRDB 2ZAEA 3RESA 1K73R 2QDJA 1VINA 2YLCA 4M77E 4OMMA 2EGCA 2CT3A 2HKNA 3CPWS 3TSWA 4BE2A 3OW2A 2DM1A 3MEWA 3EAEA 1K73C 1C1AA 2CREA 1KD1C 1W2BS 3EJ1B 1VQPA 1OPLA 2EWNA 4M75F 5J26A 1BI0A 1YHQA 2LQ8A 1VQ8T 3PMTA 1TUCA 2V8JA 4J9GA 4B9XA 4DOVA 3TW6A 1MGQA 3M0QA 1VQOA 1GCQC 2RM4A 3UWNA 4MMLA 3M58A 2DPPB 2IG0A 3LWIA 1AISB 4JUVA 5M9OA 2DXCA 1YITA 3EHQA 2MCNA 2CYZB 1Y57A 2QA4T 2JJ9A 4HXJA 4M78B 2FO0A 1RUWA 2DD4A 4J6YA 1MMNA 1VQ8A 1Y7XA 2KYMA 1VQNT 4M77F 3SWNB 5GAN3 3CCRQ 3R6OA 3RDVA 1RI9A 2FL7A 3DB4A 2A0FB 3M53A 3URGA 5GAOm 1Q81U 2RHYA 2R57A 3GPLA 3JB9H 2JGZB 2AT1B 3META 2Y4YA 3NPFA 3CBMA 1FMKA 3KFVA 4RTZA 3MKDA 3G1JA 1KQSA 3OYYA 1S72A 1K9MR 2XK0A 3A98A 4M78F 5LJ5g 1BIAA 1Q82C 2DL8A 2DYIA 1KC8U 4FT4A 1VYWB 3H0FA 4OB0B 4AKIA 5LJ3j 4JLIA 1E7PA 3VS5A 1I0CA 1KHIA 3M57A 5GAN2 3E19A 2HMAA 3RKXA 3VS2A 1SG5A 2P4RA 5GJVB 1JB0E 4KH1B 1ZSZA 2CP0A 1Q82R 2AZSA 1NG2A 2KROA 3EFOA 2QQAA 3BW1A 3VS6A 1VQ9A 1KD1U 4C8QA 2JXBA 4M75C 1ZSZB 4M77G 2BS3A 2L89A 4PNOA 1N27A 1O9SA 3HRTA 5KYNA 2BIVA 4PL6A 2DJZA 5GANg 2AKLA 4QQ6A 3JCMg 2BKDN 2JM9A 3A8OB 2O88A 1ZBJA 2PHGA 3UA7A 1W98B 1VQLA 2V1QA 3GNGA 1U06A 2ZZDB 2D1XA 4ROCA 2RA2A 3EFRA 3L1AA 5L2WB 1ZSGA 3SHWA 5IXFA 4M7DC 1O9KB 1VQ7T 1EZZB 5GMKi 2M0YA 2LP5A 1M2OA 1RLQC 4HVVA 2QDLA 1VQ5Q 3PFSA 4J5YA 4E7JA 2ABLA 2FPEA 2XMFA 1XJWB 4BI8B 1PWTA 2K3XA 4CRIA 1PG5B 4DBFA 3CCQA 2UUEB 4EONB 4HKEA 2QQ9A 1VQ8Q 3PMIA 2EYXA 4YOSA 3KBGA 4N4IA 2GTOA 2O9SA 4OP0A 3JCMQ 4ZTJA 1QP3A 4BBRM 3OYIA 3BG9A 4UN0A 1N9RA 3M55A 4C92G 2W96A 5IDPB 5GMKm 1ACMB 4F04B 1LOJA 5I22A 3A5ZB 1M8VA 1VA7A 3VS1A 3G4ST 2COZA 1N8RR 2FZKB 1FWZA 3F70A 1RACB 3T9NA 2M9UA 4C0DC 2PJQA 1WPYA 4X34A 3VV0A 3RKWA 4P5NA 3SFMA 2RI5A 4PFPA 2QQ8A 5GANh 1Q86R 4J7IA 3HL8A 1BI1A 3MY5B 1I81A 5GAMf 2BE9B 1NYFA 3POMA 2FG0A 2DAQA 2QGGA 3L2RA 1D09B 2RN8A 2OTJT 6AT1B 4ELZC 2E10A 2GFAA 1NPRA 1WHLA 4X1VA 4KBMB 3RMSA 4RTUA 4C92D 3CD6Q 2MMPA 2YXYA 4C8QB 2IN3A 1WHJA 4M7DG 2QGFB 2DL4A 5I11A 1VQ4A 3OW2S 1G3SA 1PCXA 4OB2B 4IUTA 3CCMT 3G7ZA 4M77B 3UATA 2P84A 3DOGB 3TN8B 4KRTA 4LXCA 4L59A 2YUPA 5D6WA 5LQFB 2L3SA 1YN8A 4EOMB 2HNIA 3O8VA 1D1AA 2M1HA 5ACBA 4OF1A 1HYOA 3X20B 2QTXA 2M51A 1YJWA 3EGUA 2NUPA 1D0XA 1G3TA 3CMAQ 1TOVA 4GBQA 3QUIA 4ORZA 5FW9A 3MHXA 3HFOA 1UB4A 3EG9A 1UGRB 2K9GA 3BDUA 4DBQA 3A8MB 4EMHA 2I2LA 1YIJQ 2DETA 4PJNA 3EGDB 2CCHB 4YOZA 1WXBA 1Q81C 2EQMA 4C0FA 5CEIB 3A8GB 3P8DA 4OMQA 4JDSA 4BCGB 2J6KA 1GXIE 4KT0E 1SEMA 1KK7A 3OS5A 4F7UG 3OBYA 2JUFA 1N4MA 2KK4A 1NM7A 4LE9A 4MZPA 2DXBB 5A0LA 3H8ZA 2CP2A 2LW4A 3JB9G 4FSXA 1O75A 5GAMh 3CC4A 4AFZC 5EC7A 4PJJA 4EORB 1QWEA 4BCOB 1E6HA 5KYUA 3QBYA 3BDLA 3RMQA 5FU6B 2P0KA 4OMLA 1ZUYA 2V8IA 1YBYA 2C0TA 2KXCA 4AFSC 1NLPC 3FC3A 3SWNA 2E65A 2LT1A 2VGNA 3J80E 4FYVB 1M1KC 1JJ2A 2DD4B 4MZMA 2JS2A 2KRNA 1VQMQ 5KYWA 2X3WD 2VV5A 1GCPA 2MPXC 2FRWA 2HQEA 1VQNQ 4J9FA 4YC3B 4M75B 4CFUD 1IREB 5GAN7 3E1SA 1KFZA 1TU0B 1A0NB 3AHUA 1XQHA 4BDYA 1VIFA 1U8RA 1VQPT 2PK2A 1VUBA 4KUDK 1QLYA 3VJPA 4NC6A 1QVGS 1Z9QA 3HFNA 3L2UA 4M7AE 4EOLB 3P8HA 1YJ9T 1Z9ZA 2L2PA 1V29B 1IGUA 3CCRT 1PKTA 3RR6A 3LQ5B 2CP6A 2JM8A 1UNHD 2HDAA 5AT1B 2WIHB 3M5AA 3CCSA 1RABB 4R55A 2ZPFB 2KYBA 1IXDA 2RK1A 1HK9A 2R58A 2LX7A 4MDXA 1CKBA 2WEVB 2GNCA 4C0DB 3EGXB 1PSEA 2RJFA 5GAMg 2ZPIB 3FLGA 2W9FA 2W99A 5LJ3f 4DQ2A 4BE1A 3DTOA 4VUBA 1WQWA 5EG2A 5KYYB 4F14A 4OB1B 4BE0A 1NEGA 4LNPA 2RB6A 4PJOE 2MAMA 1IGQA 4PJOG 2WIPB 5GAOn 2WFYB 5EFQB 2CDTA 1FXXA 1G3NC 1D0ZA 3OYBA 4ELYC 1Y96A 4C5EA 1QVFP 2DVJA 3HP9A 2SRCA 4GY5A 1K0SA 1JXOA 3LWHA 5GAOl 2QASA 2EFIA 1ZUKA 2OAWA 3LYIA 2CUDA 2R7GA 4II5B 2QTVA 1T3SA 3D7SB 1TFBA 3CC4T 2RH2A 3CCUT 2K5FA 5LJ5f 1YP5A 2RQTA 1SRMA 3BHTB 2F5KA 3S3NA 4FCYA 2VYTA 2E4HA 3HPWA 1VQMA 3M0RA 4BXXX 1QVPA 3V7CA 5C6SA 5GAOp 2I0NA 4PJMA 1OOTA 2KXDA 2CH4A 4M6VA 1KD1R 3TCJA 4RODA 2QF7A 2KI7A 1H24B 3UF4A 3BG5A 1K0XA 3JCMX 2K2MA 3EIDB 1M5Q1 1HSQA 3L2ZA 4XK8E 1SKUB 4ZNXA 3G71A 1N9SA 4LN2A 2RHIA 1K4US 3B57A 4BCJB 4EMKB 3CMET 4BCMD 3R6NA 1K9MU 4IUVA 3P8BB 1P5EB 2IVWA 3DJBA 1RAAB 1WZOA 4C92A 2R5AA 3CMEQ 1ZUUA 4BCMB 1AD5A 1AEYA 4C5GA 4AI6A 2DFUA 2E3HA 4EOJB 5CKHA 2DXUA 5ECAA 4Z8AA 2DEUA 2VC8A 4DEXA 4ME7A 2OTJQ 1NZ9A 1MMAA 2DXBA 2O2OA 2C06A 4CFVB 2LRQA 4B6MA 4R56A 2X3XD 5LJ3d 2GF7A 5LJ3e 5GAMj 5IHKA 4OGEA 3V7RA 2CSQA 4C8QE 1N5ZA 4F7SB 3KUFA 2QGSA 3CCEA 2Z0WA 4OVAA 3QWLA 1M2VA 1OGUB 3QJYA 1TG0A 4XTYA 4O5VA 4XTZA 4HVWA 5KCOA 4EC9B 1AWXA 1YJ9Q 2ED0A 3QYHB 1D3BA 2EKOA 2LCSA 1W1FA 1XNIA 4J9BA 2BKZB 2MYSA 4F17A 1WFWA 1QMZB 2IVXA 3TW7A 3BY7A 5KYYA 2CZ0B 2EKHA 5GAN6 3L2WA 3QXEB 2D6FA 2DVEA 2L5QA 2DZCA 4M77A 4DBHA 1VQLT 2NUTB 3V7SA 1NEBA 2JTMA 2VGMA 1ZA2B 1K73U 4LD6A 2K57A 4D8DA 2ESWA 1K9MC 2WXVB 3M0TA 2B86A 3QJ6A 4WTOB 2DBMA 2DRMA 2LJ3A 2ED1A 3I5RA 1BU1A 3G6EA 3VRZA 1AT1B 1X43A 3MI9B 2DTOA 5GAOr 1G2BA 4CFMB 4PKCC 2IW8B 2KMGA 1NLOC 4ESRA 1QVGA 2CUBA 5C0MA 1EIFA 5LJ3g 1V1CA 4JX5A 1KQ2A 1BK2A 4OMOA 3OA6A 4JZ4A 3JCMP 1B07A 5LJ5j 1WHGA 2K4YA 2HBPA 5IT9E 1WI7A 1Q95G 4LDVA 3CMEA 1C6VX 4F7UB 1IHVA 3QG1A 4RTVA 3GIBA 4F7UE 5FROA 3BG3A 4F6UB 2G9XB 2O31A 3CCQQ 4AMCA 2B9RA 1Y96B 1KQ1A 1QVGP 1QKWA 4CXAB 4M7AC 2K7AA 2K5IA 1WHHA 3CCMQ 1F1BB 1K8AR 3OYNA 2XDDA 3CCVA 2XG8D 3BLQB 4D6WA 1EFNA 2JT4A 5HVYB 3JV3A 1AOJA 5CKBA 1ZLMA 1VQMT 2CZ6B 1AWWA 2DL5A 5IHNA 3OYLA 2PZ1A 1Y0MA 2HL5C 2PTKA 3NFCA 5HK0A 3LH0A 2F69A 1H26B 2ZPHB 1YJ9A 4PJOD 2XICA 3C95A 3G71T 1M2VB 1LVKA 1AD6A 3VYHB 4AFQC 1YWPA 3VKIA 4FW2A 1GRIA 2W0ZA 4PLLA 3DB3A 3SB2A 3ASKA 4EPCA 3QZ5B 1UTIA 2A36A 5FRMA 1PHTA 1UHFA 2ECZA 2VXEA 1OKVB 2E1HA 1I4K1 5J3BA 1YJNT 2JTEA 4M75D 1K9AA 2MWPA 3EG9B 3G6EQ 3CD6A 4PFOA 4E2FB 4WF2A 1S72Q 3HB9A 3MP1A 4XU1A 2RQUA 4F7UF 5KYWB 2J7IA 1WDXA 2F2WA 3U23A 2DRKA 4JJDA 3OYMA 1ABQA 3PO3S 2W9ZA 1MHNA 3VUBA 1OL1B 2A28A 2C5XB 3I9QA 4A4FA 4ZN3A 4KGVB 1URCB 5GAMe 4XTWA 4E7IA 3OYKA 3C0CA 4JX6A 2VASA 1SHGA 2H8HA 3FIFA 3OYHA 4NL2A 1YIJA 3JCMh 5IHIA 4B9WA 2RHXA 4HA8A 1R0BG 1T3LA 3SDZA 5HBJB 1FMVA 4BBSM 2HKQB 1VQ6T 3CCMA 2JS0A 2GQVA 1TH7A 1W6XA 2E5KA 3H41A 3VRYA 3I55Q 3G33B 5DLQE 3JCMe 4M7DF 2EJGA 1OX9A 3REAB 2OTLT 1VQKT 2DA9A 3VS0A 5HBHB 4XU2A 3BLRB 5IDNB 2CS7A 5CO7A 1UGVA 4MZTA 1B34A 1KG1A 1B3QA 2DJQA 3FJ5A 4Z6YA 3VKHA 3EFSA 1OZ2A 5BNJB 2D8HA 2KVQG 2P0PA 4PFZA 2KE9A 1M90U 1TWBA 3REBB 2NUZA 3GP8A 1QP2A 4JRIA 1RAGB 3V8JA 3NGPA 2OTLA 2ROLA 5HCKA 3RIRA 3QDRB 2BS4A 2E64A 2L0AA 2YHTA 2CP5A 1EX4A 1ZSZC 3GF5A 3M0UA 3OB9A 2DNUA 2EJFA 3FRNA 2XHCA 2BZ8A 3NTHA 4BB7A 1KXUA 2NWMA 4JJCA 3CCET 5LJ5h 2C5VB 5D6XA 1U1SA 2X4XA 3C4SA 3LW5E 1BKBA 2XU8A 4HNUA 4HVUA 3OYJA 5A0GA 1UDLA 3S3OA 3OY9A 1JBMA 3QHSA 4LDUA 4OMPA 1T0HA 2LVMA 2EAYA 2DZ9A 4M7DB 3FB9A 4I3ZB 1KSWA 2WACA 3CXCS 2Y4XA 4XTVA 2L8DA 1G3WA 2LZ6B 2IW6B 2K79A 5FGKB 1NPPA 3LLRA 4XU3A 3G4SA 4IIMA 3I55A 2WSFE 4LDYA 4FYXB 4CFXB 4JS4A 3QWYA 4NSTB 3SEMA 2DTHA 3JCMW 5I2SA 1VYTA 4CFUB 2C6TB 4OGCA 2G3RA 1GCQA 5KYUB 1VQ7A 5CQYA 4QSHA 1VYVA 2BTTA 2MOXA 5DQWA 1BIBA 4A4HA 2LMJA 3HHTB 1O9KA 1UEBA 2VXFA 5KYXA 2W2HA 1UHCA 2F2XA 4OB3B 1M3AA 4M75G 2FEIA 2JVVA 4G6LB 2ZZDA 2OTLQ 2BPMB 1UUEA 2D0NA 4II1A 2DD5B 1CKAA 1M1KR 4FT2A 3BFMA 1VQ4Q 4NL3A 3KXTA 1E7OA 4PLIA 2RQWA 4GLMA 2AKKA 2RJDA 2XDPA 1BB9A 3OYAA 4M7AA 2FVUA 4PJOB 1M27C 2YT6A 2AK5A 3PVQA 1OULA 2RO0A 2X35A 1ENWA 3VS4A 3HRSA 5GMKe 3M56A 2DO3A 1VOMA 3CMAA 5FLXE 4EOSB 2W10A 4RG2A 3SWNC 5ICPB 3QZ9B 4XTUA 2JTFA 1LJOA 2K3BA 1AVZC 2JMAA 5CKDA 1M90R 1OEBA 2YRVA 3EG2A 4M7DE 2X1NB 1YCSB 2EBPA 2VKNA 4DOWA 3VU3C 4AG2C 1R77A 2YUNA 2FZCB 3O5ZA 3VYGB 3FEOA 4J9HA 4QVDA 4Q5WA 1B7TA 3CC2T 5CAIA 2KDSA 3JB9I 1H1QB 1OZ3A 4C0GA 1PKSA 4HCZA 4C8QC 3JCMb 2DX1A 1BCOA 4AFUC 1PKDB 5IHYA 1XTDA 1M3CA 4EDUA 3CC4Q 4M77C 1C0MA 3CPWP 1MV0B 2HZYA 2E12A 1BYMA 4J9CA 2COYA 1JU5C 3QYBA 4ELJA 2DLPA 2MWOA 1OIUB 5CKEA 4YTLA 5I2MA 4AG1C 1HJDA 2QEXT 3L42A 4QT7A 3JCMc 3OYEA 1BBZA 1H641 2DIQA 2PNIA 1FINB 4EIKA 1YITT 3A8LB 3UA6A 1H1RB 1QQJA 1K1ZA 4AKGA 1M3BA 3VS7A 3BHVB 4ZGEB 2GTJA 4RKUE 2DYBA 2GBQA 2KQWA 2IPOB 2E70A 4BCKB 3PT9A 3M0SA 1K76A 5CK9A 2DL7A 1WHMA 2EYQA 2JN0A 4ROEA 1NJIC 5EJCA 4IURA 4E7LA 1MNEA 1SPKA 1C9BA 4KH0B 2LNHB 5L23A 5GJWB 1PC0A 2A7YA 4XQ3A 4EOKB 5HK3A 2JNGA 2K5LA 2RD1A 1UG1A 2I40B 3GLXA 1IB8A 2ROTA 5AYFA 4BY6C 3CCSQ 1X75C 1MV3A 1PM3A 4KULA 4MMKA 3N5BB 3V8KA 2NLUA 4C92F 2HD0A 2UZLB 1TUDA 2ENMA 2H3JA 1W2BP 3TEEA 5DY9A 2EGAA 2PUKB 2PVGB 3JCMV 3EG3A 5FU7B 2PVOB 1OV3A 2CT4A 4EOOB 2EJ9A 2QYZA 4NS5A 4J9EA 2FRYA 3C12A 2C0IA 1JKWA 1YI2Q 1OU8A 2RHUA 1W2BA 5HBEB 2YWWA 3GNFB 5J39A 1YIJT 3MP8A 1FX7A 4ZTFA 2RQRA 3CXCA 2D9TA 7AT1B 3Q1JA 2QI2A 3M59A 3CCVQ 3UT1A 1LPLA 2CJMB 3J81E 2FPDA 2FYKA 2QDYB 1UGSB 5CVIA 3AT1B 4M7DD 3L2QA 2BZXA 1SRLA 4E7KA 4L6V5 1R0CB 1AWJA 1RADB 2G77A 2BZYA 2DMOA 1W70A 4J6XA 4ZGJB 4K11A 3JAME 2OTJA 1K8AC 4HT8A 3I5SA 4F16A 3CQTA 2LTOA 4EOPB 4M78E 3CC7T 2BS2A 2LJ0A 2JOYA 4FIBA 2QK0A 1RLPC 3HSBA 5GMKh 3CMAT 3JCMJ 5GANj 2QFZA 1N8RC 2F2VA 1TS9A 3LGLA 2P0QA 1I8FA 1QCNA 3OYGA 2C5NB 2F5TX 2GQIA 3TU4K 1QLBA 1M4ZA 4DBRA 2GFUA 5IF1B 2ATCB 1S1NA 3VUZA 5KE2A 3DLMA 1YNZA 3A8HB 5CYIB 3MO8A 5CQXA 2LJ1A 4PJLA 4NOYA 4F7UA 4YOOA 2RJEA 4QQDA 2QA4A 1WJSA 4AT1B 5KYXB 4FL6A 2RNAA 3WVEB 3E9FA 1H1SB 1AWOA 4RCBA 1VQKQ 1GUXB 3QIIA 3UDCA 1KHCA 2HQXA 3OQ5A 2X4YA 4F70B 2ZGWA 1JQQA 5GAN4 1VQPQ 2WJ9A 5L8RE 2O4XB 2P4TA 3RNJA 1WQ7A 4M78D 1VQ4T 1U5SA 1IO6A 1X01A 1Q7YC 4LD9K 2YRDA 1VOLA 4PJOF 1M1KU 5FWBA 3PTAA 1VQOQ 3CBOA 1G3YA 1Y71A 2D0QB 2KRSA 2DF6A 4EC8B 4M78C 2WSCE 3OW2P 2QAZA 4CC3A 2M02A 3RGFB 3I35A 3QHWB 3EHRA 1WJRA 2K3YA 3I56T 1I5LA 1N8RU 4M77D 1IZ6A 1D3BB 1BCMA 1JOWA 1J3TA 1VQ9T 3MEAA 4BY6B 4JS5A 2E6NA 1UGQB 1H28B 5A0DA 3OYDA 1FKMA 5IXBA 1WA7A 2YUQA 3ZFJA 3CCRA 4RTYA 2YSQA 1SSHA 8AT1B 2LCLA 4GLKA 3CCUA 2FB7A 1U3OA 4C92E 1WGSA 4M75A 4JPBW 1H25B 1Y07A 2ZPBB 3MCAB 2QG9B 3CCLT 2WMAB 1ZP2A 5DQVA 1RL2A 4HCKA 4QQGA 3TQ7P
chains in the Genus database with same CATH topology
3FRNA 2XHCA 3OSVA 2PVDB 3GOXA 1VQNA 3NTHA 2DTIA 4BB7A 4M75B 2CGHA 2YLBA 4LOCA 1JJ2S 5LJ5h 4HNTA 1KC8C 3H6ZA 1IREB 5D6XA 1VIEA 5GAN7 3OS1A 1U1SA 2DIGA 5KE3A 3X26B 4FU6A 1S72T 2X4XA 3E1SA 3C4SA 3LW5E 5GAN8 2XDBA 4C92B 3AHUA 1BKBA 1XQHA 4HNUA 2XU8A 4JLGA 5LL6S 5HKCA 1VIFA 2X4JA 4BDYA 3OYJA 1U8RA 1VQPT 1VUBA 3S6WA 4KUDK 2CKKA 3HZJA 5A0GA 3VJPA 4NC6A 1QVGS 3HFNA 3L2UA 1M90C 4M7AE 3S3OA 1LNXA 2ZPGB 3P8HA 3OY9A 2LT4A 3NTIA 2CZ1B 1JBMA 1YJ9T 3C94A 3QHSA 1V29B 4LDUA 4C8QF 4EMKA 5GAOq 3CCRT 2LVMA 3HKSA 2EAYA 4BACA 2DZ9A 4O6JA 5KCHA 4M7DB 2KMTA 1DJ7B 3FB9A 3M5AA 2WSEE 4N0AA 3CCSA 4R55A 2ZPFB 2EIFA 1ZBXA 2WACA 4BI4A 3CXCS 3QYGB 2XI9A 2RK1A 3OB9A 2M16A 1HK9A 5GANd 4BD3A 1N6AA 2R58A 2Y4XA 4MDXA 4XTVA 2L8DA 1G3WA 4OMFB 3G6ET 1NPPA 2MI6A 3CPFA 3LLRA 4C0DB 4XU3A 1PSEA 3G4SA 1Q82U 2RHZA 2DXTA 4M7AB 3I55A 2RJFA 5GAMg 2ZPIB 3HO8A 3FLGA 3CC7A 5LJ3f 4HNVA 2WSFE 4DQ2A 4LDYA 4JRPA 4BE1A 4VUBA 1WQWA 5EG2A 4JS4A 4J83A 4EMGA 4OB1B 2DTHA 3ER0A 4BE0A 3JCMW 1VQ5A 2DXCB 2RB6A 4PJOE 3ZEHA 2DD5A 2MAMA 3QPHA 4PJOG 5I2SA 5GAOn 3JB9D 1VQKA 4OGCA 1R8OB 1M1GA 3X24B 1FXXA 4J8OA 2G3RA 4J6WA 1VQ7A 1OI1A 3MEUA 3OYBA 4ELYC 3JCMf 1Y96A 4UC4A 4QVZA 5CQYA 4C5EA 5A2QE 4N4GA 4QSHA 2EQUA 4AKHA 2B8AA 3HP9A 3TREA 4GY5A 2PUOB 3LWHA 3KHIA 4N4HA 5GAOl 1BIBA 2EFIA 4A4HA 3JB9F 3MP6A 3LYIA 4C5IA 3CCQT 3HHTB 1HXDA 2V8KA 3CD6T 4M78G 4ATOA 1UEBA 2Y90A 4HT9A 2VXFA 3CC4T 5CR2A 4QVCA 2M0OA 3SD4A 4OB3B 4EMKC 3V8LA 2RH2A 4M75G 3CCUT 2JVVA 3INZA 2ZZDA 5DLOA 2K5FA 5LJ5f 2QXFA 3OMCA 4FM4B 2F5KA 3S3NA 1YI2T 3M54A 2XKOC 2VYTA 3HPWA 5GAN5 4II1A 1VQMA 3PIOA 3OMGA 2DD5B 3DKMA 4FT2A 1H3ZA 1OYXA 5LJ3h 1QVPA 3BFMA 2OAUA 2LC4A 3V7CA 5C6SA 4PJOA 5GAOp 4NL3A 3KXTA 4PLIA 2RJDA 4PJOC 4C0ZA 3CBPA 2XDPA 3OYAA 4JRKA 1VQOT 3VYGA 3J7AF 4C8QD 4M7AA 2FVUA 4PJOB 4M6VA 5D6YA 2CZ7B 4ZN1A 4BI3A 3TCJA 3CCLA 3RESA 2QDJA 4RCCA 2QF7A 2FHDA 2RO0A 2X35A 2YLCA 1ZQ1A 3BG5A 2AHJB 4MIMA 3JCMX 1QVFS 4M77E 1SSFA 3HRSA 3ME9A 3CPWS 1M5Q1 5GMKe 5GMKl 3M56A 4BE2A 3CC2A 2DO3A 3L2ZA 4XK8E 3OW2A 3CCJA 3CMAA 5FLXE 3G71A 3JSCA 4MDWA 1N9SA 2RHIA 2LX9A 3MEWA 3EAEA 2QQBA 4RG2A 1K73C 3SWNC 4EMKB 3CMET 3QZ9B 4XTUA 2JTFA 1LJOA 1W2BS 1VQPA 1KD1C 2EWNA 1K9MU 4IKFA 4M75F 5J26A 1BI0A 5CKDA 1Q7YU 1WJQA 1YHQA 4IUVA 2LQ8A 4Z02A 3P8BB 2YRVA 1VQ8T 3PMTA 4M7DE 2V8JA 2IVWA 4B9XA 2DEQA 3RKYA 4DOVA 4DOWA 3VU3C 3TW6A 1MGQA 4C92A 1VQOA 2HAXA 1WNLA 2R5AA 2RM4A 5FRNA 3VYGB 3MEVA 3FEOA 3UWNA 4C5GA 4AI6A 2ZCFB 4MMLA 5CKHA 2DXUA 5FU6C 3M58A 2DPPB 3X28B 2IG0A 4QVDA 3LWIA 2QEXA 4BUGA 4Q5WA 2VC8A 4MFDA 2KR6A 3CC2T 4X9DA 4ME7A 5CAIA 1NZ9A 2KDSA 4Y91A 3JB9I 1U1TA 4JUVA 4L5GA 5M9OA 1OZ3A 4C0GA 2DXBA 2DXCA 3CCJT 1YITA 2C06A 2CYZB 4HCZA 2QA4T 2LRQA 4C8QC 3JCMb 4R56A 4M78B 5LJ3d 1XTDA 2GF7A 4A4EA 5LJ3e 2DD4A 1NE8A 4J6YA 4KUIA 3WXMB 4EDUA 5GAMj 4JJNK 1RI0A 4OGEA 3V7RA 4M77C 1Y7XA 1VQ8A 4C8QE 2PU9B 3PNWC 3UPUA 4J7FA 2E12A 1VQNT 4M77F 3DL1A 1BYMA 3KUFA 3SWNB 1YJWT 3CCEA 2O01E 3QYBA 4OVAA 4N0AC 3QWLA 4ELJA 3R6OA 5GAN3 2MWOA 3QJYA 2FL7A 3CEYA 3DB4A 3PGGA 5I2MA 5CKEA 4YTLA 4XTYA 3M53A 2QEXT 3L42A 3OBWA 4O5VA 4XTZA 3JCMc 3URGA 5GAOm 1Q81U 1QW1A 2RHYA 4CI0C 2R57A 5KCOA 3OYEA 2DIQA 1H641 5DM7R 3GPLA 3JB9H 2DKGA 2Y4YA 3E9GA 3META 3CBMA 2JZ2A 3QYHB 2KAFA 1YITT 1D3BA 2EKOA 4JRQA 3A8LB 2KSSA 3OYYA 1KQSA 5IAYA 1S72A 4AKGA 1XNIA 2XK0A 4M78F 1BI3A 5LJ5g 1BIAA 1Q82C 3S3MA 4ZGEB 3TW7A 3BY7A 1KC8U 4FT4A 2CZ0B 4Y28E 4OB0B 4AKIA 4X9CA 5GAN6 4RKUE 5LJ3j 3QXEB 3L2WA 2KQWA 4JLIA 2D6FA 1E7PA 2DVEA 2L5QA 2E70A 3PT9A 1KHIA 2DZCA 3M57A 4M77A 3E19A 5CK9A 5GAN2 3RKXA 1VQLT 2EYQA 2JN0A 3V7SA 1JB0E 1NJIC 4V2SA 2JTMA 2VGMA 5EJCA 1K73U 4LD6A 2K57A 4IURA 2QQAA 3BW1A 1VQ9A 4HCBA 1KD1U 4C8QA 1K9MC 2E6ZA 4RG8A 4E7LA 3QJ6A 4M75C 4M77G 2BS3A 2L89A 4PNOA 3NTKA 2A7YA 3QYEA 2E5QA 4XQ3A 3G6EA 1N27A 5HK3A 3M4GA 1O9SA 2JNGA 3HRTA 2K5LA 4M7DA 3M9QA 4IUUA 2RD1A 4M75E 2DTOA 2BIVA 4PL6A 5GAOr 3I55T 2DJZA 5GANg 3JRZA 4PKCC 3GLXA 5AYFA 4BY6C 4QQ6A 1X75C 2KMGA 3JCMg 1Q86U 1QVGA 3CCET 4KULA 4C92C 2BKDN 3A8OB 3N5BB 1EIFA 4MMKA 3V8KA 2NLUA 5C0MA 5LJ3g 2R5MA 4JX5A 4C92F 1KQ2A 2HD0A 3OA6A 1VQLA 3JCMP 3GNGA 5LJ5j 2H3JA 2ZZDB 2K4YA 2HBPA 3TEEA 4LDVA 5DY9A 5CIUA 3CMEA 2PUKB 2RA2A 5IT9E 3EFRA 2PVGB 3L1AA 3JCMV 4F7UB 5FU7B 4C5HA 2PVOB 3QG1A 4M7DC 1VQ7T 5GMKi 3OYCA 3GIBA 4F7UE 5FU7C 2EJ9A 4NS5A 3PFSA 4J5YA 5FROA 4IUPA 4E7JA 3BG3A 1JRIA 1YI2A 3C12A 4BI8B 2K3XA 5HY6A 4CRIA 2RHUA 1W2BA 1Y96B 3GNFB 5J39A 1KQ1A 3CCQA 1W4SA 1YJNA 1YIJT 3MP8A 4M7AC 1FX7A 4HKEA 4ZTFA 3CXCA 2D9TA 2QQ9A 2K5IA 4M7AF 5GAMd 3Q1JA 2QI2A 3M59A 3PMIA 3UT1A 3OYNA 2XDDA 2RI3A 3KBGA 3CCVA 2XG8D 4N4IA 4D6WA 3JCMQ 4HL4A 2DK3A 4OP0A 1QP3A 4BBRM 3J81E 5CKBA 3OYIA 3BG9A 2FYKA 4ZTJA 1VQMT 1KQSS 2QDYB 1UGSB 5CVIA 2CZ6B 1N9RA 3M55A 4M7DD 4XAXB 3OYLA 3L2QA 4XTXA 4E7KA 3CCST 4C92G 1B34B 1ZHIA 3WVDB 4L6V5 5GMKm 3ZBDA 3NFCA 5HK0A 2G77A 1LOJA 2RJCA 3HBLA 3A5ZB 4J6XA 4ZGJB 2OTJA 3LH0A 2F69A 3JAME 2ZPHB 1YJ9A 4PJOD 1M8VA 2XICA 3C95A 3G71T 1K8AC 4QW2A 5GANf 3G4ST 3OSSC 4HT8A 3JB9J 1NJIU 3VYHB 2LTOA 3VKIA 4M7AD 1FWZA 4M78E 3F70A 4PLLA 3CC7T 2BS2A 3T9NA 1YHQT 3DB3A 2JOYA 2M9UA 3ASKA 4FIBA 3SB2A 4C0DC 4EPCA 3QZ5B 5KH6A 3JCMd 1WPYA 2LDMA 4X34A 3VV0A 5CCAA 3RKWA 4P5NA 2RK2A 5GMKh 3CMAT 3JCMJ 5GANj 5FRMA 3SFMA 4A4KA 2RI5A 2QFZA 2QQ8A 2VXEA 3LGFA 5GANh 1N8RC 2KY9A 3LGLA 2E1HA 2P0QA 4J7IA 1I4K1 3HL8A 1BI1A 5J3BA 1I8FA 1YJNT 3HRUA 4M75D 4M7AG 3OYGA 1I81A 5GAMf 2F5TX 5I21A 3TU4K 1G5VA 2MWPA 3L2RA 2DAQA 2XD0A 1QLBA 1M4ZA 2GFUA 3FDRA 1VQ6A 2OTJT 4ELZC 2GFAA 2E10A 3OYFA 2ZPEB 1NPRA 5CKFA 2X4WA 4KBMB 3RMSA 3CD6A 2VUBA 4TVRA 4WF2A 4A54A 3HSBA 3HB9A 1UGPB 4C92D 1QVFA 2MMPA 3MP1A 4XU1A 3VUZA 4C8QB 5KE2A 2EQKA 3DLMA 4ZGDB 4F7UF 4M7DG 2L3RA 3A8HB 1VQ4A 1K8AU 4LDWA 3OW2S 1G3SA 4OB2B 2E41A 3MO8A 4IUTA 3G7ZA 4NOYA 5CQXA 4A4GA 4M77B 5LJ5d 3CPWA 4F7UA 3CCMT 3OYMA 2RJEA 4QQDA 2K2VA 2EQJA 1M9SA 4C8QG 2QA4A 1WJSA 3I56A 4L59A 1MHNA 3VUBA 4FL6A 5D6WA 3WVEB 3E9FA 3RERA 4A53A 4ZN3A 2HNIA 3O8VA 4A4FA 2M1HA 4RCBA 1P92A 4OF1A 5GAMe 4BDZA 4XTWA 3X20B 2LNVA 2QTXA 3QIIA 3OYKA 4E7IA 4JX6A 3UDCA 1YJWA 1KHCA 1G3TA 2HQXA 3OQ5A 2X4YA 2LCCA 3QUIA 4JX4A 3MHXA 4E47A 2ZGWA 3FIFA 3HFOA 1UB4A 1UGRB 3BDUA 5GAN4 3OYHA 3VKGA 2WJ9A 3A8MB 2A3LA 4NL2A 5L8RE 3JCMh 4B9WA 2RHXA 3DLLA 1YIJA 4IUQA 4EMHA 2I2LA 4HA8A 2O4XB 2P4TA 1VQ4T 1WQ7A 4M78D 3SDZA 3QSUA 4BBSM 1X01A 3CCMA 1Q7YC 4LD9K 1VQ6T 4PJOF 1M1KU 3CCVT 2MF2A 4LDXA 2GQVA 1TH7A 2PQWA 3PTAA 2EQMA 4C0FA 3QO3A 1Q81C 3A8GB 3CBOA 1G3YA 1Y71A 3FJPA 3P8DA 4JDSA 2D0QB 3OS0A 1GXIE 4M78C 4KT0E 2QQSA 2WSCE 3OS5A 5DLQE 2LQKA 3JCMe 4F7UG 1AHJB 2JUFA 2EJGA 3OBYA 4M7DF 1PSFA 3RUXA 3QKJA 2KK4A 1VQ5T 5GANe 4RMOA 2OTLT 1VQKT 4MZPA 2DXBB 5A0LA 1WJRA 4XU0A 3H8ZA 2K3YA 4XU2A 3I56T 1I5LA 4HCCA 3JB9G 1N8RU 4M77D 3PIPA 1IZ6A 1D3BB 4FSXA 3H4CA 2CS7A 1O75A 5GAMh 1VQ9T 3MEAA 5CO7A 3L2VA 3CC4A 4MZTA 1M1FA 1B34A 2RI2A 4BY6B 1KG1A 4JS5A 4Z6YA 3VKHA 3QBYA 2E6NA 1UGQB 3OS2A 1OZ2A 3EFSA 2KVQG 5IN1A 1FKMA 5A0DA 2P0PA 3BDLA 2XIDA 5GMKj 3OYDA 3RMQA 5FU6B 2GCXA 3ZFJA 3CCRA 2P0KA 1M90U 1XOVA 2V8IA 1YBYA 3FC3A 3GP8A 3SWNA 2LCLA 2E65A 2LT1A 2VGNA 1X6OA 3J80E 4E7HA 1QP2A 4JRIA 4GLKA 3CCUA 2FB7A 1M1KC 2BUDA 3V8JA 5LJ5e 4C92E 4DA4A 2OTLA 2QQRA 1JJ2A 2DD4B 1WGSA 2BS4A 3QDRB 4HLQA 3X25B 2E64A 4M75A 3RIRA 1Q86C 4MZMA 1Y07A 2ZPBB 2YHTA 4M78A 3MCAB 1YCYA 4MFEA 3M4YA 3CCLT 1BI2A 2VV5A 1RL2A 2HQEA 3GF5A 3LX7A 4QQGA 2EJFA 2O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPE B;  2CZ7 B;  2PVD B;  1UGP B;  1IRE B;  4ZGD B;  2AHJ B;  3X26 B;  3A8H B;  3LW5 E;  4OB2 B;  4XK8 E;  3A8O B;  3QZ9 B;  2ZPG B;  2CZ1 B;  3WVE B;  1V29 B;  2ZZD B;  2PUK B;  1DJ7 B;  2PVG B;  3X20 B;  2WSE E;  2PVO B;  2ZPF B;  3QYG B;  3VYG B;  2ZCF B;  1UGR B;  2DPP B;  3X28 B;  3A8M B;  5L8R E;  1PSE A;  2ZPI B;  2DXB A;  2DXC A;  2CYZ B;  2WSF E;  3A8G B;  4OB1 B;  2D0Q B;  2DXC B;  2DD4 A;  2DD5 A;  1GXI E;  4KT0 E;  2WSC E;  1QP3 A;  3X24 B;  1AHJ B;  2PU9 B;  1PSF A;  2QDY B;  1UGS B;  2CZ6 B;  2DXB B;  2O01 E;  4L6V 5;  3WVD B;  4ZGJ B;  2PUO B;  2ZPH B;  3VYH B;  3HHT B;  1UGQ B;  3QYH B;  3A8L B;  4OB3 B;  3QZ5 B;  2ZZD A;  4FM4 B;  4ZGE B;  1QP2 A;  4Y28 E;  2CZ0 B;  4OB0 B;  4RKU E;  3QXE B;  2DD5 B;  2DD4 B;  3X25 B;  2ZPB B;  1JB0 E;  3VYG A; 
#chains in the Genus database with same CATH topology
 1RAF B;  1UNG D;  3EG1 A;  3OSV A;  5HNB B;  4Z89 A;  3GOX A;  2DTI A;  4LOC A;  1JJ2 S;  4HNT A;  3OS1 A;  1VIE A;  2DIG A;  3X26 B;  4FU6 A;  1S72 T;  5GAN 8;  4C92 B;  4RTT A;  5HKC A;  2X4J A;  1ZA1 B;  3S6W A;  2CKK A;  3HZJ A;  4JJB A;  4Y72 B;  1E9H B;  3CC2 Q;  1M90 C;  3CCJ Q;  2CZ1 B;  1X6G A;  1YWO A;  2HBW A;  1OI9 B;  3HKS A;  5KCH A;  4O6J A;  2WSE E;  4N0A A;  2EIF A;  1ZBX A;  2SEM A;  4BI4 A;  3QYG B;  2M16 A;  1BU2 A;  1N6A A;  3DDQ B;  4OMF B;  3LH5 A;  3CPF A;  3G4S Q;  1Q82 U;  2RHZ A;  4M7A B;  3THK A;  1G83 A;  4HNV A;  2QEX Q;  1IRX A;  4JRP A;  2EYW A;  3H9N A;  1T0J A;  3CC7 Q;  1OPK A;  4EMG A;  1VQ5 A;  1JEG A;  2DXC B;  2RQV A;  2DD5 A;  3ZEH A;  1KC8 R;  3QPH A;  4CFW B;  1Q7Y R;  1R8O B;  1M1G A;  4J8O A;  2MIO A;  4CC7 A;  1OI1 A;  3MEU A;  4BCN B;  1UJY A;  3JCM f;  4UC4 A;  1NYG A;  3MJX A;  4WCI A;  4AKH A;  2NUP B;  2B8A A;  2PUO B;  4F6W B;  4N4H A;  3PE0 A;  3JB9 F;  3MP6 A;  4C5I A;  2VWF A;  1VQ9 Q;  3CCQ T;  1HXD A;  4BCN D;  2V8K A;  3CD6 T;  1QCF A;  2Y90 A;  4HT9 A;  1PD0 A;  2M0O A;  3SD4 A;  4EMK C;  3NDQ A;  4KGZ B;  3V8L A;  2YDL A;  5DLO A;  1H8K A;  3OMC A;  2HSP A;  1YI2 T;  1MUZ A;  5GAN 5;  3EGD A;  3PIO A;  3OMG A;  1NJI R;  4TTH A;  1H3Z A;  5LJ3 h;  2OAU A;  2LC4 A;  3PVL A;  8ATC B;  1AZG B;  1VQL Q;  4PJO C;  4C0Z A;  3CBP A;  4JRK A;  1VQO T;  1JSU B;  4C8Q D;  3EGX A;  5D6Y A;  2CZ7 B;  1PRL C;  4ZN1 A;  4BI3 A;  3CCL A;  4RCC A;  2FHD A;  2X9H A;  1H4L D;  3BLH B;  1ZQ1 A;  4MIM A;  2AHJ B;  1QVF S;  4FSS A;  1SSF A;  3ME9 A;  3CC2 A;  5GMK l;  3ULR B;  1LCK A;  2DME A;  1VYU A;  1ZX6 A;  2LQW A;  3CCJ A;  1RAH B;  3JSC A;  4MDW A;  1WHK A;  2LX9 A;  2QQB A;  2EW3 A;  1FYN A;  4IKF A;  1GFC A;  1Q7Y U;  1WJQ A;  4Z02 A;  2L3Q A;  3E2U A;  1NBE B;  1OU9 A;  2EPD A;  2CSI A;  2DEQ A;  3RKY A;  2EVR A;  2HAX A;  1WNL A;  5FRN A;  3MEV A;  2ZCF B;  1H92 A;  1E6G A;  5FU6 C;  4OGR B;  3X28 B;  2QEX A;  4BUG A;  4BY1 X;  4MFD A;  2KR6 A;  4X9D A;  4Y91 A;  1U1T A;  4L5G A;  3CCJ T;  1FMW A;  2G6F X;  1YIT Q;  1TXQ A;  2CP3 A;  4A4E A;  4JJN K;  2DE0 X;  1NE8 A;  4KUI A;  3WXM B;  2VVK A;  3TVT A;  1RI0 A;  2OJ2 A;  2PU9 B;  3PNW C;  5HQ0 B;  3UPU A;  4J7F A;  3DL1 A;  4EOQ B;  2DIL A;  2DER A;  1YJW T;  2O01 E;  4ELL A;  1M30 A;  4N0A C;  1WXT A;  1JXM A;  2V1R A;  3CEY A;  3PGG A;  2BE7 D;  1QWF A;  3OBW A;  2AZV A;  4FYY B;  1QW1 A;  4CI0 C;  5DM7 R;  4RUG A;  2DKG A;  3E9G A;  3TNW B;  3M0P A;  2JZ2 A;  1OL2 B;  2C5O B;  2KAF A;  1GUX A;  4JRQ A;  2KSS A;  3DDP B;  5IAY A;  1GH6 B;  1BI3 A;  4LUD A;  2KR3 A;  3MPU B;  3S3M A;  2WMB B;  1OIY B;  4Y28 E;  3NMZ C;  4E7H A;  4X9C A;  1X2Q A;  2OI3 A;  4V2S A;  4E7Z A;  3O0G D;  4HCB A;  2E6Z A;  2JMC A;  4RG8 A;  2J6F A;  2L3P A;  3NTK A;  2A08 A;  1GBR A;  4OMN A;  3QYE A;  4KRC B;  2E5Q A;  2PMI B;  1Q81 R;  3M4G A;  4M7D A;  2EQI A;  4E7S A;  3M9Q A;  4IUU A;  3BHU B;  4M75 E;  2C0O A;  3I55 T;  3JRZ A;  2FZG B;  4FYW B;  1D1C A;  5LMK B;  2CCI B;  1Q86 U;  4C92 C;  3A1P A;  2HEQ A;  4Z88 A;  9ATC B;  4FW1 A;  2R5M A;  1JST B;  1WXU A;  1D0Y A;  2C4G B;  4BCQ B;  3QDF A;  2IIM A;  1MND A;  4BY7 X;  1WLP B;  5CIU A;  4EOI B;  2I53 A;  4C5H A;  3VS3 A;  2AIR B;  3OYC A;  1UE9 A;  2KT1 A;  5FU7 C;  2UZD B;  4BCQ D;  2J05 A;  1JJ2 P;  1AZE A;  2UZE B;  4IUP A;  1H3H A;  3EFO B;  1JRI A;  1YI2 A;  2D8J A;  1RAI B;  3MY1 B;  5HY6 A;  2KGT A;  1VQ7 Q;  1W4S A;  2EUF A;  1YJN A;  2KNB B;  2HCK A;  4M7A F;  5GAM d;  1I07 A;  2RI3 A;  2DBK A;  1D3U B;  4HL4 A;  2DK3 A;  1KQS S;  3M03 A;  2CH4 W;  4XAX B;  4XTX A;  1KIK A;  3CCS T;  1H27 B;  4F7L B;  1B34 B;  3WVD B;  1ZHI A;  3GBQ A;  3ZBD A;  3HTR A;  2RJC A;  3HBL A;  1IHW A;  4QW2 A;  5GAN f;  3OSS C;  3JB9 J;  1NJI U;  4IMY B;  3EG0 A;  5IH2 A;  4M7A D;  4PK4 A;  2J6O A;  2HQH A;  1YHQ T;  4BCH B;  4IIO A;  1D1B A;  5KH6 A;  3JCM d;  1XO2 A;  2LDM A;  5CCA A;  4CC4 B;  2RK2 A;  4A4K A;  2E3I A;  1PRM C;  1JO8 A;  3LGF A;  2KY9 A;  4QKU A;  3HRU A;  2JW4 A;  4M7A G;  1UJ0 A;  5I21 A;  1G5V A;  1PNJ A;  2XD0 A;  3FDR A;  1VQ6 A;  1TTH B;  2F1L A;  3OYF A;  2ZPE B;  3F5X B;  5CKF A;  2X4W A;  1X69 A;  2VUB A;  4TVR A;  4A54 A;  1UGP B;  1QVF A;  2O9V A;  4OR5 B;  2EQK A;  4ZGD B;  3H0H A;  2L3R A;  4CC2 A;  1K8A U;  4LDW A;  3QHR B;  2E41 A;  4A4G A;  3CPW A;  2RPN A;  2QA4 Q;  5LJ5 d;  4BCI B;  2K2V A;  1MMD A;  1M9S A;  2EQJ A;  2EYY A;  4C8Q G;  3I56 A;  1YFN A;  3BE3 A;  3RBB B;  1WX6 A;  1I1J A;  3NHN A;  3RER A;  4A53 A;  1GY3 B;  1RAE B;  2V22 B;  2V26 A;  1P92 A;  4BDZ A;  2F2C A;  2LNV A;  1OKW B;  2IW9 B;  4M4Z A;  1SF9 A;  1YJW Q;  3G71 Q;  2LCC A;  4JX4 A;  4JZ3 A;  4E47 A;  2RF0 A;  1UNL D;  1GBQ A;  3VKG A;  1YJN Q;  4BCF B;  2A3L A;  3DLL A;  4IUQ A;  1F5Q B;  1I5O B;  3QSU A;  2HSE B;  3CCV T;  2MF2 A;  4LDX A;  2PQW A;  3QO3 A;  3FJP A;  2NUT A;  4F7J B;  3OS0 A;  1X2K A;  2QQS A;  2HL3 A;  4R0K A;  2LQK A;  2KBT A;  1SHF A;  1AHJ B;  2KEA A;  1PSF A;  3RUX A;  3QKJ A;  1VQ5 T;  2EGE A;  5GAN e;  4RMO A;  2K6D A;  1WIE A;  3EH1 A;  4XU0 A;  1GFD A;  4HCC A;  1TD6 A;  3PIP A;  3H4C A;  2FPF A;  4RTX A;  3L2V A;  4J9I A;  1M1F A;  2RI2 A;  4J9D A;  1TUG B;  3OS2 A;  2X51 A;  5IN1 A;  5GMK j;  2XID A;  1UEC A;  2GCX A;  1QKX A;  2UZB B;  1XOV A;  2RMO A;  4F6S B;  1X6B A;  1M8M A;  1X6O A;  3CCU Q;  2PK9 B;  1ARK A;  2BUD A;  5LJ5 e;  4DA4 A;  4BCP B;  2QQR A;  1FVV B;  4CRL B;  2OX7 A;  4HLQ A;  3X25 B;  1Q86 C;  1VQ6 Q;  4M78 A;  2GGR A;  1CSK A;  5FWC A;  1YCY A;  4MFE A;  3M4Y A;  1BI2 A;  3LX7 A;  4ANJ A;  2O4X A;  2A37 A;  2PVD B;  1VQN A;  2WPA B;  2CGH A;  2YLB A;  1OQK A;  1KC8 C;  3H6Z A;  5KE3 A;  2H3E B;  3I56 Q;  2XDB A;  1TSF A;  5LL6 S;  4JLG A;  4F7N B;  2NYS A;  2J06 A;  4CFN B;  2KT8 A;  3MIA B;  4DEY A;  2DL3 A;  1LNX A;  2ZPG B;  2MK5 A;  4LUE A;  2LT4 A;  3NTI A;  3C94 A;  4C8Q F;  4EMK A;  1WYX A;  5GAO q;  1QCO A;  1MMG A;  4BAC A;  2VB6 A;  2KMT A;  1DJ7 B;  3TNH B;  1V76 A;  5D7U A;  3IQL A;  3TNI B;  2YRC A;  1YHQ Q;  1UFF A;  2EYZ A;  2XI9 A;  5GAN d;  4BD3 A;  1HD3 A;  3CCE Q;  2YUO A;  3G6E T;  2MI6 A;  3EH2 A;  3QWX X;  2DXT A;  3HO8 A;  3CC7 A;  1OX8 A;  4J83 A;  3ER0 A;  4D8K A;  3JB9 D;  1VQK A;  1H1P B;  2LQN A;  3X24 B;  4FX3 B;  2CP7 A;  4J6W A;  1GL5 A;  4QVZ A;  5A2Q E;  4N4G A;  1X27 A;  2EQU A;  4RTW A;  4KGX B;  3TRE A;  3KHI A;  2COW A;  2KRM A;  4A63 B;  4Y92 A;  1QMC A;  4M78 G;  4ATO A;  5CR2 A;  3CXC P;  4QVC A;  3H0I A;  3INZ A;  5I5Z B;  2QXF A;  1KQS P;  4FM4 B;  3ZL7 C;  3K7A M;  3M54 A;  2XKO C;  3TSZ A;  2WHB B;  3DKM A;  4E6R A;  1OYX A;  3EOC B;  4PJO A;  3GTM S;  3J7A F;  3VYG A;  1ABO A;  3CCL Q;  1G8X A;  1KJW A;  1PD1 A;  4KRD B;  2ZAE A;  3RES A;  1K73 R;  2QDJ A;  1VIN A;  2YLC A;  4M77 E;  4OMM A;  2EGC A;  2CT3 A;  2HKN A;  3CPW S;  3TSW A;  4BE2 A;  3OW2 A;  2DM1 A;  3MEW A;  3EAE A;  1K73 C;  1C1A A;  2CRE A;  1KD1 C;  1W2B S;  3EJ1 B;  1VQP A;  1OPL A;  2EWN A;  4M75 F;  5J26 A;  1BI0 A;  1YHQ A;  2LQ8 A;  1VQ8 T;  3PMT A;  1TUC A;  2V8J A;  4J9G A;  4B9X A;  4DOV A;  3TW6 A;  1MGQ A;  3M0Q A;  1VQO A;  1GCQ C;  2RM4 A;  3UWN A;  4MML A;  3M58 A;  2DPP B;  2IG0 A;  3LWI A;  1AIS B;  4JUV A;  5M9O A;  2DXC A;  1YIT A;  3EHQ A;  2MCN A;  2CYZ B;  1Y57 A;  2QA4 T;  2JJ9 A;  4HXJ A;  4M78 B;  2FO0 A;  1RUW A;  2DD4 A;  4J6Y A;  1MMN A;  1VQ8 A;  1Y7X A;  2KYM A;  1VQN T;  4M77 F;  3SWN B;  5GAN 3;  3CCR Q;  3R6O A;  3RDV A;  1RI9 A;  2FL7 A;  3DB4 A;  2A0F B;  3M53 A;  3URG A;  5GAO m;  1Q81 U;  2RHY A;  2R57 A;  3GPL A;  3JB9 H;  2JGZ B;  2AT1 B;  3MET A;  2Y4Y A;  3NPF A;  3CBM A;  1FMK A;  3KFV A;  4RTZ A;  3MKD A;  3G1J A;  1KQS A;  3OYY A;  1S72 A;  1K9M R;  2XK0 A;  3A98 A;  4M78 F;  5LJ5 g;  1BIA A;  1Q82 C;  2DL8 A;  2DYI A;  1KC8 U;  4FT4 A;  1VYW B;  3H0F A;  4OB0 B;  4AKI A;  5LJ3 j;  4JLI A;  1E7P A;  3VS5 A;  1I0C A;  1KHI A;  3M57 A;  5GAN 2;  3E19 A;  2HMA A;  3RKX A;  3VS2 A;  1SG5 A;  2P4R A;  5GJV B;  1JB0 E;  4KH1 B;  1ZSZ A;  2CP0 A;  1Q82 R;  2AZS A;  1NG2 A;  2KRO A;  3EFO A;  2QQA A;  3BW1 A;  3VS6 A;  1VQ9 A;  1KD1 U;  4C8Q A;  2JXB A;  4M75 C;  1ZSZ B;  4M77 G;  2BS3 A;  2L89 A;  4PNO A;  1N27 A;  1O9S A;  3HRT A;  5KYN A;  2BIV A;  4PL6 A;  2DJZ A;  5GAN g;  2AKL A;  4QQ6 A;  3JCM g;  2BKD N;  2JM9 A;  3A8O B;  2O88 A;  1ZBJ A;  2PHG A;  3UA7 A;  1W98 B;  1VQL A;  2V1Q A;  3GNG A;  1U06 A;  2ZZD B;  2D1X A;  4ROC A;  2RA2 A;  3EFR A;  3L1A A;  5L2W B;  1ZSG A;  3SHW A;  5IXF A;  4M7D C;  1O9K B;  1VQ7 T;  1EZZ B;  5GMK i;  2M0Y A;  2LP5 A;  1M2O A;  1RLQ C;  4HVV A;  2QDL A;  1VQ5 Q;  3PFS A;  4J5Y A;  4E7J A;  2ABL A;  2FPE A;  2XMF A;  1XJW B;  4BI8 B;  1PWT A;  2K3X A;  4CRI A;  1PG5 B;  4DBF A;  3CCQ A;  2UUE B;  4EON B;  4HKE A;  2QQ9 A;  1VQ8 Q;  3PMI A;  2EYX A;  4YOS A;  3KBG A;  4N4I A;  2GTO A;  2O9S A;  4OP0 A;  3JCM Q;  4ZTJ A;  1QP3 A;  4BBR M;  3OYI A;  3BG9 A;  4UN0 A;  1N9R A;  3M55 A;  4C92 G;  2W96 A;  5IDP B;  5GMK m;  1ACM B;  4F04 B;  1LOJ A;  5I22 A;  3A5Z B;  1M8V A;  1VA7 A;  3VS1 A;  3G4S T;  2COZ A;  1N8R R;  2FZK B;  1FWZ A;  3F70 A;  1RAC B;  3T9N A;  2M9U A;  4C0D C;  2PJQ A;  1WPY A;  4X34 A;  3VV0 A;  3RKW A;  4P5N A;  3SFM A;  2RI5 A;  4PFP A;  2QQ8 A;  5GAN h;  1Q86 R;  4J7I A;  3HL8 A;  1BI1 A;  3MY5 B;  1I81 A;  5GAM f;  2BE9 B;  1NYF A;  3POM A;  2FG0 A;  2DAQ A;  2QGG A;  3L2R A;  1D09 B;  2RN8 A;  2OTJ T;  6AT1 B;  4ELZ C;  2E10 A;  2GFA A;  1NPR A;  1WHL A;  4X1V A;  4KBM B;  3RMS A;  4RTU A;  4C92 D;  3CD6 Q;  2MMP A;  2YXY A;  4C8Q B;  2IN3 A;  1WHJ A;  4M7D G;  2QGF B;  2DL4 A;  5I11 A;  1VQ4 A;  3OW2 S;  1G3S A;  1PCX A;  4OB2 B;  4IUT A;  3CCM T;  3G7Z A;  4M77 B;  3UAT A;  2P84 A;  3DOG B;  3TN8 B;  4KRT A;  4LXC A;  4L59 A;  2YUP A;  5D6W A;  5LQF B;  2L3S A;  1YN8 A;  4EOM B;  2HNI A;  3O8V A;  1D1A A;  2M1H A;  5ACB A;  4OF1 A;  1HYO A;  3X20 B;  2QTX A;  2M51 A;  1YJW A;  3EGU A;  2NUP A;  1D0X A;  1G3T A;  3CMA Q;  1TOV A;  4GBQ A;  3QUI A;  4ORZ A;  5FW9 A;  3MHX A;  3HFO A;  1UB4 A;  3EG9 A;  1UGR B;  2K9G A;  3BDU A;  4DBQ A;  3A8M B;  4EMH A;  2I2L A;  1YIJ Q;  2DET A;  4PJN A;  3EGD B;  2CCH B;  4YOZ A;  1WXB A;  1Q81 C;  2EQM A;  4C0F A;  5CEI B;  3A8G B;  3P8D A;  4OMQ A;  4JDS A;  4BCG B;  2J6K A;  1GXI E;  4KT0 E;  1SEM A;  1KK7 A;  3OS5 A;  4F7U G;  3OBY A;  2JUF A;  1N4M A;  2KK4 A;  1NM7 A;  4LE9 A;  4MZP A;  2DXB B;  5A0L A;  3H8Z A;  2CP2 A;  2LW4 A;  3JB9 G;  4FSX A;  1O75 A;  5GAM h;  3CC4 A;  4AFZ C;  5EC7 A;  4PJJ A;  4EOR B;  1QWE A;  4BCO B;  1E6H A;  5KYU A;  3QBY A;  3BDL A;  3RMQ A;  5FU6 B;  2P0K A;  4OML A;  1ZUY A;  2V8I A;  1YBY A;  2C0T A;  2KXC A;  4AFS C;  1NLP C;  3FC3 A;  3SWN A;  2E65 A;  2LT1 A;  2VGN A;  3J80 E;  4FYV B;  1M1K C;  1JJ2 A;  2DD4 B;  4MZM A;  2JS2 A;  2KRN A;  1VQM Q;  5KYW A;  2X3W D;  2VV5 A;  1GCP A;  2MPX C;  2FRW A;  2HQE A;  1VQN Q;  4J9F A;  4YC3 B;  4M75 B;  4CFU D;  1IRE B;  5GAN 7;  3E1S A;  1KFZ A;  1TU0 B;  1A0N B;  3AHU A;  1XQH A;  4BDY A;  1VIF A;  1U8R A;  1VQP T;  2PK2 A;  1VUB A;  4KUD K;  1QLY A;  3VJP A;  4NC6 A;  1QVG S;  1Z9Q A;  3HFN A;  3L2U A;  4M7A E;  4EOL B;  3P8H A;  1YJ9 T;  1Z9Z A;  2L2P A;  1V29 B;  1IGU A;  3CCR T;  1PKT A;  3RR6 A;  3LQ5 B;  2CP6 A;  2JM8 A;  1UNH D;  2HDA A;  5AT1 B;  2WIH B;  3M5A A;  3CCS A;  1RAB B;  4R55 A;  2ZPF B;  2KYB A;  1IXD A;  2RK1 A;  1HK9 A;  2R58 A;  2LX7 A;  4MDX A;  1CKB A;  2WEV B;  2GNC A;  4C0D B;  3EGX B;  1PSE A;  2RJF A;  5GAM g;  2ZPI B;  3FLG A;  2W9F A;  2W99 A;  5LJ3 f;  4DQ2 A;  4BE1 A;  3DTO A;  4VUB A;  1WQW A;  5EG2 A;  5KYY B;  4F14 A;  4OB1 B;  4BE0 A;  1NEG A;  4LNP A;  2RB6 A;  4PJO E;  2MAM A;  1IGQ A;  4PJO G;  2WIP B;  5GAO n;  2WFY B;  5EFQ B;  2CDT A;  1FXX A;  1G3N C;  1D0Z A;  3OYB A;  4ELY C;  1Y96 A;  4C5E A;  1QVF P;  2DVJ A;  3HP9 A;  2SRC A;  4GY5 A;  1K0S A;  1JXO A;  3LWH A;  5GAO l;  2QAS A;  2EFI A;  1ZUK A;  2OAW A;  3LYI A;  2CUD A;  2R7G A;  4II5 B;  2QTV A;  1T3S A;  3D7S B;  1TFB A;  3CC4 T;  2RH2 A;  3CCU T;  2K5F A;  5LJ5 f;  1YP5 A;  2RQT A;  1SRM A;  3BHT B;  2F5K A;  3S3N A;  4FCY A;  2VYT A;  2E4H A;  3HPW A;  1VQM A;  3M0R A;  4BXX X;  1QVP A;  3V7C A;  5C6S A;  5GAO p;  2I0N A;  4PJM A;  1OOT A;  2KXD A;  2CH4 A;  4M6V A;  1KD1 R;  3TCJ A;  4ROD A;  2QF7 A;  2KI7 A;  1H24 B;  3UF4 A;  3BG5 A;  1K0X A;  3JCM X;  2K2M A;  3EID B;  1M5Q 1;  1HSQ A;  3L2Z A;  4XK8 E;  1SKU B;  4ZNX A;  3G71 A;  1N9S A;  4LN2 A;  2RHI A;  1K4U S;  3B57 A;  4BCJ B;  4EMK B;  3CME T;  4BCM D;  3R6N A;  1K9M U;  4IUV A;  3P8B B;  1P5E B;  2IVW A;  3DJB A;  1RAA B;  1WZO A;  4C92 A;  2R5A A;  3CME Q;  1ZUU A;  4BCM B;  1AD5 A;  1AEY A;  4C5G A;  4AI6 A;  2DFU A;  2E3H A;  4EOJ B;  5CKH A;  2DXU A;  5ECA A;  4Z8A A;  2DEU A;  2VC8 A;  4DEX A;  4ME7 A;  2OTJ Q;  1NZ9 A;  1MMA A;  2DXB A;  2O2O A;  2C06 A;  4CFV B;  2LRQ A;  4B6M A;  4R56 A;  2X3X D;  5LJ3 d;  2GF7 A;  5LJ3 e;  5GAM j;  5IHK A;  4OGE A;  3V7R A;  2CSQ A;  4C8Q E;  1N5Z A;  4F7S B;  3KUF A;  2QGS A;  3CCE A;  2Z0W A;  4OVA A;  3QWL A;  1M2V A;  1OGU B;  3QJY A;  1TG0 A;  4XTY A;  4O5V A;  4XTZ A;  4HVW A;  5KCO A;  4EC9 B;  1AWX A;  1YJ9 Q;  2ED0 A;  3QYH B;  1D3B A;  2EKO A;  2LCS A;  1W1F A;  1XNI A;  4J9B A;  2BKZ B;  2MYS A;  4F17 A;  1WFW A;  1QMZ B;  2IVX A;  3TW7 A;  3BY7 A;  5KYY A;  2CZ0 B;  2EKH A;  5GAN 6;  3L2W A;  3QXE B;  2D6F A;  2DVE A;  2L5Q A;  2DZC A;  4M77 A;  4DBH A;  1VQL T;  2NUT B;  3V7S A;  1NEB A;  2JTM A;  2VGM A;  1ZA2 B;  1K73 U;  4LD6 A;  2K57 A;  4D8D A;  2ESW A;  1K9M C;  2WXV B;  3M0T A;  2B86 A;  3QJ6 A;  4WTO B;  2DBM A;  2DRM A;  2LJ3 A;  2ED1 A;  3I5R A;  1BU1 A;  3G6E A;  3VRZ A;  1AT1 B;  1X43 A;  3MI9 B;  2DTO A;  5GAO r;  1G2B A;  4CFM B;  4PKC C;  2IW8 B;  2KMG A;  1NLO C;  4ESR A;  1QVG A;  2CUB A;  5C0M A;  1EIF A;  5LJ3 g;  1V1C A;  4JX5 A;  1KQ2 A;  1BK2 A;  4OMO A;  3OA6 A;  4JZ4 A;  3JCM P;  1B07 A;  5LJ5 j;  1WHG A;  2K4Y A;  2HBP A;  5IT9 E;  1WI7 A;  1Q95 G;  4LDV A;  3CME A;  1C6V X;  4F7U B;  1IHV A;  3QG1 A;  4RTV A;  3GIB A;  4F7U E;  5FRO A;  3BG3 A;  4F6U B;  2G9X B;  2O31 A;  3CCQ Q;  4AMC A;  2B9R A;  1Y96 B;  1KQ1 A;  1QVG P;  1QKW A;  4CXA B;  4M7A C;  2K7A A;  2K5I A;  1WHH A;  3CCM Q;  1F1B B;  1K8A R;  3OYN A;  2XDD A;  3CCV A;  2XG8 D;  3BLQ B;  4D6W A;  1EFN A;  2JT4 A;  5HVY B;  3JV3 A;  1AOJ A;  5CKB A;  1ZLM A;  1VQM T;  2CZ6 B;  1AWW A;  2DL5 A;  5IHN A;  3OYL A;  2PZ1 A;  1Y0M A;  2HL5 C;  2PTK A;  3NFC A;  5HK0 A;  3LH0 A;  2F69 A;  1H26 B;  2ZPH B;  1YJ9 A;  4PJO D;  2XIC A;  3C95 A;  3G71 T;  1M2V B;  1LVK A;  1AD6 A;  3VYH B;  4AFQ C;  1YWP A;  3VKI A;  4FW2 A;  1GRI A;  2W0Z A;  4PLL A;  3DB3 A;  3SB2 A;  3ASK A;  4EPC A;  3QZ5 B;  1UTI A;  2A36 A;  5FRM A;  1PHT A;  1UHF A;  2ECZ A;  2VXE A;  1OKV B;  2E1H A;  1I4K 1;  5J3B A;  1YJN T;  2JTE A;  4M75 D;  1K9A A;  2MWP A;  3EG9 B;  3G6E Q;  3CD6 A;  4PFO A;  4E2F B;  4WF2 A;  1S72 Q;  3HB9 A;  3MP1 A;  4XU1 A;  2RQU A;  4F7U F;  5KYW B;  2J7I A;  1WDX A;  2F2W A;  3U23 A;  2DRK A;  4JJD A;  3OYM A;  1ABQ A;  3PO3 S;  2W9Z A;  1MHN A;  3VUB A;  1OL1 B;  2A28 A;  2C5X B;  3I9Q A;  4A4F A;  4ZN3 A;  4KGV B;  1URC B;  5GAM e;  4XTW A;  4E7I A;  3OYK A;  3C0C A;  4JX6 A;  2VAS A;  1SHG A;  2H8H A;  3FIF A;  3OYH A;  4NL2 A;  1YIJ A;  3JCM h;  5IHI A;  4B9W A;  2RHX A;  4HA8 A;  1R0B G;  1T3L A;  3SDZ A;  5HBJ B;  1FMV A;  4BBS M;  2HKQ B;  1VQ6 T;  3CCM A;  2JS0 A;  2GQV A;  1TH7 A;  1W6X A;  2E5K A;  3H41 A;  3VRY A;  3I55 Q;  3G33 B;  5DLQ E;  3JCM e;  4M7D F;  2EJG A;  1OX9 A;  3REA B;  2OTL T;  1VQK T;  2DA9 A;  3VS0 A;  5HBH B;  4XU2 A;  3BLR B;  5IDN B;  2CS7 A;  5CO7 A;  1UGV A;  4MZT A;  1B34 A;  1KG1 A;  1B3Q A;  2DJQ A;  3FJ5 A;  4Z6Y A;  3VKH A;  3EFS A;  1OZ2 A;  5BNJ B;  2D8H A;  2KVQ G;  2P0P A;  4PFZ A;  2KE9 A;  1M90 U;  1TWB A;  3REB B;  2NUZ A;  3GP8 A;  1QP2 A;  4JRI A;  1RAG B;  3V8J A;  3NGP A;  2OTL A;  2ROL A;  5HCK A;  3RIR A;  3QDR B;  2BS4 A;  2E64 A;  2L0A A;  2YHT A;  2CP5 A;  1EX4 A;  1ZSZ C;  3GF5 A;  3M0U A;  3OB9 A;  2DNU A;  2EJF A;  3FRN A;  2XHC A;  2BZ8 A;  3NTH A;  4BB7 A;  1KXU A;  2NWM A;  4JJC A;  3CCE T;  5LJ5 h;  2C5V B;  5D6X A;  1U1S A;  2X4X A;  3C4S A;  3LW5 E;  1BKB A;  2XU8 A;  4HNU A;  4HVU A;  3OYJ A;  5A0G A;  1UDL A;  3S3O A;  3OY9 A;  1JBM A;  3QHS A;  4LDU A;  4OMP A;  1T0H A;  2LVM A;  2EAY A;  2DZ9 A;  4M7D B;  3FB9 A;  4I3Z B;  1KSW A;  2WAC A;  3CXC S;  2Y4X A;  4XTV A;  2L8D A;  1G3W A;  2LZ6 B;  2IW6 B;  2K79 A;  5FGK B;  1NPP A;  3LLR A;  4XU3 A;  3G4S A;  4IIM A;  3I55 A;  2WSF E;  4LDY A;  4FYX B;  4CFX B;  4JS4 A;  3QWY A;  4NST B;  3SEM A;  2DTH A;  3JCM W;  5I2S A;  1VYT A;  4CFU B;  2C6T B;  4OGC A;  2G3R A;  1GCQ A;  5KYU B;  1VQ7 A;  5CQY A;  4QSH A;  1VYV A;  2BTT A;  2MOX A;  5DQW A;  1BIB A;  4A4H A;  2LMJ A;  3HHT B;  1O9K A;  1UEB A;  2VXF A;  5KYX A;  2W2H A;  1UHC A;  2F2X A;  4OB3 B;  1M3A A;  4M75 G;  2FEI A;  2JVV A;  4G6L B;  2ZZD A;  2OTL Q;  2BPM B;  1UUE A;  2D0N A;  4II1 A;  2DD5 B;  1CKA A;  1M1K R;  4FT2 A;  3BFM A;  1VQ4 Q;  4NL3 A;  3KXT A;  1E7O A;  4PLI A;  2RQW A;  4GLM A;  2AKK A;  2RJD A;  2XDP A;  1BB9 A;  3OYA A;  4M7A A;  2FVU A;  4PJO B;  1M27 C;  2YT6 A;  2AK5 A;  3PVQ A;  1OUL A;  2RO0 A;  2X35 A;  1ENW A;  3VS4 A;  3HRS A;  5GMK e;  3M56 A;  2DO3 A;  1VOM A;  3CMA A;  5FLX E;  4EOS B;  2W10 A;  4RG2 A;  3SWN C;  5ICP B;  3QZ9 B;  4XTU A;  2JTF A;  1LJO A;  2K3B A;  1AVZ C;  2JMA A;  5CKD A;  1M90 R;  1OEB A;  2YRV A;  3EG2 A;  4M7D E;  2X1N B;  1YCS B;  2EBP A;  2VKN A;  4DOW A;  3VU3 C;  4AG2 C;  1R77 A;  2YUN A;  2FZC B;  3O5Z A;  3VYG B;  3FEO A;  4J9H A;  4QVD A;  4Q5W A;  1B7T A;  3CC2 T;  5CAI A;  2KDS A;  3JB9 I;  1H1Q B;  1OZ3 A;  4C0G A;  1PKS A;  4HCZ A;  4C8Q C;  3JCM b;  2DX1 A;  1BCO A;  4AFU C;  1PKD B;  5IHY A;  1XTD A;  1M3C A;  4EDU A;  3CC4 Q;  4M77 C;  1C0M A;  3CPW P;  1MV0 B;  2HZY A;  2E12 A;  1BYM A;  4J9C A;  2COY A;  1JU5 C;  3QYB A;  4ELJ A;  2DLP A;  2MWO A;  1OIU B;  5CKE A;  4YTL A;  5I2M A;  4AG1 C;  1HJD A;  2QEX T;  3L42 A;  4QT7 A;  3JCM c;  3OYE A;  1BBZ A;  1H64 1;  2DIQ A;  2PNI A;  1FIN B;  4EIK A;  1YIT T;  3A8L B;  3UA6 A;  1H1R B;  1QQJ A;  1K1Z A;  4AKG A;  1M3B A;  3VS7 A;  3BHV B;  4ZGE B;  2GTJ A;  4RKU E;  2DYB A;  2GBQ A;  2KQW A;  2IPO B;  2E70 A;  4BCK B;  3PT9 A;  3M0S A;  1K76 A;  5CK9 A;  2DL7 A;  1WHM A;  2EYQ A;  2JN0 A;  4ROE A;  1NJI C;  5EJC A;  4IUR A;  4E7L A;  1MNE A;  1SPK A;  1C9B A;  4KH0 B;  2LNH B;  5L23 A;  5GJW B;  1PC0 A;  2A7Y A;  4XQ3 A;  4EOK B;  5HK3 A;  2JNG A;  2K5L A;  2RD1 A;  1UG1 A;  2I40 B;  3GLX A;  1IB8 A;  2ROT A;  5AYF A;  4BY6 C;  3CCS Q;  1X75 C;  1MV3 A;  1PM3 A;  4KUL A;  4MMK A;  3N5B B;  3V8K A;  2NLU A;  4C92 F;  2HD0 A;  2UZL B;  1TUD A;  2ENM A;  2H3J A;  1W2B P;  3TEE A;  5DY9 A;  2EGA A;  2PUK B;  2PVG B;  3JCM V;  3EG3 A;  5FU7 B;  2PVO B;  1OV3 A;  2CT4 A;  4EOO B;  2EJ9 A;  2QYZ A;  4NS5 A;  4J9E A;  2FRY A;  3C12 A;  2C0I A;  1JKW A;  1YI2 Q;  1OU8 A;  2RHU A;  1W2B A;  5HBE B;  2YWW A;  3GNF B;  5J39 A;  1YIJ T;  3MP8 A;  1FX7 A;  4ZTF A;  2RQR A;  3CXC A;  2D9T A;  7AT1 B;  3Q1J A;  2QI2 A;  3M59 A;  3CCV Q;  3UT1 A;  1LPL A;  2CJM B;  3J81 E;  2FPD A;  2FYK A;  2QDY B;  1UGS B;  5CVI A;  3AT1 B;  4M7D D;  3L2Q A;  2BZX A;  1SRL A;  4E7K A;  4L6V 5;  1R0C B;  1AWJ A;  1RAD B;  2G77 A;  2BZY A;  2DMO A;  1W70 A;  4J6X A;  4ZGJ B;  4K11 A;  3JAM E;  2OTJ A;  1K8A C;  4HT8 A;  3I5S A;  4F16 A;  3CQT A;  2LTO A;  4EOP B;  4M78 E;  3CC7 T;  2BS2 A;  2LJ0 A;  2JOY A;  4FIB A;  2QK0 A;  1RLP C;  3HSB A;  5GMK h;  3CMA T;  3JCM J;  5GAN j;  2QFZ A;  1N8R C;  2F2V A;  1TS9 A;  3LGL A;  2P0Q A;  1I8F A;  1QCN A;  3OYG A;  2C5N B;  2F5T X;  2GQI A;  3TU4 K;  1QLB A;  1M4Z A;  4DBR A;  2GFU A;  5IF1 B;  2ATC B;  1S1N A;  3VUZ A;  5KE2 A;  3DLM A;  1YNZ A;  3A8H B;  5CYI B;  3MO8 A;  5CQX A;  2LJ1 A;  4PJL A;  4NOY A;  4F7U A;  4YOO A;  2RJE A;  4QQD A;  2QA4 A;  1WJS A;  4AT1 B;  5KYX B;  4FL6 A;  2RNA A;  3WVE B;  3E9F A;  1H1S B;  1AWO A;  4RCB A;  1VQK Q;  1GUX B;  3QII A;  3UDC A;  1KHC A;  2HQX A;  3OQ5 A;  2X4Y A;  4F70 B;  2ZGW A;  1JQQ A;  5GAN 4;  1VQP Q;  2WJ9 A;  5L8R E;  2O4X B;  2P4T A;  3RNJ A;  1WQ7 A;  4M78 D;  1VQ4 T;  1U5S A;  1IO6 A;  1X01 A;  1Q7Y C;  4LD9 K;  2YRD A;  1VOL A;  4PJO F;  1M1K U;  5FWB A;  3PTA A;  1VQO Q;  3CBO A;  1G3Y A;  1Y71 A;  2D0Q B;  2KRS A;  2DF6 A;  4EC8 B;  4M78 C;  2WSC E;  3OW2 P;  2QAZ A;  4CC3 A;  2M02 A;  3RGF B;  3I35 A;  3QHW B;  3EHR A;  1WJR A;  2K3Y A;  3I56 T;  1I5L A;  1N8R U;  4M77 D;  1IZ6 A;  1D3B B;  1BCM A;  1JOW A;  1J3T A;  1VQ9 T;  3MEA A;  4BY6 B;  4JS5 A;  2E6N A;  1UGQ B;  1H28 B;  5A0D A;  3OYD A;  1FKM A;  5IXB A;  1WA7 A;  2YUQ A;  3ZFJ A;  3CCR A;  4RTY A;  2YSQ A;  1SSH A;  8AT1 B;  2LCL A;  4GLK A;  3CCU A;  2FB7 A;  1U3O A;  4C92 E;  1WGS A;  4M75 A;  4JPB W;  1H25 B;  1Y07 A;  2ZPB B;  3MCA B;  2QG9 B;  3CCL T;  2WMA B;  1ZP2 A;  5DQV A;  1RL2 A;  4HCK A;  4QQG A;  3TQ7 P; 
#chains in the Genus database with same CATH homology
 3FRN A;  2XHC A;  3OSV A;  2PVD B;  3GOX A;  1VQN A;  3NTH A;  2DTI A;  4BB7 A;  4M75 B;  2CGH A;  2YLB A;  4LOC A;  1JJ2 S;  5LJ5 h;  4HNT A;  1KC8 C;  3H6Z A;  1IRE B;  5D6X A;  1VIE A;  5GAN 7;  3OS1 A;  1U1S A;  2DIG A;  5KE3 A;  3X26 B;  4FU6 A;  1S72 T;  2X4X A;  3E1S A;  3C4S A;  3LW5 E;  5GAN 8;  2XDB A;  4C92 B;  3AHU A;  1BKB A;  1XQH A;  4HNU A;  2XU8 A;  4JLG A;  5LL6 S;  5HKC A;  1VIF A;  2X4J A;  4BDY A;  3OYJ A;  1U8R A;  1VQP T;  1VUB A;  3S6W A;  4KUD K;  2CKK A;  3HZJ A;  5A0G A;  3VJP A;  4NC6 A;  1QVG S;  3HFN A;  3L2U A;  1M90 C;  4M7A E;  3S3O A;  1LNX A;  2ZPG B;  3P8H A;  3OY9 A;  2LT4 A;  3NTI A;  2CZ1 B;  1JBM A;  1YJ9 T;  3C94 A;  3QHS A;  1V29 B;  4LDU A;  4C8Q F;  4EMK A;  5GAO q;  3CCR T;  2LVM A;  3HKS A;  2EAY A;  4BAC A;  2DZ9 A;  4O6J A;  5KCH A;  4M7D B;  2KMT A;  1DJ7 B;  3FB9 A;  3M5A A;  2WSE E;  4N0A A;  3CCS A;  4R55 A;  2ZPF B;  2EIF A;  1ZBX A;  2WAC A;  4BI4 A;  3CXC S;  3QYG B;  2XI9 A;  2RK1 A;  3OB9 A;  2M16 A;  1HK9 A;  5GAN d;  4BD3 A;  1N6A A;  2R58 A;  2Y4X A;  4MDX A;  4XTV A;  2L8D A;  1G3W A;  4OMF B;  3G6E T;  1NPP A;  2MI6 A;  3CPF A;  3LLR A;  4C0D B;  4XU3 A;  1PSE A;  3G4S A;  1Q82 U;  2RHZ A;  2DXT A;  4M7A B;  3I55 A;  2RJF A;  5GAM g;  2ZPI B;  3HO8 A;  3FLG A;  3CC7 A;  5LJ3 f;  4HNV A;  2WSF E;  4DQ2 A;  4LDY A;  4JRP A;  4BE1 A;  4VUB A;  1WQW A;  5EG2 A;  4JS4 A;  4J83 A;  4EMG A;  4OB1 B;  2DTH A;  3ER0 A;  4BE0 A;  3JCM W;  1VQ5 A;  2DXC B;  2RB6 A;  4PJO E;  3ZEH A;  2DD5 A;  2MAM A;  3QPH A;  4PJO G;  5I2S A;  5GAO n;  3JB9 D;  1VQK A;  4OGC A;  1R8O B;  1M1G A;  3X24 B;  1FXX A;  4J8O A;  2G3R A;  4J6W A;  1VQ7 A;  1OI1 A;  3MEU A;  3OYB A;  4ELY C;  3JCM f;  1Y96 A;  4UC4 A;  4QVZ A;  5CQY A;  4C5E A;  5A2Q E;  4N4G A;  4QSH A;  2EQU A;  4AKH A;  2B8A A;  3HP9 A;  3TRE A;  4GY5 A;  2PUO B;  3LWH A;  3KHI A;  4N4H A;  5GAO l;  1BIB A;  2EFI A;  4A4H A;  3JB9 F;  3MP6 A;  3LYI A;  4C5I A;  3CCQ T;  3HHT B;  1HXD A;  2V8K A;  3CD6 T;  4M78 G;  4ATO A;  1UEB A;  2Y90 A;  4HT9 A;  2VXF A;  3CC4 T;  5CR2 A;  4QVC A;  2M0O A;  3SD4 A;  4OB3 B;  4EMK C;  3V8L A;  2RH2 A;  4M75 G;  3CCU T;  2JVV A;  3INZ A;  2ZZD A;  5DLO A;  2K5F A;  5LJ5 f;  2QXF A;  3OMC A;  4FM4 B;  2F5K A;  3S3N A;  1YI2 T;  3M54 A;  2XKO C;  2VYT A;  3HPW A;  5GAN 5;  4II1 A;  1VQM A;  3PIO A;  3OMG A;  2DD5 B;  3DKM A;  4FT2 A;  1H3Z A;  1OYX A;  5LJ3 h;  1QVP A;  3BFM A;  2OAU A;  2LC4 A;  3V7C A;  5C6S A;  4PJO A;  5GAO p;  4NL3 A;  3KXT A;  4PLI A;  2RJD A;  4PJO C;  4C0Z A;  3CBP A;  2XDP A;  3OYA A;  4JRK A;  1VQO T;  3VYG A;  3J7A F;  4C8Q D;  4M7A A;  2FVU A;  4PJO B;  4M6V A;  5D6Y A;  2CZ7 B;  4ZN1 A;  4BI3 A;  3TCJ A;  3CCL A;  3RES A;  2QDJ A;  4RCC A;  2QF7 A;  2FHD A;  2RO0 A;  2X35 A;  2YLC A;  1ZQ1 A;  3BG5 A;  2AHJ B;  4MIM A;  3JCM X;  1QVF S;  4M77 E;  1SSF A;  3HRS A;  3ME9 A;  3CPW S;  1M5Q 1;  5GMK e;  5GMK l;  3M56 A;  4BE2 A;  3CC2 A;  2DO3 A;  3L2Z A;  4XK8 E;  3OW2 A;  3CCJ A;  3CMA A;  5FLX E;  3G71 A;  3JSC A;  4MDW A;  1N9S A;  2RHI A;  2LX9 A;  3MEW A;  3EAE A;  2QQB A;  4RG2 A;  1K73 C;  3SWN C;  4EMK B;  3CME T;  3QZ9 B;  4XTU A;  2JTF A;  1LJO A;  1W2B S;  1VQP A;  1KD1 C;  2EWN A;  1K9M U;  4IKF A;  4M75 F;  5J26 A;  1BI0 A;  5CKD A;  1Q7Y U;  1WJQ A;  1YHQ A;  4IUV A;  2LQ8 A;  4Z02 A;  3P8B B;  2YRV A;  1VQ8 T;  3PMT A;  4M7D E;  2V8J A;  2IVW A;  4B9X A;  2DEQ A;  3RKY A;  4DOV A;  4DOW A;  3VU3 C;  3TW6 A;  1MGQ A;  4C92 A;  1VQO A;  2HAX A;  1WNL A;  2R5A A;  2RM4 A;  5FRN A;  3VYG B;  3MEV A;  3FEO A;  3UWN A;  4C5G A;  4AI6 A;  2ZCF B;  4MML A;  5CKH A;  2DXU A;  5FU6 C;  3M58 A;  2DPP B;  3X28 B;  2IG0 A;  4QVD A;  3LWI A;  2QEX A;  4BUG A;  4Q5W A;  2VC8 A;  4MFD A;  2KR6 A;  3CC2 T;  4X9D A;  4ME7 A;  5CAI A;  1NZ9 A;  2KDS A;  4Y91 A;  3JB9 I;  1U1T A;  4JUV A;  4L5G A;  5M9O A;  1OZ3 A;  4C0G A;  2DXB A;  2DXC A;  3CCJ T;  1YIT A;  2C06 A;  2CYZ B;  4HCZ A;  2QA4 T;  2LRQ A;  4C8Q C;  3JCM b;  4R56 A;  4M78 B;  5LJ3 d;  1XTD A;  2GF7 A;  4A4E A;  5LJ3 e;  2DD4 A;  1NE8 A;  4J6Y A;  4KUI A;  3WXM B;  4EDU A;  5GAM j;  4JJN K;  1RI0 A;  4OGE A;  3V7R A;  4M77 C;  1Y7X A;  1VQ8 A;  4C8Q E;  2PU9 B;  3PNW C;  3UPU A;  4J7F A;  2E12 A;  1VQN T;  4M77 F;  3DL1 A;  1BYM A;  3KUF A;  3SWN B;  1YJW T;  3CCE A;  2O01 E;  3QYB A;  4OVA A;  4N0A C;  3QWL A;  4ELJ A;  3R6O A;  5GAN 3;  2MWO A;  3QJY A;  2FL7 A;  3CEY A;  3DB4 A;  3PGG A;  5I2M A;  5CKE A;  4YTL A;  4XTY A;  3M53 A;  2QEX T;  3L42 A;  3OBW A;  4O5V A;  4XTZ A;  3JCM c;  3URG A;  5GAO m;  1Q81 U;  1QW1 A;  2RHY A;  4CI0 C;  2R57 A;  5KCO A;  3OYE A;  2DIQ A;  1H64 1;  5DM7 R;  3GPL A;  3JB9 H;  2DKG A;  2Y4Y A;  3E9G A;  3MET A;  3CBM A;  2JZ2 A;  3QYH B;  2KAF A;  1YIT T;  1D3B A;  2EKO A;  4JRQ A;  3A8L B;  2KSS A;  3OYY A;  1KQS A;  5IAY A;  1S72 A;  4AKG A;  1XNI A;  2XK0 A;  4M78 F;  1BI3 A;  5LJ5 g;  1BIA A;  1Q82 C;  3S3M A;  4ZGE B;  3TW7 A;  3BY7 A;  1KC8 U;  4FT4 A;  2CZ0 B;  4Y28 E;  4OB0 B;  4AKI A;  4X9C A;  5GAN 6;  4RKU E;  5LJ3 j;  3QXE B;  3L2W A;  2KQW A;  4JLI A;  2D6F A;  1E7P A;  2DVE A;  2L5Q A;  2E70 A;  3PT9 A;  1KHI A;  2DZC A;  3M57 A;  4M77 A;  3E19 A;  5CK9 A;  5GAN 2;  3RKX A;  1VQL T;  2EYQ A;  2JN0 A;  3V7S A;  1JB0 E;  1NJI C;  4V2S A;  2JTM A;  2VGM A;  5EJC A;  1K73 U;  4LD6 A;  2K57 A;  4IUR A;  2QQA A;  3BW1 A;  1VQ9 A;  4HCB A;  1KD1 U;  4C8Q A;  1K9M C;  2E6Z A;  4RG8 A;  4E7L A;  3QJ6 A;  4M75 C;  4M77 G;  2BS3 A;  2L89 A;  4PNO A;  3NTK A;  2A7Y A;  3QYE A;  2E5Q A;  4XQ3 A;  3G6E A;  1N27 A;  5HK3 A;  3M4G A;  1O9S A;  2JNG A;  3HRT A;  2K5L A;  4M7D A;  3M9Q A;  4IUU A;  2RD1 A;  4M75 E;  2DTO A;  2BIV A;  4PL6 A;  5GAO r;  3I55 T;  2DJZ A;  5GAN g;  3JRZ A;  4PKC C;  3GLX A;  5AYF A;  4BY6 C;  4QQ6 A;  1X75 C;  2KMG A;  3JCM g;  1Q86 U;  1QVG A;  3CCE T;  4KUL A;  4C92 C;  2BKD N;  3A8O B;  3N5B B;  1EIF A;  4MMK A;  3V8K A;  2NLU A;  5C0M A;  5LJ3 g;  2R5M A;  4JX5 A;  4C92 F;  1KQ2 A;  2HD0 A;  3OA6 A;  1VQL A;  3JCM P;  3GNG A;  5LJ5 j;  2H3J A;  2ZZD B;  2K4Y A;  2HBP A;  3TEE A;  4LDV A;  5DY9 A;  5CIU A;  3CME A;  2PUK B;  2RA2 A;  5IT9 E;  3EFR A;  2PVG B;  3L1A A;  3JCM V;  4F7U B;  5FU7 B;  4C5H A;  2PVO B;  3QG1 A;  4M7D C;  1VQ7 T;  5GMK i;  3OYC A;  3GIB A;  4F7U E;  5FU7 C;  2EJ9 A;  4NS5 A;  3PFS A;  4J5Y A;  5FRO A;  4IUP A;  4E7J A;  3BG3 A;  1JRI A;  1YI2 A;  3C12 A;  4BI8 B;  2K3X A;  5HY6 A;  4CRI A;  2RHU A;  1W2B A;  1Y96 B;  3GNF B;  5J39 A;  1KQ1 A;  3CCQ A;  1W4S A;  1YJN A;  1YIJ T;  3MP8 A;  4M7A C;  1FX7 A;  4HKE A;  4ZTF A;  3CXC A;  2D9T A;  2QQ9 A;  2K5I A;  4M7A F;  5GAM d;  3Q1J A;  2QI2 A;  3M59 A;  3PMI A;  3UT1 A;  3OYN A;  2XDD A;  2RI3 A;  3KBG A;  3CCV A;  2XG8 D;  4N4I A;  4D6W A;  3JCM Q;  4HL4 A;  2DK3 A;  4OP0 A;  1QP3 A;  4BBR M;  3J81 E;  5CKB A;  3OYI A;  3BG9 A;  2FYK A;  4ZTJ A;  1VQM T;  1KQS S;  2QDY B;  1UGS B;  5CVI A;  2CZ6 B;  1N9R A;  3M55 A;  4M7D D;  4XAX B;  3OYL A;  3L2Q A;  4XTX A;  4E7K A;  3CCS T;  4C92 G;  1B34 B;  1ZHI A;  3WVD B;  4L6V 5;  5GMK m;  3ZBD A;  3NFC A;  5HK0 A;  2G77 A;  1LOJ A;  2RJC A;  3HBL A;  3A5Z B;  4J6X A;  4ZGJ B;  2OTJ A;  3LH0 A;  2F69 A;  3JAM E;  2ZPH B;  1YJ9 A;  4PJO D;  1M8V A;  2XIC A;  3C95 A;  3G71 T;  1K8A C;  4QW2 A;  5GAN f;  3G4S T;  3OSS C;  4HT8 A;  3JB9 J;  1NJI U;  3VYH B;  2LTO A;  3VKI A;  4M7A D;  1FWZ A;  4M78 E;  3F70 A;  4PLL A;  3CC7 T;  2BS2 A;  3T9N A;  1YHQ T;  3DB3 A;  2JOY A;  2M9U A;  3ASK A;  4FIB A;  3SB2 A;  4C0D C;  4EPC A;  3QZ5 B;  5KH6 A;  3JCM d;  1WPY A;  2LDM A;  4X34 A;  3VV0 A;  5CCA A;  3RKW A;  4P5N A;  2RK2 A;  5GMK h;  3CMA T;  3JCM J;  5GAN j;  5FRM A;  3SFM A;  4A4K A;  2RI5 A;  2QFZ A;  2QQ8 A;  2VXE A;  3LGF A;  5GAN h;  1N8R C;  2KY9 A;  3LGL A;  2E1H A;  2P0Q A;  4J7I A;  1I4K 1;  3HL8 A;  1BI1 A;  5J3B A;  1I8F A;  1YJN T;  3HRU A;  4M75 D;  4M7A G;  3OYG A;  1I81 A;  5GAM f;  2F5T X;  5I21 A;  3TU4 K;  1G5V A;  2MWP A;  3L2R A;  2DAQ A;  2XD0 A;  1QLB A;  1M4Z A;  2GFU A;  3FDR A;  1VQ6 A;  2OTJ T;  4ELZ C;  2GFA A;  2E10 A;  3OYF A;  2ZPE B;  1NPR A;  5CKF A;  2X4W A;  4KBM B;  3RMS A;  3CD6 A;  2VUB A;  4TVR A;  4WF2 A;  4A54 A;  3HSB A;  3HB9 A;  1UGP B;  4C92 D;  1QVF A;  2MMP A;  3MP1 A;  4XU1 A;  3VUZ A;  4C8Q B;  5KE2 A;  2EQK A;  3DLM A;  4ZGD B;  4F7U F;  4M7D G;  2L3R A;  3A8H B;  1VQ4 A;  1K8A U;  4LDW A;  3OW2 S;  1G3S A;  4OB2 B;  2E41 A;  3MO8 A;  4IUT A;  3G7Z A;  4NOY A;  5CQX A;  4A4G A;  4M77 B;  5LJ5 d;  3CPW A;  4F7U A;  3CCM T;  3OYM A;  2RJE A;  4QQD A;  2K2V A;  2EQJ A;  1M9S A;  4C8Q G;  2QA4 A;  1WJS A;  3I56 A;  4L59 A;  1MHN A;  3VUB A;  4FL6 A;  5D6W A;  3WVE B;  3E9F A;  3RER A;  4A53 A;  4ZN3 A;  2HNI A;  3O8V A;  4A4F A;  2M1H A;  4RCB A;  1P92 A;  4OF1 A;  5GAM e;  4BDZ A;  4XTW A;  3X20 B;  2LNV A;  2QTX A;  3QII A;  3OYK A;  4E7I A;  4JX6 A;  3UDC A;  1YJW A;  1KHC A;  1G3T A;  2HQX A;  3OQ5 A;  2X4Y A;  2LCC A;  3QUI A;  4JX4 A;  3MHX A;  4E47 A;  2ZGW A;  3FIF A;  3HFO A;  1UB4 A;  1UGR B;  3BDU A;  5GAN 4;  3OYH A;  3VKG A;  2WJ9 A;  3A8M B;  2A3L A;  4NL2 A;  5L8R E;  3JCM h;  4B9W A;  2RHX A;  3DLL A;  1YIJ A;  4IUQ A;  4EMH A;  2I2L A;  4HA8 A;  2O4X B;  2P4T A;  1VQ4 T;  1WQ7 A;  4M78 D;  3SDZ A;  3QSU A;  4BBS M;  1X01 A;  3CCM A;  1Q7Y C;  4LD9 K;  1VQ6 T;  4PJO F;  1M1K U;  3CCV T;  2MF2 A;  4LDX A;  2GQV A;  1TH7 A;  2PQW A;  3PTA A;  2EQM A;  4C0F A;  3QO3 A;  1Q81 C;  3A8G B;  3CBO A;  1G3Y A;  1Y71 A;  3FJP A;  3P8D A;  4JDS A;  2D0Q B;  3OS0 A;  1GXI E;  4M78 C;  4KT0 E;  2QQS A;  2WSC E;  3OS5 A;  5DLQ E;  2LQK A;  3JCM e;  4F7U G;  1AHJ B;  2JUF A;  2EJG A;  3OBY A;  4M7D F;  1PSF A;  3RUX A;  3QKJ A;  2KK4 A;  1VQ5 T;  5GAN e;  4RMO A;  2OTL T;  1VQK T;  4MZP A;  2DXB B;  5A0L A;  1WJR A;  4XU0 A;  3H8Z A;  2K3Y A;  4XU2 A;  3I56 T;  1I5L A;  4HCC A;  3JB9 G;  1N8R U;  4M77 D;  3PIP A;  1IZ6 A;  1D3B B;  4FSX A;  3H4C A;  2CS7 A;  1O75 A;  5GAM h;  1VQ9 T;  3MEA A;  5CO7 A;  3L2V A;  3CC4 A;  4MZT A;  1M1F A;  1B34 A;  2RI2 A;  4BY6 B;  1KG1 A;  4JS5 A;  4Z6Y A;  3VKH A;  3QBY A;  2E6N A;  1UGQ B;  3OS2 A;  1OZ2 A;  3EFS A;  2KVQ G;  5IN1 A;  1FKM A;  5A0D A;  2P0P A;  3BDL A;  2XID A;  5GMK j;  3OYD A;  3RMQ A;  5FU6 B;  2GCX A;  3ZFJ A;  3CCR A;  2P0K A;  1M90 U;  1XOV A;  2V8I A;  1YBY A;  3FC3 A;  3GP8 A;  3SWN A;  2LCL A;  2E65 A;  2LT1 A;  2VGN A;  1X6O A;  3J80 E;  4E7H A;  1QP2 A;  4JRI A;  4GLK A;  3CCU A;  2FB7 A;  1M1K C;  2BUD A;  3V8J A;  5LJ5 e;  4C92 E;  4DA4 A;  2OTL A;  2QQR A;  1JJ2 A;  2DD4 B;  1WGS A;  2BS4 A;  3QDR B;  4HLQ A;  3X25 B;  2E64 A;  4M75 A;  3RIR A;  1Q86 C;  4MZM A;  1Y07 A;  2ZPB B;  2YHT A;  4M78 A;  3MCA B;  1YCY A;  4MFE A;  3M4Y A;  3CCL T;  1BI2 A;  2VV5 A;  1RL2 A;  2HQE A;  3GF5 A;  3LX7 A;  4QQG A;  2EJF A;  2O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...