2ZPFB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 18min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpfB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpfB02
3HHTB 2PUKB 2PVDB 3QYHB 3QZ5B 2DXBB 4Y28E 3A8OB 2DXCB 2ZZDA 2PU9B 2DD4B 1AHJB 2DD5A 2PVOB 2CZ1B 3QYGB 1JB0E 3WVDB 3X28B 2CYZB 4ZGJB 2WSEE 3X25B 1PSFA 4RKUE 1UGRB 2CZ6B 2DPPB 2DXBA 3VYHB 4KT0E 3A8LB 1PSEA 1DJ7B 2ZPFB 1QP2A 1V29B 1GXIE 4OB2B 3X26B 2ZPBB 2QDYB 2D0QB 3VYGB 2ZPIB 4FM4B 3A8HB 3A8GB 1UGQB 2CZ0B 2DXCA 2WSFE 2DD4A 2WSCE 4L6V5 1UGSB 3QXEB 2ZCFB 5L8RE 2AHJB 1UGPB 2ZZDB 4ZGEB 2PVGB 3WVEB 2DD5B 3X24B 2PUOB 2O01E 2ZPEB 3QZ9B 3X20B 4OB3B 2CZ7B 1IREB 3LW5E 4OB1B 3A8MB 4OB0B 1QP3A 3VYGA 4XK8E 4ZGDB 2ZPGB 2ZPHB
chains in the Genus database with same CATH superfamily
1VOMA 1M90R 2LDMA 1WA7A 3RMSA 2L0AA 2KAFA 1VIFA 2BUDA 2AZSA 3K7AM 3OW2S 2G77A 1ENWA 1D3BB 2YHTA 3EGUA 2VXFA 3CC4Q 2LQNA 1X6BA 1PM3A 4WCIA 3HRTA 3MEAA 5LJ5e 5HBHB 1UTIA 4JZ3A 2WPAB 3OYAA 2WJ9A 4ATOA 1S1NA 2DTHA 4YOOA 1UJYA 2K5IA 3VS4A 4OF1A 3HFOA 2CZ1B 4Y92A 2BKDN 1OPLA 5GAMh 1BI0A 2ZAEA 4C92A 1JJ2A 4XTYA 4QVDA 4YC3B 2QA4A 2KROA 3M5AA 4FW1A 3EGDA 2NUPA 4BXXX 1ZUUA 3QJYA 2VGMA 2MWPA 4PJMA 2ZGWA 5IHKA 3OYJA 4M77C 2DVJA 1K73C 4BY1X 4RG2A 1X75C 1YHQT 1GXIE 1WX6A 5LJ5g 1M5Q1 1M3AA 5LJ3j 3G4ST 1QVFP 2JTFA 4DA4A 1M90U 5GAN4 1RAAB 3CC4A 1YJWA 2DVEA 1YCSB 1JJ2S 1V1CA 2XDBA 1JBMA 1X43A 5LJ5d 3KHIA 1GCPA 3JRZA 3PE0A 3JB9D 3TSZA 1UE9A 4AFUC 3HTRA 2HQXA 4CFVB 5A0LA 3EFSA 3EG3A 4UC4A 3G33B 2LCLA 5HCKA 4XU1A 2A7YA 1JQQA 1WDXA 3PT9A 3QDFA 1UGPB 1P5EB 2HD0A 4ZGEB 4LOCA 4C5IA 1K9MR 4E47A 2KEAA 1D09B 1M3BA 1JOWA 3X24B 5J26A 4A4GA 2A37A 4FSSA 4RTVA 4E2FB 2GF7A 4QVZA 2O9SA 3M54A 4N0AC 3PGGA 1GY3B 2R5AA 2AT1B 4M77A 4C5EA 3VU3C 4EOJB 1H4LD 2JUFA 2IW8B 2CH4W 2QA4T 2CH4A 4BCQB 3CBMA 3BE3A 3M57A 3QWXX 1QQJA 3O5ZA 4PJOC 2Y4YA 2VVKA 4LNPA 4AI6A 3CCVQ 3VKHA 1M8VA 1TXQA 3OBWA 4M7DF 1T0JA 3NTIA 2C6TB 2L3QA 4M7AC 1NYGA 3HBLA 3VRZA 4VUBA 3JCMc 2KT8A 5FU7B 1BU1A 1LNXA 2QK0A 3U23A 2GQIA 1WLPB 2RQTA 3V8JA 5CQXA 5IHNA 2DL8A 2JT4A 2BS2A 2DZCA 5L2WB 1YJWT 1Q86U 3PNWC 4AG1C 1K9MU 2M02A 2P0QA 1OZ2A 4DBQA 1SPKA 1IRXA 2JMAA 2E1HA 3JV3A 4B6MA 2WSEE 3OS0A 4M6VA 1Z9QA 3MIAB 3FIFA 3AHUA 1WQ7A 1PKDB 1GRIA 3OS2A 4N0AA 4EPCA 2LX7A 2IPOB 3UATA 1PWTA 4YOZA 1M8MA 4O5VA 2YUOA 3DLLA 4RCCA 3CCVA 2KI7A 2IVXA 2J6KA 2ROLA 1AZEA 2DMEA 1ARKA 5GJWB 3L2ZA 3HRUA 2LCSA 1E6HA 4PJOA 3LH5A 3CPWA 2R7GA 4BCPB 2JMCA 2K57A 5HBJB 2DBKA 4M7AA 2KMTA 5D6XA 1FXXA 2K79A 1VQ5T 3G71A 2WXVB 4IUQA 4I3ZB 5GAOl 3EFOB 2P4TA 3VS7A 2ZCFB 4F7NB 1P92A 1XNIA 2MK5A 4J83A 2DETA 4M78C 4BCGB 4BCKB 3P8DA 4PFOA 3CPWS 1KG1A 5J3BA 1ACMB 2HL3A 3CPFA 1V76A 3MY5B 2AKKA 2D1XA 4QT7A 5KYXA 3THKA 1W98B 1N9SA 1K4US 4C8QE 4J9HA 3A8MB 3OYIA 2XHCA 1OX9A 5KCOA 5GAMf 1QVPA 3CCUA 5CR2A 2VUBA 3CEYA 2HCKA 4DEXA 2FZCB 5FWBA 1EX4A 1Y0MA 2AKLA 1OIYB 2QGSA 3RKWA 1I1JA 3L2WA 1YWPA 4JS5A 3S3MA 1VQOT 1H28B 1BI3A 2EYWA 1TD6A 3NHNA 4C0FA 2KY9A 2NUPB 4N4HA 1VQPT 2PU9B 5GAMe 3OYMA 2G3RA 2W9FA 4M78A 3RESA 3OMCA 1TOVA 2RO0A 1E9HB 2A3LA 3CMEQ 2R58A 3CCJT 3G71T 1QWEA 1GH6B 3LQ5B 2ATCB 5GMKe 1KD1R 2K7AA 3V8LA 2ZPFB 2RN8A 4TVRA 1AISB 2L3SA 1VQ4T 2C5NB 4JLIA 1NEGA 1AWXA 3X26B 1U1TA 2XIDA 3MP8A 4ZTFA 4C92D 3PIOA 1GUXB 2QF7A 2A08A 5GAMg 3VYGB 2EGCA 2O88A 4JRQA 1M2VA 2K2MA 5HY6A 4DQ2A 3SWNB 2CGHA 5I21A 4X34A 1UNLD 3LGFA 5GAMd 1XJWB 1W2BP 2XI9A 4RG8A 3CCUT 3TN8B 3A1PA 3RBBB 4LDWA 3CMEA 4Z89A 2FG0A 3J80E 1ZBJA 4AFQC 2YSQA 1GCQC 1RI0A 1FX7A 1R0BG 3WVEB 1ZP2A 2RQUA 1Q82R 4C5GA 1SSHA 2LTOA 3MEUA 2CSQA 3JCMb 2DYBA 1I0CA 1X2KA 2EBPA 1KD1U 4UN0A 3VKIA 2DTOA 4A63B 2OAWA 4GY5A 2F2VA 2E12A 1S72A 2RHYA 3MY1B 3LWIA 1AWWA 1VYTA 5CQYA 4OB0B 2DF6A 3VS0A 3V7RA 5I5ZB 3CCLQ 1YFNA 1VQNQ 1BIAA 4HKEA 4ESRA 1UNGD 1YIJQ 2WHBB 2YLBA 2DL3A 2F2CA 3R6NA 2ED1A 4KRTA 2OTJQ 2EVRA 2L2PA 3HFNA 2C0IA 2FRYA 3TCJA 3S6WA 1RAGB 4M77D 4OMNA 3QYHB 5FGKB 1QKWA 3QWYA 3I56Q 4HCCA 3QZ5B 2BZ8A 4CFWB 1KHIA 4BE2A 4J9FA 1YCYA 2C5OB 2KBTA 4ELZC 4C8QG 2PJQA 1QW1A 3RMQA 4GBQA 4ANJA 1Q82U 3LYIA 1KSWA 2LNVA 3L42A 1H8KA 1YN8A 3X28B 3RDVA 1GCQA 4C5HA 5HKCA 3I35A 1IZ6A 4XQ3A 2RJFA 3G6ET 3DDQB 5GMKl 2Y4XA 2VKNA 3CCLA 1VQNA 4PNOA 1DJ7B 1ZUKA 1QVGP 4LD6A 3CD6Q 2OTJA 2RJEA 2HBWA 4LDVA 2A36A 2GTOA 5EG2A 3DJBA 4OVAA 2L89A 1BIBA 4XTUA 1VQ8Q 3G1JA 3L2UA 1D3BA 2MF2A 1S72T 4J9EA 2DTIA 4D6WA 4AFSC 4CRIA 4BDYA 4F7JB 4V2SA 2CZ0B 1LOJA 2BE9B 4QQ6A 2BKZB 5C0MA 3GTMS 3DL1A 5L8RE 4PL6A 3LLRA 4OGCA 4A4EA 1Q81C 4C92E 1VQ9A 2HNIA 4PJOD 4PJJA 3PMIA 2YRCA 2EJGA 3V7CA 2MMPA 4FT4A 2QEXT 4M7AD 2O31A 5CCAA 4M75A 4ME7A 4JUVA 1UG1A 2NUZA 3OB9A 3CCQQ 1H1RB 2R5MA 3QHSA 5D7UA 4CFUB 2EUFA 3L1AA 2DMOA 1NJIR 4J9BA 4JRKA 3URGA 1AT1B 3ZL7C 3SB2A 1U1SA 2YRVA 4JLGA 3OS5A 1FKMA 1YNZA 3AT1B 4FL6A 2KR6A 4Y91A 2W2HA 2C4GB 2EAYA 1W70A 1X69A 1H3HA 4CC7A 1VQ7A 2DXCB 1Z9ZA 4LUDA 1N8RC 2PHGA 1B07A 1YITQ 2RHZA 2X3WD 4HVUA 1JB0E 4A4KA 5IT9E 1C6VX 4ZGJB 1CKBA 2DJQA 4JRIA 5I2SA 2WEVB 3KXTA 3VS1A 4XU0A 2X3XD 3HPWA 2FYKA 1M1KR 4M77E 2QQAA 3C4SA 5CKBA 1LVKA 3JCMh 2D8JA 1VQ9T 4EORB 1TUDA 2G9XB 5DQWA 4M78D 1V29B 3M56A 3CC7T 4FT2A 2M1HA 1YI2A 2RJDA 1JKWA 3JB9F 1G8XA 4BI3A 3GP8A 1JSUB 4IIOA 2ZPIB 4BY6B 3EFRA 3TREA 3OYNA 3OYKA 2E5KA 3DB4A 2UZEB 2PMIB 1G3YA 4C8QF 3RKXA 1YITA 1ZX6A 1H3ZA 3R6OA 5KYYB 2NWMA 4RTUA 4LUEA 3LX7A 1YHQQ 1BCMA 4BBRM 3L2QA 4F14A 3PMTA 3BHTB 1UHCA 1IHVA 3G4SQ 2DXUA 1ABQA 3H9NA 4PKCC 3OYCA 1TG0A 3BLHB 2HZYA 4N4GA 3EG1A 1PKSA 3OMGA 1G5VA 1X27A 1CSKA 1JJ2P 1N5ZA 2DERA 8ATCB 3F5XB 5LMKB 1AD5A 4F7LB 4MZTA 1H1QB 1VQ7T 2VWFA 2D6FA 4J6WA 3SFMA 2F1LA 4JPBW 3MEVA 1OOTA 1UB4A 4CC4B 1VQ6A 1UGVA 2QYZA 1WXTA 1JXOA 2O4XA 1WHHA 2B86A 3HZJA 2V8JA 4XU3A 5IHYA 4C92G 4M7AE 2EQJA 4OMFB 2C0OA 1BKBA 1IB8A 4JZ4A 4XU2A 1BYMA 2YUNA 3OW2A 2AZVA 2E65A 3M4YA 3V7SA 2HEQA 1M9SA 1IXDA 2PVDB 1YI2T 3OYHA 1KFZA 3QHRB 2QA4Q 4M7DC 2YRDA 1H92A 2X35A 5FW9A 9ATCB 3P8HA 3EHQA 1PD0A 1NM7A 4BCMD 3A5ZB 5GMKi 2IW6B 1PSFA 2JVVA 2E3IA 5IN1A 2MI6A 2YDLA 1KHCA 1YJNT 5J39A 1YJWQ 2I40B 2MIOA 2LC4A 3I9QA 3I5RA 5IXBA 4MZPA 1WJRA 2UZBB 2IW9B 1QCOA 2ECZA 3UT1A 1TUGB 3SWNC 2EGAA 2QQSA 2K6DA 1M27C 2DM1A 3EJ1B 2V26A 5EFQB 1UGQB 3HRSA 1QCNA 3INZA 4JS4A 1VQ6T 2HBPA 1G2BA 1TSFA 4M75B 1UGSB 2DAQA 4M78E 4N4IA 3NTHA 4M7DA 5HK3A 2K2VA 2BPMB 1O9SA 3HL8A 1T3SA 4PK4A 1GL5A 1KIKA 1RABB 3JCMW 4C8QB 3M53A 2VASA 1SHFA 3ULRB 1KQSS 1VQ5Q 2KK4A 1OZ3A 2K3XA 3P8BB 5GAOm 1ZA2B 4FW2A 2FPEA 1OI1A 2K9GA 2EPDA 4HA8A 4B9XA 4JRPA 4BCIB 1MV3A 3VS2A 5KE2A 2E3HA 2XMFA 1GUXA 1KC8U 3VYGA 5IF1B 1Y57A 2XICA 1EFNA 2RI5A 2OTLA 4F7UE 2EYZA 1D0XA 1Q86R 4HNVA 6AT1B 2JW4A 1SSFA 3SWNA 1JSTB 4F6SB 4EONB 4XTWA 4ZNXA 3CPWP 2QXFA 1XQHA 3META 4J7IA 3ER0A 3KFVA 2DFUA 2DILA 3UWNA 2KYBA 5HQ0B 1B3QA 2E5QA 2DE0X 4DBRA 4F70B 2RQVA 1MUZA 4F17A 2DD4B 1UFFA 1RAIB 1VQ5A 3Q1JA 2JS0A 3RUXA 3QYGB 2JXBA 4J9DA 3JB9H 2K5FA 3EG0A 2DIQA 2O2OA 2FO0A 2QDJA 1VQOQ 2KGTA 5GAOr 2YUQA 4M7AG 1SF9A 3O8VA 4CFMB 5CKHA 3OA6A 5I2MA 2X9HA 1VQPQ 3BY7A 4BE1A 1ZQ1A 4C92F 3A8LB 2RHUA 4FSXA 1W4SA 2HQHA 3CCJQ 4HT8A 1C9BA 2EFIA 3G71Q 2X1NB 2RD1A 3FJ5A 4MFEA 4AT1B 1KQ1A 4AKIA 1EIFA 1SRMA 1OULA 1NLPC 1OL1B 2EIFA 2JNGA 3A8GB 2WSFE 1VQ4Q 2DIGA 1Q7YC 4BCQD 4M4ZA 1E6GA 4AMCA 5GANh 2DRMA 3LGLA 2OTLT 1VQOA 4EC8B 1BU2A 4FYWB 2CP5A 2XDDA 3UF4A 3JCMJ 3BHVB 5A0GA 5M9OA 3JCMd 1VQMT 1SRLA 3EH2A 1WIEA 4Z88A 1VQPA 2O4XB 1WI7A 4EC9B 1TU0B 2BTTA 1NBEB 3CCUQ 1JU5C 1RUWA 2YWWA 3CCJA 3RR6A 4ROEA 4OB1B 2M9UA 2I0NA 1M4ZA 2KRSA 3TVTA 1M1FA 4M78G 4E7JA 4DOWA 4ELYC 4M77F 2YT6A 1RACB 1VQ4A 3FDRA 1O75A 4D8DA 5LJ5j 1FMKA 3EOCB 3CBPA 2FPFA 4RUGA 1I81A 4WTOB 3QWLA 2WIHB 2DZ9A 4MDWA 2EWNA 3M0RA 3QYEA 4BCFB 2RHXA 1VUBA 2QI2A 4KGVB 4RTTA 3FC3A 4C0GA 1NJIC 4F7UG 2CT3A 4XTZA 1FINB 1Y96B 2IVWA 5CYIB 1RI9A 4EMHA 3VYHB 2LRQA 2JZ2A 3CCEA 3M59A 4J8OA 1OKVB 1ZHIA 2E6ZA 2F5TX 4QQDA 4QSHA 1K76A 3BFMA 3CXCA 4BY6C 1GBRA 1G3NC 2DK3A 3G6EQ 4M7DB 2L3RA 3CC2T 4JJNK 5FU6B 1U3OA 3F70A 4Z8AA 1SG5A 4F7SB 4R56A 1X01A 4FM4B 2EYYA 4A4HA 2PNIA 4PJOF 2DXCA 1M1KC 2BS4A 5LJ3h 4M7AF 3S3NA 2H3JA 1K8AC 2G6FX 4OP0A 1T0HA 3BDLA 5ECAA 4P5NA 3CXCS 2ZZDB 3V8KA 1S72Q 1VQLA 2DL5A 2FPDA 4J9CA 4EMGA 3CMAT 2CP0A 8AT1B 3M03A 1WGSA 2VV5A 1YBYA 2LVMA 2PK9B 2ZPEB 2O9VA 4CXAB 3KBGA 3X20B 3TW6A 2QGGA 2F2WA 1U8RA 5FROA 5GAOq 1OYXA 3LW5E 4NOYA 3G6EA 4M7DD 1QLYA 1ZSZB 3OS1A 3MP6A 3H0HA 4R55A 4E7HA 2QEXQ 3CBOA 2HSPA 4BE0A 4YOSA 2COZA 2K3BA 1YJ9A 4HVVA 3CCET 5KYYA 1NPRA 1VINA 1MHNA 2QAZA 2MPXC 1WJSA 2KT1A 4HT9A 2KXCA 4F04B 4MFDA 3QHWB 3DB3A 2VC8A 2CCIB 2L3PA 4KRCB 1QKXA 3OBYA 4B9WA 4BI4A 4OR5B 1B34B 3TEEA 4DBFA 1PG5B 2KRMA 2LQKA 3DDPB 1BI2A 1UGRB 1K73U 3O0GD 4QW2A 4M78F 3H6ZA 4BCNB 5GJVB 1T3LA 2EYQA 5GANf 2QEXA 4DOVA 2RNAA 4YTLA 3JB9G 1W1FA 1VQLT 2F5KA 2K5LA 3MO8A 3C94A 3VJPA 1VIEA 2QFZA 2EYXA 4BDZA 2F69A 5IAYA 1VQ9Q 4M75C 1M90C 5KE3A 2WSCE 3QPHA 3CC7Q 1IGQA 2AIRB 3UA6A 1KXUA 4PLIA 4F7UF 3L2RA 1EZZB 1FYNA 4NS5A 2EW3A 5I11A 2D9TA 2QG9B 4C8QC 3PVLA 1YJ9T 1VYWB 4D8KA 1Y71A 5EC7A 4EOKB 4NC6A 4Z6YA 3E1SA 3OQ5A 2FVUA 4BB7A 1D1BA 3S3OA 2GFUA 3EIDB 4HVWA 3BW1A 3REAB 1WHKA 5FLXE 2J7IA 1H1SB 2CJMB 5CKDA 3PVQA 3VS3A 1YP5A 2ZPGB 3ASKA 4PJLA 5GANd 1HD3A 3CC7A 1VQ7Q 4EOSB 2EQMA 3VRYA 5DLOA 2CCHB 5GAMj 4HCKA 3E2UA 4KBMB 3OYEA 3BG3A 5AT1B 2CSIA 1TWBA 4EDUA 4LE9A 3A8OB 3CCSA 2DYIA 2V1RA 2RI2A 4C8QA 1D0ZA 1H25B 4G6LB 1G3SA 1M2OA 3C12A 2JN0A 2DKGA 3X25B 2ABLA 4PJNA 5GMKj 3BG5A 5GAN5 2CZ6B 2J6FA 1Q86C 1K9MC 5GAN2 5EJCA 2ESWA 1YI2Q 2RK2A 3CCMA 4OGEA 1PKTA 5LJ3f 4EIKA 3VS5A 2LP5A 3EG9B 4HCZA 1RAFB 1PRLC 2LZ6B 1IHWA 4Q5WA 1Y7XA 3QKJA 3QDRB 1YJNQ 2HDAA 2LQ8A 4CFUD 1BCOA 4K11A 5CVIA 2OAUA 2X51A 5LJ3e 3DTOA 3NTKA 3RERA 2DD4A 2FZGB 2E6NA 2GFAA 3OW2P 2BS3A 5HBEB 2DRKA 3M55A 1H24B 4GLMA 1MMAA 1ZLMA 1HYOA 2CUBA 5IDPB 4RTYA 5IH2A 4BI8B 4O6JA 4C0ZA 4NL2A 2EQKA 4ROCA 2X4WA 2WIPB 4TTHA 3RIRA 3I55T 4AKHA 1JO8A 3M0TA 2LT1A 1VQ6Q 3OYLA 1VQKA 1AEYA 1U5SA 1QMCA 5KYWB 1NPPA 4F6WB 1OV3A 1ZUYA 2NUTA 1SKUB 3CCST 3PO3S 3ZFJA 1UNHD 1X6GA 2AK5A 3JSCA 1XO2A 3QYBA 4CFXB 2JS2A 5LJ3g 1JXMA 1YJNA 4JX6A 4XK8E 2LW4A 4ZGDB 1WXBA 2RJCA 3OYYA 2KXDA 3L2VA 3CCMT 1KQ2A 2KDSA 2ENMA 2CDTA 2E41A 5LJ3d 5KCHA 1K0SA 1PCXA 3TU4K 4MDXA 2DJZA 4II1A 1TS9A 3QUIA 1WYXA 4FU6A 4FYYB 3CCRA 2E70A 3EAEA 4Z02A 2DBMA 1PNJA 3H8ZA 1BBZA 3DOGB 2E10A 4PJOE 2JTEA 3M0QA 1HSQA 3E9FA 4BD3A 1JRIA 2C0TA 1OGUB 2CYZB 2KYMA 2HAXA 2J06A 2LJ3A 2KR3A 3JCMP 2W96A 2A28A 2DPPB 2QGFB 2CT4A 1NG2A 3KUFA 3GIBA 3E9GA 2BE7D 1QP2A 4HXJA 1MNDA 2E64A 4OB2B 1H27B 2DEUA 5FU6C 2ZPBB 2MCNA 1VQKT 3MHXA 2D0QB 2KMGA 1XOVA 1K9AA 2I2LA 1M30A 1NZ9A 2XDPA 1OQKA 3TSWA 2KE9A 1J3TA 1K0XA 2VB6A 3C95A 4L6V5 3JCMQ 1TTHB 2KQWA 2XK0A 1OPKA 4J7FA 1UJ0A 7AT1B 4CC2A 2MYSA 2KNBB 2XD0A 2CKKA 1I07A 1Y96A 3GPLA 2OI3A 2NLUA 2PVGB 1KC8R 2Y90A 2DD5B 4NSTB 1KQSA 3CCRT 1LJOA 3QBYA 5L23A 2NYSA 4EOIB 2OTLQ 1ZSZC 3NMZC 4M77G 4ZN1A 3M0PA 2KRNA 2K4YA 1VQMQ 2KVQG 1KD1C 2XU8A 2LCCA 4IKFA 4MMLA 5CKFA 2CREA 4FIBA 4X9DA 2ZPHB 2MOXA 2GTJA 3PFSA 2RM4A 4IURA 4A53A 3GNGA 5GAN3 1Q81R 2CUDA 4Y28E 1WNLA 2ZZDA 5GMKh 1VYUA 1VOLA 4BBSM 1VA7A 4NL3A 1AD6A 2VYTA 3UDCA 3RGFB 4DEYA 4BUGA 2IG0A 3EGXB 4M75D 4II5B 1VQMA 4E7SA 1Q82C 2P0KA 1BB9A 3JCMf 1RLQC 3VKGA 4KT0E 3OYGA 1ZSZA 4KH0B 2FZKB 3NDQA 4C8QD 3MEWA 3H0FA 3WXMB 3CQTA 4E7LA 2RA2A 5ICPB 4PJOG 3J81E 5HNBB 4KULA 3TNWB 3T9NA 3JCMe 2QDLA 2HKQB 3A8HB 3FLGA 2J05A 4PFZA 1Q81U 1YWOA 1N8RR 1TH7A 2YXYA 5CO7A 5GAN7 1B34A 4RCBA 2NUTB 1D3UB 3GLXA 3QG1A 2QASA 2AHJB 2PQWA 3CC2Q 3LH0A 1OX8A 4IIMA 2P4RA 1I5OB 3MJXA 2DX1A 4JJCA 2Z0WA 2JM9A 5CEIB 2ROTA 4R0KA 3M4GA 3N5BB 1O9KA 4ELLA 2L8DA 1W6XA 2RQRA 2CP3A 4DBHA 4E7IA 2MAMA 5GAN8 1PC0A 3JCMg 2C5VB 3NGPA 1C0MA 3CC4T 3CMAQ 2DL4A 2RMOA 3GNFB 4C0DB 1QVFA 2QTXA 1N27A 3CXCP 1SEMA 2YUPA 1PRMC 4QKUA 4CRLB 1FMVA 2PUKB 1N8RU 1AVZC 1M3CA 3UPUA 4JX5A 1A0NB 2LJ0A 3FB9A 2OX7A 1WHJA 3CC2A 1H641 3OSSC 3RNJA 1QWFA 4EOPB 1C1AA 2DLPA 2GCXA 2DO3A 1BK2A 1Q95G 4KH1B 3GOXA 1UECA 3QO3A 1R0CB 3SDZA 1QVFS 3HKSA 2R57A 3WVDB 4WF2A 4X1VA 3CCEQ 5LL6S 3HO8A 3SHWA 2EJ9A 2IN3A 1XTDA 2DXBA 4EMKB 2GNCA 3CMAA 5GAN6 4KUIA 2UZDB 3EG2A 4BCOB 1CKAA 4EOOB 3GF5A 1K1ZA 3MI9B 2VXEA 2V8IA 1B7TA 2XKOC 4HL4A 3E19A 3BHUB 4RTZA 1OL2B 2M0YA 1FVVB 2PZ1A 1G83A 2GQVA 3JB9I 2E4HA 1RLPC 3A98A 4M75E 2P84A 3SD4A 4LDXA 2DXTA 2CP7A 2KSSA 5A2QE 2C06A 4KRDB 4PFPA 1VQLQ 4MIMA 4HNTA 4IUVA 1WXUA 5BNJB 1OI9B 2OJ2A 2UZLB 1MV0B 2JGZB 4CC3A 3ZBDA 4LXCA 2V22B 4RMOA 3OY9A 3REBB 2F2XA 1X2QA 1I4K1 5GMKm 1GFCA 3J7AF 5HVYB 2PUOB 1U06A 2XG8D 5KH6A 4AFZC 2WMAB 5I22A 3VUZA 4C92B 3CCVT 4OGRB 3NPFA 2CZ7B 1M1GA 1RL2A 3EG9A 1GBQA 3EGDB 1FMWA 1YJ9Q 1QLBA 1LCKA 1N6AA 2RB6A 1OU9A 2RF0A 4XAXB 2WMBB 3HSBA 2DL7A 1N9RA 2IIMA 1D1AA 4BACA 2COWA 5KYNA 3VS6A 2JM8A 4IUTA 2MWOA 3FRNA 1AWOA 2JTMA 2M0OA 1K73R 5KYUA 1F5QB 2FB7A 2EJFA 1WJQA 2HKNA 3NFCA 1X6OA 3OYBA 5DM7R 4OMMA 3QIIA 3B57A 1R77A 1F1BB 5KYWA 4ZTJA 4F7UA 2PTKA 1FWZA 4J6XA 1WFWA 2V8KA 4KUDK 4EOLB 3H41A 2EKHA 2W9ZA 1MMGA 1PSEA 1RADB 1E7PA 1H1PB 5DQVA 4HCBA 4M77B 2CS7A 2COYA 1D1CA 2QDYB 5D6YA 4FCYA 4JX4A 2X4JA 3BLQB 3OYFA 4FYVB 4CFNB 3LWHA 5AYFA 3FJPA 2PK2A 1O9KB 1G3TA 1Y07A 5CK9A 2A0FB 2EQIA 1OKWB 3QXEB 2BIVA 2LT4A 4PLLA 3MP1A 3DLMA 2QQ8A 4J9GA 4BCHB 1KK7A 1TUCA 2FHDA 1NE8A 3BDUA 3TNIB 3TW7A 1D0YA 1WHLA 4KGXB 1OEBA 4M75G 2O01E 4LD9K 1IO6A 5CAIA 5GANe 4J6YA 4OB3B 2ED0A 2JOYA 3GBQA 1URCB 4FX3B 3MCAB 4HLQA 4JDSA 2B8AA 1QMZB 1WQWA 1UUEA 3I55Q 4BCND 3ZEHA 2BZXA 4E7KA 1AZGB 2QQ9A 3CCSQ 1G3WA 2L5QA 1Q7YR 1KC8C 4PJOB 3CMET 1PD1A 2LQWA 2W10A 2X4XA 1W2BA 4JJDA 4M7AB 5CKEA 1YIJA 2DXBB 5GANg 2HL5C 4F6UB 4OMPA 1OIUB 1TFBA 2RQWA 3CCMQ 2DD5A 5LJ5h 2PVOB 3QJ6A 3HB9A 3I56A 2W0ZA 2QQRA 3BG9A 5IXFA 3IQLA 5FRNA 4IUUA 1W2BS 1BI1A 2DEQA 4LDYA 3C0CA 3I55A 5DY9A 2VGNA 4M7DE 1HK9A 5LQFB 4QQGA 2D0NA 5KYXB 3JCMV 1N4MA 4BCJB 1UDLA 3TQ7P 3RKYA 1AWJA 1SHGA 5D6WA 3TNHB 1MNEA 3M9QA 1Q7YU 1IGUA 4FYXB 4L59A 3CD6A 5FWCA 2GBQA 3M58A 4F16A 4AKGA 2JJ9A 2HQEA 2FL7A 2H8HA 3UA7A 1MMNA 3JAME 1VQ8A 4OMLA 1VQKQ 2EGEA 1VYVA 3EGXA 4IUPA 2CP6A 3H4CA 3BLRB 2RH2A 4X9CA 4E7ZA 2EQUA 2C5XB 3CCLT 1VQNT 1AOJA 4M78B 4BY7X 5FU7C 3D7SB 1YIJT 5IDNB 5GAOn 1NEBA 1ZBXA 1ZA1B 1HXDA 3MKDA 1QVGA 2FRWA 2OTJT 3M0SA 2DNUA 4ORZA 4C0DC 3PIPA 4XTVA 5KYUB 4QVCA 2RPNA 1NYFA 3I56T 2I53A 3FEOA 1QP3A 2QTVA 2WFYB 3CCRQ 3CCQA 1HJDA 2D8HA 1MMDA 1NLOC 2P0PA 3HHTB 1E7OA 5IHIA 2YLCA 1M2VB 2FEIA 3QSUA 2SRCA 4F7UB 5GAOp 1QVGS 4Y72B 4EOQB 2LNHB 1K8AR 1WPYA 2EKOA 2CP2A 2HMAA 3MPUB 5DLQE 1NJIU 4RTXA 4M75F 1AHJB 3OSVA 4RODA 1UEBA 4KGZB 4L5GA 3CD6T 2GGRA 1ABOA 4EMKC 4RKUE 1OU8A 2B9RA 3OYDA 3EHRA 1RAEB 3I5SA 1KQSP 1VQ8T 4MZMA 3JB9J 2BZYA 1GFDA 5ACBA 5HK0A 4E6RA 4LN2A 4A54A 2LMJA 4ZN3A 5A0DA 1H26B 1I8FA 4JJBA 4OMOA 5GANj 2M51A 2RK1A 4HNUA 1WHGA 3M0UA 1M1KU 2M16A 3SEMA 5CIUA 2HSEB 3PTAA 2UUEB 1RAHB 1LPLA 1WHMA 1K8AU 5FRMA 4BCMB 4MMKA 3DKMA 4A4FA 2K3YA 3CCQT 3ME9A 3HP9A 4M7DG 4ELJA 3VV0A 4IMYB 2W99A 3H0IA 2RHIA 1I5LA 4OMQA 3VUBA 4LDUA 1YHQA 4C92C 4EMKA 1R8OB 2SEMA 3JCMX 2QQBA 1PHTA 3G4SA 3EFOA 2RI3A 2J6OA 3EH1A 1UHFA 3QZ9B 2DA9A 4RTWA 4XTXA 1IREB 4EOMB 4CI0C 1MGQA 1KJWA 2V1QA 3G7ZA 5LJ5f 3POMA 5C6SA 4J9IA 1QCFA 1ZSGA 1WZOA 4AG2C 1JEGA 4J5YA 1YITT 2H3EB 2LJ1A 2X4YA 2WACA 2LX9A 4GLKA
chains in the Genus database with same CATH topology
1FKMA 4FL6A 3CCET 2LDMA 3RMSA 1NPRA 1VIFA 2KAFA 2BUDA 1MHNA 2PUKB 1N8RU 2KR6A 4JX5A 3UPUA 3FB9A 3OW2S 2G77A 2YHTA 1D3BB 3CC2A 2VXFA 1H641 4Y91A 3OSSC 2EAYA 1WJSA 3HRTA 3MEAA 4HT9A 5LJ5e 2GCXA 4MFDA 2DO3A 3DB3A 3OYAA 2WJ9A 2DXCB 2VC8A 1VQ7A 4ATOA 2DTHA 3GOXA 1N8RC 3QO3A 2K5IA 2RHZA 3OBYA 4B9WA 4BI4A 4OF1A 3HFOA 3SDZA 1B34B 1QVFS 3TEEA 2CZ1B 1JB0E 3HKSA 2R57A 3WVDB 4WF2A 4A4KA 5IT9E 5LL6S 2BKDN 4ZGJB 4JRIA 3HO8A 5I2SA 1BI0A 5GAMh 3KXTA 2LQKA 4C92A 1JJ2A 4XTYA 1BI2A 1UGRB 4XU0A 4QVDA 1K73U 2QA4A 2EJ9A 3M5AA 1XTDA 2FYKA 3HPWA 4M77E 4QW2A 2DXBA 4M78F 3H6ZA 4EMKB 3CMAA 5GAN6 2EYQA 3QJYA 2QQAA 2VGMA 3C4SA 4KUIA 5GANf 2QEXA 2MWPA 4DOVA 2ZGWA 5CKBA 3JCMh 3OYJA 4M77C 4YTLA 3JB9G 1VQ9T 1K73C 4RG2A 1VQLT 1X75C 2F5KA 4M78D 1V29B 3GF5A 3M56A 1YHQT 4FT2A 3CC7T 1GXIE 2VXEA 2M1HA 1YI2A 2V8IA 2K5LA 5LJ5g 2RJDA 2XKOC 1M5Q1 4HL4A 3MO8A 3E19A 3C94A 5LJ3j 3G4ST 3JB9F 2JTFA 4DA4A 3VJPA 5GAN4 2GQVA 1VIEA 4BI3A 3JB9I 1YJWA 1M90U 2DVEA 3CC4A 4M75E 3GP8A 2ZPIB 4BY6B 1JJ2S 3EFRA 3SD4A 3TREA 2QFZA 2DXTA 3OYNA 3OYKA 4LDXA 4BDZA 1JBMA 3DB4A 2XDBA 1G3YA 2KSSA 5A2QE 2F69A 4C8QF 5IAYA 5LJ5d 3KHIA 4M75C 3JRZA 2C06A 3RKXA 1YITA 3JB9D 1H3ZA 3R6OA 1M90C 4MIMA 4HNTA 4IUVA 5KE3A 3LX7A 2WSCE 3QPHA 2HQXA 4BBRM 3L2QA 4F7UF 4PLIA 3L2RA 5A0LA 3EFSA 3PMTA 4UC4A 2LCLA 4NS5A 4XU1A 2DXUA 2D9TA 3ZBDA 2A7YA 4C8QC 4RMOA 1YJ9T 3PT9A 1UGPB 1Y71A 4PKCC 3OY9A 3OYCA 2HD0A 4ZGEB 4LOCA 4NC6A 4Z6YA 3E1SA 4C5IA 4E47A 4N4GA 1I4K1 5GMKm 3OQ5A 3OMGA 2FVUA 3J7AF 3X24B 1G5VA 5J26A 2PUOB 4A4GA 2XG8D 4BB7A 5KH6A 3S3OA 3VUZA 2GF7A 4C92B 4MZTA 3CCVT 4QVZA 3M54A 2GFUA 1VQ7T 4N0AC 2CZ7B 2D6FA 1M1GA 1RL2A 4J6WA 3PGGA 2R5AA 4M77A 3BW1A 1QLBA 1N6AA 3SFMA 2RB6A 4C5EA 3MEVA 3VU3C 1UB4A 2JUFA 5FLXE 1KD1C 1VQ6A 4XAXB 5CKDA 2O4XA 2QA4T 3HSBA 3HZJA 1N9RA 2ZPGB 2V8JA 3CBMA 3M57A 4XU3A 3ASKA 4BACA 4M7AF 2Y4YA 4C92G 4M7AE 4PJOC 2EQJA 5GANd 4OMFB 4AI6A 3CC7A 3VKHA 1BKBA 2EQMA 1M8VA 3OBWA 4M7DF 5DLOA 4IUTA 2MWOA 3NTIA 4XU2A 3FRNA 4M7AC 5GAMj 1BYMA 2JTMA 2M0OA 3OW2A 4KBMB 2E65A 3M4YA 3V7SA 3HBLA 1M9SA 4VUBA 3JCMc 5FU7B 3OYEA 1LNXA 2PVDB 3BG3A 1YI2T 2FB7A 2EJFA 3V8JA 3OYHA 4EDUA 5CQXA 3A8OB 1WJQA 2BS2A 3CCSA 3NFCA 1X6OA 2DZCA 3OYBA 5DM7R 1YJWT 1Q86U 3PNWC 4M7DC 2RI2A 4C8QA 1K9MU 3QIIA 2X35A 2P0QA 1G3SA 3P8HA 1OZ2A 3C12A 2JN0A 2E1HA 3A5ZB 5GMKi 2WSEE 2DKGA 3X25B 5GMKj 3OS0A 1PSFA 4M6VA 4ZTJA 3BG5A 2JVVA 4F7UA 5GAN5 2CZ6B 3FIFA 1Q86C 5IN1A 1FWZA 4J6XA 1WQ7A 5GAN2 1K9MC 2MI6A 3AHUA 5EJCA 2RK2A 3CCMA 2V8KA 4KUDK 1KHCA 1YJNT 3OS2A 4OGEA 4N0AA 5J39A 4EPCA 5LJ3f 1PSEA 2LC4A 1E7PA 4O5VA 3DLLA 4RCCA 4HCBA 3CCVA 4HCZA 4M77B 4MZPA 1WJRA 2QDYB 3L2ZA 3HRUA 5D6YA 4PJOA 3UT1A 4Q5WA 4JX4A 2X4JA 1Y7XA 3QKJA 3OYFA 3CPWA 3SWNC 3QDRB 2QQSA 2K57A 2LQ8A 4M7AA 2KMTA 3LWHA 5D6XA 5CVIA 5AYFA 2OAUA 3FJPA 1FXXA 5LJ3e 1UGQB 3HRSA 1VQ5T 3RERA 3NTKA 3INZA 3G71A 4JS4A 2DD4A 2HBPA 1VQ6T 2E6NA 2GFAA 4IUQA 2BS3A 1G3TA 1Y07A 4M75B 5CK9A 4M7DB 5GAOl 1UGSB 2DAQA 2P4TA 4M78E 4N4IA 3QXEB 2ZCFB 2BIVA 2LT4A 3M55A 3NTHA 4PLLA 4M7DA 1P92A 1XNIA 3DLMA 3MP1A 5HK3A 2K2VA 4J83A 2QQ8A 1O9SA 3HL8A 4M78C 2FHDA 4BI8B 1NE8A 3BDUA 4O6JA 4C0ZA 4NL2A 3TW7A 2EQKA 4C8QB 3P8DA 3JCMW 2X4WA 3M53A 3RIRA 3CPWS 3I55T 1KQSS 1KG1A 5J3BA 4AKHA 2LT1A 2KK4A 3OYLA 1VQKA 1OZ3A 2K3XA 3CPFA 2O01E 4M75G 4LD9K 1NPPA 5CAIA 3P8BB 5GAOm 5GANe 4J6YA 3CCST 4OB3B 3ZFJA 3JSCA 1N9SA 1OI1A 3QYBA 4HA8A 4C8QE 2JOYA 4B9XA 3A8MB 3OYIA 4JRPA 3MCAB 4HLQA 2XHCA 4JDSA 5KE2A 5LJ3g 2B8AA 4JX6A 1YJNA 5KCOA 1KC8U 3VYGA 1WQWA 4XK8E 5GAMf 1QVPA 2XICA 3CCUA 4ZGDB 2RI5A 2VUBA 4F7UE 5CR2A 2RJCA 3OYYA 3CEYA 2OTLA 4PJOD 4HNVA 3L2VA 3ZEHA 3CCMT 1KQ2A 2KDSA 1SSFA 3SWNA 4E7KA 5LJ3d 2QQ9A 2E41A 1G3WA 5KCHA 2L5QA 4XTWA 3TU4K 3RKWA 1KC8C 4MDXA 4PJOB 2QXFA 1XQHA 2DJZA 3META 4J7IA 3ER0A 3L2WA 4II1A 3CMET 4JS5A 3S3MA 1VQOT 2X4XA 3UWNA 1W2BA 3QUIA 4FU6A 1BI3A 3CCRA 2E70A 4M7AB 5CKEA 2E5QA 1YIJA 3EAEA 2DXBB 4Z02A 4C0FA 2KY9A 3H8ZA 4N4HA 5GANg 1VQPT 2PU9B 2DD4B 5GAMe 1VQ5A 3Q1JA 2E10A 4PJOE 3OYMA 2G3RA 2DD5A 3RUXA 5LJ5h 4M78A 3RESA 2PVOB 3QYGB 3OMCA 3E9FA 3JB9H 2K5FA 1JRIA 2RO0A 3QJ6A 4BD3A 2CYZB 3HB9A 2DIQA 2A3LA 3I56A 2QDJA 2HAXA 2R58A 3CCJT 2QQRA 5GAOr 3G71T 4M7AG 3JCMP 3BG9A 3O8VA 2DPPB 5CKHA 5FRNA 3OA6A 5I2MA 4IUUA 1W2BS 1BI1A 2DEQA 4LDYA 3I55A 5GMKe 3BY7A 2VGNA 1ZQ1A 3KUFA 5DY9A 3A8LB 4C92F 4BE1A 4M7DE 3V8LA 1HK9A 2ZPFB 4TVRA 2RHUA 4QQGA 4FSXA 3GIBA 3E9GA 1VQ4T 4JLIA 3JCMV 1QP2A 2E64A 4OB2B 3RKYA 1W4SA 2WACA 3X26B 1U1TA 2XIDA 3MP8A 5FU6C 4HT8A 5D6WA 4ZTFA 2EFIA 2ZPBB 4C92D 1VQKT 3PIOA 2RD1A 2QF7A 3M9QA 3MHXA 4MFEA 1Q7YU 2D0QB 5GAMg 3VYGB 2KMGA 1XOVA 4JRQA 2I2LA 1KQ1A 4AKIA 1EIFA 4L59A 5HY6A 1NZ9A 3CD6A 2XDPA 4DQ2A 2EIFA 3SWNB 3M58A 2CGHA 3A8GB 2JNGA 5I21A 4X34A 2WSFE 3LGFA 4AKGA 2DIGA 1Q7YC 2HQEA 5GAMd 2FL7A 3C95A 4L6V5 3JCMQ 2XI9A 2KQWA 4RG8A 2XK0A 3CCUT 5GANh 3JAME 3LGLA 4J7FA 1VQ8A 4LDWA 3CMEA 2OTLT 1VQOA 2XD0A 2CKKA 2XDDA 3J80E 3JCMJ 4IUPA 5A0GA 1VQMT 3H4CA 1Y96A 2RH2A 4X9CA 5M9OA 3JCMd 2NLUA 2PVGB 2EQUA 3GPLA 1RI0A 1FX7A 3CCLT 3WVEB 2Y90A 1VQPA 1VQNT 2DD5B 4C5GA 4M78B 2O4XB 5FU7C 3CCRT 1KQSA 2LTOA 1LJOA 3MEUA 1YIJT 3JCMb 3QBYA 5GAOn 1ZBXA 1HXDA 1KD1U 3VKIA 2DTOA 1QVGA 2OTJT 3CCJA 4GY5A 2E12A 1S72A 2RHYA 4M77G 4ZN1A 4C0DC 4OB1B 3LWIA 2M9UA 3PIPA 5CQYA 4OB0B 2K4YA 4XTVA 1M4ZA 4QVCA 3V7RA 2KVQG 3FEOA 3I56T 1M1FA 1QP3A 4M78G 2XU8A 1BIAA 2LCCA 4E7JA 4DOWA 4IKFA 4MMLA 4HKEA 4ELYC 5CKFA 4FIBA 4M77F 4X9DA 3CCQA 2ZPHB 1VQ4A 2YLBA 3FDRA 1O75A 5LJ5j 3CBPA 2P0PA 3HFNA 3HHTB 3PFSA 2RM4A 3TCJA 2YLCA 3S6WA 4IURA 4M77D 4A53A 3QSUA 1I81A 4F7UB 5GAOp 1QVGS 3QYHB 1WPYA 3GNGA 4HCCA 3QWLA 5GAN3 3QZ5B 2EKOA 1KHIA 5DLQE 4BE2A 1YCYA 2DZ9A 4MDWA 1WNLA 4Y28E 1NJIU 2ZZDA 4ELZC 5GMKh 4M75F 4C8QG 2EWNA 1QW1A 3RMQA 1AHJB 4BBSM 3OSVA 1Q82U 1UEBA 3LYIA 4L5GA 3CD6T 2LNVA 4NL3A 3QYEA 2RHXA 3L42A 1VUBA 2QI2A 3X28B 4M7DG 2VYTA 4C5HA 3UDCA 5HKCA 4C0GA 3FC3A 4EMKC 1NJIC 1IZ6A 4XQ3A 4F7UG 4RKUE 4XTZA 2IG0A 4BUGA 2RJFA 4M75D 2IVWA 1Y96B 3OYDA 3G6ET 1VQMA 1Q82C 2P0KA 5GMKl 2Y4XA 4EMHA 1VQ8T 3VYHB 3JCMf 4MZMA 3JB9J 3VKGA 4KT0E 3CCLA 3OYGA 1VQNA 2LRQA 4PNOA 2JZ2A 3CCEA 3M59A 4J8OA 5HK0A 1DJ7B 4A54A 1ZHIA 4ZN3A 4C8QD 4LD6A 3MEWA 2E6ZA 2F5TX 5A0DA 4QQDA 3WXMB 4QSHA 4E7LA 2RJEA 1I8FA 2RA2A 3BFMA 2OTJA 5GANj 3CXCA 2RK1A 4LDVA 4BY6C 5EG2A 4HNUA 2DK3A 4PJOG 4OVAA 3J81E 2L3RA 1M1KU 2L89A 3CC2T 1BIBA 4XTUA 4JJNK 3L2UA 2M16A 5FU6B 3F70A 4KULA 1D3BA 5CIUA 3PTAA 2MF2A 4R56A 1S72T 1X01A 3T9NA 2DTIA 4FM4B 3JCMe 3A8HB 4D6WA 3FLGA 4A4HA 1K8AU 4CRIA 4BDYA 5FRMA 1Q81U 4PJOF 2CZ0B 1LOJA 2DXCA 4V2SA 4QQ6A 1TH7A 5CO7A 1M1KC 4MMKA 5C0MA 3DKMA 2BS4A 5GAN7 1B34A 4RCBA 3DL1A 4A4FA 2K3YA 3QG1A 3GLXA 3HP9A 3ME9A 5LJ3h 3CCQT 5L8RE 2AHJB 4PL6A 2H3JA 3S3NA 4ELJA 3VV0A 1K8AC 2PQWA 3LLRA 4OGCA 4A4EA 1Q81C 2RHIA 3LH0A 2HNIA 4OP0A 4C92E 1I5LA 1VQ9A 3BDLA 3CXCS 4P5NA 2ZZDB 3V8KA 3PMIA 1VQLA 4EMGA 3VUBA 3CMAT 4LDUA 1YHQA 2EJGA 3V7CA 4C92C 1WGSA 2MMPA 2VV5A 4FT4A 4EMKA 2QEXT 4M7AD 1R8OB 3M4GA 3JCMX 3N5BB 1YBYA 2L8DA 2LVMA 2QQBA 5CCAA 4M75A 4ME7A 3G4SA 2ZPEB 2RI3A 3KBGA 4JUVA 3QZ9B 3X20B 3TW6A 4E7IA 2MAMA 3OB9A 5GAN8 4XTXA 1U8RA 1IREB 5FROA 5GAOq 1OYXA 3LW5E 4NOYA 3JCMg 2R5MA 3G6EA 4CI0C 4M7DD 3QHSA 1MGQA 3G7ZA 5LJ5f 3CC4T 3L1AA 3OS1A 3MP6A 5C6SA 4R55A 3GNFB 4E7HA 4C0DB 1QVFA 2QTXA 4JRKA 3URGA 1N27A 3CBOA 4J5YA 3SB2A 1U1SA 1YITT 2YRVA 4BE0A 2X4YA 2CS7A 2LX9A 4JLGA 3OS5A 4GLKA 1YJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHT B;  2PUK B;  2PVD B;  3QYH B;  3QZ5 B;  2DXB B;  4Y28 E;  3A8O B;  2DXC B;  2ZZD A;  2PU9 B;  2DD4 B;  1AHJ B;  2DD5 A;  2PVO B;  2CZ1 B;  3QYG B;  1JB0 E;  3WVD B;  3X28 B;  2CYZ B;  4ZGJ B;  2WSE E;  3X25 B;  1PSF A;  4RKU E;  1UGR B;  2CZ6 B;  2DPP B;  2DXB A;  3VYH B;  4KT0 E;  3A8L B;  1PSE A;  1DJ7 B;  2ZPF B;  1QP2 A;  1V29 B;  1GXI E;  4OB2 B;  3X26 B;  2ZPB B;  2QDY B;  2D0Q B;  3VYG B;  2ZPI B;  4FM4 B;  3A8H B;  3A8G B;  1UGQ B;  2CZ0 B;  2DXC A;  2WSF E;  2DD4 A;  2WSC E;  4L6V 5;  1UGS B;  3QXE B;  2ZCF B;  5L8R E;  2AHJ B;  1UGP B;  2ZZD B;  4ZGE B;  2PVG B;  3WVE B;  2DD5 B;  3X24 B;  2PUO B;  2O01 E;  2ZPE B;  3QZ9 B;  3X20 B;  4OB3 B;  2CZ7 B;  1IRE B;  3LW5 E;  4OB1 B;  3A8M B;  4OB0 B;  1QP3 A;  3VYG A;  4XK8 E;  4ZGD B;  2ZPG B;  2ZPH B; 
#chains in the Genus database with same CATH topology
 1VOM A;  1M90 R;  2LDM A;  1WA7 A;  3RMS A;  2L0A A;  2KAF A;  1VIF A;  2BUD A;  2AZS A;  3K7A M;  3OW2 S;  2G77 A;  1ENW A;  1D3B B;  2YHT A;  3EGU A;  2VXF A;  3CC4 Q;  2LQN A;  1X6B A;  1PM3 A;  4WCI A;  3HRT A;  3MEA A;  5LJ5 e;  5HBH B;  1UTI A;  4JZ3 A;  2WPA B;  3OYA A;  2WJ9 A;  4ATO A;  1S1N A;  2DTH A;  4YOO A;  1UJY A;  2K5I A;  3VS4 A;  4OF1 A;  3HFO A;  2CZ1 B;  4Y92 A;  2BKD N;  1OPL A;  5GAM h;  1BI0 A;  2ZAE A;  4C92 A;  1JJ2 A;  4XTY A;  4QVD A;  4YC3 B;  2QA4 A;  2KRO A;  3M5A A;  4FW1 A;  3EGD A;  2NUP A;  4BXX X;  1ZUU A;  3QJY A;  2VGM A;  2MWP A;  4PJM A;  2ZGW A;  5IHK A;  3OYJ A;  4M77 C;  2DVJ A;  1K73 C;  4BY1 X;  4RG2 A;  1X75 C;  1YHQ T;  1GXI E;  1WX6 A;  5LJ5 g;  1M5Q 1;  1M3A A;  5LJ3 j;  3G4S T;  1QVF P;  2JTF A;  4DA4 A;  1M90 U;  5GAN 4;  1RAA B;  3CC4 A;  1YJW A;  2DVE A;  1YCS B;  1JJ2 S;  1V1C A;  2XDB A;  1JBM A;  1X43 A;  5LJ5 d;  3KHI A;  1GCP A;  3JRZ A;  3PE0 A;  3JB9 D;  3TSZ A;  1UE9 A;  4AFU C;  3HTR A;  2HQX A;  4CFV B;  5A0L A;  3EFS A;  3EG3 A;  4UC4 A;  3G33 B;  2LCL A;  5HCK A;  4XU1 A;  2A7Y A;  1JQQ A;  1WDX A;  3PT9 A;  3QDF A;  1UGP B;  1P5E B;  2HD0 A;  4ZGE B;  4LOC A;  4C5I A;  1K9M R;  4E47 A;  2KEA A;  1D09 B;  1M3B A;  1JOW A;  3X24 B;  5J26 A;  4A4G A;  2A37 A;  4FSS A;  4RTV A;  4E2F B;  2GF7 A;  4QVZ A;  2O9S A;  3M54 A;  4N0A C;  3PGG A;  1GY3 B;  2R5A A;  2AT1 B;  4M77 A;  4C5E A;  3VU3 C;  4EOJ B;  1H4L D;  2JUF A;  2IW8 B;  2CH4 W;  2QA4 T;  2CH4 A;  4BCQ B;  3CBM A;  3BE3 A;  3M57 A;  3QWX X;  1QQJ A;  3O5Z A;  4PJO C;  2Y4Y A;  2VVK A;  4LNP A;  4AI6 A;  3CCV Q;  3VKH A;  1M8V A;  1TXQ A;  3OBW A;  4M7D F;  1T0J A;  3NTI A;  2C6T B;  2L3Q A;  4M7A C;  1NYG A;  3HBL A;  3VRZ A;  4VUB A;  3JCM c;  2KT8 A;  5FU7 B;  1BU1 A;  1LNX A;  2QK0 A;  3U23 A;  2GQI A;  1WLP B;  2RQT A;  3V8J A;  5CQX A;  5IHN A;  2DL8 A;  2JT4 A;  2BS2 A;  2DZC A;  5L2W B;  1YJW T;  1Q86 U;  3PNW C;  4AG1 C;  1K9M U;  2M02 A;  2P0Q A;  1OZ2 A;  4DBQ A;  1SPK A;  1IRX A;  2JMA A;  2E1H A;  3JV3 A;  4B6M A;  2WSE E;  3OS0 A;  4M6V A;  1Z9Q A;  3MIA B;  3FIF A;  3AHU A;  1WQ7 A;  1PKD B;  1GRI A;  3OS2 A;  4N0A A;  4EPC A;  2LX7 A;  2IPO B;  3UAT A;  1PWT A;  4YOZ A;  1M8M A;  4O5V A;  2YUO A;  3DLL A;  4RCC A;  3CCV A;  2KI7 A;  2IVX A;  2J6K A;  2ROL A;  1AZE A;  2DME A;  1ARK A;  5GJW B;  3L2Z A;  3HRU A;  2LCS A;  1E6H A;  4PJO A;  3LH5 A;  3CPW A;  2R7G A;  4BCP B;  2JMC A;  2K57 A;  5HBJ B;  2DBK A;  4M7A A;  2KMT A;  5D6X A;  1FXX A;  2K79 A;  1VQ5 T;  3G71 A;  2WXV B;  4IUQ A;  4I3Z B;  5GAO l;  3EFO B;  2P4T A;  3VS7 A;  2ZCF B;  4F7N B;  1P92 A;  1XNI A;  2MK5 A;  4J83 A;  2DET A;  4M78 C;  4BCG B;  4BCK B;  3P8D A;  4PFO A;  3CPW S;  1KG1 A;  5J3B A;  1ACM B;  2HL3 A;  3CPF A;  1V76 A;  3MY5 B;  2AKK A;  2D1X A;  4QT7 A;  5KYX A;  3THK A;  1W98 B;  1N9S A;  1K4U S;  4C8Q E;  4J9H A;  3A8M B;  3OYI A;  2XHC A;  1OX9 A;  5KCO A;  5GAM f;  1QVP A;  3CCU A;  5CR2 A;  2VUB A;  3CEY A;  2HCK A;  4DEX A;  2FZC B;  5FWB A;  1EX4 A;  1Y0M A;  2AKL A;  1OIY B;  2QGS A;  3RKW A;  1I1J A;  3L2W A;  1YWP A;  4JS5 A;  3S3M A;  1VQO T;  1H28 B;  1BI3 A;  2EYW A;  1TD6 A;  3NHN A;  4C0F A;  2KY9 A;  2NUP B;  4N4H A;  1VQP T;  2PU9 B;  5GAM e;  3OYM A;  2G3R A;  2W9F A;  4M78 A;  3RES A;  3OMC A;  1TOV A;  2RO0 A;  1E9H B;  2A3L A;  3CME Q;  2R58 A;  3CCJ T;  3G71 T;  1QWE A;  1GH6 B;  3LQ5 B;  2ATC B;  5GMK e;  1KD1 R;  2K7A A;  3V8L A;  2ZPF B;  2RN8 A;  4TVR A;  1AIS B;  2L3S A;  1VQ4 T;  2C5N B;  4JLI A;  1NEG A;  1AWX A;  3X26 B;  1U1T A;  2XID A;  3MP8 A;  4ZTF A;  4C92 D;  3PIO A;  1GUX B;  2QF7 A;  2A08 A;  5GAM g;  3VYG B;  2EGC A;  2O88 A;  4JRQ A;  1M2V A;  2K2M A;  5HY6 A;  4DQ2 A;  3SWN B;  2CGH A;  5I21 A;  4X34 A;  1UNL D;  3LGF A;  5GAM d;  1XJW B;  1W2B P;  2XI9 A;  4RG8 A;  3CCU T;  3TN8 B;  3A1P A;  3RBB B;  4LDW A;  3CME A;  4Z89 A;  2FG0 A;  3J80 E;  1ZBJ A;  4AFQ C;  2YSQ A;  1GCQ C;  1RI0 A;  1FX7 A;  1R0B G;  3WVE B;  1ZP2 A;  2RQU A;  1Q82 R;  4C5G A;  1SSH A;  2LTO A;  3MEU A;  2CSQ A;  3JCM b;  2DYB A;  1I0C A;  1X2K A;  2EBP A;  1KD1 U;  4UN0 A;  3VKI A;  2DTO A;  4A63 B;  2OAW A;  4GY5 A;  2F2V A;  2E12 A;  1S72 A;  2RHY A;  3MY1 B;  3LWI A;  1AWW A;  1VYT A;  5CQY A;  4OB0 B;  2DF6 A;  3VS0 A;  3V7R A;  5I5Z B;  3CCL Q;  1YFN A;  1VQN Q;  1BIA A;  4HKE A;  4ESR A;  1UNG D;  1YIJ Q;  2WHB B;  2YLB A;  2DL3 A;  2F2C A;  3R6N A;  2ED1 A;  4KRT A;  2OTJ Q;  2EVR A;  2L2P A;  3HFN A;  2C0I A;  2FRY A;  3TCJ A;  3S6W A;  1RAG B;  4M77 D;  4OMN A;  3QYH B;  5FGK B;  1QKW A;  3QWY A;  3I56 Q;  4HCC A;  3QZ5 B;  2BZ8 A;  4CFW B;  1KHI A;  4BE2 A;  4J9F A;  1YCY A;  2C5O B;  2KBT A;  4ELZ C;  4C8Q G;  2PJQ A;  1QW1 A;  3RMQ A;  4GBQ A;  4ANJ A;  1Q82 U;  3LYI A;  1KSW A;  2LNV A;  3L42 A;  1H8K A;  1YN8 A;  3X28 B;  3RDV A;  1GCQ A;  4C5H A;  5HKC A;  3I35 A;  1IZ6 A;  4XQ3 A;  2RJF A;  3G6E T;  3DDQ B;  5GMK l;  2Y4X A;  2VKN A;  3CCL A;  1VQN A;  4PNO A;  1DJ7 B;  1ZUK A;  1QVG P;  4LD6 A;  3CD6 Q;  2OTJ A;  2RJE A;  2HBW A;  4LDV A;  2A36 A;  2GTO A;  5EG2 A;  3DJB A;  4OVA A;  2L89 A;  1BIB A;  4XTU A;  1VQ8 Q;  3G1J A;  3L2U A;  1D3B A;  2MF2 A;  1S72 T;  4J9E A;  2DTI A;  4D6W A;  4AFS C;  4CRI A;  4BDY A;  4F7J B;  4V2S A;  2CZ0 B;  1LOJ A;  2BE9 B;  4QQ6 A;  2BKZ B;  5C0M A;  3GTM S;  3DL1 A;  5L8R E;  4PL6 A;  3LLR A;  4OGC A;  4A4E A;  1Q81 C;  4C92 E;  1VQ9 A;  2HNI A;  4PJO D;  4PJJ A;  3PMI A;  2YRC A;  2EJG A;  3V7C A;  2MMP A;  4FT4 A;  2QEX T;  4M7A D;  2O31 A;  5CCA A;  4M75 A;  4ME7 A;  4JUV A;  1UG1 A;  2NUZ A;  3OB9 A;  3CCQ Q;  1H1R B;  2R5M A;  3QHS A;  5D7U A;  4CFU B;  2EUF A;  3L1A A;  2DMO A;  1NJI R;  4J9B A;  4JRK A;  3URG A;  1AT1 B;  3ZL7 C;  3SB2 A;  1U1S A;  2YRV A;  4JLG A;  3OS5 A;  1FKM A;  1YNZ A;  3AT1 B;  4FL6 A;  2KR6 A;  4Y91 A;  2W2H A;  2C4G B;  2EAY A;  1W70 A;  1X69 A;  1H3H A;  4CC7 A;  1VQ7 A;  2DXC B;  1Z9Z A;  4LUD A;  1N8R C;  2PHG A;  1B07 A;  1YIT Q;  2RHZ A;  2X3W D;  4HVU A;  1JB0 E;  4A4K A;  5IT9 E;  1C6V X;  4ZGJ B;  1CKB A;  2DJQ A;  4JRI A;  5I2S A;  2WEV B;  3KXT A;  3VS1 A;  4XU0 A;  2X3X D;  3HPW A;  2FYK A;  1M1K R;  4M77 E;  2QQA A;  3C4S A;  5CKB A;  1LVK A;  3JCM h;  2D8J A;  1VQ9 T;  4EOR B;  1TUD A;  2G9X B;  5DQW A;  4M78 D;  1V29 B;  3M56 A;  3CC7 T;  4FT2 A;  2M1H A;  1YI2 A;  2RJD A;  1JKW A;  3JB9 F;  1G8X A;  4BI3 A;  3GP8 A;  1JSU B;  4IIO A;  2ZPI B;  4BY6 B;  3EFR A;  3TRE A;  3OYN A;  3OYK A;  2E5K A;  3DB4 A;  2UZE B;  2PMI B;  1G3Y A;  4C8Q F;  3RKX A;  1YIT A;  1ZX6 A;  1H3Z A;  3R6O A;  5KYY B;  2NWM A;  4RTU A;  4LUE A;  3LX7 A;  1YHQ Q;  1BCM A;  4BBR M;  3L2Q A;  4F14 A;  3PMT A;  3BHT B;  1UHC A;  1IHV A;  3G4S Q;  2DXU A;  1ABQ A;  3H9N A;  4PKC C;  3OYC A;  1TG0 A;  3BLH B;  2HZY A;  4N4G A;  3EG1 A;  1PKS A;  3OMG A;  1G5V A;  1X27 A;  1CSK A;  1JJ2 P;  1N5Z A;  2DER A;  8ATC B;  3F5X B;  5LMK B;  1AD5 A;  4F7L B;  4MZT A;  1H1Q B;  1VQ7 T;  2VWF A;  2D6F A;  4J6W A;  3SFM A;  2F1L A;  4JPB W;  3MEV A;  1OOT A;  1UB4 A;  4CC4 B;  1VQ6 A;  1UGV A;  2QYZ A;  1WXT A;  1JXO A;  2O4X A;  1WHH A;  2B86 A;  3HZJ A;  2V8J A;  4XU3 A;  5IHY A;  4C92 G;  4M7A E;  2EQJ A;  4OMF B;  2C0O A;  1BKB A;  1IB8 A;  4JZ4 A;  4XU2 A;  1BYM A;  2YUN A;  3OW2 A;  2AZV A;  2E65 A;  3M4Y A;  3V7S A;  2HEQ A;  1M9S A;  1IXD A;  2PVD B;  1YI2 T;  3OYH A;  1KFZ A;  3QHR B;  2QA4 Q;  4M7D C;  2YRD A;  1H92 A;  2X35 A;  5FW9 A;  9ATC B;  3P8H A;  3EHQ A;  1PD0 A;  1NM7 A;  4BCM D;  3A5Z B;  5GMK i;  2IW6 B;  1PSF A;  2JVV A;  2E3I A;  5IN1 A;  2MI6 A;  2YDL A;  1KHC A;  1YJN T;  5J39 A;  1YJW Q;  2I40 B;  2MIO A;  2LC4 A;  3I9Q A;  3I5R A;  5IXB A;  4MZP A;  1WJR A;  2UZB B;  2IW9 B;  1QCO A;  2ECZ A;  3UT1 A;  1TUG B;  3SWN C;  2EGA A;  2QQS A;  2K6D A;  1M27 C;  2DM1 A;  3EJ1 B;  2V26 A;  5EFQ B;  1UGQ B;  3HRS A;  1QCN A;  3INZ A;  4JS4 A;  1VQ6 T;  2HBP A;  1G2B A;  1TSF A;  4M75 B;  1UGS B;  2DAQ A;  4M78 E;  4N4I A;  3NTH A;  4M7D A;  5HK3 A;  2K2V A;  2BPM B;  1O9S A;  3HL8 A;  1T3S A;  4PK4 A;  1GL5 A;  1KIK A;  1RAB B;  3JCM W;  4C8Q B;  3M53 A;  2VAS A;  1SHF A;  3ULR B;  1KQS S;  1VQ5 Q;  2KK4 A;  1OZ3 A;  2K3X A;  3P8B B;  5GAO m;  1ZA2 B;  4FW2 A;  2FPE A;  1OI1 A;  2K9G A;  2EPD A;  4HA8 A;  4B9X A;  4JRP A;  4BCI B;  1MV3 A;  3VS2 A;  5KE2 A;  2E3H A;  2XMF A;  1GUX A;  1KC8 U;  3VYG A;  5IF1 B;  1Y57 A;  2XIC A;  1EFN A;  2RI5 A;  2OTL A;  4F7U E;  2EYZ A;  1D0X A;  1Q86 R;  4HNV A;  6AT1 B;  2JW4 A;  1SSF A;  3SWN A;  1JST B;  4F6S B;  4EON B;  4XTW A;  4ZNX A;  3CPW P;  2QXF A;  1XQH A;  3MET A;  4J7I A;  3ER0 A;  3KFV A;  2DFU A;  2DIL A;  3UWN A;  2KYB A;  5HQ0 B;  1B3Q A;  2E5Q A;  2DE0 X;  4DBR A;  4F70 B;  2RQV A;  1MUZ A;  4F17 A;  2DD4 B;  1UFF A;  1RAI B;  1VQ5 A;  3Q1J A;  2JS0 A;  3RUX A;  3QYG B;  2JXB A;  4J9D A;  3JB9 H;  2K5F A;  3EG0 A;  2DIQ A;  2O2O A;  2FO0 A;  2QDJ A;  1VQO Q;  2KGT A;  5GAO r;  2YUQ A;  4M7A G;  1SF9 A;  3O8V A;  4CFM B;  5CKH A;  3OA6 A;  5I2M A;  2X9H A;  1VQP Q;  3BY7 A;  4BE1 A;  1ZQ1 A;  4C92 F;  3A8L B;  2RHU A;  4FSX A;  1W4S A;  2HQH A;  3CCJ Q;  4HT8 A;  1C9B A;  2EFI A;  3G71 Q;  2X1N B;  2RD1 A;  3FJ5 A;  4MFE A;  4AT1 B;  1KQ1 A;  4AKI A;  1EIF A;  1SRM A;  1OUL A;  1NLP C;  1OL1 B;  2EIF A;  2JNG A;  3A8G B;  2WSF E;  1VQ4 Q;  2DIG A;  1Q7Y C;  4BCQ D;  4M4Z A;  1E6G A;  4AMC A;  5GAN h;  2DRM A;  3LGL A;  2OTL T;  1VQO A;  4EC8 B;  1BU2 A;  4FYW B;  2CP5 A;  2XDD A;  3UF4 A;  3JCM J;  3BHV B;  5A0G A;  5M9O A;  3JCM d;  1VQM T;  1SRL A;  3EH2 A;  1WIE A;  4Z88 A;  1VQP A;  2O4X B;  1WI7 A;  4EC9 B;  1TU0 B;  2BTT A;  1NBE B;  3CCU Q;  1JU5 C;  1RUW A;  2YWW A;  3CCJ A;  3RR6 A;  4ROE A;  4OB1 B;  2M9U A;  2I0N A;  1M4Z A;  2KRS A;  3TVT A;  1M1F A;  4M78 G;  4E7J A;  4DOW A;  4ELY C;  4M77 F;  2YT6 A;  1RAC B;  1VQ4 A;  3FDR A;  1O75 A;  4D8D A;  5LJ5 j;  1FMK A;  3EOC B;  3CBP A;  2FPF A;  4RUG A;  1I81 A;  4WTO B;  3QWL A;  2WIH B;  2DZ9 A;  4MDW A;  2EWN A;  3M0R A;  3QYE A;  4BCF B;  2RHX A;  1VUB A;  2QI2 A;  4KGV B;  4RTT A;  3FC3 A;  4C0G A;  1NJI C;  4F7U G;  2CT3 A;  4XTZ A;  1FIN B;  1Y96 B;  2IVW A;  5CYI B;  1RI9 A;  4EMH A;  3VYH B;  2LRQ A;  2JZ2 A;  3CCE A;  3M59 A;  4J8O A;  1OKV B;  1ZHI A;  2E6Z A;  2F5T X;  4QQD A;  4QSH A;  1K76 A;  3BFM A;  3CXC A;  4BY6 C;  1GBR A;  1G3N C;  2DK3 A;  3G6E Q;  4M7D B;  2L3R A;  3CC2 T;  4JJN K;  5FU6 B;  1U3O A;  3F70 A;  4Z8A A;  1SG5 A;  4F7S B;  4R56 A;  1X01 A;  4FM4 B;  2EYY A;  4A4H A;  2PNI A;  4PJO F;  2DXC A;  1M1K C;  2BS4 A;  5LJ3 h;  4M7A F;  3S3N A;  2H3J A;  1K8A C;  2G6F X;  4OP0 A;  1T0H A;  3BDL A;  5ECA A;  4P5N A;  3CXC S;  2ZZD B;  3V8K A;  1S72 Q;  1VQL A;  2DL5 A;  2FPD A;  4J9C A;  4EMG A;  3CMA T;  2CP0 A;  8AT1 B;  3M03 A;  1WGS A;  2VV5 A;  1YBY A;  2LVM A;  2PK9 B;  2ZPE B;  2O9V A;  4CXA B;  3KBG A;  3X20 B;  3TW6 A;  2QGG A;  2F2W A;  1U8R A;  5FRO A;  5GAO q;  1OYX A;  3LW5 E;  4NOY A;  3G6E A;  4M7D D;  1QLY A;  1ZSZ B;  3OS1 A;  3MP6 A;  3H0H A;  4R55 A;  4E7H A;  2QEX Q;  3CBO A;  2HSP A;  4BE0 A;  4YOS A;  2COZ A;  2K3B A;  1YJ9 A;  4HVV A;  3CCE T;  5KYY A;  1NPR A;  1VIN A;  1MHN A;  2QAZ A;  2MPX C;  1WJS A;  2KT1 A;  4HT9 A;  2KXC A;  4F04 B;  4MFD A;  3QHW B;  3DB3 A;  2VC8 A;  2CCI B;  2L3P A;  4KRC B;  1QKX A;  3OBY A;  4B9W A;  4BI4 A;  4OR5 B;  1B34 B;  3TEE A;  4DBF A;  1PG5 B;  2KRM A;  2LQK A;  3DDP B;  1BI2 A;  1UGR B;  1K73 U;  3O0G D;  4QW2 A;  4M78 F;  3H6Z A;  4BCN B;  5GJV B;  1T3L A;  2EYQ A;  5GAN f;  2QEX A;  4DOV A;  2RNA A;  4YTL A;  3JB9 G;  1W1F A;  1VQL T;  2F5K A;  2K5L A;  3MO8 A;  3C94 A;  3VJP A;  1VIE A;  2QFZ A;  2EYX A;  4BDZ A;  2F69 A;  5IAY A;  1VQ9 Q;  4M75 C;  1M90 C;  5KE3 A;  2WSC E;  3QPH A;  3CC7 Q;  1IGQ A;  2AIR B;  3UA6 A;  1KXU A;  4PLI A;  4F7U F;  3L2R A;  1EZZ B;  1FYN A;  4NS5 A;  2EW3 A;  5I11 A;  2D9T A;  2QG9 B;  4C8Q C;  3PVL A;  1YJ9 T;  1VYW B;  4D8K A;  1Y71 A;  5EC7 A;  4EOK B;  4NC6 A;  4Z6Y A;  3E1S A;  3OQ5 A;  2FVU A;  4BB7 A;  1D1B A;  3S3O A;  2GFU A;  3EID B;  4HVW A;  3BW1 A;  3REA B;  1WHK A;  5FLX E;  2J7I A;  1H1S B;  2CJM B;  5CKD A;  3PVQ A;  3VS3 A;  1YP5 A;  2ZPG B;  3ASK A;  4PJL A;  5GAN d;  1HD3 A;  3CC7 A;  1VQ7 Q;  4EOS B;  2EQM A;  3VRY A;  5DLO A;  2CCH B;  5GAM j;  4HCK A;  3E2U A;  4KBM B;  3OYE A;  3BG3 A;  5AT1 B;  2CSI A;  1TWB A;  4EDU A;  4LE9 A;  3A8O B;  3CCS A;  2DYI A;  2V1R A;  2RI2 A;  4C8Q A;  1D0Z A;  1H25 B;  4G6L B;  1G3S A;  1M2O A;  3C12 A;  2JN0 A;  2DKG A;  3X25 B;  2ABL A;  4PJN A;  5GMK j;  3BG5 A;  5GAN 5;  2CZ6 B;  2J6F A;  1Q86 C;  1K9M C;  5GAN 2;  5EJC A;  2ESW A;  1YI2 Q;  2RK2 A;  3CCM A;  4OGE A;  1PKT A;  5LJ3 f;  4EIK A;  3VS5 A;  2LP5 A;  3EG9 B;  4HCZ A;  1RAF B;  1PRL C;  2LZ6 B;  1IHW A;  4Q5W A;  1Y7X A;  3QKJ A;  3QDR B;  1YJN Q;  2HDA A;  2LQ8 A;  4CFU D;  1BCO A;  4K11 A;  5CVI A;  2OAU A;  2X51 A;  5LJ3 e;  3DTO A;  3NTK A;  3RER A;  2DD4 A;  2FZG B;  2E6N A;  2GFA A;  3OW2 P;  2BS3 A;  5HBE B;  2DRK A;  3M55 A;  1H24 B;  4GLM A;  1MMA A;  1ZLM A;  1HYO A;  2CUB A;  5IDP B;  4RTY A;  5IH2 A;  4BI8 B;  4O6J A;  4C0Z A;  4NL2 A;  2EQK A;  4ROC A;  2X4W A;  2WIP B;  4TTH A;  3RIR A;  3I55 T;  4AKH A;  1JO8 A;  3M0T A;  2LT1 A;  1VQ6 Q;  3OYL A;  1VQK A;  1AEY A;  1U5S A;  1QMC A;  5KYW B;  1NPP A;  4F6W B;  1OV3 A;  1ZUY A;  2NUT A;  1SKU B;  3CCS T;  3PO3 S;  3ZFJ A;  1UNH D;  1X6G A;  2AK5 A;  3JSC A;  1XO2 A;  3QYB A;  4CFX B;  2JS2 A;  5LJ3 g;  1JXM A;  1YJN A;  4JX6 A;  4XK8 E;  2LW4 A;  4ZGD B;  1WXB A;  2RJC A;  3OYY A;  2KXD A;  3L2V A;  3CCM T;  1KQ2 A;  2KDS A;  2ENM A;  2CDT A;  2E41 A;  5LJ3 d;  5KCH A;  1K0S A;  1PCX A;  3TU4 K;  4MDX A;  2DJZ A;  4II1 A;  1TS9 A;  3QUI A;  1WYX A;  4FU6 A;  4FYY B;  3CCR A;  2E70 A;  3EAE A;  4Z02 A;  2DBM A;  1PNJ A;  3H8Z A;  1BBZ A;  3DOG B;  2E10 A;  4PJO E;  2JTE A;  3M0Q A;  1HSQ A;  3E9F A;  4BD3 A;  1JRI A;  2C0T A;  1OGU B;  2CYZ B;  2KYM A;  2HAX A;  2J06 A;  2LJ3 A;  2KR3 A;  3JCM P;  2W96 A;  2A28 A;  2DPP B;  2QGF B;  2CT4 A;  1NG2 A;  3KUF A;  3GIB A;  3E9G A;  2BE7 D;  1QP2 A;  4HXJ A;  1MND A;  2E64 A;  4OB2 B;  1H27 B;  2DEU A;  5FU6 C;  2ZPB B;  2MCN A;  1VQK T;  3MHX A;  2D0Q B;  2KMG A;  1XOV A;  1K9A A;  2I2L A;  1M30 A;  1NZ9 A;  2XDP A;  1OQK A;  3TSW A;  2KE9 A;  1J3T A;  1K0X A;  2VB6 A;  3C95 A;  4L6V 5;  3JCM Q;  1TTH B;  2KQW A;  2XK0 A;  1OPK A;  4J7F A;  1UJ0 A;  7AT1 B;  4CC2 A;  2MYS A;  2KNB B;  2XD0 A;  2CKK A;  1I07 A;  1Y96 A;  3GPL A;  2OI3 A;  2NLU A;  2PVG B;  1KC8 R;  2Y90 A;  2DD5 B;  4NST B;  1KQS A;  3CCR T;  1LJO A;  3QBY A;  5L23 A;  2NYS A;  4EOI B;  2OTL Q;  1ZSZ C;  3NMZ C;  4M77 G;  4ZN1 A;  3M0P A;  2KRN A;  2K4Y A;  1VQM Q;  2KVQ G;  1KD1 C;  2XU8 A;  2LCC A;  4IKF A;  4MML A;  5CKF A;  2CRE A;  4FIB A;  4X9D A;  2ZPH B;  2MOX A;  2GTJ A;  3PFS A;  2RM4 A;  4IUR A;  4A53 A;  3GNG A;  5GAN 3;  1Q81 R;  2CUD A;  4Y28 E;  1WNL A;  2ZZD A;  5GMK h;  1VYU A;  1VOL A;  4BBS M;  1VA7 A;  4NL3 A;  1AD6 A;  2VYT A;  3UDC A;  3RGF B;  4DEY A;  4BUG A;  2IG0 A;  3EGX B;  4M75 D;  4II5 B;  1VQM A;  4E7S A;  1Q82 C;  2P0K A;  1BB9 A;  3JCM f;  1RLQ C;  3VKG A;  4KT0 E;  3OYG A;  1ZSZ A;  4KH0 B;  2FZK B;  3NDQ A;  4C8Q D;  3MEW A;  3H0F A;  3WXM B;  3CQT A;  4E7L A;  2RA2 A;  5ICP B;  4PJO G;  3J81 E;  5HNB B;  4KUL A;  3TNW B;  3T9N A;  3JCM e;  2QDL A;  2HKQ B;  3A8H B;  3FLG A;  2J05 A;  4PFZ A;  1Q81 U;  1YWO A;  1N8R R;  1TH7 A;  2YXY A;  5CO7 A;  5GAN 7;  1B34 A;  4RCB A;  2NUT B;  1D3U B;  3GLX A;  3QG1 A;  2QAS A;  2AHJ B;  2PQW A;  3CC2 Q;  3LH0 A;  1OX8 A;  4IIM A;  2P4R A;  1I5O B;  3MJX A;  2DX1 A;  4JJC A;  2Z0W A;  2JM9 A;  5CEI B;  2ROT A;  4R0K A;  3M4G A;  3N5B B;  1O9K A;  4ELL A;  2L8D A;  1W6X A;  2RQR A;  2CP3 A;  4DBH A;  4E7I A;  2MAM A;  5GAN 8;  1PC0 A;  3JCM g;  2C5V B;  3NGP A;  1C0M A;  3CC4 T;  3CMA Q;  2DL4 A;  2RMO A;  3GNF B;  4C0D B;  1QVF A;  2QTX A;  1N27 A;  3CXC P;  1SEM A;  2YUP A;  1PRM C;  4QKU A;  4CRL B;  1FMV A;  2PUK B;  1N8R U;  1AVZ C;  1M3C A;  3UPU A;  4JX5 A;  1A0N B;  2LJ0 A;  3FB9 A;  2OX7 A;  1WHJ A;  3CC2 A;  1H64 1;  3OSS C;  3RNJ A;  1QWF A;  4EOP B;  1C1A A;  2DLP A;  2GCX A;  2DO3 A;  1BK2 A;  1Q95 G;  4KH1 B;  3GOX A;  1UEC A;  3QO3 A;  1R0C B;  3SDZ A;  1QVF S;  3HKS A;  2R57 A;  3WVD B;  4WF2 A;  4X1V A;  3CCE Q;  5LL6 S;  3HO8 A;  3SHW A;  2EJ9 A;  2IN3 A;  1XTD A;  2DXB A;  4EMK B;  2GNC A;  3CMA A;  5GAN 6;  4KUI A;  2UZD B;  3EG2 A;  4BCO B;  1CKA A;  4EOO B;  3GF5 A;  1K1Z A;  3MI9 B;  2VXE A;  2V8I A;  1B7T A;  2XKO C;  4HL4 A;  3E19 A;  3BHU B;  4RTZ A;  1OL2 B;  2M0Y A;  1FVV B;  2PZ1 A;  1G83 A;  2GQV A;  3JB9 I;  2E4H A;  1RLP C;  3A98 A;  4M75 E;  2P84 A;  3SD4 A;  4LDX A;  2DXT A;  2CP7 A;  2KSS A;  5A2Q E;  2C06 A;  4KRD B;  4PFP A;  1VQL Q;  4MIM A;  4HNT A;  4IUV A;  1WXU A;  5BNJ B;  1OI9 B;  2OJ2 A;  2UZL B;  1MV0 B;  2JGZ B;  4CC3 A;  3ZBD A;  4LXC A;  2V22 B;  4RMO A;  3OY9 A;  3REB B;  2F2X A;  1X2Q A;  1I4K 1;  5GMK m;  1GFC A;  3J7A F;  5HVY B;  2PUO B;  1U06 A;  2XG8 D;  5KH6 A;  4AFZ C;  2WMA B;  5I22 A;  3VUZ A;  4C92 B;  3CCV T;  4OGR B;  3NPF A;  2CZ7 B;  1M1G A;  1RL2 A;  3EG9 A;  1GBQ A;  3EGD B;  1FMW A;  1YJ9 Q;  1QLB A;  1LCK A;  1N6A A;  2RB6 A;  1OU9 A;  2RF0 A;  4XAX B;  2WMB B;  3HSB A;  2DL7 A;  1N9R A;  2IIM A;  1D1A A;  4BAC A;  2COW A;  5KYN A;  3VS6 A;  2JM8 A;  4IUT A;  2MWO A;  3FRN A;  1AWO A;  2JTM A;  2M0O A;  1K73 R;  5KYU A;  1F5Q B;  2FB7 A;  2EJF A;  1WJQ A;  2HKN A;  3NFC A;  1X6O A;  3OYB A;  5DM7 R;  4OMM A;  3QII A;  3B57 A;  1R77 A;  1F1B B;  5KYW A;  4ZTJ A;  4F7U A;  2PTK A;  1FWZ A;  4J6X A;  1WFW A;  2V8K A;  4KUD K;  4EOL B;  3H41 A;  2EKH A;  2W9Z A;  1MMG A;  1PSE A;  1RAD B;  1E7P A;  1H1P B;  5DQV A;  4HCB A;  4M77 B;  2CS7 A;  2COY A;  1D1C A;  2QDY B;  5D6Y A;  4FCY A;  4JX4 A;  2X4J A;  3BLQ B;  3OYF A;  4FYV B;  4CFN B;  3LWH A;  5AYF A;  3FJP A;  2PK2 A;  1O9K B;  1G3T A;  1Y07 A;  5CK9 A;  2A0F B;  2EQI A;  1OKW B;  3QXE B;  2BIV A;  2LT4 A;  4PLL A;  3MP1 A;  3DLM A;  2QQ8 A;  4J9G A;  4BCH B;  1KK7 A;  1TUC A;  2FHD A;  1NE8 A;  3BDU A;  3TNI B;  3TW7 A;  1D0Y A;  1WHL A;  4KGX B;  1OEB A;  4M75 G;  2O01 E;  4LD9 K;  1IO6 A;  5CAI A;  5GAN e;  4J6Y A;  4OB3 B;  2ED0 A;  2JOY A;  3GBQ A;  1URC B;  4FX3 B;  3MCA B;  4HLQ A;  4JDS A;  2B8A A;  1QMZ B;  1WQW A;  1UUE A;  3I55 Q;  4BCN D;  3ZEH A;  2BZX A;  4E7K A;  1AZG B;  2QQ9 A;  3CCS Q;  1G3W A;  2L5Q A;  1Q7Y R;  1KC8 C;  4PJO B;  3CME T;  1PD1 A;  2LQW A;  2W10 A;  2X4X A;  1W2B A;  4JJD A;  4M7A B;  5CKE A;  1YIJ A;  2DXB B;  5GAN g;  2HL5 C;  4F6U B;  4OMP A;  1OIU B;  1TFB A;  2RQW A;  3CCM Q;  2DD5 A;  5LJ5 h;  2PVO B;  3QJ6 A;  3HB9 A;  3I56 A;  2W0Z A;  2QQR A;  3BG9 A;  5IXF A;  3IQL A;  5FRN A;  4IUU A;  1W2B S;  1BI1 A;  2DEQ A;  4LDY A;  3C0C A;  3I55 A;  5DY9 A;  2VGN A;  4M7D E;  1HK9 A;  5LQF B;  4QQG A;  2D0N A;  5KYX B;  3JCM V;  1N4M A;  4BCJ B;  1UDL A;  3TQ7 P;  3RKY A;  1AWJ A;  1SHG A;  5D6W A;  3TNH B;  1MNE A;  3M9Q A;  1Q7Y U;  1IGU A;  4FYX B;  4L59 A;  3CD6 A;  5FWC A;  2GBQ A;  3M58 A;  4F16 A;  4AKG A;  2JJ9 A;  2HQE A;  2FL7 A;  2H8H A;  3UA7 A;  1MMN A;  3JAM E;  1VQ8 A;  4OML A;  1VQK Q;  2EGE A;  1VYV A;  3EGX A;  4IUP A;  2CP6 A;  3H4C A;  3BLR B;  2RH2 A;  4X9C A;  4E7Z A;  2EQU A;  2C5X B;  3CCL T;  1VQN T;  1AOJ A;  4M78 B;  4BY7 X;  5FU7 C;  3D7S B;  1YIJ T;  5IDN B;  5GAO n;  1NEB A;  1ZBX A;  1ZA1 B;  1HXD A;  3MKD A;  1QVG A;  2FRW A;  2OTJ T;  3M0S A;  2DNU A;  4ORZ A;  4C0D C;  3PIP A;  4XTV A;  5KYU B;  4QVC A;  2RPN A;  1NYF A;  3I56 T;  2I53 A;  3FEO A;  1QP3 A;  2QTV A;  2WFY B;  3CCR Q;  3CCQ A;  1HJD A;  2D8H A;  1MMD A;  1NLO C;  2P0P A;  3HHT B;  1E7O A;  5IHI A;  2YLC A;  1M2V B;  2FEI A;  3QSU A;  2SRC A;  4F7U B;  5GAO p;  1QVG S;  4Y72 B;  4EOQ B;  2LNH B;  1K8A R;  1WPY A;  2EKO A;  2CP2 A;  2HMA A;  3MPU B;  5DLQ E;  1NJI U;  4RTX A;  4M75 F;  1AHJ B;  3OSV A;  4ROD A;  1UEB A;  4KGZ B;  4L5G A;  3CD6 T;  2GGR A;  1ABO A;  4EMK C;  4RKU E;  1OU8 A;  2B9R A;  3OYD A;  3EHR A;  1RAE B;  3I5S A;  1KQS P;  1VQ8 T;  4MZM A;  3JB9 J;  2BZY A;  1GFD A;  5ACB A;  5HK0 A;  4E6R A;  4LN2 A;  4A54 A;  2LMJ A;  4ZN3 A;  5A0D A;  1H26 B;  1I8F A;  4JJB A;  4OMO A;  5GAN j;  2M51 A;  2RK1 A;  4HNU A;  1WHG A;  3M0U A;  1M1K U;  2M16 A;  3SEM A;  5CIU A;  2HSE B;  3PTA A;  2UUE B;  1RAH B;  1LPL A;  1WHM A;  1K8A U;  5FRM A;  4BCM B;  4MMK A;  3DKM A;  4A4F A;  2K3Y A;  3CCQ T;  3ME9 A;  3HP9 A;  4M7D G;  4ELJ A;  3VV0 A;  4IMY B;  2W99 A;  3H0I A;  2RHI A;  1I5L A;  4OMQ A;  3VUB A;  4LDU A;  1YHQ A;  4C92 C;  4EMK A;  1R8O B;  2SEM A;  3JCM X;  2QQB A;  1PHT A;  3G4S A;  3EFO A;  2RI3 A;  2J6O A;  3EH1 A;  1UHF A;  3QZ9 B;  2DA9 A;  4RTW A;  4XTX A;  1IRE B;  4EOM B;  4CI0 C;  1MGQ A;  1KJW A;  2V1Q A;  3G7Z A;  5LJ5 f;  3POM A;  5C6S A;  4J9I A;  1QCF A;  1ZSG A;  1WZO A;  4AG2 C;  1JEG A;  4J5Y A;  1YIT T;  2H3E B;  2LJ1 A;  2X4Y A;  2WAC A;  2LX9 A;  4GLK A; 
#chains in the Genus database with same CATH homology
 1FKM A;  4FL6 A;  3CCE T;  2LDM A;  3RMS A;  1NPR A;  1VIF A;  2KAF A;  2BUD A;  1MHN A;  2PUK B;  1N8R U;  2KR6 A;  4JX5 A;  3UPU A;  3FB9 A;  3OW2 S;  2G77 A;  2YHT A;  1D3B B;  3CC2 A;  2VXF A;  1H64 1;  4Y91 A;  3OSS C;  2EAY A;  1WJS A;  3HRT A;  3MEA A;  4HT9 A;  5LJ5 e;  2GCX A;  4MFD A;  2DO3 A;  3DB3 A;  3OYA A;  2WJ9 A;  2DXC B;  2VC8 A;  1VQ7 A;  4ATO A;  2DTH A;  3GOX A;  1N8R C;  3QO3 A;  2K5I A;  2RHZ A;  3OBY A;  4B9W A;  4BI4 A;  4OF1 A;  3HFO A;  3SDZ A;  1B34 B;  1QVF S;  3TEE A;  2CZ1 B;  1JB0 E;  3HKS A;  2R57 A;  3WVD B;  4WF2 A;  4A4K A;  5IT9 E;  5LL6 S;  2BKD N;  4ZGJ B;  4JRI A;  3HO8 A;  5I2S A;  1BI0 A;  5GAM h;  3KXT A;  2LQK A;  4C92 A;  1JJ2 A;  4XTY A;  1BI2 A;  1UGR B;  4XU0 A;  4QVD A;  1K73 U;  2QA4 A;  2EJ9 A;  3M5A A;  1XTD A;  2FYK A;  3HPW A;  4M77 E;  4QW2 A;  2DXB A;  4M78 F;  3H6Z A;  4EMK B;  3CMA A;  5GAN 6;  2EYQ A;  3QJY A;  2QQA A;  2VGM A;  3C4S A;  4KUI A;  5GAN f;  2QEX A;  2MWP A;  4DOV A;  2ZGW A;  5CKB A;  3JCM h;  3OYJ A;  4M77 C;  4YTL A;  3JB9 G;  1VQ9 T;  1K73 C;  4RG2 A;  1VQL T;  1X75 C;  2F5K A;  4M78 D;  1V29 B;  3GF5 A;  3M56 A;  1YHQ T;  4FT2 A;  3CC7 T;  1GXI E;  2VXE A;  2M1H A;  1YI2 A;  2V8I A;  2K5L A;  5LJ5 g;  2RJD A;  2XKO C;  1M5Q 1;  4HL4 A;  3MO8 A;  3E19 A;  3C94 A;  5LJ3 j;  3G4S T;  3JB9 F;  2JTF A;  4DA4 A;  3VJP A;  5GAN 4;  2GQV A;  1VIE A;  4BI3 A;  3JB9 I;  1YJW A;  1M90 U;  2DVE A;  3CC4 A;  4M75 E;  3GP8 A;  2ZPI B;  4BY6 B;  1JJ2 S;  3EFR A;  3SD4 A;  3TRE A;  2QFZ A;  2DXT A;  3OYN A;  3OYK A;  4LDX A;  4BDZ A;  1JBM A;  3DB4 A;  2XDB A;  1G3Y A;  2KSS A;  5A2Q E;  2F69 A;  4C8Q F;  5IAY A;  5LJ5 d;  3KHI A;  4M75 C;  3JRZ A;  2C06 A;  3RKX A;  1YIT A;  3JB9 D;  1H3Z A;  3R6O A;  1M90 C;  4MIM A;  4HNT A;  4IUV A;  5KE3 A;  3LX7 A;  2WSC E;  3QPH A;  2HQX A;  4BBR M;  3L2Q A;  4F7U F;  4PLI A;  3L2R A;  5A0L A;  3EFS A;  3PMT A;  4UC4 A;  2LCL A;  4NS5 A;  4XU1 A;  2DXU A;  2D9T A;  3ZBD A;  2A7Y A;  4C8Q C;  4RMO A;  1YJ9 T;  3PT9 A;  1UGP B;  1Y71 A;  4PKC C;  3OY9 A;  3OYC A;  2HD0 A;  4ZGE B;  4LOC A;  4NC6 A;  4Z6Y A;  3E1S A;  4C5I A;  4E47 A;  4N4G A;  1I4K 1;  5GMK m;  3OQ5 A;  3OMG A;  2FVU A;  3J7A F;  3X24 B;  1G5V A;  5J26 A;  2PUO B;  4A4G A;  2XG8 D;  4BB7 A;  5KH6 A;  3S3O A;  3VUZ A;  2GF7 A;  4C92 B;  4MZT A;  3CCV T;  4QVZ A;  3M54 A;  2GFU A;  1VQ7 T;  4N0A C;  2CZ7 B;  2D6F A;  1M1G A;  1RL2 A;  4J6W A;  3PGG A;  2R5A A;  4M77 A;  3BW1 A;  1QLB A;  1N6A A;  3SFM A;  2RB6 A;  4C5E A;  3MEV A;  3VU3 C;  1UB4 A;  2JUF A;  5FLX E;  1KD1 C;  1VQ6 A;  4XAX B;  5CKD A;  2O4X A;  2QA4 T;  3HSB A;  3HZJ A;  1N9R A;  2ZPG B;  2V8J A;  3CBM A;  3M57 A;  4XU3 A;  3ASK A;  4BAC A;  4M7A F;  2Y4Y A;  4C92 G;  4M7A E;  4PJO C;  2EQJ A;  5GAN d;  4OMF B;  4AI6 A;  3CC7 A;  3VKH A;  1BKB A;  2EQM A;  1M8V A;  3OBW A;  4M7D F;  5DLO A;  4IUT A;  2MWO A;  3NTI A;  4XU2 A;  3FRN A;  4M7A C;  5GAM j;  1BYM A;  2JTM A;  2M0O A;  3OW2 A;  4KBM B;  2E65 A;  3M4Y A;  3V7S A;  3HBL A;  1M9S A;  4VUB A;  3JCM c;  5FU7 B;  3OYE A;  1LNX A;  2PVD B;  3BG3 A;  1YI2 T;  2FB7 A;  2EJF A;  3V8J A;  3OYH A;  4EDU A;  5CQX A;  3A8O B;  1WJQ A;  2BS2 A;  3CCS A;  3NFC A;  1X6O A;  2DZC A;  3OYB A;  5DM7 R;  1YJW T;  1Q86 U;  3PNW C;  4M7D C;  2RI2 A;  4C8Q A;  1K9M U;  3QII A;  2X35 A;  2P0Q A;  1G3S A;  3P8H A;  1OZ2 A;  3C12 A;  2JN0 A;  2E1H A;  3A5Z B;  5GMK i;  2WSE E;  2DKG A;  3X25 B;  5GMK j;  3OS0 A;  1PSF A;  4M6V A;  4ZTJ A;  3BG5 A;  2JVV A;  4F7U A;  5GAN 5;  2CZ6 B;  3FIF A;  1Q86 C;  5IN1 A;  1FWZ A;  4J6X A;  1WQ7 A;  5GAN 2;  1K9M C;  2MI6 A;  3AHU A;  5EJC A;  2RK2 A;  3CCM A;  2V8K A;  4KUD K;  1KHC A;  1YJN T;  3OS2 A;  4OGE A;  4N0A A;  5J39 A;  4EPC A;  5LJ3 f;  1PSE A;  2LC4 A;  1E7P A;  4O5V A;  3DLL A;  4RCC A;  4HCB A;  3CCV A;  4HCZ A;  4M77 B;  4MZP A;  1WJR A;  2QDY B;  3L2Z A;  3HRU A;  5D6Y A;  4PJO A;  3UT1 A;  4Q5W A;  4JX4 A;  2X4J A;  1Y7X A;  3QKJ A;  3OYF A;  3CPW A;  3SWN C;  3QDR B;  2QQS A;  2K57 A;  2LQ8 A;  4M7A A;  2KMT A;  3LWH A;  5D6X A;  5CVI A;  5AYF A;  2OAU A;  3FJP A;  1FXX A;  5LJ3 e;  1UGQ B;  3HRS A;  1VQ5 T;  3RER A;  3NTK A;  3INZ A;  3G71 A;  4JS4 A;  2DD4 A;  2HBP A;  1VQ6 T;  2E6N A;  2GFA A;  4IUQ A;  2BS3 A;  1G3T A;  1Y07 A;  4M75 B;  5CK9 A;  4M7D B;  5GAO l;  1UGS B;  2DAQ A;  2P4T A;  4M78 E;  4N4I A;  3QXE B;  2ZCF B;  2BIV A;  2LT4 A;  3M55 A;  3NTH A;  4PLL A;  4M7D A;  1P92 A;  1XNI A;  3DLM A;  3MP1 A;  5HK3 A;  2K2V A;  4J83 A;  2QQ8 A;  1O9S A;  3HL8 A;  4M78 C;  2FHD A;  4BI8 B;  1NE8 A;  3BDU A;  4O6J A;  4C0Z A;  4NL2 A;  3TW7 A;  2EQK A;  4C8Q B;  3P8D A;  3JCM W;  2X4W A;  3M53 A;  3RIR A;  3CPW S;  3I55 T;  1KQS S;  1KG1 A;  5J3B A;  4AKH A;  2LT1 A;  2KK4 A;  3OYL A;  1VQK A;  1OZ3 A;  2K3X A;  3CPF A;  2O01 E;  4M75 G;  4LD9 K;  1NPP A;  5CAI A;  3P8B B;  5GAO m;  5GAN e;  4J6Y A;  3CCS T;  4OB3 B;  3ZFJ A;  3JSC A;  1N9S A;  1OI1 A;  3QYB A;  4HA8 A;  4C8Q E;  2JOY A;  4B9X A;  3A8M B;  3OYI A;  4JRP A;  3MCA B;  4HLQ A;  2XHC A;  4JDS A;  5KE2 A;  5LJ3 g;  2B8A A;  4JX6 A;  1YJN A;  5KCO A;  1KC8 U;  3VYG A;  1WQW A;  4XK8 E;  5GAM f;  1QVP A;  2XIC A;  3CCU A;  4ZGD B;  2RI5 A;  2VUB A;  4F7U E;  5CR2 A;  2RJC A;  3OYY A;  3CEY A;  2OTL A;  4PJO D;  4HNV A;  3L2V A;  3ZEH A;  3CCM T;  1KQ2 A;  2KDS A;  1SSF A;  3SWN A;  4E7K A;  5LJ3 d;  2QQ9 A;  2E41 A;  1G3W A;  5KCH A;  2L5Q A;  4XTW A;  3TU4 K;  3RKW A;  1KC8 C;  4MDX A;  4PJO B;  2QXF A;  1XQH A;  2DJZ A;  3MET A;  4J7I A;  3ER0 A;  3L2W A;  4II1 A;  3CME T;  4JS5 A;  3S3M A;  1VQO T;  2X4X A;  3UWN A;  1W2B A;  3QUI A;  4FU6 A;  1BI3 A;  3CCR A;  2E70 A;  4M7A B;  5CKE A;  2E5Q A;  1YIJ A;  3EAE A;  2DXB B;  4Z02 A;  4C0F A;  2KY9 A;  3H8Z A;  4N4H A;  5GAN g;  1VQP T;  2PU9 B;  2DD4 B;  5GAM e;  1VQ5 A;  3Q1J A;  2E10 A;  4PJO E;  3OYM A;  2G3R A;  2DD5 A;  3RUX A;  5LJ5 h;  4M78 A;  3RES A;  2PVO B;  3QYG B;  3OMC A;  3E9F A;  3JB9 H;  2K5F A;  1JRI A;  2RO0 A;  3QJ6 A;  4BD3 A;  2CYZ B;  3HB9 A;  2DIQ A;  2A3L A;  3I56 A;  2QDJ A;  2HAX A;  2R58 A;  3CCJ T;  2QQR A;  5GAO r;  3G71 T;  4M7A G;  3JCM P;  3BG9 A;  3O8V A;  2DPP B;  5CKH A;  5FRN A;  3OA6 A;  5I2M A;  4IUU A;  1W2B S;  1BI1 A;  2DEQ A;  4LDY A;  3I55 A;  5GMK e;  3BY7 A;  2VGN A;  1ZQ1 A;  3KUF A;  5DY9 A;  3A8L B;  4C92 F;  4BE1 A;  4M7D E;  3V8L A;  1HK9 A;  2ZPF B;  4TVR A;  2RHU A;  4QQG A;  4FSX A;  3GIB A;  3E9G A;  1VQ4 T;  4JLI A;  3JCM V;  1QP2 A;  2E64 A;  4OB2 B;  3RKY A;  1W4S A;  2WAC A;  3X26 B;  1U1T A;  2XID A;  3MP8 A;  5FU6 C;  4HT8 A;  5D6W A;  4ZTF A;  2EFI A;  2ZPB B;  4C92 D;  1VQK T;  3PIO A;  2RD1 A;  2QF7 A;  3M9Q A;  3MHX A;  4MFE A;  1Q7Y U;  2D0Q B;  5GAM g;  3VYG B;  2KMG A;  1XOV A;  4JRQ A;  2I2L A;  1KQ1 A;  4AKI A;  1EIF A;  4L59 A;  5HY6 A;  1NZ9 A;  3CD6 A;  2XDP A;  4DQ2 A;  2EIF A;  3SWN B;  3M58 A;  2CGH A;  3A8G B;  2JNG A;  5I21 A;  4X34 A;  2WSF E;  3LGF A;  4AKG A;  2DIG A;  1Q7Y C;  2HQE A;  5GAM d;  2FL7 A;  3C95 A;  4L6V 5;  3JCM Q;  2XI9 A;  2KQW A;  4RG8 A;  2XK0 A;  3CCU T;  5GAN h;  3JAM E;  3LGL A;  4J7F A;  1VQ8 A;  4LDW A;  3CME A;  2OTL T;  1VQO A;  2XD0 A;  2CKK A;  2XDD A;  3J80 E;  3JCM J;  4IUP A;  5A0G A;  1VQM T;  3H4C A;  1Y96 A;  2RH2 A;  4X9C A;  5M9O A;  3JCM d;  2NLU A;  2PVG B;  2EQU A;  3GPL A;  1RI0 A;  1FX7 A;  3CCL T;  3WVE B;  2Y90 A;  1VQP A;  1VQN T;  2DD5 B;  4C5G A;  4M78 B;  2O4X B;  5FU7 C;  3CCR T;  1KQS A;  2LTO A;  1LJO A;  3MEU A;  1YIJ T;  3JCM b;  3QBY A;  5GAO n;  1ZBX A;  1HXD A;  1KD1 U;  3VKI A;  2DTO A;  1QVG A;  2OTJ T;  3CCJ A;  4GY5 A;  2E12 A;  1S72 A;  2RHY A;  4M77 G;  4ZN1 A;  4C0D C;  4OB1 B;  3LWI A;  2M9U A;  3PIP A;  5CQY A;  4OB0 B;  2K4Y A;  4XTV A;  1M4Z A;  4QVC A;  3V7R A;  2KVQ G;  3FEO A;  3I56 T;  1M1F A;  1QP3 A;  4M78 G;  2XU8 A;  1BIA A;  2LCC A;  4E7J A;  4DOW A;  4IKF A;  4MML A;  4HKE A;  4ELY C;  5CKF A;  4FIB A;  4M77 F;  4X9D A;  3CCQ A;  2ZPH B;  1VQ4 A;  2YLB A;  3FDR A;  1O75 A;  5LJ5 j;  3CBP A;  2P0P A;  3HFN A;  3HHT B;  3PFS A;  2RM4 A;  3TCJ A;  2YLC A;  3S6W A;  4IUR A;  4M77 D;  4A53 A;  3QSU A;  1I81 A;  4F7U B;  5GAO p;  1QVG S;  3QYH B;  1WPY A;  3GNG A;  4HCC A;  3QWL A;  5GAN 3;  3QZ5 B;  2EKO A;  1KHI A;  5DLQ E;  4BE2 A;  1YCY A;  2DZ9 A;  4MDW A;  1WNL A;  4Y28 E;  1NJI U;  2ZZD A;  4ELZ C;  5GMK h;  4M75 F;  4C8Q G;  2EWN A;  1QW1 A;  3RMQ A;  1AHJ B;  4BBS M;  3OSV A;  1Q82 U;  1UEB A;  3LYI A;  4L5G A;  3CD6 T;  2LNV A;  4NL3 A;  3QYE A;  2RHX A;  3L42 A;  1VUB A;  2QI2 A;  3X28 B;  4M7D G;  2VYT A;  4C5H A;  3UDC A;  5HKC A;  4C0G A;  3FC3 A;  4EMK C;  1NJI C;  1IZ6 A;  4XQ3 A;  4F7U G;  4RKU E;  4XTZ A;  2IG0 A;  4BUG A;  2RJF A;  4M75 D;  2IVW A;  1Y96 B;  3OYD A;  3G6E T;  1VQM A;  1Q82 C;  2P0K A;  5GMK l;  2Y4X A;  4EMH A;  1VQ8 T;  3VYH B;  3JCM f;  4MZM A;  3JB9 J;  3VKG A;  4KT0 E;  3CCL A;  3OYG A;  1VQN A;  2LRQ A;  4PNO A;  2JZ2 A;  3CCE A;  3M59 A;  4J8O A;  5HK0 A;  1DJ7 B;  4A54 A;  1ZHI A;  4ZN3 A;  4C8Q D;  4LD6 A;  3MEW A;  2E6Z A;  2F5T X;  5A0D A;  4QQD A;  3WXM B;  4QSH A;  4E7L A;  2RJE A;  1I8F A;  2RA2 A;  3BFM A;  2OTJ A;  5GAN j;  3CXC A;  2RK1 A;  4LDV A;  4BY6 C;  5EG2 A;  4HNU A;  2DK3 A;  4PJO G;  4OVA A;  3J81 E;  2L3R A;  1M1K U;  2L89 A;  3CC2 T;  1BIB A;  4XTU A;  4JJN K;  3L2U A;  2M16 A;  5FU6 B;  3F70 A;  4KUL A;  1D3B A;  5CIU A;  3PTA A;  2MF2 A;  4R56 A;  1S72 T;  1X01 A;  3T9N A;  2DTI A;  4FM4 B;  3JCM e;  3A8H B;  4D6W A;  3FLG A;  4A4H A;  1K8A U;  4CRI A;  4BDY A;  5FRM A;  1Q81 U;  4PJO F;  2CZ0 B;  1LOJ A;  2DXC A;  4V2S A;  4QQ6 A;  1TH7 A;  5CO7 A;  1M1K C;  4MMK A;  5C0M A;  3DKM A;  2BS4 A;  5GAN 7;  1B34 A;  4RCB A;  3DL1 A;  4A4F A;  2K3Y A;  3QG1 A;  3GLX A;  3HP9 A;  3ME9 A;  5LJ3 h;  3CCQ T;  5L8R E;  2AHJ B;  4PL6 A;  2H3J A;  3S3N A;  4ELJ A;  3VV0 A;  1K8A C;  2PQW A;  3LLR A;  4OGC A;  4A4E A;  1Q81 C;  2RHI A;  3LH0 A;  2HNI A;  4OP0 A;  4C92 E;  1I5L A;  1VQ9 A;  3BDL A;  3CXC S;  4P5N A;  2ZZD B;  3V8K A;  3PMI A;  1VQL A;  4EMG A;  3VUB A;  3CMA T;  4LDU A;  1YHQ A;  2EJG A;  3V7C A;  4C92 C;  1WGS A;  2MMP A;  2VV5 A;  4FT4 A;  4EMK A;  2QEX T;  4M7A D;  1R8O B;  3M4G A;  3JCM X;  3N5B B;  1YBY A;  2L8D A;  2LVM A;  2QQB A;  5CCA A;  4M75 A;  4ME7 A;  3G4S A;  2ZPE B;  2RI3 A;  3KBG A;  4JUV A;  3QZ9 B;  3X20 B;  3TW6 A;  4E7I A;  2MAM A;  3OB9 A;  5GAN 8;  4XTX A;  1U8R A;  1IRE B;  5FRO A;  5GAO q;  1OYX A;  3LW5 E;  4NOY A;  3JCM g;  2R5M A;  3G6E A;  4CI0 C;  4M7D D;  3QHS A;  1MGQ A;  3G7Z A;  5LJ5 f;  3CC4 T;  3L1A A;  3OS1 A;  3MP6 A;  5C6S A;  4R55 A;  3GNF B;  4E7H A;  4C0D B;  1QVF A;  2QTX A;  4JRK A;  3URG A;  1N27 A;  3CBO A;  4J5Y A;  3SB2 A;  1U1S A;  1YIT T;  2YRV A;  4BE0 A;  2X4Y A;  2CS7 A;  2LX9 A;  4JLG A;  3OS5 A;  4GLK A;  1YJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...