2ZPBB

Nitrosylated fe-type nitrile hydratase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpbB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpbB02
3WVEB 3A8MB 3A8OB 4RKUE 4OB1B 1GXIE 1UGQB 2CZ7B 3X25B 2PU9B 2DD5B 3WVDB 2DD4B 3LW5E 2ZZDB 3QXEB 4OB3B 4FM4B 4OB0B 2DXCB 3X26B 4OB2B 2PUKB 3A8HB 3VYHB 2CZ1B 3X28B 2PVDB 1UGPB 2ZCFB 2CYZB 2DXBB 1UGRB 4L6V5 3X20B 2AHJB 4ZGJB 2ZPFB 3A8LB 2QDYB 3QZ9B 2D0QB 4ZGDB 1JB0E 2DPPB 1IREB 3A8GB 2ZPBB 2CZ6B 2DXCA 3VYGB 2CZ0B 1QP3A 3QYGB 3HHTB 4Y28E 3QZ5B 2ZPEB 2ZZDA 1V29B 2PUOB 1QP2A 1PSFA 2ZPIB 2DD5A 2PVOB 5L8RE 3VYGA 2DXBA 2O01E 3X24B 2ZPHB 1UGSB 2ZPGB 1PSEA 3QYHB 4XK8E 2WSEE 1DJ7B 2WSFE 4KT0E 1AHJB 2DD4A 2WSCE 4ZGEB 2PVGB
chains in the Genus database with same CATH superfamily
2K5LA 4LNPA 4OMLA 2XI9A 5GAN5 5FU7B 2CP7A 1PKDB 1URCB 2BZXA 1XTDA 2HBPA 2QQAA 1KC8U 4BY6B 4JZ4A 4C0DC 4E7ZA 3G71A 1H26B 2Y4YA 2O4XA 1VQ7T 1PHTA 2DD5B 5HQ0B 4LD9K 5GANj 3QXEB 2JT4A 3O5ZA 2E64A 1M1KC 4CC7A 1IHWA 4R55A 2HQHA 3JAME 1VYWB 1TSFA 1ZBJA 5EJCA 3QJ6A 1Y71A 3A8HB 1C1AA 2VC8A 3TCJA 3CMAQ 4JLIA 3G71Q 5IDPB 2CZ1B 3PIOA 4F7UG 1YITA 2V8IA 5FLXE 1VQMT 4IMYB 5A0LA 1JJ2S 4RG8A 4OR5B 3PFSA 3CCJA 2HKQB 2RI3A 4PJOA 1TFBA 1O75A 1RAGB 1W6XA 4M7DG 4PFOA 2F69A 2E6NA 3GP8A 1IHVA 1TWBA 4ZGJB 2A28A 1NJIC 3C95A 2IW8B 4C0GA 4QW2A 2D9TA 2D0QB 4ZGDB 3HRTA 3L42A 2QA4A 1AD6A 1KJWA 1RABB 2K57A 3QYBA 4AFUC 2BS2A 4A63B 1SSFA 2IVXA 1M2VA 3G6ET 1RL2A 4MDXA 4BCOB 1VOMA 1BK2A 4X1VA 1R77A 2UZLB 3OS2A 3REAB 5FWBA 1VYTA 2MMPA 4BCJB 5LJ3h 2DZ9A 4M75A 4C8QC 1JSUB 2ABLA 1JSTB 4C92C 1UDLA 5GJWB 2DIGA 4MFEA 4XU1A 2ZPGB 2KXCA 1I5OB 4LUDA 4BCMD 5GAOm 2KVQG 2AKKA 3GOXA 2LQ8A 2ROTA 4LDYA 2FRYA 2JXBA 4M7DE 3LWHA 3CCLT 3EGXB 3VUZA 1NJIR 1OKWB 4P5NA 4QVCA 2RJFA 5FRMA 1AWOA 2FZKB 4J6YA 1D3BA 4BXXX 2XIDA 4II5B 3CC7T 1UEBA 1VQ9T 5LMKB 1ZSZA 5LJ3g 1UTIA 3CXCA 2DD4B 4QKUA 2K3XA 3CMEQ 2MCNA 3OYYA 2IN3A 1JU5C 1GRIA 1MGQA 2X3WD 2XK0A 4F16A 1LNXA 4PJOF 1VQ4A 2LT4A 2LRQA 2YUQA 1NEGA 1VQMA 4RTYA 4M7AD 3MEVA 1NLOC 3BHTB 2M0OA 4J5YA 1M5Q1 2KSSA 4BCQD 3FRNA 4I3ZB 2KYBA 3CMET 4ELYC 2M02A 1N9SA 1GUXB 1TU0B 1UB4A 3SWNC 4L59A 4M75D 1ARKA 4CFXB 1YN8A 2HNIA 1WHJA 3LH5A 2QYZA 3RERA 2KI7A 3NFCA 5EC7A 4ORZA 1V76A 4E7JA 1LVKA 4IUVA 4EIKA 1Q81R 3M0SA 2CZ0B 4RTVA 4C8QD 3F5XB 1QVFA 1T0HA 4M77E 5GANd 3OBWA 3MEUA 1JQQA 2X4WA 1QVGS 3HZJA 2QGSA 1B7TA 1ZX6A 2LT1A 3I56Q 4HLQA 2OJ2A 2QAZA 5CQXA 4BUGA 4PJOD 2G9XB 2OX7A 4CFNB 5C0MA 3J7AF 5A0GA 1JOWA 2QQ9A 4FIBA 4KRCB 2FPEA 2HD0A 2BE7D 3QHRB 2RB6A 3QG1A 4JJNK 1Q95G 1QW1A 2PZ1A 2LQKA 2K7AA 2RK1A 8ATCB 1KIKA 2W2HA 3L2RA 2RQWA 4C92E 1FMWA 2J6OA 3JSCA 3JB9H 4OB1B 4C92D 1N27A 1EZZB 2A36A 2CT3A 1LOJA 2CZ7B 3SWNA 4KUDK 2X4YA 1AWWA 1TG0A 4BCMB 3LGLA 3TN8B 2ENMA 1H28B 2K3YA 1QVGA 5EG2A 2AKLA 5CKFA 3CCQA 4FW1A 4E7LA 3N5BB 5CR2A 4M7DA 1VQ7A 1KD1C 4KGVB 1K73R 1B3QA 1X6GA 4D8DA 2XDDA 2NUPB 2KGTA 1I0CA 1HK9A 3FEOA 1H27B 5BNJB 1OIYB 5HK0A 3VS1A 1X01A 2E12A 5GAOl 1R8OB 3OW2A 2DERA 2LC4A 2VYTA 4NL2A 3R6OA 1N4MA 2YUOA 2H3JA 4FYXB 4N4HA 4BE1A 4JDSA 5CKHA 2FPDA 4JX4A 4M75C 1YP5A 1JJ2A 1XQHA 1YITQ 5CEIB 1LPLA 5HK3A 1M1FA 1KC8R 1D0YA 3CCJT 3HB9A 3V7RA 4BCND 1SRLA 2I40B 2DE0X 2DJQA 1W2BS 2F1LA 5DQWA 4RTXA 4E2FB 2HCKA 2KQWA 4M78C 2AIRB 2ED1A 2BS3A 4N4IA 3BE3A 2H3EB 1ZSZB 3M55A 3HHTB 1YITT 2FYKA 3EGDB 1OGUB 1RLPC 2LJ3A 3CBOA 4BBRM 2KYMA 3L2ZA 3NGPA 2A7YA 2DK3A 1PSEA 3QYHB 1QCFA 2MWPA 2EYZA 5FRNA 2VXEA 1UUEA 5IHIA 4AKHA 2R58A 4X9CA 4C5HA 2KY9A 5EFQB 2WSCE 2DD4A 1QKXA 1VQNT 2R57A 5GMKl 5LJ3d 2V8KA 3M56A 1YJWA 3V8KA 1SPKA 3A8OB 3QWYA 3S3MA 2DA9A 2E41A 3I56A 1YJNA 2DF6A 3OYBA 4CFWB 4BE2A 2XICA 1Y7XA 1OYXA 1WQ7A 1E7PA 1VA7A 1BI2A 2HL3A 1K8AR 3FJ5A 4LDWA 3TVTA 1K8AU 2L8DA 1BU2A 2IW6B 4QSHA 3QO3A 4WTOB 3H0FA 2KK4A 3JB9D 2ESWA 2HL5C 3SHWA 2VV5A 4AI6A 4XTXA 3L2WA 1OU9A 2PQWA 1VQ5T 2KDSA 5HBEB 1ZHIA 2VGMA 1UNLD 2UZDB 4LN2A 3OYMA 3VRYA 2DBMA 2KR6A 2WFYB 4B9WA 2YLBA 1GCQC 3C0CA 4PJJA 2KRSA 4FT2A 3CPWA 4ZTFA 2DRKA 1QVPA 1XNIA 3MPUB 4BCPB 4EC9B 4CFMB 1W4SA 3RR6A 2G77A 4JS4A 3J80E 1OI1A 3M9QA 5KYXA 1S1NA 2D8HA 2DPPB 4FYWB 3GIBA 2WEVB 1GL5A 1GCPA 2J6KA 4EOQB 1E7OA 2CREA 1N8RU 3RDVA 4EOMB 3FIFA 2NUTB 1SG5A 1RAAB 2Z0WA 3THKA 4AFZC 2VVKA 3S3OA 3RBBB 3S6WA 2XD0A 1HXDA 3H41A 1VQ6T 2EVRA 5FROA 3E2UA 4XU3A 4M75F 2BTTA 4JJCA 2OTLQ 1TTHB 3TEEA 3POMA 2IIMA 2LX9A 4KT0E 1X43A 2DJZA 3MIAB 2PJQA 4F7JB 4XTVA 4A4HA 4J6WA 1YWPA 4M7DF 1NBEB 5KYYB 4RUGA 2DLPA 1FYNA 1YI2A 2XG8D 2MAMA 1H1PB 3C4SA 3CCVA 3QKJA 1VINA 3EOCB 4CFVB 2QK0A 5I5ZB 1ZUKA 3FB9A 3H6ZA 3CCJQ 1MMNA 2EQUA 1Q82R 3MP8A 2CUDA 2QEXQ 3X26B 1G3NC 4LD6A 1BBZA 2QA4T 3TSZA 2X4XA 1VQOQ 1G3WA 3CCUQ 3X28B 3FLGA 3VJPA 4EMHA 4ELJA 4EOOB 1H641 4CI0C 2FHDA 3JCMQ 3VS6A 4QT7A 1BI1A 3IQLA 3JCMe 1VQ8T 1I07A 1O9KB 2KRMA 2LDMA 2GBQA 4MZMA 4XTWA 3TNHB 4J7IA 2CYZB 1MMGA 3HL8A 1T3LA 1UGRB 1VIFA 3CBPA 4KULA 3CCMQ 2OTJT 3V8LA 1HD3A 3EFSA 1ABQA 3CCSA 2V26A 2LCSA 4MDWA 1KK7A 4M75E 4EMKA 1M2OA 3AHUA 4IUUA 5GMKm 1Q82C 1KG1A 2HDAA 1YHQQ 3BHVB 1I4K1 4PKCC 3M03A 3HKSA 3TNWB 3VUBA 2R7GA 4EOKB 1C0MA 2K2MA 4BDYA 3CC4A 3RMSA 3CCRQ 2M9UA 2RHZA 3LX7A 1V29B 1KXUA 1K8AC 3L2QA 1GH6B 3G1JA 3VYGA 1RI9A 4A4GA 2LMJA 4A4EA 1WPYA 1V1CA 1PCXA 3CC4Q 2EGCA 3VS3A 4J9IA 2A0FB 2GFUA 3ZEHA 5LQFB 3V8JA 3B57A 4KH0B 3MJXA 1UJ0A 3BLRB 2LZ6B 3DB4A 1TD6A 2PVGB 4YC3B 2I0NA 4Q5WA 4NOYA 3VS4A 3A8MB 5IH2A 3CCVT 4LDUA 1WHGA 3L1AA 5GAN4 1BYMA 5CAIA 4AKGA 5GAOp 5CKEA 4HCKA 2LP5A 5CYIB 4HVVA 1D1AA 2SEMA 2K6DA 4M77A 3NPFA 3H4CA 5IAYA 2XDBA 2GGRA 3E19A 3MCAB 4FT4A 2RHUA 1M1GA 4J8OA 1UG1A 3FC3A 4PJOB 1VQPA 2DX1A 2KE9A 2YXYA 3E1SA 4OMQA 4EOLB 4ME7A 3J81E 4EOSB 3URGA 5GJVB 2X1NB 1IZ6A 2RHXA 3DDPB 1YWOA 5KCOA 4C8QB 1ZUYA 2OTJA 5GANf 2EJFA 2BUDA 1VQ5A 3QBYA 3EIDB 1Q7YR 2PTKA 4J9HA 3X20B 3MHXA 1VQ9Q 4ELLA 4E6RA 4NSTB 2QGFB 2NUTA 1YJNT 2CP5A 2P0QA 4C5IA 3NTHA 1O9SA 1VQ4T 3CCEQ 5GMKh 2FB7A 2F2XA 1UGVA 3VS2A 2ZAEA 1YIJA 4JLGA 5KYUA 4BCGB 3LQ5B 1QVFP 3GTMS 3QUIA 4HCCA 4F7UF 2B8AA 4F7UB 2UZEB 1M90C 2EYXA 5GAMe 2DETA 4R56A 3QHWB 1TXQA 3CCMA 4NC6A 3GNFB 4G6LB 2V1QA 4LXCA 2IG0A 2C0OA 1WNLA 5GAN7 1H3HA 1WJQA 1YBYA 4J9FA 2BS4A 3X24B 2M16A 4DA4A 1H92A 2GQIA 1AVZC 3PIPA 1ZA2B 3CC7Q 3BY7A 4PJLA 4M78D 2JMCA 1WXBA 2KMGA 4GLKA 1K0XA 2C5VB 3CCRA 1I5LA 2K79A 1Q86U 1MNDA 2MK5A 2EJ9A 3M4YA 3MKDA 3CCLQ 4M77G 2O9VA 4BCIB 5FU7C 5IDNB 2D6FA 3EFRA 3OS0A 4Y92A 1D1BA 1KFZA 1W98B 4M7AE 1J3TA 3BLQB 2RJDA 2DEQA 2PK2A 2CP6A 1OOTA 4OB0B 1JRIA 2EYYA 1M3AA 1WXUA 1Y0MA 2BKDN 3E9GA 3QIIA 4CRLB 1K9MU 3QSUA 1YJ9A 4IKFA 2WACA 1KD1R 1OX8A 3JCMc 2M1HA 2GFAA 3NMZC 2L3RA 2YHTA 4MFDA 4PNOA 3I5SA 2C5NB 5LJ5j 3FJPA 1UFFA 2COYA 4F6SB 3TQ7P 4RTWA 1VQOA 1K0SA 2HSPA 5J26A 2K4YA 3JCMf 3NHNA 1WLPB 2DAQA 4BD3A 2DFUA 2RA2A 4HL4A 3MY1B 2KT8A 3EG2A 3CCST 2VB6A 3CC7A 4N0AA 4MZTA 2JJ9A 2CP3A 3VKIA 2QQ8A 4DEYA 4KGXB 1X27A 1C9BA 1GY3B 3ME9A 4M4ZA 2ZZDA 2PUOB 1M8MA 1JXMA 1OX9A 2X35A 3LLRA 1FWZA 2RQVA 2DL7A 2DXBA 3HRSA 2Y90A 4CFUB 2ZPHB 2WJ9A 2EYQA 3MEWA 4M7DC 4JS5A 2QQSA 2YUPA 4F6UB 3BG3A 4FYYB 1RUWA 1WDXA 3M57A 4J6XA 4J9CA 1BIAA 2NUZA 3REBB 1RACB 2HKNA 1WHLA 1M4ZA 4BE0A 5CVIA 5HBHB 2C5OB 4M78A 4FX3B 4PJMA 4C92F 5A0DA 2DL3A 2O31A 3QDRB 3MO8A 3DLMA 1D0ZA 5FGKB 5GAMf 2I53A 1WQWA 3TU4K 1K73U 2L2PA 5LJ3f 4ATOA 2CGHA 2RPNA 4JRKA 3QJYA 2GF7A 3VU3C 2WXVB 2DEUA 4F7UE 1WHHA 3OYJA 1VQNA 1M8VA 3LGFA 4Z88A 4M7AC 1SF9A 4Z8AA 4QQ6A 3AT1B 1H4LD 4AFQC 1VOLA 3I56T 1BI3A 2C6TB 1VQPT 1NEBA 4E47A 5IN1A 3UWNA 2X51A 1AD5A 1W2BA 4M77F 3RKWA 2PMIB 3M54A 1KHCA 3SD4A 3HBLA 4K11A 3BG5A 3HFOA 2EYWA 3CBMA 2F5TX 2QDLA 2CKKA 3OYAA 2J05A 3A8LB 3A5ZB 1AWXA 3JV3A 2W99A 2LQNA 4OP0A 2JNGA 1D1CA 4M7AG 4ANJA 4MZPA 2BE9B 3I55T 5GMKj 2LJ0A 1NYFA 4HXJA 3LWIA 2EFIA 2OTLA 4BB7A 3QYGB 3HSBA 2UZBB 2DL5A 2LQWA 2LCLA 2X9HA 3SEMA 1OQKA 2EGEA 3CCQT 5D6YA 1OZ2A 3DB3A 4V2SA 4JJDA 1EX4A 5HY6A 1K76A 4PJOG 1HJDA 2P4RA 2ED0A 3JB9F 1S72T 4FL6A 4HCBA 2EW3A 3O8VA 4CRIA 3CCMT 3SDZA 4FYVB 1DJ7B 2NLUA 2WSFE 1VQPQ 2DYIA 1N6AA 5GANh 2OAUA 4HT9A 2OI3A 2JGZB 5CCAA 3EG9A 3T9NA 2CJMB 3I5RA 1CSKA 1KQSP 4RKUE 3MI9B 1F1BB 4F17A 2DL8A 2BZ8A 3TSWA 2WMBB 2FL7A 4C0DB 4BY6C 2LX7A 2LCCA 1BI0A 1O9KA 1Y57A 4E7HA 2B86A 1NZ9A 2EQKA 2K9GA 4C0ZA 3HRUA 2NYSA 4OB3B 2SRCA 2QFZA 3CCRT 1SKUB 4DEXA 4EMKB 2DXCB 3I9QA 3OYCA 1ZUUA 4OB2B 1QWFA 4JUVA 5GMKi 2KR3A 5GAN8 3OYEA 1F5QB 3KHIA 5L23A 3CCSQ 4NL3A 4LDVA 1KQSS 5IXBA 3H0IA 2RNAA 5ACBA 5DQVA 2PVDB 1N8RR 2KEAA 2YRCA 3GBQA 3OSSC 5IHNA 1B34A 1FVVB 4XU2A 4QQGA 2QEXA 3GPLA 1U5SA 4DBHA 3BDUA 4XTUA 3CMEA 1AEYA 2QI2A 2O9SA 3P8HA 4M77B 2BZYA 3QWXX 5GAMd 2DYBA 3NTKA 1T3SA 4JX6A 2K2VA 1YJWT 3EJ1B 4KUIA 4C8QF 1H25B 4F7UA 2OAWA 4N0AC 4AFSC 2DXTA 1VQOT 5DM7R 4DBRA 1PD1A 4II1A 5ECAA 1QP3A 3KFVA 4QVDA 2P0PA 2L3SA 1WIEA 2COWA 2CUBA 4CC3A 2DTHA 4RG2A 1QWEA 3RGFB 1VQ5Q 1K73C 3QYEA 1BB9A 3L2VA 1K4US 4ELZC 2ZPIB 2PVOB 4GY5A 3M0PA 1G3SA 4ESRA 1UHCA 4BY1X 4JRIA 4Y91A 5LJ3j 4Z6YA 1P5EB 1WJSA 3RKYA 5KYUB 2CT4A 5LJ5h 1IRXA 3BG9A 2XDPA 1AHJB 4Z89A 3MY5B 3CCQQ 4KH1B 1MV3A 2KNBB 2JZ2A 3RIRA 1Q81U 4Y72B 1OU8A 1UNGD 2HBWA 1XOVA 4C8QA 5LJ5f 5HNBB 1X2QA 1OL2B 3RKXA 2HZYA 2PU9B 2EGAA 1R0BG 2WIHB 1G2BA 1GBQA 4DOWA 3LW5E 1H3ZA 1ZP2A 2AZSA 2DO3A 3JB9G 3JCMg 3SB2A 1ZSGA 1D3BB 2DZCA 2PUKB 1KD1U 4EOIB 4MIMA 2DL4A 5HVYB 2EJGA 1BIBA 4OF1A 3OA6A 1YI2Q 4KRDB 3PMTA 3CD6Q 1NPRA 2QEXT 1R0CB 2MIOA 4J9DA 1QCOA 1EFNA 2VUBA 2C4GB 1G5VA 2A08A 2C5XB 4XAXB 4M7AA 4N4GA 2FRWA 1XJWB 4RCCA 2CSIA 4E7IA 2C06A 4B9XA 3OY9A 3OW2S 5DLOA 5A2QE 1VQNQ 1H1SB 2DMEA 3OS5A 2ZPFB 3OYNA 4E7KA 1I8FA 4MMLA 3PGGA 3DL1A 4Z02A 3G4SA 1YCYA 2ZPBB 4MMKA 4OGRB 1OEBA 2E5QA 1VQ6A 3EG3A 2YRVA 3LYIA 3CXCS 2KBTA 5GAMj 3OYDA 1W70A 4BI3A 2IW9B 1YFNA 4GLMA 2EBPA 3QZ5B 3RMQA 3MP6A 3OW2P 4TVRA 2RHIA 4BCQB 1PSFA 2RMOA 2DD5A 4AT1B 1NYGA 5I11A 3I35A 2CDTA 1X75C 4OMNA 3I55A 1SRMA 3BDLA 4VUBA 2G3RA 3SFMA 3C94A 4AG1C 3CPWS 3VKHA 3CCLA 1TUCA 3JCMJ 1VQKA 4ZTJA 1M1KR 2VXFA 2JTMA 1VQ4Q 1I81A 2GCXA 1Q86C 1WFWA 1H24B 2YRDA 4A53A 2RN8A 5D6XA 2VGNA 1ZBXA 8AT1B 5IF1B 3INZA 2D1XA 2MF2A 2HQXA 4F6WB 3CD6A 2DVJA 5IXFA 4EOPB 1IB8A 1U3OA 5HKCA 2RF0A 2X3XD 1M90U 1NG2A 3CC2A 5CIUA 4QVZA 2VASA 2X4JA 3EFOA 1VUBA 3VRZA 4BCFB 4B6MA 2E3HA 4AG2C 5GAOr 1WHKA 4M7AF 4ZN3A 1VYVA 3TW7A 2DM1A 4YTLA 1RAHB 4FSXA 3HP9A 1X2KA 2HQEA 1Z9ZA 4PFPA 3OYKA 4BCKB 1YHQT 4CC4B 1NM7A 4HA8A 1NPPA 1D0XA 1WYXA 4DBQA 3EG1A 1H1QB 3UF4A 5DLQE 2DIQA 2FPFA 3CCUA 4M78F 1U1TA 2PNIA 3CQTA 3GNGA 3G71T 2J06A 1Q7YC 2K5IA 2KAFA 3JRZA 3M5AA 3OBYA 2FEIA 1WI7A 2BPMB 3TW6A 3UATA 2JM8A 2QG9B 5J3BA 1P92A 3EG0A 5LJ5d 5D6WA 4JRPA 3LH0A 2EAYA 1WZOA 4OMOA 5KYWB 3EHRA 4Y28E 1G8XA 2DNUA 5GAN2 2JS0A 2W9FA 5GAMh 4OGEA 1Q82U 2QA4Q 1GBRA 2WIPB 5GANg 1Q7YU 1BCMA 5FU6C 5IHKA 1OPKA 3DJBA 4A54A 1VQKT 4OVAA 1IGUA 1SEMA 1UGSB 5LJ3e 5AT1B 4PJOC 1I1JA 2JVVA 4M78E 2NUPA 4DOVA 4M78G 1KQ1A 5I21A 3UPUA 1SHGA 1ZLMA 4UN0A 1Z9QA 5GAOn 4CXAB 1VQLQ 3DKMA 1NJIU 3WVEB 3A98A 1AWJA 3E9FA 3PT9A 1YCSB 1Y96B 1A0NB 1TS9A 1KSWA 2E10A 2DRMA 3EG9B 3JCMd 1OL1B 7AT1B 4J9EA 4OMFB 3H9NA 3I55Q 3UA7A 2EQMA 1UHFA 3V7SA 3JB9J 2ZZDB 1TUGB 5LJ5e 3G6EQ 1BKBA 2UUEB 2HMAA 4HCZA 5J39A 2W96A 2V22B 2LVMA 2RQTA 3VS5A 5AYFA 4EMGA 1K9AA 3R6NA 3META 1VQ9A 3DTOA 1PD0A 2KRNA 2RQUA 2JMAA 1PKTA 2VKNA 1Q86R 1G3TA 1UGPB 3G4SQ 2R5MA 4R0KA 3PE0A 1ZSZC 4CFUD 2ZCFB 1YIJT 4BI4A 1VQ8A 1MNEA 1X6OA 5CKBA 2AHJB 4LDXA 5HBJB 4M77D 1WXTA 3KXTA 2LNVA 1YJ9Q 1HSQA 1W1FA 1IREB 2BKZB 4M6VA 4X34A 1M90R 4HNVA 5I2SA 1BCOA 1QMCA 2IVWA 3HO8A 2RJCA 1VQLA 1AZEA 1N8RC 2P4TA 1JJ2P 1OULA 2B9RA 3F70A 1KQSA 2JN0A 3EFOB 2FG0A 4KRTA 3SWNB 2O2OA 4BI8B 3P8DA 3CPFA 2L0AA 5L8RE 1IGQA 3JCMb 1AT1B 5KYYA 5LL6S 3CXCP 1LJOA 1M3BA 2RM4A 3OYGA 3TREA 1BU1A 4YOOA 4BCNB 1RAFB 1FKMA 4F7LB 4A4FA 2JUFA 2AT1B 4M7DD 4YOZA 1ENWA 2C0IA 2JTEA 1E6GA 2VWFA 2MWOA 3H8ZA 2YSQA 1GXIE 2EUFA 4PLIA 2E4HA 1U06A 3OS1A 2F2CA 1YJ9T 2RI2A 2ROLA 1UNHD 3EGXA 4J9BA 2CP0A 5GANe 5KH6A 4C0FA 1M9SA 1M2VB 2HEQA 1T0JA 4D8KA 2HAXA 3VYHB 2D8JA 4F70B 3PVLA 5CKDA 4HNTA 1HYOA 3UT1A 2EIFA 1OPLA 2FZGB 1PG5B 2E3IA 1UJYA 2BIVA 2P0KA 4HVWA 5GMKe 1ZQ1A 2C0TA 5FW9A 2RHYA 2P84A 1RI0A 2RJEA 4IUQA 2WMAB 2WHBB 3EGUA 4HVUA 5LJ5g 1UE9A 4C92A 5GAN6 2DKGA 4J83A 5IHYA 1IO6A 2K5FA 4O6JA 4GBQA 2DXCA 3M0QA 1Y96A 3VYGB 2EQJA 2R5AA 1WGSA 4X9DA 1W2BP 1E9HB 2A3LA 2PHGA 5CQYA 1X69A 2K3BA 4ZNXA 5KCHA 5I2MA 4IIOA 1YHQA 3BHUB 2JOYA 4A4KA 2F5KA 2DMOA 4C8QE 2J7IA 3JCMh 2QDJA 1CKAA 4LE9A 3M53A 4HKEA 6AT1B 3UDCA 3Q1JA 2JTFA 2XHCA 5FWCA 3UA6A 4BDZA 2MPXC 5D7UA 4PJOE 1E6HA 2E70A 2LNHB 3CMAA 3HFNA 3KUFA 1EIFA 1GUXA 2V1RA 2QASA 4PFZA 4RCBA 3TNIB 4FSSA 4RTZA 1UGQB 2HSEB 3FDRA 3L2UA 1NLPC 4EONB 2CH4W 4FU6A 2DTOA 1JEGA 5I22A 1M1KU 3WVDB 4BY7X 2XKOC 1OKVB 4JZ3A 4FW2A 3PO3S 2LJ1A 2FO0A 3RESA 1N5ZA 1MV0B 3BW1A 2KT1A 3S3NA 5CK9A 1QVFS 1G83A 5ICPB 2QXFA 3VKGA 3EAEA 5GAOq 5FU6B 3ZFJA 3CCEA 2GTJA 4ROCA 2M0YA 3PNWC 2W0ZA 3ULRB 4ZN1A 2W9ZA 3NDQA 3OYLA 3M4GA 4M78B 4NS5A 2LTOA 1KC8C 4JX5A 2F2VA 2WPAB 3M0TA 5C6SA 2CSQA 2IPOB 1OIUB 1QMZB 2RI5A 3QZ9B 1JB0E 3QHSA 4XU0A 4HNUA 3A8GB 4AKIA 2E65A 3ASKA 2QQBA 5KE3A 2EWNA 5GAN3 3OYFA 3JCMV 2KROA 3M59A 4M75B 1K9MR 2GTOA 1S72A 3CD6T 1WA7A 3OSVA 1QQJA 3OQ5A 2DVEA 1SHFA 1PC0A 1MUZA 1MHNA 3MP1A 1G3YA 3OYHA 2QF7A 1PRMC 1FXXA 3CC2T 3C12A 3PVQA 3VS0A 4M7DB 1X6BA 4M7AB 4OGCA 1TOVA 1VYUA 2DILA 3QPHA 4C5GA 2EKHA 4XK8E 4JPBW 2CS7A 1WJRA 2H8HA 4JRQA 2EPDA 2CCHB 2YWWA 3U23A 4J7FA 2MOXA 4CC2A 1PWTA 4BACA 4YOSA 1GCQA 3PMIA 4J9GA 1AISB 2NWMA 3M0RA 1PM3A 2FVUA 2M51A 3X25B 4LOCA 2J6FA 2JS2A 1ACMB 5IT9E 1B07A 1VQ8Q 4IUPA 4EDUA 3PTAA 5HCKA 1K1ZA 1TUDA 1M27C 3V7CA 3ZBDA 2W10A 4EOJB 1KQ2A 4LUEA 1B34B 2ATCB 1YNZA 2JM9A 5L2WB 1Q81C 3GLXA 2QTXA 1H8KA 4JJBA 2L3QA 4C92B 2YUNA 2YLCA 4KGZB 2JW4A 1RLQC 1FMKA 4XQ3A 2A37A 1C6VX 3ER0A 4PLLA 3EH1A 1M30A 4EC8B 1YI2T 1JO8A 3O0GD 3G6EA 2ECZA 4HT8A 1RAIB 4C5EA 2L89A 2GNCA 3JCMW 1LCKA 1PRLC 2PK9B 4F04B 2ZGWA 1D09B 2MI6A 4EPCA 2L3PA 2CZ6B 1JXOA 2YT6A 1IXDA 4OMPA 3K7AM 1FINB 3DLLA 2YDLA 1FMVA 2O4XB 2GQVA 1QKWA 3QWLA 5KE2A 2KMTA 5KYXB 1CKBA 3NTIA 4ROEA 2ZPEB 2OTLT 1QCNA 1QP2A 2D0NA 3VV0A 1YJWQ 3CCVQ 1GFDA 3CCUT 1U8RA 2CCIB 5CO7A 3RNJA 3BFMA 2O01E 1AZGB 1QLBA 1N9RA 3H0HA 4WF2A 1U1SA 4F14A 2DXUA 1OZ3A 1OV3A 1YIJQ 4TTHA 2EQIA 3DOGB 1D3UB 3WXMB 3ZL7C 3DDQB 4QQDA 4PL6A 4XTZA 4UC4A 4ZGEB 3RUXA 4OMMA 4EMKC 1QVGP 2E6ZA 3OB9A 9ATCB 3OMCA 4BCHB 1ABOA 4DQ2A 3CEYA 1K9MC 2V8JA 1JBMA 1MMAA 1SSHA 2CH4A 1PKSA 5M9OA 2QQRA 3CC4T 2CP2A 2QGGA 2I2LA 4PK4A 4D6WA 3G4ST 5GAMg 3JCMX 2RD1A 4FM4B 2Y4XA 3G7ZA 4C8QG 3M58A 1UECA 2RO0A 2RK2A 3M0UA 1YJNQ 1Y07A 1NE8A 2XU8A 4BBSM 4DBFA 1FX7A 4XTYA 3JCMP 3A1PA 4KBMB 3VS7A 3D7SB 2RH2A 1VQLT 2DBKA 1RADB 2E1HA 1RAEB 1WHMA 4PJNA 2RQRA 3CMAT 5DY9A 1AOJA 4M75G 2O88A 3CC2Q 2DXBB 1PNJA 3BLHB 1VIEA 1XO2A 2COZA 3OYIA 1H1RB 2LW4A 3P8BB 3KBGA 1VQ6Q 1VQMQ 4L6V5 1S72Q 4F7NB 1QLYA 2G6FX 4IIMA 2FZCB 1WX6A 3HTRA 4E7SA 1MMDA 5KYWA 2QDYB 1VQ7Q 4RTUA 1GFCA 2OTJQ 4C92G 2E5KA 3HPWA 4M77C 1TH7A 2EKOA 3EGDA 2XMFA 4O5VA 3JB9I 4WCIA 4RODA 5KYNA 1VQKQ 2AZVA 3G33B 1ZA1B 4FCYA 4EORB 4IURA 3CPWP 2L5QA 2AK5A 3CCET 2KXDA 3MEAA 1KHIA 3OMGA 2MYSA 3EHQA 3QDFA 2QTVA 1M3CA 2DTIA 4IUTA 1JKWA 1OI9B 3GF5A 2F2WA 4F7SB 2WSEE 3EH2A 4RTTA 4AMCA 4L5GA 4RMOA
chains in the Genus database with same CATH topology
4M7DF 2K5LA 2XI9A 5GAN5 5FU7B 4RKUE 1YI2A 2XG8D 2MAMA 2MWOA 3H8ZA 1XTDA 2HBPA 2QQAA 1KC8U 1GXIE 2FL7A 4BY6B 4BY6C 4PLIA 4C0DB 4C0DC 3G71A 2LCCA 3OS1A 1BI0A 3C4SA 2Y4YA 2O4XA 3CCVA 1YJ9T 1VQ7T 4E7HA 3QKJA 2DD5B 1NZ9A 2RI2A 2EQKA 4C0ZA 4LD9K 3HRUA 5GANj 5GANe 3FB9A 3H6ZA 3QXEB 4OB3B 2EQUA 2QFZA 4C0FA 5KH6A 3CCRT 3MP8A 2E64A 1M9SA 1M1KC 4EMKB 2DXCB 3OYCA 3X26B 4R55A 4LD6A 3JAME 4OB2B 5EJCA 3QJ6A 1Y71A 2QA4T 5GMKi 3A8HB 4JUVA 3OYEA 5GAN8 2VC8A 3TCJA 2X4XA 4JLIA 3KHIA 3VYHB 2CZ1B 1G3WA 4LDVA 4NL3A 3PIOA 1KQSS 4F7UG 1YITA 2V8IA 5CKDA 3X28B 2PVDB 3FLGA 3VJPA 5FLXE 4HNTA 4EMHA 1VQMT 4ELJA 3UT1A 5A0LA 1JJ2S 2EIFA 3OSSC 4RG8A 1H641 4CI0C 2FHDA 3JCMQ 1B34A 3PFSA 4XU2A 3CCJA 1BI1A 4QQGA 3JCMe 2P0KA 2BIVA 1VQ8T 2QEXA 2LDMA 4MZMA 3GPLA 4XTWA 2RI3A 4PJOA 5GMKe 1ZQ1A 4J7IA 2CYZB 3BDUA 1O75A 1VIFA 1UGRB 3HL8A 3CBPA 4KULA 4XTUA 3CMEA 4M7DG 2OTJT 2RHYA 2RJEA 1RI0A 2F69A 2QI2A 2E6NA 3EFSA 4IUQA 3V8LA 3GP8A 3CCSA 3P8HA 4M77B 4ZGJB 4MDWA 5GAMd 4M75E 4EMKA 5LJ5g 1NJIC 3C95A 3AHUA 3NTKA 4C92A 4JX6A 2K2VA 2D9TA 4QW2A 2D0QB 4ZGDB 3HRTA 4IUUA 4KUIA 2DKGA 3L42A 5GAN6 4C8QF 5GMKm 2QA4A 4J83A 1KG1A 4F7UA 4N0AC 2K5FA 2K57A 3QYBA 1I4K1 4O6JA 2DXTA 2BS2A 2DXCA 1Y96A 1SSFA 4PKCC 1VQOT 3VYGB 2EQJA 3HKSA 5DM7R 1RL2A 2R5AA 3G6ET 4MDXA 3VUBA 1WGSA 4II1A 4X9DA 1QP3A 4BDYA 3CC4A 4QVDA 2A3LA 3OS2A 2P0PA 3RMSA 2MMPA 5LJ3h 2M9UA 2DTHA 2DZ9A 2RHZA 3LX7A 4M75A 4RG2A 1V29B 5CQYA 4C8QC 1K73C 3QYEA 5KCHA 5I2MA 1YHQA 3L2VA 1K8AC 2JOYA 4ELZC 2ZPIB 2PVOB 3L2QA 4GY5A 4A4KA 2F5KA 4C8QE 1G3SA 3JCMh 3VYGA 4C92C 2QDJA 4JRIA 4A4GA 4Y91A 2DIGA 3M53A 4MFEA 4Z6YA 4HKEA 4XU1A 2ZPGB 1WJSA 1WPYA 3UDCA 3Q1JA 2JTFA 2XHCA 2KVQG 5GAOm 3RKYA 3GOXA 2LQ8A 4LDYA 4BDZA 2GFUA 4M7DE 3ZEHA 5LJ5h 3V8JA 3LWHA 2XDPA 3BG9A 3CCLT 1AHJB 4PJOE 3DB4A 2E70A 3VUZA 3CMAA 3HFNA 2JZ2A 3KUFA 2PVGB 1EIFA 4Q5WA 4P5NA 3RIRA 1Q82C 4NOYA 4QVCA 2RJFA 1Q81U 3A8MB 4RCBA 5FRMA 5LJ5f 3CCVT 1XOVA 4C8QA 4J6YA 4LDUA 1D3BA 3L1AA 5GAN4 2XIDA 1UGQB 1BYMA 5CAIA 3FDRA 3L2UA 4AKGA 5GAOp 3CC7T 3RKXA 1UEBA 4FU6A 2DTOA 2PU9B 1VQ9T 5CKEA 5LJ3g 3CXCA 1M1KU 4DOWA 3WVDB 2DD4B 1VQ4A 3LW5E 2K3XA 2XKOC 1H3ZA 3OYYA 4M77A 5IAYA 3H4CA 1MGQA 2XK0A 2XDBA 2DO3A 1LNXA 3E19A 4PJOF 3RESA 3JB9G 3MCAB 4FT4A 2LT4A 2LRQA 2RHUA 1M1GA 4J8OA 3JCMg 3SB2A 3FC3A 3BW1A 4PJOB 1D3BB 2DZCA 1VQPA 2PUKB 1KD1U 3S3NA 4MIMA 5CK9A 3E1SA 1VQMA 1QVFS 4ME7A 3J81E 4M7AD 2QXFA 3URGA 3VKGA 2EJGA 1BIBA 3EAEA 3MEVA 4OF1A 1IZ6A 2RHXA 5GAOq 3OA6A 5FU6B 2M0OA 4J5YA 1M5Q1 2KSSA 3PMTA 3ZFJA 5KCOA 1NPRA 3FRNA 2QEXT 3CCEA 4C8QB 3PNWC 3CMET 2VUBA 4ZN1A 2OTJA 4ELYC 5GANf 1N9SA 2EJFA 1G5VA 1UB4A 3SWNC 2BUDA 4XAXB 3OYLA 4M7AA 3M4GA 4N4GA 4L59A 4M78B 1VQ5A 3QBYA 4NS5A 2LTOA 4RCCA 4E7IA 4M75D 1KC8C 4JX5A 2C06A 4B9XA 3X20B 3MHXA 3OY9A 2HNIA 3OW2S 5DLOA 5A2QE 5C6SA 1YJNT 2P0QA 4C5IA 3NTHA 3OS5A 2ZPFB 3OYNA 4E7KA 1O9SA 1VQ4T 1I8FA 4MMLA 2RI5A 3PGGA 3QZ9B 5GMKh 1JB0E 2FB7A 3QHSA 4XU0A 4HNUA 3DL1A 4Z02A 3A8GB 4AKIA 3G4SA 2E65A 1YCYA 3RERA 1YIJA 2ZPBB 4JLGA 3ASKA 3NFCA 2QQBA 4MMKA 5LJ3j 5KE3A 2EWNA 5GAN3 3QUIA 3OYFA 3JCMV 4HCCA 2E5QA 4F7UF 4E7JA 3M59A 4M75B 1VQ6A 4IUVA 2YRVA 2CZ0B 2B8AA 3LYIA 4C8QD 4F7UB 3CXCS 1QVFA 1M90C 4M77E 1S72A 5GANd 5GAMj 3OYDA 3CC4T 3CD6T 5GAMe 3OBWA 3OSVA 4BI3A 3MEUA 4R56A 3OQ5A 2X4WA 3CCMA 3QZ5B 1QVGS 4NC6A 2DVEA 3GNFB 3HZJA 3RMQA 3MP6A 2LT1A 2IG0A 1MHNA 3MP1A 4HLQA 1G3YA 4TVRA 2RHIA 1PSFA 1WNLA 5CQXA 2QF7A 4BUGA 5GAN7 1FXXA 2DD5A 1WJQA 3CC2T 3C12A 4PJOD 1X75C 3I55A 1YBYA 2BS4A 3BDLA 4M7DB 4VUBA 4M7AB 2G3RA 4OGCA 3X24B 3C94A 3SFMA 5C0MA 2M16A 3CPWS 3QPHA 3J7AF 5A0GA 3VKHA 2QQ9A 4XK8E 4C5GA 4FIBA 4DA4A 2HD0A 3JCMJ 3CCLA 2RB6A 1VQKA 3QG1A 4ZTJA 2VXFA 2JTMA 4JJNK 1I81A 2CS7A 3PIPA 1WJRA 2GCXA 1QW1A 4JRQA 1Q86C 2LQKA 3BY7A 2RK1A 4M78D 4A53A 3L2RA 5D6XA 2KMGA 4GLKA 4J7FA 2VGNA 1ZBXA 4C92E 3CCRA 3INZA 1I5LA 3JSCA 2MF2A 3JB9H 4BACA 2HQXA 1Q86U 3CD6A 3PMIA 4OB1B 4C92D 1N27A 2EJ9A 3M4YA 1LOJA 2CZ7B 5HKCA 3SWNA 4KUDK 2FVUA 4M77G 3X25B 2X4YA 4LOCA 1M90U 2D6FA 5FU7C 5IT9E 3EFRA 3OS0A 3CC2A 5CIUA 4QVZA 4M7AE 3LGLA 2RJDA 2DEQA 2K3YA 2X4JA 1QVGA 4IUPA 1VUBA 5EG2A 4EDUA 4OB0B 5CKFA 3PTAA 1JRIA 3CCQA 5GAOr 2BKDN 3E9GA 3QIIA 3V7CA 3N5BB 5CR2A 4E7LA 1K9MU 3QSUA 3ZBDA 4ZN3A 4M7DA 4M7AF 3TW7A 4YTLA 1YJ9A 1VQ7A 4IKFA 1KQ2A 1B34B 1KD1C 2WACA 4M7DD 4FSXA 3HP9A 2HQEA 2XDDA 3OYKA 3GLXA 1Q81C 1YHQT 1HK9A 2QTXA 3JCMc 3FEOA 2M1HA 4C92B 2GFAA 2YLCA 5HK0A 4HA8A 1X01A 1NPPA 2E12A 2L3RA 4MFDA 2YHTA 4PNOA 4XQ3A 5GAOl 1R8OB 3OW2A 5LJ5j 2LC4A 2VYTA 3ER0A 3FJPA 4NL2A 3R6OA 4PLLA 2H3JA 4BE1A 4N4HA 4JDSA 5CKHA 1YI2T 5DLQE 4JX4A 4M75C 1VQOA 2DIQA 3G6EA 3CCUA 1XQHA 4M78F 1JJ2A 4HT8A 5J26A 1U1TA 4C5EA 3GNGA 3G71T 5HK3A 2K4YA 1M1FA 3JCMf 1Q7YC 2L89A 2K5IA 3CCJT 3JCMW 3HB9A 2KAFA 3V7RA 3JRZA 3M5AA 2DAQA 3OBYA 4BD3A 2ZGWA 1W2BS 2RA2A 2MI6A 3TW6A 4EPCA 2CZ6B 4HL4A 5J3BA 2HAXA 3CCST 1P92A 3DLLA 3CC7A 2KQWA 4M78C 5LJ5d 5D6WA 2O4XB 2GQVA 4N0AA 2BS3A 4MZTA 4N4IA 4JRPA 3LH0A 3QWLA 2EAYA 3VKIA 2QQ8A 3M55A 3HHTB 5KE2A 2KMTA 4Y28E 2FYKA 1YITT 5GAN2 3ME9A 3NTIA 2ZPEB 2ZZDA 2PUOB 2OTLT 5GAMh 1QP2A 4OGEA 1Q82U 2X35A 3VV0A 3CBOA 5GANg 1Q7YU 4BBRM 5FU6C 3CCUT 1U8RA 3LLRA 1FWZA 3L2ZA 5CO7A 4A54A 3BFMA 2DXBA 3HRSA 1VQKT 2Y90A 2O01E 1QLBA 1N9RA 4OVAA 2ZPHB 2DK3A 2WJ9A 1UGSB 2A7YA 1PSEA 4WF2A 3QYHB 2MWPA 1U1SA 2DXUA 2EYQA 5LJ3e 1OZ3A 5FRNA 3MEWA 4PJOC 4M7DC 4JS5A 2VXEA 2JVVA 4M78E 2QQSA 4AKHA 3WXMB 4DOVA 2R58A 3BG3A 1KQ1A 4M78G 4QQDA 4X9CA 2KY9A 4PL6A 4C5HA 5I21A 3UPUA 4XTZA 2DD4A 2WSCE 4ZGEB 4UC4A 3M57A 4J6XA 3RUXA 2R57A 5GAOn 5GMKl 1VQNT 1BIAA 3DKMA 5LJ3d 2V8KA 3M56A 4EMKC 1NJIU 3WVEB 1YJWA 3V8KA 3A8OB 2E6ZA 3E9FA 3OB9A 3PT9A 1Y96B 3OMCA 3S3MA 1M4ZA 2E41A 2E10A 4DQ2A 3I56A 3CEYA 3JCMd 4BE0A 3OYBA 1YJNA 4BE2A 1YJWT 1K9MC 2V8JA 2XICA 5CVIA 1JBMA 4OMFB 1Y7XA 1OYXA 1WQ7A 2QQRA 4M78A 1E7PA 4C92F 5A0DA 5M9OA 3G4ST 2I2LA 2EQMA 3V7SA 4D6WA 3QDRB 1BI2A 5GAMg 2ZZDB 3JCMX 2RD1A 3JB9J 3MO8A 4LDWA 4FM4B 3DLMA 5LJ5e 1BKBA 1K8AU 2L8DA 4HCZA 2Y4XA 3G7ZA 4QSHA 3QO3A 5GAMf 1WQWA 2KK4A 2LVMA 5J39A 3TU4K 3JB9D 1K73U 4C8QG 5AYFA 4EMGA 5LJ3f 3M58A 2CGHA 2RO0A 4ATOA 4JRKA 2VV5A 4AI6A 2RK2A 3QJYA 2GF7A 3VU3C 4XTXA 3L2WA 4F7UE 3META 2PQWA 1Y07A 1VQ9A 1VQ5T 1NE8A 2KDSA 2XU8A 3OYJA 4BBSM 1VQNA 1M8VA 1FX7A 4XTYA 1ZHIA 2VGMA 3LGFA 3JCMP 4KBMB 4M7AC 3OYMA 2RH2A 1VQLT 4QQ6A 2KR6A 4B9WA 1G3TA 2YLBA 2E1HA 1UGPB 2R5MA 3I56T 1BI3A 4FT2A 3CPWA 4ZTFA 1VQPT 3CMAT 5DY9A 4E47A 5IN1A 1QVPA 2ZCFB 4M75G 2DXBB 1VIEA 3UWNA 1XNIA 4BI4A 3OYIA 1YIJT 1VQ8A 1W2BA 3P8BB 3KBGA 4M77F 3RKWA 3M54A 1X6OA 1KHCA 4L6V5 2AHJB 5CKBA 3SD4A 4A4EA 3HBLA 4LDXA 3BG5A 3HFOA 1W4SA 2G77A 4JS4A 3CBMA 2F5TX 3J80E 2CKKA 1OI1A 3M9QA 4M77D 3A8LB 3OYAA 3KXTA 2QDYB 3A5ZB 2LNVA 2DPPB 1IREB 4OP0A 2JNGA 4C92G 3GIBA 4M7AG 3HPWA 4M6VA 4X34A 4MZPA 4HNVA 4M77C 5I2SA 1TH7A 2EKOA 1N8RU 3I55T 2IVWA 5GMKj 4O5VA 3HO8A 2RJCA 3FIFA 3LWIA 1N8RC 2P4TA 3JB9I 1VQLA 2EFIA 2OTLA 4BB7A 3F70A 3QYGB 3HSBA 1KQSA 2LCLA 2JN0A 4IURA 3SWNB 3S3OA 3S6WA 2XD0A 2L5QA 1HXDA 4BI8B 3CCET 3CCQT 3P8DA 3CPFA 1OZ2A 3DB3A 1KHIA 3MEAA 3OMGA 5D6YA 5L8RE 3JCMb 4V2SA 1VQ6T 5HY6A 5LL6S 4C0GA 2DTIA 4IUTA 4PJOG 3JB9F 5FROA 1S72T 3GF5A 4FL6A 4XU3A 4M75F 4HCBA 2WSEE 3O8VA 4CRIA 1LJOA 2RM4A 3OYGA 3OYHA 3CCMT 3TEEA 3SDZA 3TREA 1DJ7B 2LX9A 2NLUA 2WSFE 4KT0E 1N6AA 5GANh 4L5GA 2DJZA 2OAUA 1FKMA 4A4FA 4RMOA 5CCAA 2JUFA 4XTVA 4A4HA 4HT9A 4J6WA 3T9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVE B;  3A8M B;  3A8O B;  4RKU E;  4OB1 B;  1GXI E;  1UGQ B;  2CZ7 B;  3X25 B;  2PU9 B;  2DD5 B;  3WVD B;  2DD4 B;  3LW5 E;  2ZZD B;  3QXE B;  4OB3 B;  4FM4 B;  4OB0 B;  2DXC B;  3X26 B;  4OB2 B;  2PUK B;  3A8H B;  3VYH B;  2CZ1 B;  3X28 B;  2PVD B;  1UGP B;  2ZCF B;  2CYZ B;  2DXB B;  1UGR B;  4L6V 5;  3X20 B;  2AHJ B;  4ZGJ B;  2ZPF B;  3A8L B;  2QDY B;  3QZ9 B;  2D0Q B;  4ZGD B;  1JB0 E;  2DPP B;  1IRE B;  3A8G B;  2ZPB B;  2CZ6 B;  2DXC A;  3VYG B;  2CZ0 B;  1QP3 A;  3QYG B;  3HHT B;  4Y28 E;  3QZ5 B;  2ZPE B;  2ZZD A;  1V29 B;  2PUO B;  1QP2 A;  1PSF A;  2ZPI B;  2DD5 A;  2PVO B;  5L8R E;  3VYG A;  2DXB A;  2O01 E;  3X24 B;  2ZPH B;  1UGS B;  2ZPG B;  1PSE A;  3QYH B;  4XK8 E;  2WSE E;  1DJ7 B;  2WSF E;  4KT0 E;  1AHJ B;  2DD4 A;  2WSC E;  4ZGE B;  2PVG B; 
#chains in the Genus database with same CATH topology
 2K5L A;  4LNP A;  4OML A;  2XI9 A;  5GAN 5;  5FU7 B;  2CP7 A;  1PKD B;  1URC B;  2BZX A;  1XTD A;  2HBP A;  2QQA A;  1KC8 U;  4BY6 B;  4JZ4 A;  4C0D C;  4E7Z A;  3G71 A;  1H26 B;  2Y4Y A;  2O4X A;  1VQ7 T;  1PHT A;  2DD5 B;  5HQ0 B;  4LD9 K;  5GAN j;  3QXE B;  2JT4 A;  3O5Z A;  2E64 A;  1M1K C;  4CC7 A;  1IHW A;  4R55 A;  2HQH A;  3JAM E;  1VYW B;  1TSF A;  1ZBJ A;  5EJC A;  3QJ6 A;  1Y71 A;  3A8H B;  1C1A A;  2VC8 A;  3TCJ A;  3CMA Q;  4JLI A;  3G71 Q;  5IDP B;  2CZ1 B;  3PIO A;  4F7U G;  1YIT A;  2V8I A;  5FLX E;  1VQM T;  4IMY B;  5A0L A;  1JJ2 S;  4RG8 A;  4OR5 B;  3PFS A;  3CCJ A;  2HKQ B;  2RI3 A;  4PJO A;  1TFB A;  1O75 A;  1RAG B;  1W6X A;  4M7D G;  4PFO A;  2F69 A;  2E6N A;  3GP8 A;  1IHV A;  1TWB A;  4ZGJ B;  2A28 A;  1NJI C;  3C95 A;  2IW8 B;  4C0G A;  4QW2 A;  2D9T A;  2D0Q B;  4ZGD B;  3HRT A;  3L42 A;  2QA4 A;  1AD6 A;  1KJW A;  1RAB B;  2K57 A;  3QYB A;  4AFU C;  2BS2 A;  4A63 B;  1SSF A;  2IVX A;  1M2V A;  3G6E T;  1RL2 A;  4MDX A;  4BCO B;  1VOM A;  1BK2 A;  4X1V A;  1R77 A;  2UZL B;  3OS2 A;  3REA B;  5FWB A;  1VYT A;  2MMP A;  4BCJ B;  5LJ3 h;  2DZ9 A;  4M75 A;  4C8Q C;  1JSU B;  2ABL A;  1JST B;  4C92 C;  1UDL A;  5GJW B;  2DIG A;  4MFE A;  4XU1 A;  2ZPG B;  2KXC A;  1I5O B;  4LUD A;  4BCM D;  5GAO m;  2KVQ G;  2AKK A;  3GOX A;  2LQ8 A;  2ROT A;  4LDY A;  2FRY A;  2JXB A;  4M7D E;  3LWH A;  3CCL T;  3EGX B;  3VUZ A;  1NJI R;  1OKW B;  4P5N A;  4QVC A;  2RJF A;  5FRM A;  1AWO A;  2FZK B;  4J6Y A;  1D3B A;  4BXX X;  2XID A;  4II5 B;  3CC7 T;  1UEB A;  1VQ9 T;  5LMK B;  1ZSZ A;  5LJ3 g;  1UTI A;  3CXC A;  2DD4 B;  4QKU A;  2K3X A;  3CME Q;  2MCN A;  3OYY A;  2IN3 A;  1JU5 C;  1GRI A;  1MGQ A;  2X3W D;  2XK0 A;  4F16 A;  1LNX A;  4PJO F;  1VQ4 A;  2LT4 A;  2LRQ A;  2YUQ A;  1NEG A;  1VQM A;  4RTY A;  4M7A D;  3MEV A;  1NLO C;  3BHT B;  2M0O A;  4J5Y A;  1M5Q 1;  2KSS A;  4BCQ D;  3FRN A;  4I3Z B;  2KYB A;  3CME T;  4ELY C;  2M02 A;  1N9S A;  1GUX B;  1TU0 B;  1UB4 A;  3SWN C;  4L59 A;  4M75 D;  1ARK A;  4CFX B;  1YN8 A;  2HNI A;  1WHJ A;  3LH5 A;  2QYZ A;  3RER A;  2KI7 A;  3NFC A;  5EC7 A;  4ORZ A;  1V76 A;  4E7J A;  1LVK A;  4IUV A;  4EIK A;  1Q81 R;  3M0S A;  2CZ0 B;  4RTV A;  4C8Q D;  3F5X B;  1QVF A;  1T0H A;  4M77 E;  5GAN d;  3OBW A;  3MEU A;  1JQQ A;  2X4W A;  1QVG S;  3HZJ A;  2QGS A;  1B7T A;  1ZX6 A;  2LT1 A;  3I56 Q;  4HLQ A;  2OJ2 A;  2QAZ A;  5CQX A;  4BUG A;  4PJO D;  2G9X B;  2OX7 A;  4CFN B;  5C0M A;  3J7A F;  5A0G A;  1JOW A;  2QQ9 A;  4FIB A;  4KRC B;  2FPE A;  2HD0 A;  2BE7 D;  3QHR B;  2RB6 A;  3QG1 A;  4JJN K;  1Q95 G;  1QW1 A;  2PZ1 A;  2LQK A;  2K7A A;  2RK1 A;  8ATC B;  1KIK A;  2W2H A;  3L2R A;  2RQW A;  4C92 E;  1FMW A;  2J6O A;  3JSC A;  3JB9 H;  4OB1 B;  4C92 D;  1N27 A;  1EZZ B;  2A36 A;  2CT3 A;  1LOJ A;  2CZ7 B;  3SWN A;  4KUD K;  2X4Y A;  1AWW A;  1TG0 A;  4BCM B;  3LGL A;  3TN8 B;  2ENM A;  1H28 B;  2K3Y A;  1QVG A;  5EG2 A;  2AKL A;  5CKF A;  3CCQ A;  4FW1 A;  4E7L A;  3N5B B;  5CR2 A;  4M7D A;  1VQ7 A;  1KD1 C;  4KGV B;  1K73 R;  1B3Q A;  1X6G A;  4D8D A;  2XDD A;  2NUP B;  2KGT A;  1I0C A;  1HK9 A;  3FEO A;  1H27 B;  5BNJ B;  1OIY B;  5HK0 A;  3VS1 A;  1X01 A;  2E12 A;  5GAO l;  1R8O B;  3OW2 A;  2DER A;  2LC4 A;  2VYT A;  4NL2 A;  3R6O A;  1N4M A;  2YUO A;  2H3J A;  4FYX B;  4N4H A;  4BE1 A;  4JDS A;  5CKH A;  2FPD A;  4JX4 A;  4M75 C;  1YP5 A;  1JJ2 A;  1XQH A;  1YIT Q;  5CEI B;  1LPL A;  5HK3 A;  1M1F A;  1KC8 R;  1D0Y A;  3CCJ T;  3HB9 A;  3V7R A;  4BCN D;  1SRL A;  2I40 B;  2DE0 X;  2DJQ A;  1W2B S;  2F1L A;  5DQW A;  4RTX A;  4E2F B;  2HCK A;  2KQW A;  4M78 C;  2AIR B;  2ED1 A;  2BS3 A;  4N4I A;  3BE3 A;  2H3E B;  1ZSZ B;  3M55 A;  3HHT B;  1YIT T;  2FYK A;  3EGD B;  1OGU B;  1RLP C;  2LJ3 A;  3CBO A;  4BBR M;  2KYM A;  3L2Z A;  3NGP A;  2A7Y A;  2DK3 A;  1PSE A;  3QYH B;  1QCF A;  2MWP A;  2EYZ A;  5FRN A;  2VXE A;  1UUE A;  5IHI A;  4AKH A;  2R58 A;  4X9C A;  4C5H A;  2KY9 A;  5EFQ B;  2WSC E;  2DD4 A;  1QKX A;  1VQN T;  2R57 A;  5GMK l;  5LJ3 d;  2V8K A;  3M56 A;  1YJW A;  3V8K A;  1SPK A;  3A8O B;  3QWY A;  3S3M A;  2DA9 A;  2E41 A;  3I56 A;  1YJN A;  2DF6 A;  3OYB A;  4CFW B;  4BE2 A;  2XIC A;  1Y7X A;  1OYX A;  1WQ7 A;  1E7P A;  1VA7 A;  1BI2 A;  2HL3 A;  1K8A R;  3FJ5 A;  4LDW A;  3TVT A;  1K8A U;  2L8D A;  1BU2 A;  2IW6 B;  4QSH A;  3QO3 A;  4WTO B;  3H0F A;  2KK4 A;  3JB9 D;  2ESW A;  2HL5 C;  3SHW A;  2VV5 A;  4AI6 A;  4XTX A;  3L2W A;  1OU9 A;  2PQW A;  1VQ5 T;  2KDS A;  5HBE B;  1ZHI A;  2VGM A;  1UNL D;  2UZD B;  4LN2 A;  3OYM A;  3VRY A;  2DBM A;  2KR6 A;  2WFY B;  4B9W A;  2YLB A;  1GCQ C;  3C0C A;  4PJJ A;  2KRS A;  4FT2 A;  3CPW A;  4ZTF A;  2DRK A;  1QVP A;  1XNI A;  3MPU B;  4BCP B;  4EC9 B;  4CFM B;  1W4S A;  3RR6 A;  2G77 A;  4JS4 A;  3J80 E;  1OI1 A;  3M9Q A;  5KYX A;  1S1N A;  2D8H A;  2DPP B;  4FYW B;  3GIB A;  2WEV B;  1GL5 A;  1GCP A;  2J6K A;  4EOQ B;  1E7O A;  2CRE A;  1N8R U;  3RDV A;  4EOM B;  3FIF A;  2NUT B;  1SG5 A;  1RAA B;  2Z0W A;  3THK A;  4AFZ C;  2VVK A;  3S3O A;  3RBB B;  3S6W A;  2XD0 A;  1HXD A;  3H41 A;  1VQ6 T;  2EVR A;  5FRO A;  3E2U A;  4XU3 A;  4M75 F;  2BTT A;  4JJC A;  2OTL Q;  1TTH B;  3TEE A;  3POM A;  2IIM A;  2LX9 A;  4KT0 E;  1X43 A;  2DJZ A;  3MIA B;  2PJQ A;  4F7J B;  4XTV A;  4A4H A;  4J6W A;  1YWP A;  4M7D F;  1NBE B;  5KYY B;  4RUG A;  2DLP A;  1FYN A;  1YI2 A;  2XG8 D;  2MAM A;  1H1P B;  3C4S A;  3CCV A;  3QKJ A;  1VIN A;  3EOC B;  4CFV B;  2QK0 A;  5I5Z B;  1ZUK A;  3FB9 A;  3H6Z A;  3CCJ Q;  1MMN A;  2EQU A;  1Q82 R;  3MP8 A;  2CUD A;  2QEX Q;  3X26 B;  1G3N C;  4LD6 A;  1BBZ A;  2QA4 T;  3TSZ A;  2X4X A;  1VQO Q;  1G3W A;  3CCU Q;  3X28 B;  3FLG A;  3VJP A;  4EMH A;  4ELJ A;  4EOO B;  1H64 1;  4CI0 C;  2FHD A;  3JCM Q;  3VS6 A;  4QT7 A;  1BI1 A;  3IQL A;  3JCM e;  1VQ8 T;  1I07 A;  1O9K B;  2KRM A;  2LDM A;  2GBQ A;  4MZM A;  4XTW A;  3TNH B;  4J7I A;  2CYZ B;  1MMG A;  3HL8 A;  1T3L A;  1UGR B;  1VIF A;  3CBP A;  4KUL A;  3CCM Q;  2OTJ T;  3V8L A;  1HD3 A;  3EFS A;  1ABQ A;  3CCS A;  2V26 A;  2LCS A;  4MDW A;  1KK7 A;  4M75 E;  4EMK A;  1M2O A;  3AHU A;  4IUU A;  5GMK m;  1Q82 C;  1KG1 A;  2HDA A;  1YHQ Q;  3BHV B;  1I4K 1;  4PKC C;  3M03 A;  3HKS A;  3TNW B;  3VUB A;  2R7G A;  4EOK B;  1C0M A;  2K2M A;  4BDY A;  3CC4 A;  3RMS A;  3CCR Q;  2M9U A;  2RHZ A;  3LX7 A;  1V29 B;  1KXU A;  1K8A C;  3L2Q A;  1GH6 B;  3G1J A;  3VYG A;  1RI9 A;  4A4G A;  2LMJ A;  4A4E A;  1WPY A;  1V1C A;  1PCX A;  3CC4 Q;  2EGC A;  3VS3 A;  4J9I A;  2A0F B;  2GFU A;  3ZEH A;  5LQF B;  3V8J A;  3B57 A;  4KH0 B;  3MJX A;  1UJ0 A;  3BLR B;  2LZ6 B;  3DB4 A;  1TD6 A;  2PVG B;  4YC3 B;  2I0N A;  4Q5W A;  4NOY A;  3VS4 A;  3A8M B;  5IH2 A;  3CCV T;  4LDU A;  1WHG A;  3L1A A;  5GAN 4;  1BYM A;  5CAI A;  4AKG A;  5GAO p;  5CKE A;  4HCK A;  2LP5 A;  5CYI B;  4HVV A;  1D1A A;  2SEM A;  2K6D A;  4M77 A;  3NPF A;  3H4C A;  5IAY A;  2XDB A;  2GGR A;  3E19 A;  3MCA B;  4FT4 A;  2RHU A;  1M1G A;  4J8O A;  1UG1 A;  3FC3 A;  4PJO B;  1VQP A;  2DX1 A;  2KE9 A;  2YXY A;  3E1S A;  4OMQ A;  4EOL B;  4ME7 A;  3J81 E;  4EOS B;  3URG A;  5GJV B;  2X1N B;  1IZ6 A;  2RHX A;  3DDP B;  1YWO A;  5KCO A;  4C8Q B;  1ZUY A;  2OTJ A;  5GAN f;  2EJF A;  2BUD A;  1VQ5 A;  3QBY A;  3EID B;  1Q7Y R;  2PTK A;  4J9H A;  3X20 B;  3MHX A;  1VQ9 Q;  4ELL A;  4E6R A;  4NST B;  2QGF B;  2NUT A;  1YJN T;  2CP5 A;  2P0Q A;  4C5I A;  3NTH A;  1O9S A;  1VQ4 T;  3CCE Q;  5GMK h;  2FB7 A;  2F2X A;  1UGV A;  3VS2 A;  2ZAE A;  1YIJ A;  4JLG A;  5KYU A;  4BCG B;  3LQ5 B;  1QVF P;  3GTM S;  3QUI A;  4HCC A;  4F7U F;  2B8A A;  4F7U B;  2UZE B;  1M90 C;  2EYX A;  5GAM e;  2DET A;  4R56 A;  3QHW B;  1TXQ A;  3CCM A;  4NC6 A;  3GNF B;  4G6L B;  2V1Q A;  4LXC A;  2IG0 A;  2C0O A;  1WNL A;  5GAN 7;  1H3H A;  1WJQ A;  1YBY A;  4J9F A;  2BS4 A;  3X24 B;  2M16 A;  4DA4 A;  1H92 A;  2GQI A;  1AVZ C;  3PIP A;  1ZA2 B;  3CC7 Q;  3BY7 A;  4PJL A;  4M78 D;  2JMC A;  1WXB A;  2KMG A;  4GLK A;  1K0X A;  2C5V B;  3CCR A;  1I5L A;  2K79 A;  1Q86 U;  1MND A;  2MK5 A;  2EJ9 A;  3M4Y A;  3MKD A;  3CCL Q;  4M77 G;  2O9V A;  4BCI B;  5FU7 C;  5IDN B;  2D6F A;  3EFR A;  3OS0 A;  4Y92 A;  1D1B A;  1KFZ A;  1W98 B;  4M7A E;  1J3T A;  3BLQ B;  2RJD A;  2DEQ A;  2PK2 A;  2CP6 A;  1OOT A;  4OB0 B;  1JRI A;  2EYY A;  1M3A A;  1WXU A;  1Y0M A;  2BKD N;  3E9G A;  3QII A;  4CRL B;  1K9M U;  3QSU A;  1YJ9 A;  4IKF A;  2WAC A;  1KD1 R;  1OX8 A;  3JCM c;  2M1H A;  2GFA A;  3NMZ C;  2L3R A;  2YHT A;  4MFD A;  4PNO A;  3I5S A;  2C5N B;  5LJ5 j;  3FJP A;  1UFF A;  2COY A;  4F6S B;  3TQ7 P;  4RTW A;  1VQO A;  1K0S A;  2HSP A;  5J26 A;  2K4Y A;  3JCM f;  3NHN A;  1WLP B;  2DAQ A;  4BD3 A;  2DFU A;  2RA2 A;  4HL4 A;  3MY1 B;  2KT8 A;  3EG2 A;  3CCS T;  2VB6 A;  3CC7 A;  4N0A A;  4MZT A;  2JJ9 A;  2CP3 A;  3VKI A;  2QQ8 A;  4DEY A;  4KGX B;  1X27 A;  1C9B A;  1GY3 B;  3ME9 A;  4M4Z A;  2ZZD A;  2PUO B;  1M8M A;  1JXM A;  1OX9 A;  2X35 A;  3LLR A;  1FWZ A;  2RQV A;  2DL7 A;  2DXB A;  3HRS A;  2Y90 A;  4CFU B;  2ZPH B;  2WJ9 A;  2EYQ A;  3MEW A;  4M7D C;  4JS5 A;  2QQS A;  2YUP A;  4F6U B;  3BG3 A;  4FYY B;  1RUW A;  1WDX A;  3M57 A;  4J6X A;  4J9C A;  1BIA A;  2NUZ A;  3REB B;  1RAC B;  2HKN A;  1WHL A;  1M4Z A;  4BE0 A;  5CVI A;  5HBH B;  2C5O B;  4M78 A;  4FX3 B;  4PJM A;  4C92 F;  5A0D A;  2DL3 A;  2O31 A;  3QDR B;  3MO8 A;  3DLM A;  1D0Z A;  5FGK B;  5GAM f;  2I53 A;  1WQW A;  3TU4 K;  1K73 U;  2L2P A;  5LJ3 f;  4ATO A;  2CGH A;  2RPN A;  4JRK A;  3QJY A;  2GF7 A;  3VU3 C;  2WXV B;  2DEU A;  4F7U E;  1WHH A;  3OYJ A;  1VQN A;  1M8V A;  3LGF A;  4Z88 A;  4M7A C;  1SF9 A;  4Z8A A;  4QQ6 A;  3AT1 B;  1H4L D;  4AFQ C;  1VOL A;  3I56 T;  1BI3 A;  2C6T B;  1VQP T;  1NEB A;  4E47 A;  5IN1 A;  3UWN A;  2X51 A;  1AD5 A;  1W2B A;  4M77 F;  3RKW A;  2PMI B;  3M54 A;  1KHC A;  3SD4 A;  3HBL A;  4K11 A;  3BG5 A;  3HFO A;  2EYW A;  3CBM A;  2F5T X;  2QDL A;  2CKK A;  3OYA A;  2J05 A;  3A8L B;  3A5Z B;  1AWX A;  3JV3 A;  2W99 A;  2LQN A;  4OP0 A;  2JNG A;  1D1C A;  4M7A G;  4ANJ A;  4MZP A;  2BE9 B;  3I55 T;  5GMK j;  2LJ0 A;  1NYF A;  4HXJ A;  3LWI A;  2EFI A;  2OTL A;  4BB7 A;  3QYG B;  3HSB A;  2UZB B;  2DL5 A;  2LQW A;  2LCL A;  2X9H A;  3SEM A;  1OQK A;  2EGE A;  3CCQ T;  5D6Y A;  1OZ2 A;  3DB3 A;  4V2S A;  4JJD A;  1EX4 A;  5HY6 A;  1K76 A;  4PJO G;  1HJD A;  2P4R A;  2ED0 A;  3JB9 F;  1S72 T;  4FL6 A;  4HCB A;  2EW3 A;  3O8V A;  4CRI A;  3CCM T;  3SDZ A;  4FYV B;  1DJ7 B;  2NLU A;  2WSF E;  1VQP Q;  2DYI A;  1N6A A;  5GAN h;  2OAU A;  4HT9 A;  2OI3 A;  2JGZ B;  5CCA A;  3EG9 A;  3T9N A;  2CJM B;  3I5R A;  1CSK A;  1KQS P;  4RKU E;  3MI9 B;  1F1B B;  4F17 A;  2DL8 A;  2BZ8 A;  3TSW A;  2WMB B;  2FL7 A;  4C0D B;  4BY6 C;  2LX7 A;  2LCC A;  1BI0 A;  1O9K A;  1Y57 A;  4E7H A;  2B86 A;  1NZ9 A;  2EQK A;  2K9G A;  4C0Z A;  3HRU A;  2NYS A;  4OB3 B;  2SRC A;  2QFZ A;  3CCR T;  1SKU B;  4DEX A;  4EMK B;  2DXC B;  3I9Q A;  3OYC A;  1ZUU A;  4OB2 B;  1QWF A;  4JUV A;  5GMK i;  2KR3 A;  5GAN 8;  3OYE A;  1F5Q B;  3KHI A;  5L23 A;  3CCS Q;  4NL3 A;  4LDV A;  1KQS S;  5IXB A;  3H0I A;  2RNA A;  5ACB A;  5DQV A;  2PVD B;  1N8R R;  2KEA A;  2YRC A;  3GBQ A;  3OSS C;  5IHN A;  1B34 A;  1FVV B;  4XU2 A;  4QQG A;  2QEX A;  3GPL A;  1U5S A;  4DBH A;  3BDU A;  4XTU A;  3CME A;  1AEY A;  2QI2 A;  2O9S A;  3P8H A;  4M77 B;  2BZY A;  3QWX X;  5GAM d;  2DYB A;  3NTK A;  1T3S A;  4JX6 A;  2K2V A;  1YJW T;  3EJ1 B;  4KUI A;  4C8Q F;  1H25 B;  4F7U A;  2OAW A;  4N0A C;  4AFS C;  2DXT A;  1VQO T;  5DM7 R;  4DBR A;  1PD1 A;  4II1 A;  5ECA A;  1QP3 A;  3KFV A;  4QVD A;  2P0P A;  2L3S A;  1WIE A;  2COW A;  2CUB A;  4CC3 A;  2DTH A;  4RG2 A;  1QWE A;  3RGF B;  1VQ5 Q;  1K73 C;  3QYE A;  1BB9 A;  3L2V A;  1K4U S;  4ELZ C;  2ZPI B;  2PVO B;  4GY5 A;  3M0P A;  1G3S A;  4ESR A;  1UHC A;  4BY1 X;  4JRI A;  4Y91 A;  5LJ3 j;  4Z6Y A;  1P5E B;  1WJS A;  3RKY A;  5KYU B;  2CT4 A;  5LJ5 h;  1IRX A;  3BG9 A;  2XDP A;  1AHJ B;  4Z89 A;  3MY5 B;  3CCQ Q;  4KH1 B;  1MV3 A;  2KNB B;  2JZ2 A;  3RIR A;  1Q81 U;  4Y72 B;  1OU8 A;  1UNG D;  2HBW A;  1XOV A;  4C8Q A;  5LJ5 f;  5HNB B;  1X2Q A;  1OL2 B;  3RKX A;  2HZY A;  2PU9 B;  2EGA A;  1R0B G;  2WIH B;  1G2B A;  1GBQ A;  4DOW A;  3LW5 E;  1H3Z A;  1ZP2 A;  2AZS A;  2DO3 A;  3JB9 G;  3JCM g;  3SB2 A;  1ZSG A;  1D3B B;  2DZC A;  2PUK B;  1KD1 U;  4EOI B;  4MIM A;  2DL4 A;  5HVY B;  2EJG A;  1BIB A;  4OF1 A;  3OA6 A;  1YI2 Q;  4KRD B;  3PMT A;  3CD6 Q;  1NPR A;  2QEX T;  1R0C B;  2MIO A;  4J9D A;  1QCO A;  1EFN A;  2VUB A;  2C4G B;  1G5V A;  2A08 A;  2C5X B;  4XAX B;  4M7A A;  4N4G A;  2FRW A;  1XJW B;  4RCC A;  2CSI A;  4E7I A;  2C06 A;  4B9X A;  3OY9 A;  3OW2 S;  5DLO A;  5A2Q E;  1VQN Q;  1H1S B;  2DME A;  3OS5 A;  2ZPF B;  3OYN A;  4E7K A;  1I8F A;  4MML A;  3PGG A;  3DL1 A;  4Z02 A;  3G4S A;  1YCY A;  2ZPB B;  4MMK A;  4OGR B;  1OEB A;  2E5Q A;  1VQ6 A;  3EG3 A;  2YRV A;  3LYI A;  3CXC S;  2KBT A;  5GAM j;  3OYD A;  1W70 A;  4BI3 A;  2IW9 B;  1YFN A;  4GLM A;  2EBP A;  3QZ5 B;  3RMQ A;  3MP6 A;  3OW2 P;  4TVR A;  2RHI A;  4BCQ B;  1PSF A;  2RMO A;  2DD5 A;  4AT1 B;  1NYG A;  5I11 A;  3I35 A;  2CDT A;  1X75 C;  4OMN A;  3I55 A;  1SRM A;  3BDL A;  4VUB A;  2G3R A;  3SFM A;  3C94 A;  4AG1 C;  3CPW S;  3VKH A;  3CCL A;  1TUC A;  3JCM J;  1VQK A;  4ZTJ A;  1M1K R;  2VXF A;  2JTM A;  1VQ4 Q;  1I81 A;  2GCX A;  1Q86 C;  1WFW A;  1H24 B;  2YRD A;  4A53 A;  2RN8 A;  5D6X A;  2VGN A;  1ZBX A;  8AT1 B;  5IF1 B;  3INZ A;  2D1X A;  2MF2 A;  2HQX A;  4F6W B;  3CD6 A;  2DVJ A;  5IXF A;  4EOP B;  1IB8 A;  1U3O A;  5HKC A;  2RF0 A;  2X3X D;  1M90 U;  1NG2 A;  3CC2 A;  5CIU A;  4QVZ A;  2VAS A;  2X4J A;  3EFO A;  1VUB A;  3VRZ A;  4BCF B;  4B6M A;  2E3H A;  4AG2 C;  5GAO r;  1WHK A;  4M7A F;  4ZN3 A;  1VYV A;  3TW7 A;  2DM1 A;  4YTL A;  1RAH B;  4FSX A;  3HP9 A;  1X2K A;  2HQE A;  1Z9Z A;  4PFP A;  3OYK A;  4BCK B;  1YHQ T;  4CC4 B;  1NM7 A;  4HA8 A;  1NPP A;  1D0X A;  1WYX A;  4DBQ A;  3EG1 A;  1H1Q B;  3UF4 A;  5DLQ E;  2DIQ A;  2FPF A;  3CCU A;  4M78 F;  1U1T A;  2PNI A;  3CQT A;  3GNG A;  3G71 T;  2J06 A;  1Q7Y C;  2K5I A;  2KAF A;  3JRZ A;  3M5A A;  3OBY A;  2FEI A;  1WI7 A;  2BPM B;  3TW6 A;  3UAT A;  2JM8 A;  2QG9 B;  5J3B A;  1P92 A;  3EG0 A;  5LJ5 d;  5D6W A;  4JRP A;  3LH0 A;  2EAY A;  1WZO A;  4OMO A;  5KYW B;  3EHR A;  4Y28 E;  1G8X A;  2DNU A;  5GAN 2;  2JS0 A;  2W9F A;  5GAM h;  4OGE A;  1Q82 U;  2QA4 Q;  1GBR A;  2WIP B;  5GAN g;  1Q7Y U;  1BCM A;  5FU6 C;  5IHK A;  1OPK A;  3DJB A;  4A54 A;  1VQK T;  4OVA A;  1IGU A;  1SEM A;  1UGS B;  5LJ3 e;  5AT1 B;  4PJO C;  1I1J A;  2JVV A;  4M78 E;  2NUP A;  4DOV A;  4M78 G;  1KQ1 A;  5I21 A;  3UPU A;  1SHG A;  1ZLM A;  4UN0 A;  1Z9Q A;  5GAO n;  4CXA B;  1VQL Q;  3DKM A;  1NJI U;  3WVE B;  3A98 A;  1AWJ A;  3E9F A;  3PT9 A;  1YCS B;  1Y96 B;  1A0N B;  1TS9 A;  1KSW A;  2E10 A;  2DRM A;  3EG9 B;  3JCM d;  1OL1 B;  7AT1 B;  4J9E A;  4OMF B;  3H9N A;  3I55 Q;  3UA7 A;  2EQM A;  1UHF A;  3V7S A;  3JB9 J;  2ZZD B;  1TUG B;  5LJ5 e;  3G6E Q;  1BKB A;  2UUE B;  2HMA A;  4HCZ A;  5J39 A;  2W96 A;  2V22 B;  2LVM A;  2RQT A;  3VS5 A;  5AYF A;  4EMG A;  1K9A A;  3R6N A;  3MET A;  1VQ9 A;  3DTO A;  1PD0 A;  2KRN A;  2RQU A;  2JMA A;  1PKT A;  2VKN A;  1Q86 R;  1G3T A;  1UGP B;  3G4S Q;  2R5M A;  4R0K A;  3PE0 A;  1ZSZ C;  4CFU D;  2ZCF B;  1YIJ T;  4BI4 A;  1VQ8 A;  1MNE A;  1X6O A;  5CKB A;  2AHJ B;  4LDX A;  5HBJ B;  4M77 D;  1WXT A;  3KXT A;  2LNV A;  1YJ9 Q;  1HSQ A;  1W1F A;  1IRE B;  2BKZ B;  4M6V A;  4X34 A;  1M90 R;  4HNV A;  5I2S A;  1BCO A;  1QMC A;  2IVW A;  3HO8 A;  2RJC A;  1VQL A;  1AZE A;  1N8R C;  2P4T A;  1JJ2 P;  1OUL A;  2B9R A;  3F70 A;  1KQS A;  2JN0 A;  3EFO B;  2FG0 A;  4KRT A;  3SWN B;  2O2O A;  4BI8 B;  3P8D A;  3CPF A;  2L0A A;  5L8R E;  1IGQ A;  3JCM b;  1AT1 B;  5KYY A;  5LL6 S;  3CXC P;  1LJO A;  1M3B A;  2RM4 A;  3OYG A;  3TRE A;  1BU1 A;  4YOO A;  4BCN B;  1RAF B;  1FKM A;  4F7L B;  4A4F A;  2JUF A;  2AT1 B;  4M7D D;  4YOZ A;  1ENW A;  2C0I A;  2JTE A;  1E6G A;  2VWF A;  2MWO A;  3H8Z A;  2YSQ A;  1GXI E;  2EUF A;  4PLI A;  2E4H A;  1U06 A;  3OS1 A;  2F2C A;  1YJ9 T;  2RI2 A;  2ROL A;  1UNH D;  3EGX A;  4J9B A;  2CP0 A;  5GAN e;  5KH6 A;  4C0F A;  1M9S A;  1M2V B;  2HEQ A;  1T0J A;  4D8K A;  2HAX A;  3VYH B;  2D8J A;  4F70 B;  3PVL A;  5CKD A;  4HNT A;  1HYO A;  3UT1 A;  2EIF A;  1OPL A;  2FZG B;  1PG5 B;  2E3I A;  1UJY A;  2BIV A;  2P0K A;  4HVW A;  5GMK e;  1ZQ1 A;  2C0T A;  5FW9 A;  2RHY A;  2P84 A;  1RI0 A;  2RJE A;  4IUQ A;  2WMA B;  2WHB B;  3EGU A;  4HVU A;  5LJ5 g;  1UE9 A;  4C92 A;  5GAN 6;  2DKG A;  4J83 A;  5IHY A;  1IO6 A;  2K5F A;  4O6J A;  4GBQ A;  2DXC A;  3M0Q A;  1Y96 A;  3VYG B;  2EQJ A;  2R5A A;  1WGS A;  4X9D A;  1W2B P;  1E9H B;  2A3L A;  2PHG A;  5CQY A;  1X69 A;  2K3B A;  4ZNX A;  5KCH A;  5I2M A;  4IIO A;  1YHQ A;  3BHU B;  2JOY A;  4A4K A;  2F5K A;  2DMO A;  4C8Q E;  2J7I A;  3JCM h;  2QDJ A;  1CKA A;  4LE9 A;  3M53 A;  4HKE A;  6AT1 B;  3UDC A;  3Q1J A;  2JTF A;  2XHC A;  5FWC A;  3UA6 A;  4BDZ A;  2MPX C;  5D7U A;  4PJO E;  1E6H A;  2E70 A;  2LNH B;  3CMA A;  3HFN A;  3KUF A;  1EIF A;  1GUX A;  2V1R A;  2QAS A;  4PFZ A;  4RCB A;  3TNI B;  4FSS A;  4RTZ A;  1UGQ B;  2HSE B;  3FDR A;  3L2U A;  1NLP C;  4EON B;  2CH4 W;  4FU6 A;  2DTO A;  1JEG A;  5I22 A;  1M1K U;  3WVD B;  4BY7 X;  2XKO C;  1OKV B;  4JZ3 A;  4FW2 A;  3PO3 S;  2LJ1 A;  2FO0 A;  3RES A;  1N5Z A;  1MV0 B;  3BW1 A;  2KT1 A;  3S3N A;  5CK9 A;  1QVF S;  1G83 A;  5ICP B;  2QXF A;  3VKG A;  3EAE A;  5GAO q;  5FU6 B;  3ZFJ A;  3CCE A;  2GTJ A;  4ROC A;  2M0Y A;  3PNW C;  2W0Z A;  3ULR B;  4ZN1 A;  2W9Z A;  3NDQ A;  3OYL A;  3M4G A;  4M78 B;  4NS5 A;  2LTO A;  1KC8 C;  4JX5 A;  2F2V A;  2WPA B;  3M0T A;  5C6S A;  2CSQ A;  2IPO B;  1OIU B;  1QMZ B;  2RI5 A;  3QZ9 B;  1JB0 E;  3QHS A;  4XU0 A;  4HNU A;  3A8G B;  4AKI A;  2E65 A;  3ASK A;  2QQB A;  5KE3 A;  2EWN A;  5GAN 3;  3OYF A;  3JCM V;  2KRO A;  3M59 A;  4M75 B;  1K9M R;  2GTO A;  1S72 A;  3CD6 T;  1WA7 A;  3OSV A;  1QQJ A;  3OQ5 A;  2DVE A;  1SHF A;  1PC0 A;  1MUZ A;  1MHN A;  3MP1 A;  1G3Y A;  3OYH A;  2QF7 A;  1PRM C;  1FXX A;  3CC2 T;  3C12 A;  3PVQ A;  3VS0 A;  4M7D B;  1X6B A;  4M7A B;  4OGC A;  1TOV A;  1VYU A;  2DIL A;  3QPH A;  4C5G A;  2EKH A;  4XK8 E;  4JPB W;  2CS7 A;  1WJR A;  2H8H A;  4JRQ A;  2EPD A;  2CCH B;  2YWW A;  3U23 A;  4J7F A;  2MOX A;  4CC2 A;  1PWT A;  4BAC A;  4YOS A;  1GCQ A;  3PMI A;  4J9G A;  1AIS B;  2NWM A;  3M0R A;  1PM3 A;  2FVU A;  2M51 A;  3X25 B;  4LOC A;  2J6F A;  2JS2 A;  1ACM B;  5IT9 E;  1B07 A;  1VQ8 Q;  4IUP A;  4EDU A;  3PTA A;  5HCK A;  1K1Z A;  1TUD A;  1M27 C;  3V7C A;  3ZBD A;  2W10 A;  4EOJ B;  1KQ2 A;  4LUE A;  1B34 B;  2ATC B;  1YNZ A;  2JM9 A;  5L2W B;  1Q81 C;  3GLX A;  2QTX A;  1H8K A;  4JJB A;  2L3Q A;  4C92 B;  2YUN A;  2YLC A;  4KGZ B;  2JW4 A;  1RLQ C;  1FMK A;  4XQ3 A;  2A37 A;  1C6V X;  3ER0 A;  4PLL A;  3EH1 A;  1M30 A;  4EC8 B;  1YI2 T;  1JO8 A;  3O0G D;  3G6E A;  2ECZ A;  4HT8 A;  1RAI B;  4C5E A;  2L89 A;  2GNC A;  3JCM W;  1LCK A;  1PRL C;  2PK9 B;  4F04 B;  2ZGW A;  1D09 B;  2MI6 A;  4EPC A;  2L3P A;  2CZ6 B;  1JXO A;  2YT6 A;  1IXD A;  4OMP A;  3K7A M;  1FIN B;  3DLL A;  2YDL A;  1FMV A;  2O4X B;  2GQV A;  1QKW A;  3QWL A;  5KE2 A;  2KMT A;  5KYX B;  1CKB A;  3NTI A;  4ROE A;  2ZPE B;  2OTL T;  1QCN A;  1QP2 A;  2D0N A;  3VV0 A;  1YJW Q;  3CCV Q;  1GFD A;  3CCU T;  1U8R A;  2CCI B;  5CO7 A;  3RNJ A;  3BFM A;  2O01 E;  1AZG B;  1QLB A;  1N9R A;  3H0H A;  4WF2 A;  1U1S A;  4F14 A;  2DXU A;  1OZ3 A;  1OV3 A;  1YIJ Q;  4TTH A;  2EQI A;  3DOG B;  1D3U B;  3WXM B;  3ZL7 C;  3DDQ B;  4QQD A;  4PL6 A;  4XTZ A;  4UC4 A;  4ZGE B;  3RUX A;  4OMM A;  4EMK C;  1QVG P;  2E6Z A;  3OB9 A;  9ATC B;  3OMC A;  4BCH B;  1ABO A;  4DQ2 A;  3CEY A;  1K9M C;  2V8J A;  1JBM A;  1MMA A;  1SSH A;  2CH4 A;  1PKS A;  5M9O A;  2QQR A;  3CC4 T;  2CP2 A;  2QGG A;  2I2L A;  4PK4 A;  4D6W A;  3G4S T;  5GAM g;  3JCM X;  2RD1 A;  4FM4 B;  2Y4X A;  3G7Z A;  4C8Q G;  3M58 A;  1UEC A;  2RO0 A;  2RK2 A;  3M0U A;  1YJN Q;  1Y07 A;  1NE8 A;  2XU8 A;  4BBS M;  4DBF A;  1FX7 A;  4XTY A;  3JCM P;  3A1P A;  4KBM B;  3VS7 A;  3D7S B;  2RH2 A;  1VQL T;  2DBK A;  1RAD B;  2E1H A;  1RAE B;  1WHM A;  4PJN A;  2RQR A;  3CMA T;  5DY9 A;  1AOJ A;  4M75 G;  2O88 A;  3CC2 Q;  2DXB B;  1PNJ A;  3BLH B;  1VIE A;  1XO2 A;  2COZ A;  3OYI A;  1H1R B;  2LW4 A;  3P8B B;  3KBG A;  1VQ6 Q;  1VQM Q;  4L6V 5;  1S72 Q;  4F7N B;  1QLY A;  2G6F X;  4IIM A;  2FZC B;  1WX6 A;  3HTR A;  4E7S A;  1MMD A;  5KYW A;  2QDY B;  1VQ7 Q;  4RTU A;  1GFC A;  2OTJ Q;  4C92 G;  2E5K A;  3HPW A;  4M77 C;  1TH7 A;  2EKO A;  3EGD A;  2XMF A;  4O5V A;  3JB9 I;  4WCI A;  4ROD A;  5KYN A;  1VQK Q;  2AZV A;  3G33 B;  1ZA1 B;  4FCY A;  4EOR B;  4IUR A;  3CPW P;  2L5Q A;  2AK5 A;  3CCE T;  2KXD A;  3MEA A;  1KHI A;  3OMG A;  2MYS A;  3EHQ A;  3QDF A;  2QTV A;  1M3C A;  2DTI A;  4IUT A;  1JKW A;  1OI9 B;  3GF5 A;  2F2W A;  4F7S B;  2WSE E;  3EH2 A;  4RTT A;  4AMC A;  4L5G A;  4RMO A; 
#chains in the Genus database with same CATH homology
 4M7D F;  2K5L A;  2XI9 A;  5GAN 5;  5FU7 B;  4RKU E;  1YI2 A;  2XG8 D;  2MAM A;  2MWO A;  3H8Z A;  1XTD A;  2HBP A;  2QQA A;  1KC8 U;  1GXI E;  2FL7 A;  4BY6 B;  4BY6 C;  4PLI A;  4C0D B;  4C0D C;  3G71 A;  2LCC A;  3OS1 A;  1BI0 A;  3C4S A;  2Y4Y A;  2O4X A;  3CCV A;  1YJ9 T;  1VQ7 T;  4E7H A;  3QKJ A;  2DD5 B;  1NZ9 A;  2RI2 A;  2EQK A;  4C0Z A;  4LD9 K;  3HRU A;  5GAN j;  5GAN e;  3FB9 A;  3H6Z A;  3QXE B;  4OB3 B;  2EQU A;  2QFZ A;  4C0F A;  5KH6 A;  3CCR T;  3MP8 A;  2E64 A;  1M9S A;  1M1K C;  4EMK B;  2DXC B;  3OYC A;  3X26 B;  4R55 A;  4LD6 A;  3JAM E;  4OB2 B;  5EJC A;  3QJ6 A;  1Y71 A;  2QA4 T;  5GMK i;  3A8H B;  4JUV A;  3OYE A;  5GAN 8;  2VC8 A;  3TCJ A;  2X4X A;  4JLI A;  3KHI A;  3VYH B;  2CZ1 B;  1G3W A;  4LDV A;  4NL3 A;  3PIO A;  1KQS S;  4F7U G;  1YIT A;  2V8I A;  5CKD A;  3X28 B;  2PVD B;  3FLG A;  3VJP A;  5FLX E;  4HNT A;  4EMH A;  1VQM T;  4ELJ A;  3UT1 A;  5A0L A;  1JJ2 S;  2EIF A;  3OSS C;  4RG8 A;  1H64 1;  4CI0 C;  2FHD A;  3JCM Q;  1B34 A;  3PFS A;  4XU2 A;  3CCJ A;  1BI1 A;  4QQG A;  3JCM e;  2P0K A;  2BIV A;  1VQ8 T;  2QEX A;  2LDM A;  4MZM A;  3GPL A;  4XTW A;  2RI3 A;  4PJO A;  5GMK e;  1ZQ1 A;  4J7I A;  2CYZ B;  3BDU A;  1O75 A;  1VIF A;  1UGR B;  3HL8 A;  3CBP A;  4KUL A;  4XTU A;  3CME A;  4M7D G;  2OTJ T;  2RHY A;  2RJE A;  1RI0 A;  2F69 A;  2QI2 A;  2E6N A;  3EFS A;  4IUQ A;  3V8L A;  3GP8 A;  3CCS A;  3P8H A;  4M77 B;  4ZGJ B;  4MDW A;  5GAM d;  4M75 E;  4EMK A;  5LJ5 g;  1NJI C;  3C95 A;  3AHU A;  3NTK A;  4C92 A;  4JX6 A;  2K2V A;  2D9T A;  4QW2 A;  2D0Q B;  4ZGD B;  3HRT A;  4IUU A;  4KUI A;  2DKG A;  3L42 A;  5GAN 6;  4C8Q F;  5GMK m;  2QA4 A;  4J83 A;  1KG1 A;  4F7U A;  4N0A C;  2K5F A;  2K57 A;  3QYB A;  1I4K 1;  4O6J A;  2DXT A;  2BS2 A;  2DXC A;  1Y96 A;  1SSF A;  4PKC C;  1VQO T;  3VYG B;  2EQJ A;  3HKS A;  5DM7 R;  1RL2 A;  2R5A A;  3G6E T;  4MDX A;  3VUB A;  1WGS A;  4II1 A;  4X9D A;  1QP3 A;  4BDY A;  3CC4 A;  4QVD A;  2A3L A;  3OS2 A;  2P0P A;  3RMS A;  2MMP A;  5LJ3 h;  2M9U A;  2DTH A;  2DZ9 A;  2RHZ A;  3LX7 A;  4M75 A;  4RG2 A;  1V29 B;  5CQY A;  4C8Q C;  1K73 C;  3QYE A;  5KCH A;  5I2M A;  1YHQ A;  3L2V A;  1K8A C;  2JOY A;  4ELZ C;  2ZPI B;  2PVO B;  3L2Q A;  4GY5 A;  4A4K A;  2F5K A;  4C8Q E;  1G3S A;  3JCM h;  3VYG A;  4C92 C;  2QDJ A;  4JRI A;  4A4G A;  4Y91 A;  2DIG A;  3M53 A;  4MFE A;  4Z6Y A;  4HKE A;  4XU1 A;  2ZPG B;  1WJS A;  1WPY A;  3UDC A;  3Q1J A;  2JTF A;  2XHC A;  2KVQ G;  5GAO m;  3RKY A;  3GOX A;  2LQ8 A;  4LDY A;  4BDZ A;  2GFU A;  4M7D E;  3ZEH A;  5LJ5 h;  3V8J A;  3LWH A;  2XDP A;  3BG9 A;  3CCL T;  1AHJ B;  4PJO E;  3DB4 A;  2E70 A;  3VUZ A;  3CMA A;  3HFN A;  2JZ2 A;  3KUF A;  2PVG B;  1EIF A;  4Q5W A;  4P5N A;  3RIR A;  1Q82 C;  4NOY A;  4QVC A;  2RJF A;  1Q81 U;  3A8M B;  4RCB A;  5FRM A;  5LJ5 f;  3CCV T;  1XOV A;  4C8Q A;  4J6Y A;  4LDU A;  1D3B A;  3L1A A;  5GAN 4;  2XID A;  1UGQ B;  1BYM A;  5CAI A;  3FDR A;  3L2U A;  4AKG A;  5GAO p;  3CC7 T;  3RKX A;  1UEB A;  4FU6 A;  2DTO A;  2PU9 B;  1VQ9 T;  5CKE A;  5LJ3 g;  3CXC A;  1M1K U;  4DOW A;  3WVD B;  2DD4 B;  1VQ4 A;  3LW5 E;  2K3X A;  2XKO C;  1H3Z A;  3OYY A;  4M77 A;  5IAY A;  3H4C A;  1MGQ A;  2XK0 A;  2XDB A;  2DO3 A;  1LNX A;  3E19 A;  4PJO F;  3RES A;  3JB9 G;  3MCA B;  4FT4 A;  2LT4 A;  2LRQ A;  2RHU A;  1M1G A;  4J8O A;  3JCM g;  3SB2 A;  3FC3 A;  3BW1 A;  4PJO B;  1D3B B;  2DZC A;  1VQP A;  2PUK B;  1KD1 U;  3S3N A;  4MIM A;  5CK9 A;  3E1S A;  1VQM A;  1QVF S;  4ME7 A;  3J81 E;  4M7A D;  2QXF A;  3URG A;  3VKG A;  2EJG A;  1BIB A;  3EAE A;  3MEV A;  4OF1 A;  1IZ6 A;  2RHX A;  5GAO q;  3OA6 A;  5FU6 B;  2M0O A;  4J5Y A;  1M5Q 1;  2KSS A;  3PMT A;  3ZFJ A;  5KCO A;  1NPR A;  3FRN A;  2QEX T;  3CCE A;  4C8Q B;  3PNW C;  3CME T;  2VUB A;  4ZN1 A;  2OTJ A;  4ELY C;  5GAN f;  1N9S A;  2EJF A;  1G5V A;  1UB4 A;  3SWN C;  2BUD A;  4XAX B;  3OYL A;  4M7A A;  3M4G A;  4N4G A;  4L59 A;  4M78 B;  1VQ5 A;  3QBY A;  4NS5 A;  2LTO A;  4RCC A;  4E7I A;  4M75 D;  1KC8 C;  4JX5 A;  2C06 A;  4B9X A;  3X20 B;  3MHX A;  3OY9 A;  2HNI A;  3OW2 S;  5DLO A;  5A2Q E;  5C6S A;  1YJN T;  2P0Q A;  4C5I A;  3NTH A;  3OS5 A;  2ZPF B;  3OYN A;  4E7K A;  1O9S A;  1VQ4 T;  1I8F A;  4MML A;  2RI5 A;  3PGG A;  3QZ9 B;  5GMK h;  1JB0 E;  2FB7 A;  3QHS A;  4XU0 A;  4HNU A;  3DL1 A;  4Z02 A;  3A8G B;  4AKI A;  3G4S A;  2E65 A;  1YCY A;  3RER A;  1YIJ A;  2ZPB B;  4JLG A;  3ASK A;  3NFC A;  2QQB A;  4MMK A;  5LJ3 j;  5KE3 A;  2EWN A;  5GAN 3;  3QUI A;  3OYF A;  3JCM V;  4HCC A;  2E5Q A;  4F7U F;  4E7J A;  3M59 A;  4M75 B;  1VQ6 A;  4IUV A;  2YRV A;  2CZ0 B;  2B8A A;  3LYI A;  4C8Q D;  4F7U B;  3CXC S;  1QVF A;  1M90 C;  4M77 E;  1S72 A;  5GAN d;  5GAM j;  3OYD A;  3CC4 T;  3CD6 T;  5GAM e;  3OBW A;  3OSV A;  4BI3 A;  3MEU A;  4R56 A;  3OQ5 A;  2X4W A;  3CCM A;  3QZ5 B;  1QVG S;  4NC6 A;  2DVE A;  3GNF B;  3HZJ A;  3RMQ A;  3MP6 A;  2LT1 A;  2IG0 A;  1MHN A;  3MP1 A;  4HLQ A;  1G3Y A;  4TVR A;  2RHI A;  1PSF A;  1WNL A;  5CQX A;  2QF7 A;  4BUG A;  5GAN 7;  1FXX A;  2DD5 A;  1WJQ A;  3CC2 T;  3C12 A;  4PJO D;  1X75 C;  3I55 A;  1YBY A;  2BS4 A;  3BDL A;  4M7D B;  4VUB A;  4M7A B;  2G3R A;  4OGC A;  3X24 B;  3C94 A;  3SFM A;  5C0M A;  2M16 A;  3CPW S;  3QPH A;  3J7A F;  5A0G A;  3VKH A;  2QQ9 A;  4XK8 E;  4C5G A;  4FIB A;  4DA4 A;  2HD0 A;  3JCM J;  3CCL A;  2RB6 A;  1VQK A;  3QG1 A;  4ZTJ A;  2VXF A;  2JTM A;  4JJN K;  1I81 A;  2CS7 A;  3PIP A;  1WJR A;  2GCX A;  1QW1 A;  4JRQ A;  1Q86 C;  2LQK A;  3BY7 A;  2RK1 A;  4M78 D;  4A53 A;  3L2R A;  5D6X A;  2KMG A;  4GLK A;  4J7F A;  2VGN A;  1ZBX A;  4C92 E;  3CCR A;  3INZ A;  1I5L A;  3JSC A;  2MF2 A;  3JB9 H;  4BAC A;  2HQX A;  1Q86 U;  3CD6 A;  3PMI A;  4OB1 B;  4C92 D;  1N27 A;  2EJ9 A;  3M4Y A;  1LOJ A;  2CZ7 B;  5HKC A;  3SWN A;  4KUD K;  2FVU A;  4M77 G;  3X25 B;  2X4Y A;  4LOC A;  1M90 U;  2D6F A;  5FU7 C;  5IT9 E;  3EFR A;  3OS0 A;  3CC2 A;  5CIU A;  4QVZ A;  4M7A E;  3LGL A;  2RJD A;  2DEQ A;  2K3Y A;  2X4J A;  1QVG A;  4IUP A;  1VUB A;  5EG2 A;  4EDU A;  4OB0 B;  5CKF A;  3PTA A;  1JRI A;  3CCQ A;  5GAO r;  2BKD N;  3E9G A;  3QII A;  3V7C A;  3N5B B;  5CR2 A;  4E7L A;  1K9M U;  3QSU A;  3ZBD A;  4ZN3 A;  4M7D A;  4M7A F;  3TW7 A;  4YTL A;  1YJ9 A;  1VQ7 A;  4IKF A;  1KQ2 A;  1B34 B;  1KD1 C;  2WAC A;  4M7D D;  4FSX A;  3HP9 A;  2HQE A;  2XDD A;  3OYK A;  3GLX A;  1Q81 C;  1YHQ T;  1HK9 A;  2QTX A;  3JCM c;  3FEO A;  2M1H A;  4C92 B;  2GFA A;  2YLC A;  5HK0 A;  4HA8 A;  1X01 A;  1NPP A;  2E12 A;  2L3R A;  4MFD A;  2YHT A;  4PNO A;  4XQ3 A;  5GAO l;  1R8O B;  3OW2 A;  5LJ5 j;  2LC4 A;  2VYT A;  3ER0 A;  3FJP A;  4NL2 A;  3R6O A;  4PLL A;  2H3J A;  4BE1 A;  4N4H A;  4JDS A;  5CKH A;  1YI2 T;  5DLQ E;  4JX4 A;  4M75 C;  1VQO A;  2DIQ A;  3G6E A;  3CCU A;  1XQH A;  4M78 F;  1JJ2 A;  4HT8 A;  5J26 A;  1U1T A;  4C5E A;  3GNG A;  3G71 T;  5HK3 A;  2K4Y A;  1M1F A;  3JCM f;  1Q7Y C;  2L89 A;  2K5I A;  3CCJ T;  3JCM W;  3HB9 A;  2KAF A;  3V7R A;  3JRZ A;  3M5A A;  2DAQ A;  3OBY A;  4BD3 A;  2ZGW A;  1W2B S;  2RA2 A;  2MI6 A;  3TW6 A;  4EPC A;  2CZ6 B;  4HL4 A;  5J3B A;  2HAX A;  3CCS T;  1P92 A;  3DLL A;  3CC7 A;  2KQW A;  4M78 C;  5LJ5 d;  5D6W A;  2O4X B;  2GQV A;  4N0A A;  2BS3 A;  4MZT A;  4N4I A;  4JRP A;  3LH0 A;  3QWL A;  2EAY A;  3VKI A;  2QQ8 A;  3M55 A;  3HHT B;  5KE2 A;  2KMT A;  4Y28 E;  2FYK A;  1YIT T;  5GAN 2;  3ME9 A;  3NTI A;  2ZPE B;  2ZZD A;  2PUO B;  2OTL T;  5GAM h;  1QP2 A;  4OGE A;  1Q82 U;  2X35 A;  3VV0 A;  3CBO A;  5GAN g;  1Q7Y U;  4BBR M;  5FU6 C;  3CCU T;  1U8R A;  3LLR A;  1FWZ A;  3L2Z A;  5CO7 A;  4A54 A;  3BFM A;  2DXB A;  3HRS A;  1VQK T;  2Y90 A;  2O01 E;  1QLB A;  1N9R A;  4OVA A;  2ZPH B;  2DK3 A;  2WJ9 A;  1UGS B;  2A7Y A;  1PSE A;  4WF2 A;  3QYH B;  2MWP A;  1U1S A;  2DXU A;  2EYQ A;  5LJ3 e;  1OZ3 A;  5FRN A;  3MEW A;  4PJO C;  4M7D C;  4JS5 A;  2VXE A;  2JVV A;  4M78 E;  2QQS A;  4AKH A;  3WXM B;  4DOV A;  2R58 A;  3BG3 A;  1KQ1 A;  4M78 G;  4QQD A;  4X9C A;  2KY9 A;  4PL6 A;  4C5H A;  5I21 A;  3UPU A;  4XTZ A;  2DD4 A;  2WSC E;  4ZGE B;  4UC4 A;  3M57 A;  4J6X A;  3RUX A;  2R57 A;  5GAO n;  5GMK l;  1VQN T;  1BIA A;  3DKM A;  5LJ3 d;  2V8K A;  3M56 A;  4EMK C;  1NJI U;  3WVE B;  1YJW A;  3V8K A;  3A8O B;  2E6Z A;  3E9F A;  3OB9 A;  3PT9 A;  1Y96 B;  3OMC A;  3S3M A;  1M4Z A;  2E41 A;  2E10 A;  4DQ2 A;  3I56 A;  3CEY A;  3JCM d;  4BE0 A;  3OYB A;  1YJN A;  4BE2 A;  1YJW T;  1K9M C;  2V8J A;  2XIC A;  5CVI A;  1JBM A;  4OMF B;  1Y7X A;  1OYX A;  1WQ7 A;  2QQR A;  4M78 A;  1E7P A;  4C92 F;  5A0D A;  5M9O A;  3G4S T;  2I2L A;  2EQM A;  3V7S A;  4D6W A;  3QDR B;  1BI2 A;  5GAM g;  2ZZD B;  3JCM X;  2RD1 A;  3JB9 J;  3MO8 A;  4LDW A;  4FM4 B;  3DLM A;  5LJ5 e;  1BKB A;  1K8A U;  2L8D A;  4HCZ A;  2Y4X A;  3G7Z A;  4QSH A;  3QO3 A;  5GAM f;  1WQW A;  2KK4 A;  2LVM A;  5J39 A;  3TU4 K;  3JB9 D;  1K73 U;  4C8Q G;  5AYF A;  4EMG A;  5LJ3 f;  3M58 A;  2CGH A;  2RO0 A;  4ATO A;  4JRK A;  2VV5 A;  4AI6 A;  2RK2 A;  3QJY A;  2GF7 A;  3VU3 C;  4XTX A;  3L2W A;  4F7U E;  3MET A;  2PQW A;  1Y07 A;  1VQ9 A;  1VQ5 T;  1NE8 A;  2KDS A;  2XU8 A;  3OYJ A;  4BBS M;  1VQN A;  1M8V A;  1FX7 A;  4XTY A;  1ZHI A;  2VGM A;  3LGF A;  3JCM P;  4KBM B;  4M7A C;  3OYM A;  2RH2 A;  1VQL T;  4QQ6 A;  2KR6 A;  4B9W A;  1G3T A;  2YLB A;  2E1H A;  1UGP B;  2R5M A;  3I56 T;  1BI3 A;  4FT2 A;  3CPW A;  4ZTF A;  1VQP T;  3CMA T;  5DY9 A;  4E47 A;  5IN1 A;  1QVP A;  2ZCF B;  4M75 G;  2DXB B;  1VIE A;  3UWN A;  1XNI A;  4BI4 A;  3OYI A;  1YIJ T;  1VQ8 A;  1W2B A;  3P8B B;  3KBG A;  4M77 F;  3RKW A;  3M54 A;  1X6O A;  1KHC A;  4L6V 5;  2AHJ B;  5CKB A;  3SD4 A;  4A4E A;  3HBL A;  4LDX A;  3BG5 A;  3HFO A;  1W4S A;  2G77 A;  4JS4 A;  3CBM A;  2F5T X;  3J80 E;  2CKK A;  1OI1 A;  3M9Q A;  4M77 D;  3A8L B;  3OYA A;  3KXT A;  2QDY B;  3A5Z B;  2LNV A;  2DPP B;  1IRE B;  4OP0 A;  2JNG A;  4C92 G;  3GIB A;  4M7A G;  3HPW A;  4M6V A;  4X34 A;  4MZP A;  4HNV A;  4M77 C;  5I2S A;  1TH7 A;  2EKO A;  1N8R U;  3I55 T;  2IVW A;  5GMK j;  4O5V A;  3HO8 A;  2RJC A;  3FIF A;  3LWI A;  1N8R C;  2P4T A;  3JB9 I;  1VQL A;  2EFI A;  2OTL A;  4BB7 A;  3F70 A;  3QYG B;  3HSB A;  1KQS A;  2LCL A;  2JN0 A;  4IUR A;  3SWN B;  3S3O A;  3S6W A;  2XD0 A;  2L5Q A;  1HXD A;  4BI8 B;  3CCE T;  3CCQ T;  3P8D A;  3CPF A;  1OZ2 A;  3DB3 A;  1KHI A;  3MEA A;  3OMG A;  5D6Y A;  5L8R E;  3JCM b;  4V2S A;  1VQ6 T;  5HY6 A;  5LL6 S;  4C0G A;  2DTI A;  4IUT A;  4PJO G;  3JB9 F;  5FRO A;  1S72 T;  3GF5 A;  4FL6 A;  4XU3 A;  4M75 F;  4HCB A;  2WSE E;  3O8V A;  4CRI A;  1LJO A;  2RM4 A;  3OYG A;  3OYH A;  3CCM T;  3TEE A;  3SDZ A;  3TRE A;  1DJ7 B;  2LX9 A;  2NLU A;  2WSF E;  4KT0 E;  1N6A A;  5GAN h;  4L5G A;  2DJZ A;  2OAU A;  1FKM A;  4A4F A;  4RMO A;  5CCA A;  2JUF A;  4XTV A;  4A4H A;  4HT9 A;  4J6W A;  3T9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...