2ZPFB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 18min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpfB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpfB02
2CZ7B 4ZGDB 4L6V5 1V29B 2DXCB 2ZPFB 4OB2B 2CYZB 1QP3A 2PVGB 3VYGA 2WSFE 4KT0E 1GXIE 3X24B 2DPPB 2CZ1B 2QDYB 1IREB 3VYHB 3VYGB 2PVOB 2WSEE 1UGPB 1UGRB 2ZPIB 2DD4A 2ZPBB 2D0QB 3LW5E 2DD4B 3X25B 3HHTB 4XK8E 2PU9B 2AHJB 2PUKB 3X28B 2DXBA 3A8HB 2ZPHB 3QXEB 3A8GB 4OB1B 4OB3B 4RKUE 2DXBB 3A8OB 3A8LB 3QYGB 4OB0B 2DD5A 1JB0E 3WVEB 1UGSB 4Y28E 3QYHB 1QP2A 2DD5B 1AHJB 3WVDB 2ZPGB 3X26B 4FM4B 2PVDB 1PSFA 2WSCE 2ZCFB 2ZPEB 2O01E 4ZGJB 3QZ9B 3X20B 2ZZDA 1UGQB 5L8RE 3QZ5B 2PUOB 2CZ6B 3A8MB 2ZZDB 2CZ0B 4ZGEB 2DXCA 1PSEA 1DJ7B
chains in the Genus database with same CATH superfamily
4ZGDB 2CP6A 1VQOQ 3U23A 2ZPFB 1OPLA 1TUDA 1U1TA 2HD0A 2OTLA 4IMYB 3I35A 4KULA 4C5IA 2R5MA 3M57A 5KYYB 2JOYA 5EG2A 1D0XA 1UJ0A 5IH2A 2CREA 5GAMd 3OYFA 2M1HA 3BHUB 3NTIA 1FMWA 1ZA2B 4J5YA 2PK2A 4EONB 1PKTA 2J6KA 1C6VX 2DD4A 4E7ZA 1KFZA 4NSTB 4JZ4A 3I56T 1D3BB 5J26A 1TG0A 1NEBA 2L5QA 1EIFA 4C92B 1CKAA 5KE2A 1X01A 2KEAA 2DTIA 1E6HA 2F69A 1YI2Q 2L3PA 4MFEA 3G71A 2VB6A 3X28B 1LOJA 2QTXA 2R57A 1ZSGA 2RMOA 2QDLA 5FW9A 2E6ZA 3RIRA 2LTOA 5CR2A 5HK0A 4OVAA 2LQ8A 4JX6A 1WQWA 1YHQT 4PNOA 4RTZA 1WGSA 2AZVA 4J9DA 1WHHA 4N4HA 5FU6B 3WVEB 5GMKl 3CEYA 4BB7A 2DZCA 2KDSA 4C0DC 3O0GD 1M1KC 3C94A 4HXJA 3X26B 1WA7A 3MEWA 4JRIA 3QSUA 1VQ5A 4ZNXA 1GUXB 4E7SA 3OY9A 4DQ2A 5D6WA 2JS2A 1SRMA 2ZGWA 1X75C 2FPFA 2K3BA 4EMKC 3MJXA 2CUBA 2A28A 3GF5A 2I40B 1SPKA 2CP0A 3LGLA 1H24B 4C0FA 2D0NA 1OZ3A 1YI2T 4C0ZA 4HCZA 8ATCB 3J81E 3CC2Q 1O9SA 3VUZA 1PRLC 1Z9ZA 2CSQA 3JRZA 1YJWQ 4ATOA 4R0KA 1QCNA 1O9KB 3URGA 1VINA 4QKUA 2PZ1A 2RA2A 2IW6B 3M0SA 3JCMe 3SDZA 4XU0A 2Y4XA 4KUDK 1QMCA 3V7CA 1ZUKA 3BFMA 1H1SB 5LMKB 5BNJB 3QYEA 2CZ1B 5GJVB 2L89A 2RN8A 1UGPB 4HCBA 4GY5A 4C92G 3RKXA 2W96A 4M7DD 3JCMf 3M9QA 2GBQA 1UEBA 2ED0A 2K79A 4JRPA 4M78D 3MEVA 3MO8A 4UC4A 1H4LD 3O5ZA 3C95A 2R7GA 1ZSZA 1UNGD 5AT1B 2M51A 3SHWA 3DTOA 3ZL7C 1QCFA 4JX4A 1MV0B 3QHRB 4YC3B 5EFQB 3CCLQ 3OYHA 3CBMA 1I0CA 1VQ9Q 1YJWT 4BE0A 3E9GA 3M0PA 3C0CA 1RAIB 1QCOA 5HBHB 1XQHA 2DTOA 3PE0A 1BCOA 2K9GA 1VQPT 2JMCA 4QVZA 2KSSA 1JRIA 2KR3A 4M77A 4EOLB 1GH6B 2FVUA 2YUPA 3HFNA 1YN8A 4M77E 4PK4A 2FO0A 5ACBA 4JJDA 2PJQA 1RI0A 4P5NA 1MMNA 4XQ3A 1TFBA 3EHRA 4PJNA 3K7AM 3L2ZA 4X1VA 5HCKA 4ELJA 4X34A 2E5QA 2VGMA 2LC4A 1M4ZA 3CCMA 1KD1C 4CC2A 2LVMA 3H0FA 3NDQA 2GFAA 1JO8A 3PTAA 3D7SB 2CZ6B 1IGQA 4BE2A 1QKWA 1OV3A 1YFNA 4CFWB 1TUCA 4Y91A 3S3OA 3EG2A 5FROA 4B6MA 3CCLT 2EGAA 1ACMB 1VQ9T 1GCQA 3BG9A 2IW8B 3DDPB 4I3ZB 3LGFA 4MMKA 2KRSA 1X2QA 3H0IA 5KCHA 4JJNK 2FPDA 1H3ZA 4M77F 3CMEQ 4MZPA 3VJPA 2DERA 3HP9A 1W98B 2EPDA 4ESRA 1AT1B 1Y71A 2O2OA 4RTWA 4DBRA 4ELLA 3BHTB 2VC8A 2DIQA 3TNIB 4KGXB 4BACA 1KHCA 2DVJA 2E3IA 2EGEA 5HY6A 4BY6B 3CCSA 4J9EA 2ZPBB 5IN1A 2FPEA 1N8RC 1QVPA 2WIPB 4AFZC 3X25B 1SHFA 4V2SA 5IXFA 3HHTB 3I5RA 2YRVA 2QI2A 4BCHB 5KYNA 5C0MA 1JJ2S 2JM9A 1QKXA 1TSFA 5EC7A 1H1RB 3A8GB 1M27C 2E70A 4F04B 1VIFA 1R8OB 2EQIA 2XIDA 3CCQT 2MF2A 4OB0B 1WX6A 3CC7Q 3EH1A 4BY7X 2DNUA 3INZA 1LCKA 1RAFB 2EFIA 1E7PA 2D6FA 3BLHB 5GMKi 1KJWA 2EKOA 4XTZA 4J9HA 3G6EQ 2HNIA 3CD6T 3CMET 1MUZA 1AISB 1WJRA 2PHGA 4J7IA 3V7RA 2ZPGB 1ZP2A 1I4K1 4EOJB 3TW6A 4PJLA 5GAN5 1SHGA 4M7DB 1IB8A 3POMA 3JSCA 2YUNA 1MNEA 5KE3A 4PFZA 4OMLA 4M78B 3VUBA 4ZGJB 3QZ9B 2D9TA 4F6WB 2WMBB 1MGQA 1K76A 2L0AA 1YJNQ 4ORZA 1VQMQ 1YWPA 2XK0A 2XICA 3L2UA 1LPLA 1X6BA 2V26A 5LJ3g 2DO3A 4OMOA 1S72A 4OP0A 2PK9B 1UTIA 3A1PA 4M75D 2G9XB 2H8HA 2CT3A 3ULRB 3UT1A 2FRWA 1UHCA 5KYYA 1V29B 4E7HA 7AT1B 3CC7T 3TN8B 4CI0C 5GANg 4DEYA 2VVKA 5J39A 1WHJA 1JJ2A 1N4MA 1YJ9A 4RTVA 4N4IA 3G4SQ 3H0HA 4M7AD 4AFQC 2QDYB 1WQ7A 1RAAB 1D3BA 2CKKA 5LJ3h 5GMKh 2LCCA 2RF0A 2HBWA 3M0RA 3NTHA 2X1NB 3EFRA 2EWNA 4O6JA 2MIOA 2O4XB 1UDLA 1VYUA 2Z0WA 2RQUA 2G77A 1HSQA 4XK8E 1YJNT 1G3YA 4BCMD 4CXAB 5FWBA 1VQMT 5GANh 1AWOA 1ZUYA 2XMFA 3OYLA 1KQSP 3RUXA 1K73U 2O31A 1D3UB 3M55A 4M77C 3DB3A 4FT4A 2GF7A 3OYGA 2DM1A 5DQVA 4Z6YA 2GCXA 3L1AA 2VASA 2H3JA 1X27A 1GUXA 3OMGA 2LX7A 1SRLA 1U3OA 4J9IA 3JCMQ 4HNTA 2OTLT 3H8ZA 4M78G 3PMIA 1RI9A 2AK5A 4KUIA 1NBEB 5KYXB 4L5GA 5GMKm 4HL4A 4Q5WA 3QO3A 2RK2A 4E7IA 4B9XA 2ENMA 2ROLA 1VQKA 1WYXA 2EYWA 3I5SA 1QQJA 1MMDA 2I0NA 2O9VA 1KQSS 3EAEA 5KYUB 4D8DA 4QSHA 5ECAA 2BIVA 2JZ2A 3JCMb 4II1A 1O9KA 1GBQA 4LUDA 4DOWA 3V7SA 1YBYA 3G71T 3L2VA 2VGNA 2BS3A 1GCQC 2ECZA 1MMGA 5IHNA 3R6NA 4EMHA 4UN0A 2OAWA 4EDUA 1IXDA 1HYOA 4CRLB 1NPPA 4LUEA 1OULA 1C0MA 5GJWB 2HCKA 3CC4A 3ZFJA 1EX4A 5GAMe 2ED1A 1Q86C 1VQ5T 5IDPB 1M9SA 2VXFA 5A2QE 1RACB 1Y96B 2FRYA 3VS2A 2W2HA 2D1XA 3HSBA 1OL1B 2DYIA 4EOMB 3SWNB 3JB9H 4PJOD 3QHSA 1Q82C 4F70B 2AKLA 1AOJA 2AHJB 2OTJA 4M75B 2LQWA 4AI6A 1VQ7A 2DKGA 3OYDA 1W4SA 1NJIR 2IVXA 1JXMA 2JGZB 3J7AF 2DXBB 1OGUB 3GNGA 4R56A 1H1QB 1YIJA 1KQSA 2QASA 2ROTA 3DKMA 3HKSA 4FIBA 4ZN3A 3NGPA 1G3WA 2BZ8A 5GAOq 3RBBB 3CCRA 1YNZA 2E1HA 4YOZA 5LJ5h 4M7AB 1U06A 3UF4A 4LD9K 2W9ZA 3M5AA 3A98A 3I55A 1K8AC 4C0GA 3CCUQ 4JPBW 1VQLA 3EGXB 2BS2A 1UG1A 2OJ2A 4FX3B 1WXTA 2GQVA 3VS6A 2ZPEB 2E5KA 1OX8A 2KT1A 4A4GA 1PD1A 4BCMB 3CCMQ 2DLPA 4TTHA 4N4GA 1W2BP 4LOCA 4HT9A 3H9NA 3DOGB 1OEBA 3LH0A 3OSSC 1AWWA 1W1FA 1EFNA 2VWFA 1AVZC 3EH2A 3NPFA 3VRYA 3ZBDA 4EORB 4F7NB 4F7JB 4RG8A 1BYMA 5FU7B 1M3BA 2A36A 3P8BB 3G33B 2MPXC 4NL3A 4BDZA 1YCYA 1BK2A 3CBPA 3DDQB 1H641 2WSFE 2YUQA 4F7LB 1RABB 2EJFA 4WTOB 2UZEB 4IUQA 4JRKA 5HQ0B 2V8JA 3TNWB 1YHQQ 2OX7A 1I07A 2K5LA 1W2BS 3CCSQ 2DVEA 1PNJA 4M75G 2J06A 5IHKA 2R58A 5CIUA 4BXXX 3CCMT 2HEQA 3NFCA 4IIMA 4L59A 3S3NA 4MMLA 2RJDA 1ZUUA 5FU6C 4PFOA 3OMCA 2ZPHB 1N9RA 3EFOB 2F2CA 4RG2A 2D8HA 1IGUA 3REAB 2YLBA 4M7AG 2K7AA 5CAIA 4PLIA 1H1PB 2MOXA 3TU4K 1QLYA 2HDAA 4KBMB 2FZCB 4M7DA 5DLOA 3NMZC 5A0DA 2EKHA 4AFSC 4E7JA 4M7DE 3FJ5A 4M78A 2LT1A 3QWLA 1AZGB 1JQQA 5I2MA 1OIYB 4M78E 3SFMA 1VA7A 5FLXE 2AIRB 1Y07A 5C6SA 1M90C 1OU9A 3GLXA 1M1KR 3CCST 3PMTA 1JBMA 3PT9A 1VYTA 2C0OA 1UHFA 5GMKj 5LJ3j 2LT4A 4J6WA 2C4GB 5DQWA 2RQVA 5LQFB 1PCXA 2LCSA 2W99A 5CCAA 2GFUA 1LJOA 4IUVA 2YRDA 3LH5A 2ZZDB 3TQ7P 1Q7YC 1VUBA 1YITA 2HAXA 1W2BA 2KRNA 3PVLA 3TNHB 3BDLA 5CKHA 5GANj 3M59A 3EGUA 2BE7D 2RJEA 1G3SA 2EAYA 2MK5A 2EQUA 1RL2A 4J9BA 3QDFA 1D0ZA 2XDBA 4M7DF 3GTMS 3GIBA 5IT9E 1GXIE 3FDRA 1YJ9Q 1GY3B 4X9DA 4DA4A 4M78F 1Z9QA 1ZX6A 3E2UA 4J6XA 4HNVA 3EG0A 4D8KA 4FSSA 2HQXA 3OYIA 2K3YA 1E7OA 2DETA 4IURA 3UA6A 1D1BA 1VQPQ 2L2PA 1K0XA 2F2VA 2D0QB 1ARKA 3E19A 5KH6A 1K73C 4RCCA 2C0TA 2DEUA 4OF1A 1JEGA 3L2RA 3JV3A 3A8HB 1WLPB 4ZTFA 2C0IA 4LD6A 4NL2A 4LNPA 1OL2B 2YXYA 2NYSA 2FL7A 3CCVA 2K2MA 3OYNA 3CBOA 3DJBA 1OKWB 1EZZB 1X69A 2FHDA 3HPWA 3V8KA 2QA4A 3EJ1B 1N6AA 4XTVA 2KNBB 1C1AA 1GFCA 2WHBB 8AT1B 4PJJA 4YOSA 2W10A 1Y57A 1YJ9T 4PJOG 2VYTA 1QVFP 3JB9F 4LDXA 5GAOl 1I1JA 3F70A 3MCAB 4OMNA 3JCMh 5DM7R 3RMSA 3GOXA 5CQXA 4MZMA 3OYJA 2CJMB 2XKOC 5KYUA 4PJMA 5HVYB 2C5NB 1E9HB 1KQ2A 1H8KA 5CO7A 2MWOA 3A5ZB 3RMQA 1HD3A 1OZ2A 2ESWA 3LLRA 4HVVA 4JDSA 3LX7A 1ZBXA 4N0AA 3KXTA 2EJ9A 4FW2A 1FYNA 1FMVA 1KD1R 2K2VA 4CFUD 1KC8C 1DJ7B 1VYWB 4JS5A 1OQKA 2DX1A 3HBLA 1QVFS 4JJBA 4MFDA 4OB2B 2CYZB 1B07A 1KG1A 2V22B 4BY6C 1VQ6A 1AEYA 1NE8A 4J9GA 3CCJA 4EOOB 1GL5A 2CDTA 2G3RA 1NJIU 2YDLA 1Q81C 1Y96A 3MIAB 2EUFA 1BIBA 3CCQQ 1BKBA 4LXCA 3SWNA 4ROEA 1KXUA 3BY7A 2LQNA 4M75A 2F2WA 1YCSB 3CD6Q 1T3LA 2QF7A 1M1FA 2EBPA 2YHTA 4F7UG 4HT8A 4M75E 2EYYA 2FG0A 3RKYA 2DXBA 3S3MA 1XNIA 1N8RR 2LMJA 3EIDB 1QW1A 3H41A 4AMCA 1VQ7Q 2DYBA 3A8OB 3FB9A 2QQ9A 3WXMB 1H26B 1QVGP 4M7AA 4M7DC 3VS3A 1YIJQ 2DJQA 3JB9J 3EG3A 2CSIA 2Y4YA 2KXCA 3KBGA 4VUBA 4M7AE 1K9MC 4M78C 3RGFB 3EGXA 4AT1B 1NEGA 4KRCB 1AHJB 3ME9A 4F7SB 2L8DA 3CMAA 2LDMA 3JAME 1UNHD 1PC0A 1UGVA 1PM3A 2LQKA 3CC4T 1VQLQ 3LWIA 4X9CA 1VQOA 1LVKA 1ZHIA 2YLCA 3F5XB 3JCMV 1QVFA 1AD6A 5FRMA 1G2BA 3OS5A 4M75F 1UB4A 1F5QB 1UGQB 3BG5A 2AT1B 4FSXA 2JT4A 1QVGS 4ROCA 1VYVA 4Y92A 2EYZA 1I5LA 4JLIA 2M16A 1VQ7T 3GNFB 3BW1A 3FRNA 3EOCB 2M02A 3EHQA 3QJYA 2HBPA 1X6OA 4M7AF 2WFYB 4BCGB 3QPHA 2E12A 1YIJT 3RERA 2CCIB 3X24B 4M6VA 4BDYA 1HJDA 2M0OA 3PVQA 1B3QA 2RQRA 2RM4A 1P5EB 4JUVA 4Z02A 2RJFA 1ENWA 1VQLT 1BI1A 1NLPC 5L23A 5FRNA 5LJ3e 5GMKe 2GNCA 2QEXA 1FWZA 2KY9A 1NZ9A 3FLGA 2OTLQ 2EQMA 4PL6A 2LRQA 1U8RA 2A3LA 2DXTA 1M3CA 4CFUB 2C5VB 1ZA1B 4PLLA 4FL6A 2XG8D 1SEMA 2LNVA 1JU5C 2KR6A 4BI8B 5LJ3f 5GANe 3DL1A 3PO3S 1M1KU 3UA7A 2RQWA 4EOQB 4C92A 3OW2P 1TWBA 4XU1A 3VS5A 2YWWA 3EGDB 3NHNA 4C92E 4EMGA 3LYIA 3RNJA 1QP2A 1GFDA 1QVGA 2E3HA 5GANf 3CC2A 2PMIB 2LJ1A 1X2KA 2AKKA 3G71Q 1K1ZA 3FEOA 3OB9A 2NUTB 5IAYA 5A0LA 2A7YA 2COZA 4C8QD 2LP5A 2X9HA 1BI2A 5D7UA 1M8MA 4F6UB 3QYBA 2HL3A 2QQBA 1SF9A 4E6RA 3UDCA 2ZZDA 2C6TB 4N0AC 5HBJB 1YWOA 4DBHA 2PUOB 3OW2S 4II5B 3BLQB 2X3WD 1VQ5Q 2X35A 2YRCA 1YITQ 2DL8A 4BCND 2HSPA 3GP8A 4EC8B 4C92F 2RNAA 4XAXB 2ATCB 4F14A 1Y0MA 3BHVB 4KH1B 2QXFA 2PVGB 4YOOA 3CPFA 2QGGA 3E9FA 5M9OA 5GAOr 4NC6A 2XU8A 2GQIA 5GAOp 1F1BB 1TTHB 2W0ZA 2LW4A 1AWXA 1IREB 1ZSZB 3SWNC 4XU2A 2EQKA 1SSFA 2JTEA 2B9RA 2JMAA 2KE9A 9ATCB 4JLGA 1LNXA 4M75C 2WPAB 4XTWA 2J05A 5ICPB 2KMTA 3REBB 3CPWP 2QAZA 4J9FA 2DL7A 3QIIA 3OS0A 3OA6A 3EG9B 1Q86R 1GRIA 2K57A 4RTTA 4Z8AA 2HQEA 2KXDA 4YTLA 4BUGA 2RQTA 4OR5B 4BCPB 1E6GA 4RUGA 2B8AA 3TEEA 4F6SB 1JKWA 4BI3A 4M7AC 2DILA 3BLRB 1NPRA 1ABOA 5LJ3d 1Q82R 2IN3A 4FYYB 1YITT 3QG1A 4EOSB 4MDXA 2KRMA 5GAMg 3THKA 1D1AA 1UGSB 5LJ5g 3CCVQ 2DA9A 1A0NB 3M58A 3OW2A 2DAQA 1H28B 1NYFA 1ABQA 1RAEB 4CFNB 1KD1U 2MCNA 4E7KA 5GANd 3M0QA 2X51A 3CPWS 4CFXB 1PHTA 2ZAEA 5HNBB 4HA8A 4R55A 3T9NA 1GBRA 3BE3A 1IRXA 4QT7A 1K8AR 3OYYA 1KK7A 5GAOm 3L2QA 5GAMh 4J83A 5HK3A 3KHIA 5FU7C 2KVQG 4RTUA 1WHKA 3M54A 3HO8A 4IIOA 2IPOB 1JSUB 2IG0A 1G3NC 2DTHA 1U5SA 3N5BB 4L6V5 2JVVA 4JX5A 5CKEA 2F2XA 4LDVA 2WMAB 4G6LB 1M1GA 1QP3A 3CCVT 3RKWA 4EOKB 1N8RU 4NOYA 2QA4T 3KUFA 1XO2A 3CCJQ 2K4YA 3O8VA 2PVOB 2WSEE 4C8QB 1H3HA 1BI3A 2P0KA 5IDNB 3JCMP 4IUTA 4KRDB 5CKFA 2RHYA 3TSZA 5KYWB 4BD3A 2P4RA 3RDVA 2UZBB 1BU2A 3G6EA 2DIGA 2DBMA 1IHVA 4KGVB 1H25B 4RODA 4JRQA 1PRMC 2JNGA 2PU9B 2K5FA 4QQGA 4HCCA 2BTTA 2NUZA 1YP5A 3CPWA 2GTJA 3C4SA 1P92A 1UE9A 2DMOA 5I11A 4Z88A 4OB1B 2MWPA 4C92C 2CS7A 4BCNB 4LDUA 1WXBA 1OPKA 4RKUE 1V1CA 1N27A 3H4CA 4IUUA 1ZBJA 1GCPA 2JN0A 2L3RA 4HNUA 2B86A 3E1SA 4DBFA 3DLLA 1UJYA 4TVRA 3HZJA 3QYHB 5I21A 3VS7A 2A0FB 3G1JA 2MI6A 3QBYA 4HVWA 1SSHA 4OMFB 3WVDB 1VQ6T 2BZXA 5J3BA 5CKBA 1R0CB 3CCJT 1OIUB 2FEIA 1G5VA 3VRZA 2COYA 1TXQA 2DFUA 4OMMA 4XTXA 1WIEA 2UUEB 3QKJA 3VS0A 4A54A 2LJ3A 3OBWA 2CCHB 4CFMB 3FIFA 3G4SA 5DY9A 3M03A 1M2OA 5LJ5d 3LQ5B 1MNDA 1FVVB 1M90R 4A4EA 4HLQA 4A63B 2JJ9A 4BCQD 1PSEA 1IO6A 2J6FA 3L42A 4QQDA 2KGTA 1M8VA 5CYIB 4PJOB 4E7LA 4HKEA 2JTMA 4KH0B 2X4YA 4XTUA 4RTXA 2KROA 4GLKA 4C8QG 1FINB 1UUEA 1Q7YR 1VQNA 2CP5A 2E4HA 4KT0E 2RD1A 3OS1A 2YT6A 5I5ZB 2EIFA 2OAUA 1MV3A 3CMAT 1S72Q 2RB6A 2L3SA 4KGZB 2DZ9A 4RCBA 1OI9B 1VQOT 2JW4A 4BBRM 1IZ6A 3HRUA 1VQ8A 3VU3C 2EYXA 4LN2A 2QEXQ 1OYXA 2CH4A 2F5TX 4HCKA 1BU1A 5CVIA 1JSTB 2KAFA 2PUKB 4CC3A 1AWJA 5L2WB 4JZ3A 1O75A 4FYWB 4ZN1A 2BZYA 1JOWA 2O4XA 3HFOA 4OB3B 2NLUA 1K73R 1TU0B 3EGDA 3VV0A 1Q95G 3A8LB 5LL6S 3TSWA 1H92A 5GAN6 1V76A 2WXVB 3EFSA 3AT1B 4A4HA 5CEIB 2PQWA 3MI9B 4E47A 1VQ4A 3HL8A 3NTKA 3M4GA 4DBQA 3MY1B 4CFVB 2NUTA 1K0SA 1NLOC 4F16A 1HXDA 5IHYA 1FX7A 3CCEA 3OQ5A 3JCMg 1URCB 1PWTA 4QVDA 1G3TA 2PVDB 2EW3A 1NM7A 4F7UB 1WNLA 2H3EB 1PSFA 3OYBA 1S72T 4C0DB 1PG5B 4BBSM 4ME7A 2NWMA 2RK1A 2NUPB 2RHZA 2EQJA 2FB7A 1FXXA 1WXUA 3VKIA 3MPUB 3GPLA 1N5ZA 1HK9A 4OGCA 3VS4A 5KYXA 2QEXT 4B9WA 4EMKB 4AKHA 2JTFA 3UWNA 1PKDB 3PNWC 1K4US 2R5AA 3HB9A 3M53A 3VS1A 4EOIB 1TH7A 5IXBA 2DRMA 2CZ7B 3P8HA 3MP6A 4FYXB 1BBZA 2ABLA 2WIHB 1VQKQ 3GBQA 4FYVB 1M5Q1 4RTYA 1Q86U 2E6NA 1B34B 3V8LA 1G83A 3QWXX 2BPMB 4J7FA 1KC8R 2V1QA 3M4YA 4WF2A 5A0GA 3VYGB 3CC2T 1Q82U 5HBEB 3C12A 2W9FA 2KT8A 3EG9A 3LW5E 2F5KA 4CRIA 1Q81R 3MEUA 4RMOA 3MP1A 4QVCA 3CCUA 4XTYA 4AFUC 2D8JA 2JXBA 4AKIA 4BCQB 3QXEB 2DXUA 2RH2A 3CC4Q 1QMZB 1M2VB 2P0PA 2P84A 5GAMj 2VKNA 5LJ5j 2K6DA 2WEVB 3QYGB 2LX9A 3JB9D 1K8AU 4IUPA 1OI1A 2CGHA 2CUDA 3TCJA 3QWYA 2XD0A 1VQKT 4Y28E 4FCYA 3QUIA 2DD5B 4FT2A 3CQTA 2RI5A 2DL3A 1KHIA 3QJ6A 5D6YA 3MKDA 2KMGA 4BCJB 2OTJQ 3META 4Z89A 2CT4A 1BCMA 3I56A 3JCMJ 1VOMA 4QQ6A 1JJ2P 2G6FX 3HTRA 1K9MR 3UATA 2DBKA 2KQWA 1ZLMA 2MAMA 4O5VA 2DL4A 1KQ1A 4J6YA 2HKQB 3I9QA 4J8OA 3CCRQ 2LZ6B 4CC4B 5IF1B 1JXOA 4GLMA 1YHQA 3IQLA 4K11A 3I55Q 4KRTA 1BB9A 3J80E 5IHIA 2COWA 4PKCC 3FC3A 3JCMd 2DXCB 4EPCA 1WJSA 3AHUA 4A4KA 5CKDA 5FGKB 3B57A 3BDUA 4C8QA 2XDPA 2V1RA 1NYGA 2QQAA 1B7TA 4JJCA 4XU3A 1KIKA 2O9SA 5KYWA 1MHNA 4A53A 4C8QE 1RUWA 4M77D 4LDYA 2OTJT 4PFPA 3PFSA 1WZOA 2AZSA 1SKUB 2MMPA 3OBYA 2CP3A 3DLMA 4AG2C 2DD4B 1Y7XA 1YI2A 1CKBA 1MMAA 1WPYA 4C5EA 2YUOA 1IHWA 5GAN3 3OYKA 1H27B 3V8JA 1WJQA 4ZTJA 3CCRT 2RI3A 3ER0A 5GAN4 2X4WA 3JCMW 3G7ZA 2X4XA 5EJCA 3I55T 2VUBA 2BKDN 2CH4W 1WHGA 1TS9A 2RPNA 1JB0E 2E65A 3FJPA 3EFOA 1M3AA 4C8QF 2HL5C 1M90U 2E41A 2X3XD 1SG5A 1R77A 3SD4A 5GAN7 1K9AA 1QLBA 4FW1A 1FMKA 3OS2A 1T0HA 4QW2A 2O88A 2RJCA 4A4FA 4ELZC 2LNHB 3OSVA 3CXCP 2ZCFB 2E10A 3ASKA 3H6ZA 4IKFA 2VXEA 2DL5A 1Q7YU 2DEQA 2HSEB 1OOTA 2J6OA 2JUFA 3SB2A 3G6ET 1I8FA 4JS4A 2HMAA 4DOVA 2GTOA 4E2FB 1I5OB 2FZKB 3OYAA 3QDRB 1YJWA 2CZ0B 2UZDB 3RR6A 4PJOA 1VQPA 1J3TA 1WI7A 5GAN8 1WHLA 4AG1C 4OMPA 4BI4A 1RAGB 1D1CA 4PJOE 2M9UA 1ZQ1A 1T0JA 3JB9I 1ZSZC 4MDWA 1KSWA 3S6WA 1U1SA 2YSQA 1XTDA 3TVTA 2Y90A 2QFZA 1N9SA 4AKGA 4C5GA 3Q1JA 3EG1A 3P8DA 3CXCS 2C06A 1VQNQ 1WHMA 2HZYA 1XJWB 3JCMc 2P0QA 3VYHB 4EIKA 2L3QA 1I81A 1D0YA 4M4ZA 1UGRB 2ZPIB 3VKGA 2DJZA 2UZLB 2CP2A 4F17A 4M7DG 1RLPC 4D6WA 4BE1A 3M0TA 2C5XB 1VQ8Q 1W6XA 1FKMA 2KBTA 3G4ST 2GGRA 1QWEA 6AT1B 2PTKA 2CP7A 3CCLA 2F1LA 2JS0A 3MP8A 1VQ9A 2QGSA 4PJOF 2KK4A 3PGGA 1VOLA 3VKHA 3SEMA 2KI7A 4LDWA 4GBQA 2VV5A 4MZTA 1XOVA 2QYZA 4Y72B 2PNIA 1D09B 1WDXA 1WFWA 5CQYA 4M77B 1BIAA 4F7UA 5GAN2 1VQ4Q 2RO0A 2SRCA 2HKNA 5DLQE 3TREA 1VQNT 2BUDA 4F7UE 3CCEQ 2K5IA 4FM4B 2EYQA 2NUPA 3MEAA 2EJGA 2K3XA 3M56A 4BCFB 4C5HA 4EMKA 3X20B 3TW7A 2QQSA 3CXCA 3R6OA 4OGEA 1KC8U 1R0BG 5L8RE 1OU8A 3JB9G 2XI9A 4ELYC 4C92D 2QA4Q 1X6GA 2HQHA 4CC7A 1VQ8T 2C5OB 2EGCA 2FZGB 1UECA 5GAOn 1X43A 4BCOB 4MIMA 5KCOA 3CCQA 1QWFA 5LJ5e 3HRSA 2JM8A 2OI3A 2XHCA 3L2WA 2WJ9A 4ANJA 5CK9A 1B34A 1UNLD 2A08A 2RHXA 3PIPA 3CD6A 3CMEA 1Q81U 4C8QC 3M0UA 3OYCA 2DF6A 3RESA 4HVUA 2QQ8A 3VYGA 5GAMf 5D6XA 5LJ5f 2A37A 1W70A 2LJ0A 2DPPB 2V8KA 1UFFA 1M30A 2DK3A 2J7IA 4LE9A 4WCIA 3ZEHA 4F7UF 1VQ4T 2QTVA 3BG3A 1OKVB 2DMEA 4EOPB 2QG9B 2IW9B 3CCET 2DRKA 2KYMA 3OYMA 4BCKB 3UPUA 1AZEA 1NJIC 1CSKA 1VIEA 2QK0A 2QGFB 3JCMX 2SEMA 1M2VA 3PIOA 1VQ6Q 2BS4A 4OMQA 1S1NA 1TOVA 1OX9A 1RLQC 2XDDA 2LCLA 1K9MU 3QHWB 5AYFA 2RHUA 5HKCA 2RI2A 3CC7A 4BCIB 2QDJA 2EVRA 4M77G 1PD0A 2DD5A 3HRTA 1NG2A 1BI0A 1TUGB 4J9CA 3LWHA 4FU6A 3DB4A 4OGRB 4DEXA 2DE0X 4NS5A 2MYSA 2RHIA 2P4TA 1TD6A 4EC9B 1RAHB 2WACA 2I2LA 2X4JA 3MY5B 5I22A 1PKSA 1C9BA 2BKZB 3I56Q 2WSCE 2O01E 3MHXA 1YJNA 1G8XA 3KFVA 4BY1X 2M0YA 1VQMA 1AD5A 3QZ5B 3OYEA 2E64A 2V8IA 4PJOC 3A8MB 2QQRA 5I2SA 2KYBA 2I53A 4ZGEB 2IIMA 2BE9B 3CCUT 2DXCA 3CMAQ 5FWCA 1RADB 2IVWA 2FYKA 1T3SA
chains in the Genus database with same CATH topology
2CZ7B 4ZGDB 3FRNA 3P8HA 3QJYA 3MP6A 2HBPA 1X6OA 2ZPFB 4M7AF 4EDUA 1U1TA 1NPPA 2HD0A 2OTLA 3QPHA 1M5Q1 2E12A 4KULA 2E6NA 1B34B 2R5MA 3M57A 3V8LA 4C5IA 2JOYA 1Q86U 3RERA 5EG2A 4J7FA 3X24B 4M6VA 4BDYA 1YIJT 5GAMd 3OYFA 2M0OA 2M1HA 2M16A 3CC4A 3M4YA 4WF2A 3NTIA 3ZFJA 5A0GA 2RM4A 3VYGB 3CC2T 4J5YA 4JUVA 4Z02A 2RJFA 5GAMe 1Q82U 1Q86C 1VQ5T 2DD4A 3C12A 1VQLT 1BI1A 1M9SA 2VXFA 5A2QE 1Y96B 3I56T 5FRNA 1D3BB 5J26A 3HSBA 5LJ3e 5GMKe 3LW5E 2F5KA 2L5QA 1EIFA 4CRIA 2QEXA 1FWZA 2KY9A 3SWNB 1NZ9A 4C92B 5KE2A 3MEUA 3QHSA 3JB9H 1Q82C 4PJOD 1X01A 3FLGA 4RMOA 2DTIA 3MP1A 2F69A 4QVCA 2EQMA 4MFEA 3G71A 2AHJB 4PL6A 2OTJA 3CCUA 2LRQA 4M75B 2A3LA 4XTYA 3X28B 2DXTA 1LOJA 1U8RA 4AI6A 2QTXA 2R57A 4AKIA 3QXEB 4PLLA 4FL6A 2DXUA 1VQ7A 2E6ZA 2RH2A 2XG8D 2LTOA 3RIRA 2DKGA 2LNVA 5HK0A 1W4SA 2KR6A 4BI8B 4OVAA 2LQ8A 5LJ3f 2P0PA 5GANe 3DL1A 3J7AF 2DXBB 4JX6A 1WQWA 1YHQT 1M1KU 3GNGA 4PNOA 5GAMj 5LJ5j 4R56A 4C92A 3QYGB 1WGSA 1YIJA 2LX9A 4N4HA 1KQSA 5FU6B 3JB9D 1K8AU 3WVEB 4IUPA 1OI1A 4XU1A 5GMKl 3DKMA 2CGHA 3HKSA 4FIBA 3TCJA 4C92E 1G3WA 4ZN3A 4EMGA 2XD0A 5GAOq 1VQKT 3LYIA 3CEYA 4Y28E 4BB7A 3CCRA 3QUIA 1QP2A 2E1HA 2DZCA 2KDSA 5LJ5h 2DD5B 1QVGA 4M7AB 4C0DC 1M1KC 3C94A 4FT2A 5D6YA 2RI5A 4LD9K 1KHIA 3M5AA 3QJ6A 3X26B 2KMGA 5GANf 3I55A 3MEWA 4JRIA 3CC2A 3QSUA 1VQ5A 1K8AC 4C0GA 3META 1VQLA 3OY9A 4DQ2A 3FEOA 5D6WA 2BS2A 3OB9A 3I56A 3JCMJ 5IAYA 4QQ6A 2ZGWA 5A0LA 2A7YA 1X75C 4EMKC 4C8QD 2GQVA 1BI2A 2ZPEB 2KQWA 2MAMA 4A4GA 3GF5A 3QYBA 2QQBA 3LGLA 3UDCA 4O5VA 2ZZDA 1KQ1A 4J6YA 4N0AC 4N4GA 4C0FA 3OYDA 4LOCA 4J8OA 1OZ3A 1YI2T 4HT9A 2PUOB 3OW2S 4C0ZA 3LH0A 4HCZA 3J81E 3OSSC 1YHQA 1O9SA 3VUZA 3JRZA 3J80E 3ZBDA 2X35A 4ATOA 4PKCC 3URGA 3FC3A 3JCMd 3GP8A 2RA2A 1BYMA 4RG8A 4C92F 4XAXB 5FU7B 2DXCB 3P8BB 4EPCA 1WJSA 3SDZA 4A4KA 3JCMe 1YCYA 4XU0A 4NL3A 2Y4XA 4BDZA 5CKDA 2QXFA 3CBPA 2PVGB 4KUDK 3CPFA 1H641 3V7CA 3BDUA 2WSFE 4C8QA 2XDPA 3BFMA 3E9FA 5M9OA 5GAOr 2QQAA 3QYEA 4NC6A 2XU8A 2EJFA 4XU3A 2CZ1B 5GAOp 1MHNA 4IUQA 4A53A 2L89A 4JRKA 4C8QE 1IREB 4M77D 3SWNC 4LDYA 2EQKA 1UGPB 4XU2A 2OTJT 4HCBA 1SSFA 3PFSA 4GY5A 2V8JA 4C92G 3RKXA 4M7DD 3JCMf 4JLGA 3M9QA 2MMPA 1LNXA 4M75C 2K5LA 3OBYA 4XTWA 1W2BS 2DVEA 1UEBA 2KMTA 4M75G 3DLMA 4JRPA 2DD4B 2R58A 4M78D 3MEVA 3MO8A 4UC4A 3QIIA 5CIUA 1Y7XA 3OS0A 3CCMT 1YI2A 3NFCA 3OA6A 3C95A 1WPYA 4L59A 4C5EA 3S3NA 5GAN3 3OYKA 2K57A 4MMLA 2RJDA 2HQEA 4YTLA 3V8JA 4BUGA 5FU6C 1WJQA 4ZTJA 3CCRT 2RI3A 3OMCA 2ZPHB 3ER0A 5GAN4 2X4WA 2B8AA 4JX4A 3TEEA 1N9RA 3JCMW 3G7ZA 2X4XA 5EJCA 4RG2A 3OYHA 3I55T 2VUBA 3CBMA 4BI3A 4M7AC 2BKDN 1YJWT 4BE0A 1NPRA 3E9GA 5LJ3d 1XQHA 2DTOA 2YLBA 1YITT 4M7AG 1VQPT 3QG1A 4MDXA 4QVZA 1JB0E 2KSSA 1JRIA 4M77A 4PLIA 5CAIA 5GAMg 3TU4K 2E65A 1UGSB 2FVUA 5LJ5g 4KBMB 3HFNA 3M58A 4M7DA 5DLOA 4M77E 5A0DA 3OW2A 3FJPA 4E7JA 2DAQA 4C8QF 1M90U 1RI0A 2E41A 4P5NA 4M7DE 4XQ3A 3SD4A 5GAN7 1QLBA 1KD1U 4M78A 4E7KA 2LT1A 5GANd 3QWLA 3L2ZA 5I2MA 3CPWS 3OS2A 4QW2A 2RJCA 4A4FA 4ELZC 4M78E 4ELJA 3SFMA 5FLXE 4X34A 3OSVA 2E5QA 1Y07A 5C6SA 5CR2A 2ZCFB 2LC4A 1M4ZA 2E10A 2VGMA 3ASKA 3H6ZA 4HA8A 4R55A 1M90C 3GLXA 3CCMA 4IKFA 2VXEA 3CCST 3T9NA 3PMTA 1KD1C 1JBMA 3PT9A 2LVMA 1Q7YU 2DEQA 3OYYA 2JUFA 2GFAA 3SB2A 5GMKj 5LJ3j 1I8FA 2LT4A 3G6ET 3PTAA 5GAOm 3L2QA 4J6WA 4JS4A 5GAMh 4DOVA 4J83A 5HK3A 3KHIA 5FU7C 3OYAA 5CCAA 2CZ6B 1LJOA 2GFUA 2KVQG 4BE2A 4IUVA 3QDRB 2ZZDB 1YJWA 2CZ0B 3M54A 3HO8A 1Q7YC 1VUBA 4Y91A 1YITA 2HAXA 1W2BA 4PJOA 1VQPA 3S3OA 5FROA 5GAN8 3CCLT 3BDLA 2IG0A 3N5BB 2DTHA 5CKHA 4L6V5 4BI4A 1VQ9T 2JVVA 5GANj 3M59A 4JX5A 5CKEA 3BG9A 4PJOE 2M9UA 1ZQ1A 2RJEA 1G3SA 3LGFA 4MMKA 3JB9I 2EAYA 4MDWA 5KCHA 2EQUA 3S6WA 1RL2A 1U1SA 4LDVA 4M77F 1XTDA 4JJNK 1H3ZA 4MZPA 1M1GA 1QP3A 3VJPA 3CCVT 2Y90A 2QFZA 3RKWA 1N9SA 3HP9A 4M7DF 4AKGA 4C5GA 2XDBA 3GIBA 3Q1JA 3P8DA 3CXCS 1Y71A 5IT9E 4NOYA 1N8RU 1GXIE 2C06A 3FDRA 2QA4T 3KUFA 4X9DA 2K4YA 4DA4A 3JCMc 4M78F 2P0QA 3VYHB 2PVOB 3O8VA 2WSEE 4HNVA 2VC8A 4J6XA 4BY6B 1I81A 2DIQA 4C8QB 4BACA 1BI3A 1KHCA 2HQXA 1UGRB 2ZPIB 2K3YA 2P0KA 4IURA 4IUTA 2ZPBB 5CKFA 5HY6A 2RHYA 3CCSA 5IN1A 3VKGA 2DJZA 4BD3A 1N8RC 1QVPA 2D0QB 3E19A 3G6EA 5KH6A 2DIGA 4M7DG 3X25B 4V2SA 1K73C 4RCCA 3HHTB 4D6WA 3OYIA 4BE1A 4JRQA 2YRVA 2QI2A 2JNGA 2PU9B 2K5FA 1FKMA 4OF1A 4QQGA 4HCCA 5C0MA 3CPWA 1JJ2S 3G4ST 3L2RA 3A8HB 1P92A 3C4SA 4ZTFA 3CCLA 3A8GB 4OB1B 2MWPA 4LD6A 4NL2A 2E70A 3MP8A 4C92C 1VIFA 2CS7A 3JCMP 1VQ9A 4LDUA 1R8OB 4RKUE 1N27A 3H4CA 2KK4A 2XIDA 3PGGA 4IUUA 4PJOF 2JN0A 2L3RA 3CCQT 2MF2A 4HNUA 3VKHA 3E1SA 4OB0B 2FL7A 4LDWA 3CCVA 3INZA 2VV5A 4MZTA 2EFIA 2D6FA 1E7PA 3CBOA 3OYNA 1XOVA 5GMKi 2EKOA 3DLLA 4XTZA 2FHDA 3HPWA 4TVRA 3V8KA 3HZJA 2HNIA 2QA4A 3QYHB 3CMET 1N6AA 5CQYA 3CD6T 4XTVA 5I21A 1WJRA 3QBYA 2MI6A 4J7IA 4M77B 1BIAA 4OMFB 4F7UA 3WVDB 2ZPGB 1I4K1 2RO0A 3V7RA 5GAN2 1VQ6T 5J3BA 5DLQE 5CKBA 4PJOG 2VYTA 3TW6A 3TREA 5GAN5 3CCJT 1YJ9T 4LDXA 1VQNT 3JB9F 4M7DB 2BUDA 4F7UE 5GAOl 2K5IA 1G5VA 3F70A 4FM4B 3JSCA 3MCAB 2EYQA 5DM7R 3JCMh 5KE3A 3RMSA 3MEAA 4XTXA 5CQXA 3GOXA 2EJGA 4M78B 2K3XA 4MZMA 3OYJA 3QKJA 3M56A 2XKOC 4C5HA 4A54A 3VUBA 4ZGJB 3QZ9B 2D9TA 3OBWA 1MGQA 3X20B 4EMKA 3TW7A 2QQSA 1KQ2A 3FIFA 3CXCA 3R6OA 4OGEA 2MWOA 3A5ZB 5CO7A 3RMQA 3G4SA 1KC8U 1OZ2A 5DY9A 2XK0A 5L8RE 3LLRA 2XICA 2XI9A 3JB9G 4ELYC 4C92D 1VQ8T 3L2UA 5LJ5d 4JDSA 5LJ3g 2DO3A 3LX7A 5GAOn 1ZBXA 4N0AA 3KXTA 2EJ9A 1S72A 4MIMA 4OP0A 4A4EA 5KCOA 4HLQA 4M75D 3CCQA 5LJ5e 3HRSA 2K2VA 2XHCA 1PSEA 1KC8C 3L2WA 1DJ7B 2WJ9A 5CK9A 3UT1A 1B34A 3L42A 4JS5A 1V29B 4QQDA 2RHXA 1M8VA 3PIPA 3CD6A 3CMEA 4E7HA 1Q81U 4PJOB 4E7LA 3HBLA 4HKEA 3CC7T 4C8QC 3OYCA 2JTMA 1QVFS 4MFDA 4OB2B 2CYZB 2X4YA 4XTUA 3RESA 4CI0C 5GANg 1KG1A 4GLKA 4BY6C 4C8QG 5J39A 1VQ6A 1JJ2A 2QQ8A 1NE8A 3VYGA 5GAMf 1YJ9A 1VQNA 5D6XA 4KT0E 5LJ5f 2RD1A 4N4IA 3CCJA 2DPPB 2V8KA 2DK3A 4F7UF 3ZEHA 3OS1A 1VQ4T 2G3RA 1NJIU 4M7AD 1Q81C 2QDYB 1Y96A 3BG3A 1WQ7A 2EIFA 1D3BA 2OAUA 2CKKA 1BIBA 5LJ3h 5GMKh 3CMAT 3CCET 2LCCA 2RB6A 1BKBA 3NTHA 3SWNA 3OYMA 3EFRA 2EWNA 2DZ9A 3BY7A 4O6JA 4RCBA 3UPUA 2O4XB 1VQOT 4BBRM 1NJIC 1IZ6A 4M75A 1VIEA 3HRUA 3JCMX 1VQ8A 2G77A 4XK8E 3VU3C 1YJNT 2QF7A 1M1FA 1G3YA 2YHTA 4F7UG 4HT8A 1OYXA 4M75E 2F5TX 3PIOA 5CVIA 1VQMT 5GANh 2KAFA 2PUKB 3RKYA 2BS4A 2DXBA 3S3MA 1O75A 1XNIA 1QW1A 3OYLA 2XDDA 2LCLA 4ZN1A 3AHUA 3RUXA 1K73U 2O4XA 3HFOA 1K9MU 4OB3B 2NLUA 5AYFA 3M55A 2RHUA 3A8OB 3FB9A 2QQ9A 3VV0A 3WXMB 3A8LB 2RI2A 4M77C 5LL6S 5HKCA 3CC7A 3DB3A 4FT4A 2QDJA 2GF7A 4M77G 5GAN6 2DD5A 3HRTA 3OYGA 4M7AA 4M7DC 1BI0A 4Z6YA 2GCXA 3EFSA 3L1AA 3JB9J 4A4HA 2H3JA 2PQWA 2Y4YA 3OMGA 3KBGA 4VUBA 4E47A 4M7AE 3LWHA 4FU6A 1K9MC 3DB4A 1VQ4A 4M78C 3JCMQ 4HNTA 3HL8A 3NTKA 3M4GA 2OTLT 1AHJB 3H8ZA 4NS5A 3ME9A 4M78G 3PMIA 2RHIA 2L8DA 2P4TA 1HXDA 2LDMA 1FX7A 3CMAA 3JAME 3OQ5A 2WACA 4KUIA 3JCMg 3CCEA 2I2LA 2X4JA 4L5GA 5GMKm 4QVDA 1G3TA 2LQKA 2PVDB 4HL4A 3BW1A 4F7UB 3LWIA 4Q5WA 1WNLA 3CC4T 4X9CA 1VQOA 3QO3A 1PSFA 3OYBA 1S72T 2WSCE 4C0DB 1ZHIA 2RK2A 4B9XA 2YLCA 4E7IA 3JCMV 1VQKA 1QVFA 5FRMA 4BBSM 2O01E 3MHXA 4ME7A 1YJNA 2RK1A 2RHZA 3OS5A 2EQJA 2FB7A 1FXXA 3VKIA 4M75F 1UB4A 1VQMA 1KQSS 3EAEA 3GPLA 1HK9A 4OGCA 1UGQB 3BG5A 3QZ5B 3OYEA 4QSHA 2QEXT 2E64A 2BIVA 4B9WA 4EMKB 2V8IA 4FSXA 2JZ2A 4AKHA 3JCMb 3A8MB 4II1A 2JTFA 2QQRA 1QVGS 4PJOC 3UWNA 4DOWA 3V7SA 5I2SA 1YBYA 3PNWC 3G71T 4ZGEB 2R5AA 3L2VA 3CCUT 3HB9A 2VGNA 2BS3A 3M53A 2DXCA 4EMHA 1I5LA 4JLIA 1TH7A 2IVWA 1VQ7T 3GNFB 2FYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ7 B;  4ZGD B;  4L6V 5;  1V29 B;  2DXC B;  2ZPF B;  4OB2 B;  2CYZ B;  1QP3 A;  2PVG B;  3VYG A;  2WSF E;  4KT0 E;  1GXI E;  3X24 B;  2DPP B;  2CZ1 B;  2QDY B;  1IRE B;  3VYH B;  3VYG B;  2PVO B;  2WSE E;  1UGP B;  1UGR B;  2ZPI B;  2DD4 A;  2ZPB B;  2D0Q B;  3LW5 E;  2DD4 B;  3X25 B;  3HHT B;  4XK8 E;  2PU9 B;  2AHJ B;  2PUK B;  3X28 B;  2DXB A;  3A8H B;  2ZPH B;  3QXE B;  3A8G B;  4OB1 B;  4OB3 B;  4RKU E;  2DXB B;  3A8O B;  3A8L B;  3QYG B;  4OB0 B;  2DD5 A;  1JB0 E;  3WVE B;  1UGS B;  4Y28 E;  3QYH B;  1QP2 A;  2DD5 B;  1AHJ B;  3WVD B;  2ZPG B;  3X26 B;  4FM4 B;  2PVD B;  1PSF A;  2WSC E;  2ZCF B;  2ZPE B;  2O01 E;  4ZGJ B;  3QZ9 B;  3X20 B;  2ZZD A;  1UGQ B;  5L8R E;  3QZ5 B;  2PUO B;  2CZ6 B;  3A8M B;  2ZZD B;  2CZ0 B;  4ZGE B;  2DXC A;  1PSE A;  1DJ7 B; 
#chains in the Genus database with same CATH topology
 4ZGD B;  2CP6 A;  1VQO Q;  3U23 A;  2ZPF B;  1OPL A;  1TUD A;  1U1T A;  2HD0 A;  2OTL A;  4IMY B;  3I35 A;  4KUL A;  4C5I A;  2R5M A;  3M57 A;  5KYY B;  2JOY A;  5EG2 A;  1D0X A;  1UJ0 A;  5IH2 A;  2CRE A;  5GAM d;  3OYF A;  2M1H A;  3BHU B;  3NTI A;  1FMW A;  1ZA2 B;  4J5Y A;  2PK2 A;  4EON B;  1PKT A;  2J6K A;  1C6V X;  2DD4 A;  4E7Z A;  1KFZ A;  4NST B;  4JZ4 A;  3I56 T;  1D3B B;  5J26 A;  1TG0 A;  1NEB A;  2L5Q A;  1EIF A;  4C92 B;  1CKA A;  5KE2 A;  1X01 A;  2KEA A;  2DTI A;  1E6H A;  2F69 A;  1YI2 Q;  2L3P A;  4MFE A;  3G71 A;  2VB6 A;  3X28 B;  1LOJ A;  2QTX A;  2R57 A;  1ZSG A;  2RMO A;  2QDL A;  5FW9 A;  2E6Z A;  3RIR A;  2LTO A;  5CR2 A;  5HK0 A;  4OVA A;  2LQ8 A;  4JX6 A;  1WQW A;  1YHQ T;  4PNO A;  4RTZ A;  1WGS A;  2AZV A;  4J9D A;  1WHH A;  4N4H A;  5FU6 B;  3WVE B;  5GMK l;  3CEY A;  4BB7 A;  2DZC A;  2KDS A;  4C0D C;  3O0G D;  1M1K C;  3C94 A;  4HXJ A;  3X26 B;  1WA7 A;  3MEW A;  4JRI A;  3QSU A;  1VQ5 A;  4ZNX A;  1GUX B;  4E7S A;  3OY9 A;  4DQ2 A;  5D6W A;  2JS2 A;  1SRM A;  2ZGW A;  1X75 C;  2FPF A;  2K3B A;  4EMK C;  3MJX A;  2CUB A;  2A28 A;  3GF5 A;  2I40 B;  1SPK A;  2CP0 A;  3LGL A;  1H24 B;  4C0F A;  2D0N A;  1OZ3 A;  1YI2 T;  4C0Z A;  4HCZ A;  8ATC B;  3J81 E;  3CC2 Q;  1O9S A;  3VUZ A;  1PRL C;  1Z9Z A;  2CSQ A;  3JRZ A;  1YJW Q;  4ATO A;  4R0K A;  1QCN A;  1O9K B;  3URG A;  1VIN A;  4QKU A;  2PZ1 A;  2RA2 A;  2IW6 B;  3M0S A;  3JCM e;  3SDZ A;  4XU0 A;  2Y4X A;  4KUD K;  1QMC A;  3V7C A;  1ZUK A;  3BFM A;  1H1S B;  5LMK B;  5BNJ B;  3QYE A;  2CZ1 B;  5GJV B;  2L89 A;  2RN8 A;  1UGP B;  4HCB A;  4GY5 A;  4C92 G;  3RKX A;  2W96 A;  4M7D D;  3JCM f;  3M9Q A;  2GBQ A;  1UEB A;  2ED0 A;  2K79 A;  4JRP A;  4M78 D;  3MEV A;  3MO8 A;  4UC4 A;  1H4L D;  3O5Z A;  3C95 A;  2R7G A;  1ZSZ A;  1UNG D;  5AT1 B;  2M51 A;  3SHW A;  3DTO A;  3ZL7 C;  1QCF A;  4JX4 A;  1MV0 B;  3QHR B;  4YC3 B;  5EFQ B;  3CCL Q;  3OYH A;  3CBM A;  1I0C A;  1VQ9 Q;  1YJW T;  4BE0 A;  3E9G A;  3M0P A;  3C0C A;  1RAI B;  1QCO A;  5HBH B;  1XQH A;  2DTO A;  3PE0 A;  1BCO A;  2K9G A;  1VQP T;  2JMC A;  4QVZ A;  2KSS A;  1JRI A;  2KR3 A;  4M77 A;  4EOL B;  1GH6 B;  2FVU A;  2YUP A;  3HFN A;  1YN8 A;  4M77 E;  4PK4 A;  2FO0 A;  5ACB A;  4JJD A;  2PJQ A;  1RI0 A;  4P5N A;  1MMN A;  4XQ3 A;  1TFB A;  3EHR A;  4PJN A;  3K7A M;  3L2Z A;  4X1V A;  5HCK A;  4ELJ A;  4X34 A;  2E5Q A;  2VGM A;  2LC4 A;  1M4Z A;  3CCM A;  1KD1 C;  4CC2 A;  2LVM A;  3H0F A;  3NDQ A;  2GFA A;  1JO8 A;  3PTA A;  3D7S B;  2CZ6 B;  1IGQ A;  4BE2 A;  1QKW A;  1OV3 A;  1YFN A;  4CFW B;  1TUC A;  4Y91 A;  3S3O A;  3EG2 A;  5FRO A;  4B6M A;  3CCL T;  2EGA A;  1ACM B;  1VQ9 T;  1GCQ A;  3BG9 A;  2IW8 B;  3DDP B;  4I3Z B;  3LGF A;  4MMK A;  2KRS A;  1X2Q A;  3H0I A;  5KCH A;  4JJN K;  2FPD A;  1H3Z A;  4M77 F;  3CME Q;  4MZP A;  3VJP A;  2DER A;  3HP9 A;  1W98 B;  2EPD A;  4ESR A;  1AT1 B;  1Y71 A;  2O2O A;  4RTW A;  4DBR A;  4ELL A;  3BHT B;  2VC8 A;  2DIQ A;  3TNI B;  4KGX B;  4BAC A;  1KHC A;  2DVJ A;  2E3I A;  2EGE A;  5HY6 A;  4BY6 B;  3CCS A;  4J9E A;  2ZPB B;  5IN1 A;  2FPE A;  1N8R C;  1QVP A;  2WIP B;  4AFZ C;  3X25 B;  1SHF A;  4V2S A;  5IXF A;  3HHT B;  3I5R A;  2YRV A;  2QI2 A;  4BCH B;  5KYN A;  5C0M A;  1JJ2 S;  2JM9 A;  1QKX A;  1TSF A;  5EC7 A;  1H1R B;  3A8G B;  1M27 C;  2E70 A;  4F04 B;  1VIF A;  1R8O B;  2EQI A;  2XID A;  3CCQ T;  2MF2 A;  4OB0 B;  1WX6 A;  3CC7 Q;  3EH1 A;  4BY7 X;  2DNU A;  3INZ A;  1LCK A;  1RAF B;  2EFI A;  1E7P A;  2D6F A;  3BLH B;  5GMK i;  1KJW A;  2EKO A;  4XTZ A;  4J9H A;  3G6E Q;  2HNI A;  3CD6 T;  3CME T;  1MUZ A;  1AIS B;  1WJR A;  2PHG A;  4J7I A;  3V7R A;  2ZPG B;  1ZP2 A;  1I4K 1;  4EOJ B;  3TW6 A;  4PJL A;  5GAN 5;  1SHG A;  4M7D B;  1IB8 A;  3POM A;  3JSC A;  2YUN A;  1MNE A;  5KE3 A;  4PFZ A;  4OML A;  4M78 B;  3VUB A;  4ZGJ B;  3QZ9 B;  2D9T A;  4F6W B;  2WMB B;  1MGQ A;  1K76 A;  2L0A A;  1YJN Q;  4ORZ A;  1VQM Q;  1YWP A;  2XK0 A;  2XIC A;  3L2U A;  1LPL A;  1X6B A;  2V26 A;  5LJ3 g;  2DO3 A;  4OMO A;  1S72 A;  4OP0 A;  2PK9 B;  1UTI A;  3A1P A;  4M75 D;  2G9X B;  2H8H A;  2CT3 A;  3ULR B;  3UT1 A;  2FRW A;  1UHC A;  5KYY A;  1V29 B;  4E7H A;  7AT1 B;  3CC7 T;  3TN8 B;  4CI0 C;  5GAN g;  4DEY A;  2VVK A;  5J39 A;  1WHJ A;  1JJ2 A;  1N4M A;  1YJ9 A;  4RTV A;  4N4I A;  3G4S Q;  3H0H A;  4M7A D;  4AFQ C;  2QDY B;  1WQ7 A;  1RAA B;  1D3B A;  2CKK A;  5LJ3 h;  5GMK h;  2LCC A;  2RF0 A;  2HBW A;  3M0R A;  3NTH A;  2X1N B;  3EFR A;  2EWN A;  4O6J A;  2MIO A;  2O4X B;  1UDL A;  1VYU A;  2Z0W A;  2RQU A;  2G77 A;  1HSQ A;  4XK8 E;  1YJN T;  1G3Y A;  4BCM D;  4CXA B;  5FWB A;  1VQM T;  5GAN h;  1AWO A;  1ZUY A;  2XMF A;  3OYL A;  1KQS P;  3RUX A;  1K73 U;  2O31 A;  1D3U B;  3M55 A;  4M77 C;  3DB3 A;  4FT4 A;  2GF7 A;  3OYG A;  2DM1 A;  5DQV A;  4Z6Y A;  2GCX A;  3L1A A;  2VAS A;  2H3J A;  1X27 A;  1GUX A;  3OMG A;  2LX7 A;  1SRL A;  1U3O A;  4J9I A;  3JCM Q;  4HNT A;  2OTL T;  3H8Z A;  4M78 G;  3PMI A;  1RI9 A;  2AK5 A;  4KUI A;  1NBE B;  5KYX B;  4L5G A;  5GMK m;  4HL4 A;  4Q5W A;  3QO3 A;  2RK2 A;  4E7I A;  4B9X A;  2ENM A;  2ROL A;  1VQK A;  1WYX A;  2EYW A;  3I5S A;  1QQJ A;  1MMD A;  2I0N A;  2O9V A;  1KQS S;  3EAE A;  5KYU B;  4D8D A;  4QSH A;  5ECA A;  2BIV A;  2JZ2 A;  3JCM b;  4II1 A;  1O9K A;  1GBQ A;  4LUD A;  4DOW A;  3V7S A;  1YBY A;  3G71 T;  3L2V A;  2VGN A;  2BS3 A;  1GCQ C;  2ECZ A;  1MMG A;  5IHN A;  3R6N A;  4EMH A;  4UN0 A;  2OAW A;  4EDU A;  1IXD A;  1HYO A;  4CRL B;  1NPP A;  4LUE A;  1OUL A;  1C0M A;  5GJW B;  2HCK A;  3CC4 A;  3ZFJ A;  1EX4 A;  5GAM e;  2ED1 A;  1Q86 C;  1VQ5 T;  5IDP B;  1M9S A;  2VXF A;  5A2Q E;  1RAC B;  1Y96 B;  2FRY A;  3VS2 A;  2W2H A;  2D1X A;  3HSB A;  1OL1 B;  2DYI A;  4EOM B;  3SWN B;  3JB9 H;  4PJO D;  3QHS A;  1Q82 C;  4F70 B;  2AKL A;  1AOJ A;  2AHJ B;  2OTJ A;  4M75 B;  2LQW A;  4AI6 A;  1VQ7 A;  2DKG A;  3OYD A;  1W4S A;  1NJI R;  2IVX A;  1JXM A;  2JGZ B;  3J7A F;  2DXB B;  1OGU B;  3GNG A;  4R56 A;  1H1Q B;  1YIJ A;  1KQS A;  2QAS A;  2ROT A;  3DKM A;  3HKS A;  4FIB A;  4ZN3 A;  3NGP A;  1G3W A;  2BZ8 A;  5GAO q;  3RBB B;  3CCR A;  1YNZ A;  2E1H A;  4YOZ A;  5LJ5 h;  4M7A B;  1U06 A;  3UF4 A;  4LD9 K;  2W9Z A;  3M5A A;  3A98 A;  3I55 A;  1K8A C;  4C0G A;  3CCU Q;  4JPB W;  1VQL A;  3EGX B;  2BS2 A;  1UG1 A;  2OJ2 A;  4FX3 B;  1WXT A;  2GQV A;  3VS6 A;  2ZPE B;  2E5K A;  1OX8 A;  2KT1 A;  4A4G A;  1PD1 A;  4BCM B;  3CCM Q;  2DLP A;  4TTH A;  4N4G A;  1W2B P;  4LOC A;  4HT9 A;  3H9N A;  3DOG B;  1OEB A;  3LH0 A;  3OSS C;  1AWW A;  1W1F A;  1EFN A;  2VWF A;  1AVZ C;  3EH2 A;  3NPF A;  3VRY A;  3ZBD A;  4EOR B;  4F7N B;  4F7J B;  4RG8 A;  1BYM A;  5FU7 B;  1M3B A;  2A36 A;  3P8B B;  3G33 B;  2MPX C;  4NL3 A;  4BDZ A;  1YCY A;  1BK2 A;  3CBP A;  3DDQ B;  1H64 1;  2WSF E;  2YUQ A;  4F7L B;  1RAB B;  2EJF A;  4WTO B;  2UZE B;  4IUQ A;  4JRK A;  5HQ0 B;  2V8J A;  3TNW B;  1YHQ Q;  2OX7 A;  1I07 A;  2K5L A;  1W2B S;  3CCS Q;  2DVE A;  1PNJ A;  4M75 G;  2J06 A;  5IHK A;  2R58 A;  5CIU A;  4BXX X;  3CCM T;  2HEQ A;  3NFC A;  4IIM A;  4L59 A;  3S3N A;  4MML A;  2RJD A;  1ZUU A;  5FU6 C;  4PFO A;  3OMC A;  2ZPH B;  1N9R A;  3EFO B;  2F2C A;  4RG2 A;  2D8H A;  1IGU A;  3REA B;  2YLB A;  4M7A G;  2K7A A;  5CAI A;  4PLI A;  1H1P B;  2MOX A;  3TU4 K;  1QLY A;  2HDA A;  4KBM B;  2FZC B;  4M7D A;  5DLO A;  3NMZ C;  5A0D A;  2EKH A;  4AFS C;  4E7J A;  4M7D E;  3FJ5 A;  4M78 A;  2LT1 A;  3QWL A;  1AZG B;  1JQQ A;  5I2M A;  1OIY B;  4M78 E;  3SFM A;  1VA7 A;  5FLX E;  2AIR B;  1Y07 A;  5C6S A;  1M90 C;  1OU9 A;  3GLX A;  1M1K R;  3CCS T;  3PMT A;  1JBM A;  3PT9 A;  1VYT A;  2C0O A;  1UHF A;  5GMK j;  5LJ3 j;  2LT4 A;  4J6W A;  2C4G B;  5DQW A;  2RQV A;  5LQF B;  1PCX A;  2LCS A;  2W99 A;  5CCA A;  2GFU A;  1LJO A;  4IUV A;  2YRD A;  3LH5 A;  2ZZD B;  3TQ7 P;  1Q7Y C;  1VUB A;  1YIT A;  2HAX A;  1W2B A;  2KRN A;  3PVL A;  3TNH B;  3BDL A;  5CKH A;  5GAN j;  3M59 A;  3EGU A;  2BE7 D;  2RJE A;  1G3S A;  2EAY A;  2MK5 A;  2EQU A;  1RL2 A;  4J9B A;  3QDF A;  1D0Z A;  2XDB A;  4M7D F;  3GTM S;  3GIB A;  5IT9 E;  1GXI E;  3FDR A;  1YJ9 Q;  1GY3 B;  4X9D A;  4DA4 A;  4M78 F;  1Z9Q A;  1ZX6 A;  3E2U A;  4J6X A;  4HNV A;  3EG0 A;  4D8K A;  4FSS A;  2HQX A;  3OYI A;  2K3Y A;  1E7O A;  2DET A;  4IUR A;  3UA6 A;  1D1B A;  1VQP Q;  2L2P A;  1K0X A;  2F2V A;  2D0Q B;  1ARK A;  3E19 A;  5KH6 A;  1K73 C;  4RCC A;  2C0T A;  2DEU A;  4OF1 A;  1JEG A;  3L2R A;  3JV3 A;  3A8H B;  1WLP B;  4ZTF A;  2C0I A;  4LD6 A;  4NL2 A;  4LNP A;  1OL2 B;  2YXY A;  2NYS A;  2FL7 A;  3CCV A;  2K2M A;  3OYN A;  3CBO A;  3DJB A;  1OKW B;  1EZZ B;  1X69 A;  2FHD A;  3HPW A;  3V8K A;  2QA4 A;  3EJ1 B;  1N6A A;  4XTV A;  2KNB B;  1C1A A;  1GFC A;  2WHB B;  8AT1 B;  4PJJ A;  4YOS A;  2W10 A;  1Y57 A;  1YJ9 T;  4PJO G;  2VYT A;  1QVF P;  3JB9 F;  4LDX A;  5GAO l;  1I1J A;  3F70 A;  3MCA B;  4OMN A;  3JCM h;  5DM7 R;  3RMS A;  3GOX A;  5CQX A;  4MZM A;  3OYJ A;  2CJM B;  2XKO C;  5KYU A;  4PJM A;  5HVY B;  2C5N B;  1E9H B;  1KQ2 A;  1H8K A;  5CO7 A;  2MWO A;  3A5Z B;  3RMQ A;  1HD3 A;  1OZ2 A;  2ESW A;  3LLR A;  4HVV A;  4JDS A;  3LX7 A;  1ZBX A;  4N0A A;  3KXT A;  2EJ9 A;  4FW2 A;  1FYN A;  1FMV A;  1KD1 R;  2K2V A;  4CFU D;  1KC8 C;  1DJ7 B;  1VYW B;  4JS5 A;  1OQK A;  2DX1 A;  3HBL A;  1QVF S;  4JJB A;  4MFD A;  4OB2 B;  2CYZ B;  1B07 A;  1KG1 A;  2V22 B;  4BY6 C;  1VQ6 A;  1AEY A;  1NE8 A;  4J9G A;  3CCJ A;  4EOO B;  1GL5 A;  2CDT A;  2G3R A;  1NJI U;  2YDL A;  1Q81 C;  1Y96 A;  3MIA B;  2EUF A;  1BIB A;  3CCQ Q;  1BKB A;  4LXC A;  3SWN A;  4ROE A;  1KXU A;  3BY7 A;  2LQN A;  4M75 A;  2F2W A;  1YCS B;  3CD6 Q;  1T3L A;  2QF7 A;  1M1F A;  2EBP A;  2YHT A;  4F7U G;  4HT8 A;  4M75 E;  2EYY A;  2FG0 A;  3RKY A;  2DXB A;  3S3M A;  1XNI A;  1N8R R;  2LMJ A;  3EID B;  1QW1 A;  3H41 A;  4AMC A;  1VQ7 Q;  2DYB A;  3A8O B;  3FB9 A;  2QQ9 A;  3WXM B;  1H26 B;  1QVG P;  4M7A A;  4M7D C;  3VS3 A;  1YIJ Q;  2DJQ A;  3JB9 J;  3EG3 A;  2CSI A;  2Y4Y A;  2KXC A;  3KBG A;  4VUB A;  4M7A E;  1K9M C;  4M78 C;  3RGF B;  3EGX A;  4AT1 B;  1NEG A;  4KRC B;  1AHJ B;  3ME9 A;  4F7S B;  2L8D A;  3CMA A;  2LDM A;  3JAM E;  1UNH D;  1PC0 A;  1UGV A;  1PM3 A;  2LQK A;  3CC4 T;  1VQL Q;  3LWI A;  4X9C A;  1VQO A;  1LVK A;  1ZHI A;  2YLC A;  3F5X B;  3JCM V;  1QVF A;  1AD6 A;  5FRM A;  1G2B A;  3OS5 A;  4M75 F;  1UB4 A;  1F5Q B;  1UGQ B;  3BG5 A;  2AT1 B;  4FSX A;  2JT4 A;  1QVG S;  4ROC A;  1VYV A;  4Y92 A;  2EYZ A;  1I5L A;  4JLI A;  2M16 A;  1VQ7 T;  3GNF B;  3BW1 A;  3FRN A;  3EOC B;  2M02 A;  3EHQ A;  3QJY A;  2HBP A;  1X6O A;  4M7A F;  2WFY B;  4BCG B;  3QPH A;  2E12 A;  1YIJ T;  3RER A;  2CCI B;  3X24 B;  4M6V A;  4BDY A;  1HJD A;  2M0O A;  3PVQ A;  1B3Q A;  2RQR A;  2RM4 A;  1P5E B;  4JUV A;  4Z02 A;  2RJF A;  1ENW A;  1VQL T;  1BI1 A;  1NLP C;  5L23 A;  5FRN A;  5LJ3 e;  5GMK e;  2GNC A;  2QEX A;  1FWZ A;  2KY9 A;  1NZ9 A;  3FLG A;  2OTL Q;  2EQM A;  4PL6 A;  2LRQ A;  1U8R A;  2A3L A;  2DXT A;  1M3C A;  4CFU B;  2C5V B;  1ZA1 B;  4PLL A;  4FL6 A;  2XG8 D;  1SEM A;  2LNV A;  1JU5 C;  2KR6 A;  4BI8 B;  5LJ3 f;  5GAN e;  3DL1 A;  3PO3 S;  1M1K U;  3UA7 A;  2RQW A;  4EOQ B;  4C92 A;  3OW2 P;  1TWB A;  4XU1 A;  3VS5 A;  2YWW A;  3EGD B;  3NHN A;  4C92 E;  4EMG A;  3LYI A;  3RNJ A;  1QP2 A;  1GFD A;  1QVG A;  2E3H A;  5GAN f;  3CC2 A;  2PMI B;  2LJ1 A;  1X2K A;  2AKK A;  3G71 Q;  1K1Z A;  3FEO A;  3OB9 A;  2NUT B;  5IAY A;  5A0L A;  2A7Y A;  2COZ A;  4C8Q D;  2LP5 A;  2X9H A;  1BI2 A;  5D7U A;  1M8M A;  4F6U B;  3QYB A;  2HL3 A;  2QQB A;  1SF9 A;  4E6R A;  3UDC A;  2ZZD A;  2C6T B;  4N0A C;  5HBJ B;  1YWO A;  4DBH A;  2PUO B;  3OW2 S;  4II5 B;  3BLQ B;  2X3W D;  1VQ5 Q;  2X35 A;  2YRC A;  1YIT Q;  2DL8 A;  4BCN D;  2HSP A;  3GP8 A;  4EC8 B;  4C92 F;  2RNA A;  4XAX B;  2ATC B;  4F14 A;  1Y0M A;  3BHV B;  4KH1 B;  2QXF A;  2PVG B;  4YOO A;  3CPF A;  2QGG A;  3E9F A;  5M9O A;  5GAO r;  4NC6 A;  2XU8 A;  2GQI A;  5GAO p;  1F1B B;  1TTH B;  2W0Z A;  2LW4 A;  1AWX A;  1IRE B;  1ZSZ B;  3SWN C;  4XU2 A;  2EQK A;  1SSF A;  2JTE A;  2B9R A;  2JMA A;  2KE9 A;  9ATC B;  4JLG A;  1LNX A;  4M75 C;  2WPA B;  4XTW A;  2J05 A;  5ICP B;  2KMT A;  3REB B;  3CPW P;  2QAZ A;  4J9F A;  2DL7 A;  3QII A;  3OS0 A;  3OA6 A;  3EG9 B;  1Q86 R;  1GRI A;  2K57 A;  4RTT A;  4Z8A A;  2HQE A;  2KXD A;  4YTL A;  4BUG A;  2RQT A;  4OR5 B;  4BCP B;  1E6G A;  4RUG A;  2B8A A;  3TEE A;  4F6S B;  1JKW A;  4BI3 A;  4M7A C;  2DIL A;  3BLR B;  1NPR A;  1ABO A;  5LJ3 d;  1Q82 R;  2IN3 A;  4FYY B;  1YIT T;  3QG1 A;  4EOS B;  4MDX A;  2KRM A;  5GAM g;  3THK A;  1D1A A;  1UGS B;  5LJ5 g;  3CCV Q;  2DA9 A;  1A0N B;  3M58 A;  3OW2 A;  2DAQ A;  1H28 B;  1NYF A;  1ABQ A;  1RAE B;  4CFN B;  1KD1 U;  2MCN A;  4E7K A;  5GAN d;  3M0Q A;  2X51 A;  3CPW S;  4CFX B;  1PHT A;  2ZAE A;  5HNB B;  4HA8 A;  4R55 A;  3T9N A;  1GBR A;  3BE3 A;  1IRX A;  4QT7 A;  1K8A R;  3OYY A;  1KK7 A;  5GAO m;  3L2Q A;  5GAM h;  4J83 A;  5HK3 A;  3KHI A;  5FU7 C;  2KVQ G;  4RTU A;  1WHK A;  3M54 A;  3HO8 A;  4IIO A;  2IPO B;  1JSU B;  2IG0 A;  1G3N C;  2DTH A;  1U5S A;  3N5B B;  4L6V 5;  2JVV A;  4JX5 A;  5CKE A;  2F2X A;  4LDV A;  2WMA B;  4G6L B;  1M1G A;  1QP3 A;  3CCV T;  3RKW A;  4EOK B;  1N8R U;  4NOY A;  2QA4 T;  3KUF A;  1XO2 A;  3CCJ Q;  2K4Y A;  3O8V A;  2PVO B;  2WSE E;  4C8Q B;  1H3H A;  1BI3 A;  2P0K A;  5IDN B;  3JCM P;  4IUT A;  4KRD B;  5CKF A;  2RHY A;  3TSZ A;  5KYW B;  4BD3 A;  2P4R A;  3RDV A;  2UZB B;  1BU2 A;  3G6E A;  2DIG A;  2DBM A;  1IHV A;  4KGV B;  1H25 B;  4ROD A;  4JRQ A;  1PRM C;  2JNG A;  2PU9 B;  2K5F A;  4QQG A;  4HCC A;  2BTT A;  2NUZ A;  1YP5 A;  3CPW A;  2GTJ A;  3C4S A;  1P92 A;  1UE9 A;  2DMO A;  5I11 A;  4Z88 A;  4OB1 B;  2MWP A;  4C92 C;  2CS7 A;  4BCN B;  4LDU A;  1WXB A;  1OPK A;  4RKU E;  1V1C A;  1N27 A;  3H4C A;  4IUU A;  1ZBJ A;  1GCP A;  2JN0 A;  2L3R A;  4HNU A;  2B86 A;  3E1S A;  4DBF A;  3DLL A;  1UJY A;  4TVR A;  3HZJ A;  3QYH B;  5I21 A;  3VS7 A;  2A0F B;  3G1J A;  2MI6 A;  3QBY A;  4HVW A;  1SSH A;  4OMF B;  3WVD B;  1VQ6 T;  2BZX A;  5J3B A;  5CKB A;  1R0C B;  3CCJ T;  1OIU B;  2FEI A;  1G5V A;  3VRZ A;  2COY A;  1TXQ A;  2DFU A;  4OMM A;  4XTX A;  1WIE A;  2UUE B;  3QKJ A;  3VS0 A;  4A54 A;  2LJ3 A;  3OBW A;  2CCH B;  4CFM B;  3FIF A;  3G4S A;  5DY9 A;  3M03 A;  1M2O A;  5LJ5 d;  3LQ5 B;  1MND A;  1FVV B;  1M90 R;  4A4E A;  4HLQ A;  4A63 B;  2JJ9 A;  4BCQ D;  1PSE A;  1IO6 A;  2J6F A;  3L42 A;  4QQD A;  2KGT A;  1M8V A;  5CYI B;  4PJO B;  4E7L A;  4HKE A;  2JTM A;  4KH0 B;  2X4Y A;  4XTU A;  4RTX A;  2KRO A;  4GLK A;  4C8Q G;  1FIN B;  1UUE A;  1Q7Y R;  1VQN A;  2CP5 A;  2E4H A;  4KT0 E;  2RD1 A;  3OS1 A;  2YT6 A;  5I5Z B;  2EIF A;  2OAU A;  1MV3 A;  3CMA T;  1S72 Q;  2RB6 A;  2L3S A;  4KGZ B;  2DZ9 A;  4RCB A;  1OI9 B;  1VQO T;  2JW4 A;  4BBR M;  1IZ6 A;  3HRU A;  1VQ8 A;  3VU3 C;  2EYX A;  4LN2 A;  2QEX Q;  1OYX A;  2CH4 A;  2F5T X;  4HCK A;  1BU1 A;  5CVI A;  1JST B;  2KAF A;  2PUK B;  4CC3 A;  1AWJ A;  5L2W B;  4JZ3 A;  1O75 A;  4FYW B;  4ZN1 A;  2BZY A;  1JOW A;  2O4X A;  3HFO A;  4OB3 B;  2NLU A;  1K73 R;  1TU0 B;  3EGD A;  3VV0 A;  1Q95 G;  3A8L B;  5LL6 S;  3TSW A;  1H92 A;  5GAN 6;  1V76 A;  2WXV B;  3EFS A;  3AT1 B;  4A4H A;  5CEI B;  2PQW A;  3MI9 B;  4E47 A;  1VQ4 A;  3HL8 A;  3NTK A;  3M4G A;  4DBQ A;  3MY1 B;  4CFV B;  2NUT A;  1K0S A;  1NLO C;  4F16 A;  1HXD A;  5IHY A;  1FX7 A;  3CCE A;  3OQ5 A;  3JCM g;  1URC B;  1PWT A;  4QVD A;  1G3T A;  2PVD B;  2EW3 A;  1NM7 A;  4F7U B;  1WNL A;  2H3E B;  1PSF A;  3OYB A;  1S72 T;  4C0D B;  1PG5 B;  4BBS M;  4ME7 A;  2NWM A;  2RK1 A;  2NUP B;  2RHZ A;  2EQJ A;  2FB7 A;  1FXX A;  1WXU A;  3VKI A;  3MPU B;  3GPL A;  1N5Z A;  1HK9 A;  4OGC A;  3VS4 A;  5KYX A;  2QEX T;  4B9W A;  4EMK B;  4AKH A;  2JTF A;  3UWN A;  1PKD B;  3PNW C;  1K4U S;  2R5A A;  3HB9 A;  3M53 A;  3VS1 A;  4EOI B;  1TH7 A;  5IXB A;  2DRM A;  2CZ7 B;  3P8H A;  3MP6 A;  4FYX B;  1BBZ A;  2ABL A;  2WIH B;  1VQK Q;  3GBQ A;  4FYV B;  1M5Q 1;  4RTY A;  1Q86 U;  2E6N A;  1B34 B;  3V8L A;  1G83 A;  3QWX X;  2BPM B;  4J7F A;  1KC8 R;  2V1Q A;  3M4Y A;  4WF2 A;  5A0G A;  3VYG B;  3CC2 T;  1Q82 U;  5HBE B;  3C12 A;  2W9F A;  2KT8 A;  3EG9 A;  3LW5 E;  2F5K A;  4CRI A;  1Q81 R;  3MEU A;  4RMO A;  3MP1 A;  4QVC A;  3CCU A;  4XTY A;  4AFU C;  2D8J A;  2JXB A;  4AKI A;  4BCQ B;  3QXE B;  2DXU A;  2RH2 A;  3CC4 Q;  1QMZ B;  1M2V B;  2P0P A;  2P84 A;  5GAM j;  2VKN A;  5LJ5 j;  2K6D A;  2WEV B;  3QYG B;  2LX9 A;  3JB9 D;  1K8A U;  4IUP A;  1OI1 A;  2CGH A;  2CUD A;  3TCJ A;  3QWY A;  2XD0 A;  1VQK T;  4Y28 E;  4FCY A;  3QUI A;  2DD5 B;  4FT2 A;  3CQT A;  2RI5 A;  2DL3 A;  1KHI A;  3QJ6 A;  5D6Y A;  3MKD A;  2KMG A;  4BCJ B;  2OTJ Q;  3MET A;  4Z89 A;  2CT4 A;  1BCM A;  3I56 A;  3JCM J;  1VOM A;  4QQ6 A;  1JJ2 P;  2G6F X;  3HTR A;  1K9M R;  3UAT A;  2DBK A;  2KQW A;  1ZLM A;  2MAM A;  4O5V A;  2DL4 A;  1KQ1 A;  4J6Y A;  2HKQ B;  3I9Q A;  4J8O A;  3CCR Q;  2LZ6 B;  4CC4 B;  5IF1 B;  1JXO A;  4GLM A;  1YHQ A;  3IQL A;  4K11 A;  3I55 Q;  4KRT A;  1BB9 A;  3J80 E;  5IHI A;  2COW A;  4PKC C;  3FC3 A;  3JCM d;  2DXC B;  4EPC A;  1WJS A;  3AHU A;  4A4K A;  5CKD A;  5FGK B;  3B57 A;  3BDU A;  4C8Q A;  2XDP A;  2V1R A;  1NYG A;  2QQA A;  1B7T A;  4JJC A;  4XU3 A;  1KIK A;  2O9S A;  5KYW A;  1MHN A;  4A53 A;  4C8Q E;  1RUW A;  4M77 D;  4LDY A;  2OTJ T;  4PFP A;  3PFS A;  1WZO A;  2AZS A;  1SKU B;  2MMP A;  3OBY A;  2CP3 A;  3DLM A;  4AG2 C;  2DD4 B;  1Y7X A;  1YI2 A;  1CKB A;  1MMA A;  1WPY A;  4C5E A;  2YUO A;  1IHW A;  5GAN 3;  3OYK A;  1H27 B;  3V8J A;  1WJQ A;  4ZTJ A;  3CCR T;  2RI3 A;  3ER0 A;  5GAN 4;  2X4W A;  3JCM W;  3G7Z A;  2X4X A;  5EJC A;  3I55 T;  2VUB A;  2BKD N;  2CH4 W;  1WHG A;  1TS9 A;  2RPN A;  1JB0 E;  2E65 A;  3FJP A;  3EFO A;  1M3A A;  4C8Q F;  2HL5 C;  1M90 U;  2E41 A;  2X3X D;  1SG5 A;  1R77 A;  3SD4 A;  5GAN 7;  1K9A A;  1QLB A;  4FW1 A;  1FMK A;  3OS2 A;  1T0H A;  4QW2 A;  2O88 A;  2RJC A;  4A4F A;  4ELZ C;  2LNH B;  3OSV A;  3CXC P;  2ZCF B;  2E10 A;  3ASK A;  3H6Z A;  4IKF A;  2VXE A;  2DL5 A;  1Q7Y U;  2DEQ A;  2HSE B;  1OOT A;  2J6O A;  2JUF A;  3SB2 A;  3G6E T;  1I8F A;  4JS4 A;  2HMA A;  4DOV A;  2GTO A;  4E2F B;  1I5O B;  2FZK B;  3OYA A;  3QDR B;  1YJW A;  2CZ0 B;  2UZD B;  3RR6 A;  4PJO A;  1VQP A;  1J3T A;  1WI7 A;  5GAN 8;  1WHL A;  4AG1 C;  4OMP A;  4BI4 A;  1RAG B;  1D1C A;  4PJO E;  2M9U A;  1ZQ1 A;  1T0J A;  3JB9 I;  1ZSZ C;  4MDW A;  1KSW A;  3S6W A;  1U1S A;  2YSQ A;  1XTD A;  3TVT A;  2Y90 A;  2QFZ A;  1N9S A;  4AKG A;  4C5G A;  3Q1J A;  3EG1 A;  3P8D A;  3CXC S;  2C06 A;  1VQN Q;  1WHM A;  2HZY A;  1XJW B;  3JCM c;  2P0Q A;  3VYH B;  4EIK A;  2L3Q A;  1I81 A;  1D0Y A;  4M4Z A;  1UGR B;  2ZPI B;  3VKG A;  2DJZ A;  2UZL B;  2CP2 A;  4F17 A;  4M7D G;  1RLP C;  4D6W A;  4BE1 A;  3M0T A;  2C5X B;  1VQ8 Q;  1W6X A;  1FKM A;  2KBT A;  3G4S T;  2GGR A;  1QWE A;  6AT1 B;  2PTK A;  2CP7 A;  3CCL A;  2F1L A;  2JS0 A;  3MP8 A;  1VQ9 A;  2QGS A;  4PJO F;  2KK4 A;  3PGG A;  1VOL A;  3VKH A;  3SEM A;  2KI7 A;  4LDW A;  4GBQ A;  2VV5 A;  4MZT A;  1XOV A;  2QYZ A;  4Y72 B;  2PNI A;  1D09 B;  1WDX A;  1WFW A;  5CQY A;  4M77 B;  1BIA A;  4F7U A;  5GAN 2;  1VQ4 Q;  2RO0 A;  2SRC A;  2HKN A;  5DLQ E;  3TRE A;  1VQN T;  2BUD A;  4F7U E;  3CCE Q;  2K5I A;  4FM4 B;  2EYQ A;  2NUP A;  3MEA A;  2EJG A;  2K3X A;  3M56 A;  4BCF B;  4C5H A;  4EMK A;  3X20 B;  3TW7 A;  2QQS A;  3CXC A;  3R6O A;  4OGE A;  1KC8 U;  1R0B G;  5L8R E;  1OU8 A;  3JB9 G;  2XI9 A;  4ELY C;  4C92 D;  2QA4 Q;  1X6G A;  2HQH A;  4CC7 A;  1VQ8 T;  2C5O B;  2EGC A;  2FZG B;  1UEC A;  5GAO n;  1X43 A;  4BCO B;  4MIM A;  5KCO A;  3CCQ A;  1QWF A;  5LJ5 e;  3HRS A;  2JM8 A;  2OI3 A;  2XHC A;  3L2W A;  2WJ9 A;  4ANJ A;  5CK9 A;  1B34 A;  1UNL D;  2A08 A;  2RHX A;  3PIP A;  3CD6 A;  3CME A;  1Q81 U;  4C8Q C;  3M0U A;  3OYC A;  2DF6 A;  3RES A;  4HVU A;  2QQ8 A;  3VYG A;  5GAM f;  5D6X A;  5LJ5 f;  2A37 A;  1W70 A;  2LJ0 A;  2DPP B;  2V8K A;  1UFF A;  1M30 A;  2DK3 A;  2J7I A;  4LE9 A;  4WCI A;  3ZEH A;  4F7U F;  1VQ4 T;  2QTV A;  3BG3 A;  1OKV B;  2DME A;  4EOP B;  2QG9 B;  2IW9 B;  3CCE T;  2DRK A;  2KYM A;  3OYM A;  4BCK B;  3UPU A;  1AZE A;  1NJI C;  1CSK A;  1VIE A;  2QK0 A;  2QGF B;  3JCM X;  2SEM A;  1M2V A;  3PIO A;  1VQ6 Q;  2BS4 A;  4OMQ A;  1S1N A;  1TOV A;  1OX9 A;  1RLQ C;  2XDD A;  2LCL A;  1K9M U;  3QHW B;  5AYF A;  2RHU A;  5HKC A;  2RI2 A;  3CC7 A;  4BCI B;  2QDJ A;  2EVR A;  4M77 G;  1PD0 A;  2DD5 A;  3HRT A;  1NG2 A;  1BI0 A;  1TUG B;  4J9C A;  3LWH A;  4FU6 A;  3DB4 A;  4OGR B;  4DEX A;  2DE0 X;  4NS5 A;  2MYS A;  2RHI A;  2P4T A;  1TD6 A;  4EC9 B;  1RAH B;  2WAC A;  2I2L A;  2X4J A;  3MY5 B;  5I22 A;  1PKS A;  1C9B A;  2BKZ B;  3I56 Q;  2WSC E;  2O01 E;  3MHX A;  1YJN A;  1G8X A;  3KFV A;  4BY1 X;  2M0Y A;  1VQM A;  1AD5 A;  3QZ5 B;  3OYE A;  2E64 A;  2V8I A;  4PJO C;  3A8M B;  2QQR A;  5I2S A;  2KYB A;  2I53 A;  4ZGE B;  2IIM A;  2BE9 B;  3CCU T;  2DXC A;  3CMA Q;  5FWC A;  1RAD B;  2IVW A;  2FYK A;  1T3S A; 
#chains in the Genus database with same CATH homology
 2CZ7 B;  4ZGD B;  3FRN A;  3P8H A;  3QJY A;  3MP6 A;  2HBP A;  1X6O A;  2ZPF B;  4M7A F;  4EDU A;  1U1T A;  1NPP A;  2HD0 A;  2OTL A;  3QPH A;  1M5Q 1;  2E12 A;  4KUL A;  2E6N A;  1B34 B;  2R5M A;  3M57 A;  3V8L A;  4C5I A;  2JOY A;  1Q86 U;  3RER A;  5EG2 A;  4J7F A;  3X24 B;  4M6V A;  4BDY A;  1YIJ T;  5GAM d;  3OYF A;  2M0O A;  2M1H A;  2M16 A;  3CC4 A;  3M4Y A;  4WF2 A;  3NTI A;  3ZFJ A;  5A0G A;  2RM4 A;  3VYG B;  3CC2 T;  4J5Y A;  4JUV A;  4Z02 A;  2RJF A;  5GAM e;  1Q82 U;  1Q86 C;  1VQ5 T;  2DD4 A;  3C12 A;  1VQL T;  1BI1 A;  1M9S A;  2VXF A;  5A2Q E;  1Y96 B;  3I56 T;  5FRN A;  1D3B B;  5J26 A;  3HSB A;  5LJ3 e;  5GMK e;  3LW5 E;  2F5K A;  2L5Q A;  1EIF A;  4CRI A;  2QEX A;  1FWZ A;  2KY9 A;  3SWN B;  1NZ9 A;  4C92 B;  5KE2 A;  3MEU A;  3QHS A;  3JB9 H;  1Q82 C;  4PJO D;  1X01 A;  3FLG A;  4RMO A;  2DTI A;  3MP1 A;  2F69 A;  4QVC A;  2EQM A;  4MFE A;  3G71 A;  2AHJ B;  4PL6 A;  2OTJ A;  3CCU A;  2LRQ A;  4M75 B;  2A3L A;  4XTY A;  3X28 B;  2DXT A;  1LOJ A;  1U8R A;  4AI6 A;  2QTX A;  2R57 A;  4AKI A;  3QXE B;  4PLL A;  4FL6 A;  2DXU A;  1VQ7 A;  2E6Z A;  2RH2 A;  2XG8 D;  2LTO A;  3RIR A;  2DKG A;  2LNV A;  5HK0 A;  1W4S A;  2KR6 A;  4BI8 B;  4OVA A;  2LQ8 A;  5LJ3 f;  2P0P A;  5GAN e;  3DL1 A;  3J7A F;  2DXB B;  4JX6 A;  1WQW A;  1YHQ T;  1M1K U;  3GNG A;  4PNO A;  5GAM j;  5LJ5 j;  4R56 A;  4C92 A;  3QYG B;  1WGS A;  1YIJ A;  2LX9 A;  4N4H A;  1KQS A;  5FU6 B;  3JB9 D;  1K8A U;  3WVE B;  4IUP A;  1OI1 A;  4XU1 A;  5GMK l;  3DKM A;  2CGH A;  3HKS A;  4FIB A;  3TCJ A;  4C92 E;  1G3W A;  4ZN3 A;  4EMG A;  2XD0 A;  5GAO q;  1VQK T;  3LYI A;  3CEY A;  4Y28 E;  4BB7 A;  3CCR A;  3QUI A;  1QP2 A;  2E1H A;  2DZC A;  2KDS A;  5LJ5 h;  2DD5 B;  1QVG A;  4M7A B;  4C0D C;  1M1K C;  3C94 A;  4FT2 A;  5D6Y A;  2RI5 A;  4LD9 K;  1KHI A;  3M5A A;  3QJ6 A;  3X26 B;  2KMG A;  5GAN f;  3I55 A;  3MEW A;  4JRI A;  3CC2 A;  3QSU A;  1VQ5 A;  1K8A C;  4C0G A;  3MET A;  1VQL A;  3OY9 A;  4DQ2 A;  3FEO A;  5D6W A;  2BS2 A;  3OB9 A;  3I56 A;  3JCM J;  5IAY A;  4QQ6 A;  2ZGW A;  5A0L A;  2A7Y A;  1X75 C;  4EMK C;  4C8Q D;  2GQV A;  1BI2 A;  2ZPE B;  2KQW A;  2MAM A;  4A4G A;  3GF5 A;  3QYB A;  2QQB A;  3LGL A;  3UDC A;  4O5V A;  2ZZD A;  1KQ1 A;  4J6Y A;  4N0A C;  4N4G A;  4C0F A;  3OYD A;  4LOC A;  4J8O A;  1OZ3 A;  1YI2 T;  4HT9 A;  2PUO B;  3OW2 S;  4C0Z A;  3LH0 A;  4HCZ A;  3J81 E;  3OSS C;  1YHQ A;  1O9S A;  3VUZ A;  3JRZ A;  3J80 E;  3ZBD A;  2X35 A;  4ATO A;  4PKC C;  3URG A;  3FC3 A;  3JCM d;  3GP8 A;  2RA2 A;  1BYM A;  4RG8 A;  4C92 F;  4XAX B;  5FU7 B;  2DXC B;  3P8B B;  4EPC A;  1WJS A;  3SDZ A;  4A4K A;  3JCM e;  1YCY A;  4XU0 A;  4NL3 A;  2Y4X A;  4BDZ A;  5CKD A;  2QXF A;  3CBP A;  2PVG B;  4KUD K;  3CPF A;  1H64 1;  3V7C A;  3BDU A;  2WSF E;  4C8Q A;  2XDP A;  3BFM A;  3E9F A;  5M9O A;  5GAO r;  2QQA A;  3QYE A;  4NC6 A;  2XU8 A;  2EJF A;  4XU3 A;  2CZ1 B;  5GAO p;  1MHN A;  4IUQ A;  4A53 A;  2L89 A;  4JRK A;  4C8Q E;  1IRE B;  4M77 D;  3SWN C;  4LDY A;  2EQK A;  1UGP B;  4XU2 A;  2OTJ T;  4HCB A;  1SSF A;  3PFS A;  4GY5 A;  2V8J A;  4C92 G;  3RKX A;  4M7D D;  3JCM f;  4JLG A;  3M9Q A;  2MMP A;  1LNX A;  4M75 C;  2K5L A;  3OBY A;  4XTW A;  1W2B S;  2DVE A;  1UEB A;  2KMT A;  4M75 G;  3DLM A;  4JRP A;  2DD4 B;  2R58 A;  4M78 D;  3MEV A;  3MO8 A;  4UC4 A;  3QII A;  5CIU A;  1Y7X A;  3OS0 A;  3CCM T;  1YI2 A;  3NFC A;  3OA6 A;  3C95 A;  1WPY A;  4L59 A;  4C5E A;  3S3N A;  5GAN 3;  3OYK A;  2K57 A;  4MML A;  2RJD A;  2HQE A;  4YTL A;  3V8J A;  4BUG A;  5FU6 C;  1WJQ A;  4ZTJ A;  3CCR T;  2RI3 A;  3OMC A;  2ZPH B;  3ER0 A;  5GAN 4;  2X4W A;  2B8A A;  4JX4 A;  3TEE A;  1N9R A;  3JCM W;  3G7Z A;  2X4X A;  5EJC A;  4RG2 A;  3OYH A;  3I55 T;  2VUB A;  3CBM A;  4BI3 A;  4M7A C;  2BKD N;  1YJW T;  4BE0 A;  1NPR A;  3E9G A;  5LJ3 d;  1XQH A;  2DTO A;  2YLB A;  1YIT T;  4M7A G;  1VQP T;  3QG1 A;  4MDX A;  4QVZ A;  1JB0 E;  2KSS A;  1JRI A;  4M77 A;  4PLI A;  5CAI A;  5GAM g;  3TU4 K;  2E65 A;  1UGS B;  2FVU A;  5LJ5 g;  4KBM B;  3HFN A;  3M58 A;  4M7D A;  5DLO A;  4M77 E;  5A0D A;  3OW2 A;  3FJP A;  4E7J A;  2DAQ A;  4C8Q F;  1M90 U;  1RI0 A;  2E41 A;  4P5N A;  4M7D E;  4XQ3 A;  3SD4 A;  5GAN 7;  1QLB A;  1KD1 U;  4M78 A;  4E7K A;  2LT1 A;  5GAN d;  3QWL A;  3L2Z A;  5I2M A;  3CPW S;  3OS2 A;  4QW2 A;  2RJC A;  4A4F A;  4ELZ C;  4M78 E;  4ELJ A;  3SFM A;  5FLX E;  4X34 A;  3OSV A;  2E5Q A;  1Y07 A;  5C6S A;  5CR2 A;  2ZCF B;  2LC4 A;  1M4Z A;  2E10 A;  2VGM A;  3ASK A;  3H6Z A;  4HA8 A;  4R55 A;  1M90 C;  3GLX A;  3CCM A;  4IKF A;  2VXE A;  3CCS T;  3T9N A;  3PMT A;  1KD1 C;  1JBM A;  3PT9 A;  2LVM A;  1Q7Y U;  2DEQ A;  3OYY A;  2JUF A;  2GFA A;  3SB2 A;  5GMK j;  5LJ3 j;  1I8F A;  2LT4 A;  3G6E T;  3PTA A;  5GAO m;  3L2Q A;  4J6W A;  4JS4 A;  5GAM h;  4DOV A;  4J83 A;  5HK3 A;  3KHI A;  5FU7 C;  3OYA A;  5CCA A;  2CZ6 B;  1LJO A;  2GFU A;  2KVQ G;  4BE2 A;  4IUV A;  3QDR B;  2ZZD B;  1YJW A;  2CZ0 B;  3M54 A;  3HO8 A;  1Q7Y C;  1VUB A;  4Y91 A;  1YIT A;  2HAX A;  1W2B A;  4PJO A;  1VQP A;  3S3O A;  5FRO A;  5GAN 8;  3CCL T;  3BDL A;  2IG0 A;  3N5B B;  2DTH A;  5CKH A;  4L6V 5;  4BI4 A;  1VQ9 T;  2JVV A;  5GAN j;  3M59 A;  4JX5 A;  5CKE A;  3BG9 A;  4PJO E;  2M9U A;  1ZQ1 A;  2RJE A;  1G3S A;  3LGF A;  4MMK A;  3JB9 I;  2EAY A;  4MDW A;  5KCH A;  2EQU A;  3S6W A;  1RL2 A;  1U1S A;  4LDV A;  4M77 F;  1XTD A;  4JJN K;  1H3Z A;  4MZP A;  1M1G A;  1QP3 A;  3VJP A;  3CCV T;  2Y90 A;  2QFZ A;  3RKW A;  1N9S A;  3HP9 A;  4M7D F;  4AKG A;  4C5G A;  2XDB A;  3GIB A;  3Q1J A;  3P8D A;  3CXC S;  1Y71 A;  5IT9 E;  4NOY A;  1N8R U;  1GXI E;  2C06 A;  3FDR A;  2QA4 T;  3KUF A;  4X9D A;  2K4Y A;  4DA4 A;  3JCM c;  4M78 F;  2P0Q A;  3VYH B;  2PVO B;  3O8V A;  2WSE E;  4HNV A;  2VC8 A;  4J6X A;  4BY6 B;  1I81 A;  2DIQ A;  4C8Q B;  4BAC A;  1BI3 A;  1KHC A;  2HQX A;  1UGR B;  2ZPI B;  2K3Y A;  2P0K A;  4IUR A;  4IUT A;  2ZPB B;  5CKF A;  5HY6 A;  2RHY A;  3CCS A;  5IN1 A;  3VKG A;  2DJZ A;  4BD3 A;  1N8R C;  1QVP A;  2D0Q B;  3E19 A;  3G6E A;  5KH6 A;  2DIG A;  4M7D G;  3X25 B;  4V2S A;  1K73 C;  4RCC A;  3HHT B;  4D6W A;  3OYI A;  4BE1 A;  4JRQ A;  2YRV A;  2QI2 A;  2JNG A;  2PU9 B;  2K5F A;  1FKM A;  4OF1 A;  4QQG A;  4HCC A;  5C0M A;  3CPW A;  1JJ2 S;  3G4S T;  3L2R A;  3A8H B;  1P92 A;  3C4S A;  4ZTF A;  3CCL A;  3A8G B;  4OB1 B;  2MWP A;  4LD6 A;  4NL2 A;  2E70 A;  3MP8 A;  4C92 C;  1VIF A;  2CS7 A;  3JCM P;  1VQ9 A;  4LDU A;  1R8O B;  4RKU E;  1N27 A;  3H4C A;  2KK4 A;  2XID A;  3PGG A;  4IUU A;  4PJO F;  2JN0 A;  2L3R A;  3CCQ T;  2MF2 A;  4HNU A;  3VKH A;  3E1S A;  4OB0 B;  2FL7 A;  4LDW A;  3CCV A;  3INZ A;  2VV5 A;  4MZT A;  2EFI A;  2D6F A;  1E7P A;  3CBO A;  3OYN A;  1XOV A;  5GMK i;  2EKO A;  3DLL A;  4XTZ A;  2FHD A;  3HPW A;  4TVR A;  3V8K A;  3HZJ A;  2HNI A;  2QA4 A;  3QYH B;  3CME T;  1N6A A;  5CQY A;  3CD6 T;  4XTV A;  5I21 A;  1WJR A;  3QBY A;  2MI6 A;  4J7I A;  4M77 B;  1BIA A;  4OMF B;  4F7U A;  3WVD B;  2ZPG B;  1I4K 1;  2RO0 A;  3V7R A;  5GAN 2;  1VQ6 T;  5J3B A;  5DLQ E;  5CKB A;  4PJO G;  2VYT A;  3TW6 A;  3TRE A;  5GAN 5;  3CCJ T;  1YJ9 T;  4LDX A;  1VQN T;  3JB9 F;  4M7D B;  2BUD A;  4F7U E;  5GAO l;  2K5I A;  1G5V A;  3F70 A;  4FM4 B;  3JSC A;  3MCA B;  2EYQ A;  5DM7 R;  3JCM h;  5KE3 A;  3RMS A;  3MEA A;  4XTX A;  5CQX A;  3GOX A;  2EJG A;  4M78 B;  2K3X A;  4MZM A;  3OYJ A;  3QKJ A;  3M56 A;  2XKO C;  4C5H A;  4A54 A;  3VUB A;  4ZGJ B;  3QZ9 B;  2D9T A;  3OBW A;  1MGQ A;  3X20 B;  4EMK A;  3TW7 A;  2QQS A;  1KQ2 A;  3FIF A;  3CXC A;  3R6O A;  4OGE A;  2MWO A;  3A5Z B;  5CO7 A;  3RMQ A;  3G4S A;  1KC8 U;  1OZ2 A;  5DY9 A;  2XK0 A;  5L8R E;  3LLR A;  2XIC A;  2XI9 A;  3JB9 G;  4ELY C;  4C92 D;  1VQ8 T;  3L2U A;  5LJ5 d;  4JDS A;  5LJ3 g;  2DO3 A;  3LX7 A;  5GAO n;  1ZBX A;  4N0A A;  3KXT A;  2EJ9 A;  1S72 A;  4MIM A;  4OP0 A;  4A4E A;  5KCO A;  4HLQ A;  4M75 D;  3CCQ A;  5LJ5 e;  3HRS A;  2K2V A;  2XHC A;  1PSE A;  1KC8 C;  3L2W A;  1DJ7 B;  2WJ9 A;  5CK9 A;  3UT1 A;  1B34 A;  3L42 A;  4JS5 A;  1V29 B;  4QQD A;  2RHX A;  1M8V A;  3PIP A;  3CD6 A;  3CME A;  4E7H A;  1Q81 U;  4PJO B;  4E7L A;  3HBL A;  4HKE A;  3CC7 T;  4C8Q C;  3OYC A;  2JTM A;  1QVF S;  4MFD A;  4OB2 B;  2CYZ B;  2X4Y A;  4XTU A;  3RES A;  4CI0 C;  5GAN g;  1KG1 A;  4GLK A;  4BY6 C;  4C8Q G;  5J39 A;  1VQ6 A;  1JJ2 A;  2QQ8 A;  1NE8 A;  3VYG A;  5GAM f;  1YJ9 A;  1VQN A;  5D6X A;  4KT0 E;  5LJ5 f;  2RD1 A;  4N4I A;  3CCJ A;  2DPP B;  2V8K A;  2DK3 A;  4F7U F;  3ZEH A;  3OS1 A;  1VQ4 T;  2G3R A;  1NJI U;  4M7A D;  1Q81 C;  2QDY B;  1Y96 A;  3BG3 A;  1WQ7 A;  2EIF A;  1D3B A;  2OAU A;  2CKK A;  1BIB A;  5LJ3 h;  5GMK h;  3CMA T;  3CCE T;  2LCC A;  2RB6 A;  1BKB A;  3NTH A;  3SWN A;  3OYM A;  3EFR A;  2EWN A;  2DZ9 A;  3BY7 A;  4O6J A;  4RCB A;  3UPU A;  2O4X B;  1VQO T;  4BBR M;  1NJI C;  1IZ6 A;  4M75 A;  1VIE A;  3HRU A;  3JCM X;  1VQ8 A;  2G77 A;  4XK8 E;  3VU3 C;  1YJN T;  2QF7 A;  1M1F A;  1G3Y A;  2YHT A;  4F7U G;  4HT8 A;  1OYX A;  4M75 E;  2F5T X;  3PIO A;  5CVI A;  1VQM T;  5GAN h;  2KAF A;  2PUK B;  3RKY A;  2BS4 A;  2DXB A;  3S3M A;  1O75 A;  1XNI A;  1QW1 A;  3OYL A;  2XDD A;  2LCL A;  4ZN1 A;  3AHU A;  3RUX A;  1K73 U;  2O4X A;  3HFO A;  1K9M U;  4OB3 B;  2NLU A;  5AYF A;  3M55 A;  2RHU A;  3A8O B;  3FB9 A;  2QQ9 A;  3VV0 A;  3WXM B;  3A8L B;  2RI2 A;  4M77 C;  5LL6 S;  5HKC A;  3CC7 A;  3DB3 A;  4FT4 A;  2QDJ A;  2GF7 A;  4M77 G;  5GAN 6;  2DD5 A;  3HRT A;  3OYG A;  4M7A A;  4M7D C;  1BI0 A;  4Z6Y A;  2GCX A;  3EFS A;  3L1A A;  3JB9 J;  4A4H A;  2H3J A;  2PQW A;  2Y4Y A;  3OMG A;  3KBG A;  4VUB A;  4E47 A;  4M7A E;  3LWH A;  4FU6 A;  1K9M C;  3DB4 A;  1VQ4 A;  4M78 C;  3JCM Q;  4HNT A;  3HL8 A;  3NTK A;  3M4G A;  2OTL T;  1AHJ B;  3H8Z A;  4NS5 A;  3ME9 A;  4M78 G;  3PMI A;  2RHI A;  2L8D A;  2P4T A;  1HXD A;  2LDM A;  1FX7 A;  3CMA A;  3JAM E;  3OQ5 A;  2WAC A;  4KUI A;  3JCM g;  3CCE A;  2I2L A;  2X4J A;  4L5G A;  5GMK m;  4QVD A;  1G3T A;  2LQK A;  2PVD B;  4HL4 A;  3BW1 A;  4F7U B;  3LWI A;  4Q5W A;  1WNL A;  3CC4 T;  4X9C A;  1VQO A;  3QO3 A;  1PSF A;  3OYB A;  1S72 T;  2WSC E;  4C0D B;  1ZHI A;  2RK2 A;  4B9X A;  2YLC A;  4E7I A;  3JCM V;  1VQK A;  1QVF A;  5FRM A;  4BBS M;  2O01 E;  3MHX A;  4ME7 A;  1YJN A;  2RK1 A;  2RHZ A;  3OS5 A;  2EQJ A;  2FB7 A;  1FXX A;  3VKI A;  4M75 F;  1UB4 A;  1VQM A;  1KQS S;  3EAE A;  3GPL A;  1HK9 A;  4OGC A;  1UGQ B;  3BG5 A;  3QZ5 B;  3OYE A;  4QSH A;  2QEX T;  2E64 A;  2BIV A;  4B9W A;  4EMK B;  2V8I A;  4FSX A;  2JZ2 A;  4AKH A;  3JCM b;  3A8M B;  4II1 A;  2JTF A;  2QQR A;  1QVG S;  4PJO C;  3UWN A;  4DOW A;  3V7S A;  5I2S A;  1YBY A;  3PNW C;  3G71 T;  4ZGE B;  2R5A A;  3L2V A;  3CCU T;  3HB9 A;  2VGN A;  2BS3 A;  3M53 A;  2DXC A;  4EMH A;  1I5L A;  4JLI A;  1TH7 A;  2IVW A;  1VQ7 T;  3GNF B;  2FYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...