2ZPFB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 18min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpfB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpfB02
1UGRB 2PUOB 3QZ5B 2WSFE 3X20B 2AHJB 2WSCE 3WVEB 3A8GB 4OB1B 4FM4B 2ZPBB 1QP2A 4OB0B 1DJ7B 4OB2B 2PVGB 2ZPEB 4ZGDB 3HHTB 2CZ7B 4ZGEB 2PVOB 3WVDB 2D0QB 3X28B 1UGQB 2DD5B 2DD5A 3VYHB 1PSFA 2CYZB 4XK8E 1UGPB 2QDYB 2O01E 2ZCFB 1GXIE 3QYHB 3VYGB 3A8MB 3VYGA 2DPPB 2PU9B 1V29B 2ZPIB 3LW5E 1AHJB 3QYGB 5L8RE 3X25B 4Y28E 2ZZDB 2ZZDA 2ZPFB 4KT0E 2ZPGB 1QP3A 1JB0E 2ZPHB 2DD4B 4OB3B 2DD4A 3X26B 4RKUE 2CZ0B 2PVDB 3X24B 3A8OB 2CZ1B 1PSEA 2DXCB 2DXCA 2WSEE 4L6V5 3QZ9B 2DXBB 2DXBA 1IREB 4ZGJB 2CZ6B 1UGSB 2PUKB 3A8LB 3A8HB 3QXEB
chains in the Genus database with same CATH superfamily
4DQ2A 1KQSP 1WX6A 3H41A 1BIAA 2WSFE 4C8QC 3PVQA 1AWWA 4JJDA 4RTVA 4NSTB 3MHXA 2OAUA 2B86A 2BS3A 1QP2A 4C92F 3N5BB 4KH0B 4OB2B 1VQ4A 3OSSC 3PNWC 1CKAA 4M7DA 2DE0X 2DBKA 4ORZA 5CYIB 4DA4A 3E1SA 2RI2A 3EG1A 3LX7A 4GY5A 5GANg 2M51A 2DD5B 3HTRA 3OS2A 3CD6Q 1QWFA 4QVDA 3MEWA 2VUBA 2CP5A 2L2PA 1BCOA 4JJNK 1GBQA 2FO0A 2CGHA 1OPKA 2BE9B 5I2SA 1YJWT 3JCMW 1K73C 4NC6A 1KK7A 5D6WA 4J6WA 3P8BB 2ZZDB 1EX4A 1FINB 3V8LA 1Z9ZA 1VQLQ 4M75A 4XU3A 1KJWA 1YWOA 2Y4YA 2VV5A 2QDLA 3PFSA 1PRMC 3RNJA 4LD9K 1VQNA 1HK9A 2MCNA 3HZJA 5IHNA 2BZ8A 2QA4Q 2YUOA 1Q95G 4M77G 1QVFP 2LJ0A 4AFSC 4F7UB 4AFZC 4E47A 2YWWA 2A28A 4BY6B 3FJ5A 3H0HA 4J7FA 4M7AB 1Q82R 4IUUA 2KMTA 2DVEA 2UUEB 1XTDA 2KVQG 2OTJT 1OZ2A 1RADB 2ZAEA 1E6HA 1IXDA 1TSFA 2KR3A 2W96A 3H0FA 3QIIA 3V7CA 3CCST 5EJCA 4C92A 3RGFB 1WZOA 2HQEA 4HCCA 4L59A 4ME7A 2QQSA 1SRMA 1WJRA 1IGQA 2FG0A 3QHRB 3EH2A 3QZ5B 3HFNA 3ULRB 3L42A 3CD6A 1UG1A 1QQJA 2WSCE 5FU6C 4M78G 1VIFA 1YIJT 1H27B 1AD5A 3L1AA 4F6SB 4LOCA 1UJYA 1KQ2A 4BY7X 1M3CA 3M57A 4F6UB 3JCMc 1D0XA 2DL5A 1ENWA 1FMWA 2Z0WA 4LUDA 3CCMQ 1VQLA 3VS6A 4DEXA 5LJ3e 1Y57A 1GBRA 1B34B 2I53A 4PNOA 2K3BA 3BDLA 4A4EA 2E12A 2CYZB 1Q82U 1YHQT 1UHFA 3G6ET 1U8RA 2QA4A 4LDYA 2X3XD 4ANJA 1KHCA 2O31A 2PU9B 3GNGA 2EUFA 2OX7A 3QWYA 4E7LA 2MOXA 2DEUA 1RL2A 3EGDA 5L8RE 2GBQA 4M77E 5CO7A 3HRSA 2JT4A 5KYXA 5KYUB 1KQSA 2A08A 3BG9A 3F70A 1AWOA 3VJPA 3TVTA 2VASA 4HNUA 4ZTFA 2XICA 3URGA 1NEGA 3CMAT 2EJFA 3LWIA 2C0TA 2FEIA 2RN8A 4IURA 1Q7YC 3A5ZB 2EQMA 1I1JA 2RJCA 2L3QA 4YOZA 4RKUE 5I22A 1PCXA 1TOVA 2GGRA 4QKUA 3EFRA 3TEEA 5HNBB 1VUBA 3A8OB 2RHZA 1AVZC 4M78E 4FT2A 3UA7A 1QCFA 1K4US 3FLGA 5C6SA 2DFUA 3LLRA 5IF1B 1JSUB 2JOYA 1VQPT 3JAME 1WYXA 2WMBB 5I5ZB 2F2VA 3NTIA 1W70A 3CCMA 4FSXA 4YTLA 1NE8A 1ZUYA 5GAN4 2P4TA 3X20B 4AKHA 4K11A 4EMGA 1M90C 1RI0A 4BE1A 2QFZA 1D3UB 3QKJA 1I4K1 3SWNA 1QKXA 4BI8B 3FEOA 4ELYC 4LDWA 2X35A 2JM8A 2CS7A 3VKHA 2AT1B 1TS9A 4ESRA 4F6WB 1K73R 3HHTB 1E9HB 1YI2Q 1D3BB 2O2OA 1RABB 3S3OA 2C0OA 2M9UA 2V1RA 1X2KA 4HCZA 1ZSZA 4Z88A 1BCMA 1X43A 4XTVA 1EFNA 1K9AA 3GPLA 2NUPA 4C8QE 1WJQA 3QJYA 4PL6A 2EQUA 2K3YA 2RJDA 4E7SA 3VYGB 5LQFB 3DB4A 1S72Q 1V29B 2ZPIB 5LJ5g 3V8KA 2P0KA 2GFUA 1VQ7Q 1KQ1A 4Y28E 3ZEHA 3M0TA 4X9DA 2M02A 1H1RB 2KK4A 1Y96A 4ZNXA 1UNLD 1SG5A 2ENMA 3JB9J 4BUGA 4E7IA 2DIGA 4J9FA 3QHWB 1QVGS 3VRYA 1N4MA 4M7DC 1X27A 4J9CA 4JS4A 2ZPHB 4JX4A 2YLCA 1YJNQ 3NMZC 1O9KB 3A1PA 2QEXT 1D0ZA 3M55A 1T3SA 1CSKA 1YCYA 1Y07A 2LT1A 4FW1A 3X24B 2CZ1B 3ASKA 1BIBA 2DXBA 1CKBA 4JLIA 4R55A 4BCJB 3LYIA 3CCJQ 3NTHA 1Q81U 3SFMA 1KC8C 5KCOA 2KR6A 4D8KA 3CCEQ 1X75C 3PTAA 1YI2A 1M8VA 4EOPB 2LCSA 2K79A 3PT9A 2EW3A 2RHIA 4FYYB 1G2BA 2LMJA 2KMGA 5KH6A 4EMKB 3JCMh 2E6ZA 1VYWB 4M75C 4AMCA 4JDSA 2E70A 1D1AA 4OGCA 5FU7C 3M03A 2ZPBB 2P84A 1XJWB 2GF7A 5DLQE 1S72A 2ED0A 3VU3C 3DL1A 2CZ7B 1VQ7A 3RMSA 4J8OA 4YC3B 2DX1A 4UC4A 3BHTB 1D1BA 2M0YA 2LZ6B 3FJPA 4OGEA 1H1SB 5EC7A 2WXVB 5FLXE 4EONB 1PKSA 1VOMA 4PJOB 4MFEA 3DB3A 2LT4A 2KI7A 4G6LB 2BTTA 2W10A 2YXYA 2M1HA 3ER0A 4C92C 5GMKh 3DJBA 5KYWA 1YJNA 4E7KA 2HL5C 5GJWB 2DIQA 1NPRA 3M0UA 4Q5WA 4CFNB 3OYLA 4CI0C 4RTXA 3HRUA 5GAMh 3OA6A 1VQ9T 4C0DB 3VS0A 4ELJA 2VC8A 2DRKA 3RKWA 3O0GD 4KT0E 4M77D 1H92A 2E6NA 3CCEA 2CH4A 3MPUB 5FWBA 4LDXA 4JS5A 1QKWA 2OJ2A 2FZKB 4A54A 4RG8A 3M4YA 3ME9A 2DD4A 2DL3A 3VS5A 3TSZA 1IB8A 2E4HA 5GAN5 4PLLA 2KBTA 1GY3B 1M8MA 4RTTA 5IHIA 3CCQQ 5LJ5e 4CFUB 3JSCA 1N8RR 3EG9A 1KD1C 3QSUA 4EC9B 2RK2A 4L6V5 2E3IA 2O9VA 1UNHD 1G8XA 4Z89A 1M2OA 1IHVA 2PUKB 1H1PB 5HBHB 2EWNA 2DXTA 5IAYA 1K9MC 4OP0A 1IGUA 4BCFB 4FU6A 4Y91A 2DTHA 1UFFA 2DZ9A 3CMEA 1QWEA 3G7ZA 3BG3A 3V7SA 1VYVA 1NZ9A 4E2FB 3EFOA 2D0NA 1UHCA 2JS2A 2DZCA 4HVWA 3OB9A 2MK5A 1VOLA 2OTLQ 2ZPEB 1ABOA 2H3EB 3SEMA 1VYUA 4JZ3A 1VQ4T 3O8VA 1NBEB 1OPLA 5A2QE 4XU1A 3CCVQ 3OYKA 4KBMB 2FVUA 1K8AU 5GMKi 1AD6A 2CP6A 3C94A 4I3ZB 3D7SB 2QDYB 2A0FB 3L2QA 1N8RU 4II1A 2IVXA 2EFIA 4LN2A 4A4FA 3UT1A 2BKDN 1PKTA 2KDSA 4C8QD 1ZX6A 3CC4T 2JVVA 4BCND 1KQSS 3DDQB 2EYXA 2QG9B 3CCQA 3G33B 2ESWA 4QVZA 1VQ5T 1K0SA 4AKGA 3SWNC 5I21A 3M59A 3TQ7P 2JM9A 1PWTA 3DLMA 3FC3A 4X1VA 3CXCP 4BCQD 4N0AA 1R77A 1KC8R 1RLQC 2QQAA 1VQNT 2XDPA 2RMOA 1ZA2B 1FVVB 2X4JA 4PFPA 3JCMV 1SHFA 1X6BA 2NLUA 2M0OA 2G77A 2UZDB 1ZSZC 2E1HA 2QK0A 2K7AA 3I5SA 4E7ZA 2DXCB 1MMAA 4J9BA 2MWOA 4MDWA 3CQTA 2XU8A 2OTLA 3QYEA 4OMLA 5ACBA 2E5QA 3JCMd 2LDMA 2RQUA 1OKVB 5GMKl 2K9GA 1ZUKA 3OYDA 4M7AF 3CCVA 4FYVB 1RAFB 4M7DE 2DNUA 3GOXA 1B07A 4EORB 2KYMA 1QCOA 2QGFB 1I8FA 1B7TA 1JXOA 3HO8A 2KY9A 1QW1A 3OMCA 3CD6T 3CC7Q 4KUDK 3QO3A 2Y4XA 3G71Q 2RK1A 4C5IA 3OYBA 2DVJA 2A37A 1GRIA 2RHUA 2HSEB 2KXCA 1BBZA 4TTHA 4CFXB 1M1FA 2QF7A 3AHUA 4PK4A 3GF5A 5HQ0B 1G3SA 5KE3A 1FXXA 3VRZA 2DD5A 1O75A 2X1NB 2JTMA 3TU4K 2DYBA 1U06A 3UF4A 1VQLT 2ABLA 2CP3A 4XK8E 3CCRQ 2DA9A 1NJIC 2LVMA 4M75E 1X6OA 1H25B 2KXDA 3RR6A 4F14A 1N5ZA 4BB7A 2DPPB 1SHGA 4ELLA 4P5NA 4BCMD 2BUDA 5GAMd 1H4LD 3REBB 1E6GA 2RI5A 3VS1A 3HRTA 3GIBA 2DLPA 3G1JA 4JPBW 2ZZDA 3EAEA 3KUFA 2V22B 4OMFB 2KRNA 1KD1R 1WI7A 4JRKA 4A4GA 2FB7A 2SRCA 2XI9A 1BI1A 2AKLA 1AZEA 1K9MR 1D09B 3MP8A 4MMLA 2LQ8A 4F7UA 1VQMQ 1FMKA 4JLGA 2KT1A 3L2RA 2VGMA 4C92E 4JJCA 1GUXB 2YLBA 4MDXA 5AT1B 1R0CB 3M9QA 4IIOA 4M7AA 1WHMA 2EPDA 3CC7A 2FRWA 4F7JB 4XTWA 2LJ1A 3G71A 4OMPA 1AWXA 4N4GA 1GCPA 1V1CA 1M9SA 3HB9A 4LUEA 2D8JA 2BS2A 4JX5A 2LCCA 3VS3A 3QXEB 1JQQA 3HBLA 1GH6B 4D8DA 4BE0A 3MP1A 3JB9D 3CCMT 2HBPA 3QWLA 3CCLQ 1OX9A 3RDVA 3CCRA 2PQWA 1VQ6Q 3R6OA 4CC2A 3E9FA 2DAQA 5GAOr 4JRQA 2IW6B 1G3YA 5LJ3h 1Q86C 3CXCA 2VWFA 5FW9A 5IHKA 2NUZA 1PC0A 2IW9B 2KQWA 1K9MU 1ZUUA 1VQKT 4BXXX 3MEVA 4XTZA 1B34A 4PFOA 2UZLB 3QUIA 5GAN2 3CPWA 2CSQA 3M0PA 3UATA 1BU2A 3VUZA 4BD3A 1EZZB 4BY1X 3QBYA 1VQMA 2EJGA 1XOVA 1BI2A 5IT9E 2F2WA 1NLOC 2FRYA 1FX7A 1FKMA 4E7JA 2IN3A 4KRCB 2QAZA 3THKA 2BZYA 5KYUA 1UNGD 1SSFA 1BI3A 1OL2B 2ZPGB 2EGCA 4PLIA 4CXAB 3HKSA 2RJFA 2EYQA 3CCUQ 2MYSA 4BI3A 1RLPC 4Z8AA 2G6FX 1ZHIA 3PMTA 1HJDA 2ROLA 4V2SA 3PVLA 5GMKj 2P0PA 4C8QG 1X6GA 3I55Q 2KE9A 4X34A 5GAN7 1YP5A 4IKFA 2PVDB 3CCLA 3S3NA 1PG5B 3NGPA 1VQ6A 3JB9H 5KCHA 1KHIA 5AYFA 5GANe 1I07A 1OU9A 1UGSB 4BCOB 5GAMj 4F70B 1ARKA 4FSSA 2DMOA 2V8IA 4HT8A 5LL6S 2B9RA 5HBEB 1JEGA 4CFMB 4LD6A 1OI9B 3C0CA 3OYYA 4VUBA 4BACA 4FYXB 4ATOA 1M2VB 2HNIA 1JXMA 4RUGA 3CEYA 1BKBA 3JRZA 2HEQA 4JZ4A 3E19A 2PZ1A 5IXFA 1BYMA 4N0AC 4M7DD 2IPOB 3BLHB 2KYBA 1N6AA 5GMKm 1MNEA 1NYGA 1JKWA 1G3NC 2O9SA 5J3BA 4F7NB 4DEYA 1M5Q1 2GCXA 1LOJA 3WVDB 1D3BA 3BY7A 1OV3A 2EIFA 4M6VA 3NFCA 1VQ7T 1SF9A 3UDCA 5DY9A 1YN8A 2QYZA 3RBBB 5KYNA 2R7GA 1SEMA 5DQVA 2EAYA 1W2BA 1XQHA 2J7IA 2RJEA 2ED1A 3VS2A 2RQVA 1UUEA 3CCUA 3A8MB 2VB6A 3VYGA 3TSWA 2DTIA 5DQWA 1TTHB 2RPNA 2DETA 4M7AD 2A3LA 2C0IA 3C12A 1YJNT 4M75D 3I55A 3OYMA 2EKHA 4XTYA 4PJOF 4PJNA 2MAMA 4GLKA 4HNVA 3CC2Q 1YBYA 2GTOA 5EG2A 1QP3A 3META 1M27C 4M77B 3CCJT 1GFDA 5GAOp 3NTKA 3F5XB 3CCET 4OB3B 2SEMA 1O9KA 4LE9A 1H1QB 1UTIA 3V8JA 2QQ8A 2NUTB 1G3TA 3DDPB 2YRCA 2X4WA 3DTOA 4IIMA 2X51A 3RERA 4C92D 1VQPQ 2MIOA 2JZ2A 2CZ6B 1C0MA 2CT3A 2X4YA 1HSQA 4F16A 1OIUB 1WXTA 2NYSA 2COYA 3KHIA 4M78B 2UZEB 4F04B 4EMKA 1K73U 2JXBA 1TUCA 4BCPB 3KFVA 8ATCB 3V7RA 4FM4B 1F1BB 5LJ3d 1V76A 2IVWA 5A0LA 2JTEA 3EGXB 4MMKA 1M1KC 1QCNA 4R0KA 4KGZB 3ZFJA 3INZA 1XNIA 1OIYB 1M30A 3I56Q 2PVOB 6AT1B 4HXJA 2KROA 2E41A 4BY6C 2LQKA 2QXFA 4CC7A 2BZXA 4M7AC 2L0AA 4FW2A 2O88A 1MHNA 3CC2A 4PJOA 3JB9G 1WHLA 8AT1B 4J7IA 3HP9A 3JCMf 1LCKA 3ZBDA 1AHJB 3KXTA 3OW2A 4C8QB 5IN1A 1HYOA 4BCNB 1Y0MA 3CMEQ 1YITQ 1VQOT 1S1NA 1XO2A 5HCKA 1E7PA 2XDBA 4QQ6A 3CCQT 4QSHA 2F2CA 2XK0A 1VQPA 5IDPB 2HL3A 4BI4A 1ZQ1A 3MKDA 4MFDA 4LNPA 5HK3A 1OL1B 1T0JA 2M16A 2KRSA 2RHXA 1Q7YR 1MV0B 9ATCB 3BW1A 1G83A 1D0YA 4RTYA 2RD1A 4DBFA 3L2VA 2RHYA 4AFUC 1OX8A 5CKFA 4Z02A 4L5GA 4ROCA 2DMEA 4HCBA 3J7AF 2EGEA 3I56A 5GAMf 2O4XB 2WHBB 2E10A 2OTLT 2WACA 1SSHA 4WF2A 4A4KA 3TW6A 3WXMB 3LGFA 1H3ZA 1MGQA 4DBRA 1PD0A 1OULA 1Y71A 5IXBA 3RUXA 4C5GA 1C6VX 1M90R 4N4HA 3CCVT 4C0ZA 2PJQA 4EOKB 3OS0A 3GP8A 2JJ9A 2QI2A 4QW2A 4YOOA 3C4SA 1C1AA 1DJ7B 5D6YA 3BG5A 3CXCS 4AKIA 1OI1A 3HPWA 2E3HA 4J9IA 1KIKA 4ZGDB 1MMNA 3T9NA 1IRXA 2HDAA 3Q1JA 2ATCB 2DL7A 3CBOA 1FWZA 3JCMQ 3OYCA 1WDXA 2E65A 1O9SA 1PNJA 4RTUA 5CQYA 2GTJA 1YITA 2BS4A 2X9HA 5GAOl 1N9RA 3BLRB 4N4IA 3RKXA 1YJ9Q 1Q7YU 3QDFA 4IMYB 1BI0A 3QYBA 2Y90A 5D7UA 5HBJB 1GXIE 1WQWA 2EYZA 3AT1B 4BCIB 4DBHA 1C9BA 1OKWB 1PHTA 2I0NA 4M7DG 1FMVA 2VXFA 1J3TA 3TW7A 2DKGA 4A63B 5FU6B 3SB2A 5CKHA 5LJ3j 1H26B 2HQHA 2IW8B 5CKBA 3EHRA 4FIBA 2JTFA 1HXDA 3DKMA 2WMAB 4XQ3A 1M90U 2COZA 2JGZB 4XAXB 1ZP2A 3GLXA 1P92A 2YHTA 1UJ0A 2EBPA 2W0ZA 1TUGB 2A7YA 4F7UG 5FRNA 1Q82C 2LC4A 3X26B 3G4SQ 4J6YA 1I81A 2EQJA 2K3XA 4M7AG 4CRIA 2K5FA 2DXCA 4M75G 3OY9A 3H9NA 3CC7T 1H24B 4IUVA 5GANj 1UE9A 3G71T 1OQKA 3LQ5B 2PNIA 1W4SA 1NM7A 2DL4A 4LDVA 5FROA 3A8HB 4E6RA 3LWHA 4XU0A 1LPLA 2J6OA 2PMIB 4J5YA 2EGAA 1TWBA 2F2XA 2F1LA 3CPWP 1ZSGA 2RF0A 5I11A 3WVEB 3U23A 1YJ9A 2D9TA 2QQBA 2VKNA 3EG3A 3MP6A 1P5EB 3TCJA 2AZVA 4FCYA 3VS7A 1GCQA 3M54A 3R6NA 3H0IA 2CH4W 3CCRT 1RAAB 3VUBA 1GFCA 5KYYB 4C92G 5IDNB 2D0QB 1SRLA 1Z9QA 3TREA 1NPPA 2DJZA 3M0QA 1WHHA 4OR5B 2HMAA 1W2BS 3BHVB 2XD0A 4M4ZA 2W99A 5ECAA 1E7OA 2AK5A 2O01E 2HKNA 2KGTA 2HBWA 1UGVA 2K5IA 1QMCA 3CC4Q 3QYGB 3EJ1B 4MZTA 2WIPB 3X25B 1KC8U 1VQMT 1VQ5Q 3G4SA 1W98B 3I9QA 4NL3A 2RQWA 2K4YA 2ZPFB 2V1QA 4EMKC 4F7UE 3PE0A 2COWA 2C4GB 2BPMB 1WQ7A 3REAB 2OI3A 2FZGB 1W1FA 4M7AE 4EOOB 5LJ5d 1UDLA 4LXCA 2G3RA 1A0NB 2DF6A 1T0HA 2P4RA 3RKYA 1OGUB 2DXUA 1QLBA 2QQ9A 2QA4T 3FB9A 1QVPA 1U3OA 1GUXA 1TU0B 1W6XA 3QHSA 2L89A 3BDUA 1OOTA 5L23A 1PSEA 1QLYA 2MI6A 2RM4A 4IUPA 4AT1B 4PJOC 1OU8A 2CDTA 3CCLT 2CCIB 1JO8A 1VQ6T 3QG1A 1JJ2A 1G3WA 1MUZA 1VQ8Q 3OBYA 4EMHA 3I35A 1WPYA 2L3SA 1UGRB 3NDQA 2YRDA 4F17A 2CCHB 1BK2A 5GAOq 4II5B 5FWCA 1W2BP 2WPAB 4EC8B 3TN8B 2DL8A 4NS5A 4C0DC 2RB6A 4EOSB 2D1XA 2J05A 3O5ZA 4DBQA 3QPHA 3M5AA 1UEBA 3A98A 2PVGB 3CC4A 1RACB 4M7DB 2VGNA 1FYNA 4B9WA 3CBPA 3MY5B 2NWMA 2DERA 1VQ5A 3TNIB 2PTKA 4J9EA 2WEVB 2YDLA 1GL5A 1WGSA 5CR2A 3E9GA 1MMGA 1Q81C 3L2WA 4KH1B 2I2LA 4HVVA 3M0RA 2JMCA 4EIKA 1IO6A 3EH1A 3OS5A 4D6WA 1H641 4JX6A 3S6WA 2CSIA 1Y7XA 1TFBA 5I2MA 1KD1U 2F5TX 3OW2S 1M1GA 2HAXA 3CCUT 1AEYA 5GAOm 2QQRA 3OYGA 2XHCA 4J9GA 2GQVA 2J06A 2WJ9A 4M75B 5LJ3f 4HNTA 5FU7B 3I55T 4OMMA 4XTXA 1LJOA 2RO0A 1ZA1B 2IG0A 5CEIB 1YJWQ 1PKDB 1VQ8A 4X9CA 2C5NB 2DM1A 2BKZB 2KT8A 3QJ6A 3FRNA 2RI3A 2E64A 2K2VA 2V26A 2RQRA 2XDDA 5GAN3 1MMDA 1RAIB 5HK0A 5GANh 3GTMS 2FZCB 2CZ0B 2G9XB 2RNAA 2WSEE 4M77F 1IREB 4B9XA 1KXUA 1R8OB 2L5QA 4GLMA 1JRIA 4C92B 5GANf 1TXQA 2BE7D 1VYTA 4HA8A 2PK2A 2PUOB 5KE2A 1KFZA 2DK3A 3PMIA 1VA7A 2QGGA 4GBQA 2R5AA 3EG0A 5CKDA 3TNWB 4RG2A 1RI9A 2OTJQ 4OB1B 4RODA 1M2VA 2LNVA 5LJ5j 3OSVA 3FIFA 3M4GA 4KGVB 3LGLA 1URCB 3NHNA 2V8KA 4OB0B 7AT1B 3CCSQ 1AT1B 2K57A 3KBGA 2C06A 4IUTA 4RTWA 5EFQB 3OBWA 3EHQA 3OW2P 5GAOn 4OVAA 4CRLB 3MCAB 1VQKQ 1BB9A 2R58A 4M78F 3QDRB 4DOWA 2YUNA 2CJMB 3UA6A 5A0DA 1YI2T 1YIJQ 1K0XA 3OS1A 2WFYB 4PJMA 3EOCB 1ZBJA 3OYFA 1WA7A 4PJOG 4HLQA 2LP5A 4JRIA 1YJWA 3UWNA 3CC2T 1NJIR 3EGDB 1VINA 2P0QA 1S72T 1M3AA 1OEBA 2GFAA 5KYXB 4EOMB 1ZBXA 1B3QA 4NOYA 4C5HA 4Y72B 2ROTA 2GQIA 1YHQQ 2DEQA 1NG2A 2DYIA 3G6EQ 3J80E 1WNLA 2AKKA 1GCQC 1TG0A 2LTOA 4M77A 1JB0E 2LX9A 1YFNA 4ZN3A 2A36A 1I5OB 5LMKB 2KNBB 3ZL7C 4C8QF 4KRDB 5IHYA 2LW4A 1H3HA 1K8AC 3K7AM 2DRMA 4WTOB 4F7LB 4J9HA 3VS4A 1K76A 1UB4A 1WXUA 1NYFA 3JCMg 2XG8D 3OYNA 4OMOA 2OTJA 3OMGA 1N8RC 1VIEA 2NUTA 3I5RA 5GAN6 3OYAA 4E7HA 3CCSA 4KUIA 5CQXA 3QZ9B 4B6MA 4A53A 5CVIA 3CMAQ 4FX3B 4HT9A 1U5SA 2YT6A 4EOLB 2C5VB 4PJJA 3MO8A 1VQKA 5HVYB 3H6ZA 2KEAA 4J83A 3BHUB 1NJIU 3H4CA 3I56T 3MEUA 3SHWA 1YIJA 3QWXX 1QVFA 2FPDA 4M78A 2EVRA 5GJVB 4YOSA 2CKKA 1Q81R 3SWNB 2J6KA 2K5LA 1AOJA 2AIRB 4QT7A 3CPFA 3TNHB 4R56A 1YNZA 3RMQA 5A0GA 3EGXA 4KULA 1X01A 2OAWA 2X4XA 4ELZC 2RH2A 4PJOE 2RA2A 2CP7A 5IH2A 1SKUB 4BCKB 4IUQA 1Q86R 4ZGEB 2K6DA 3LH0A 1WXBA 3S3MA 4BBRM 2LNHB 3L2UA 1ZSZB 4HVUA 5GAMg 3VYHB 1TD6A 2DO3A 4BBSM 4MZPA 3HSBA 4CC3A 1IZ6A 3CMET 1YHQA 4HL4A 3G6EA 2NUPB 1YITT 1PSFA 4ZTJA 2CUDA 4OGRB 1D1CA 1PM3A 2QGSA 1AISB 4DOVA 1T3LA 1LVKA 2JS0A 1WHGA 3EFSA 2W9FA 2KSSA 3JCMJ 1N27A 4J6XA 4C0GA 4C8QA 5D6XA 2RQTA 1IHWA 2R5MA 1H8KA 2C5OB 1Y96B 3BLQB 4FL6A 3OYJA 2FL7A 2R57A 2LCLA 3CMAA 4QQGA 4WCIA 2HZYA 4NL2A 3JCMP 3CBMA 2KRMA 4JJBA 3DOGB 4OMQA 2V8JA 3EIDB 5C0MA 5GANd 1TH7A 1K1ZA 2HD0A 2VXEA 3POMA 5L2WB 3H8ZA 1Q86U 2C6TB 3P8HA 2EYYA 4OMNA 2CREA 2WIHB 4AI6A 3VV0A 2HQXA 2E5KA 2DXBB 1JJ2S 4FT4A 4ZGJB 4BCQB 2QASA 3P8DA 4LDUA 3PO3S 2O4XA 5CIUA 4PFZA 2UZBB 2MWPA 2QEXQ 2F69A 4TVRA 5LJ5h 1RAHB 1WFWA 2VYTA 3J81E 1ZLMA 2ECZA 2HSPA 4BDYA 4KGXB 5HY6A 2YSQA 3A8GB 1RAGB 1N9SA 2IIMA 1KSWA 4JUVA 1YJ9T 5LJ5f 3B57A 3JCMe 1QVGP 5DLOA 4EOIB 1BU1A 3JCMX 1R0BG 4UN0A 1NLPC 2W9ZA 4C5EA 1WIEA 3VKIA 1JU5C 2CUBA 1U1SA 2LRQA 2KAFA 3RIRA 3JB9F 2YUPA 4RCCA 4EOQB 3RESA 4OF1A 4Z6YA 3CCJA 2H3JA 4QVCA 2PK9B 2XMFA 1UGPB 4HCKA 2XIDA 4KRTA 4CC4B 2W2HA 3M58A 2JN0A 5KYWB 1M3BA 3M56A 1PD1A 1TUDA 1WJSA 3NPFA 1K8AR 5CK9A 2I40B 2QTVA 2MF2A 1VQOQ 2YUQA 2EQKA 1ACMB 2EQIA 3OYIA 5GMKe 2F5KA 2VVKA 2JNGA 3HFOA 1EIFA 3CPWS 2QDJA 2FHDA 3G4ST 2AZSA 4XTUA 2CP2A 3L2ZA 1PRLC 1AZGB 1JJ2P 5ICPB 2FYKA 5GAMe 2LJ3A 4HKEA 5J26A 1LNXA 3JV3A 3PIPA 3UPUA 1RUWA 4ROEA 1JBMA 2QEXA 3E2UA 4M78D 3GBQA 4BCMB 2DD4B 2L3PA 3M53A 1OZ3A 3SDZA 2GNCA 4BDZA 2FPFA 4BCGB 3VKGA 2DJQA 1VQ9Q 3PIOA 3HL8A 4FYWB 2H8HA 3EG9B 1M4ZA 3OYHA 1RAEB 1WHKA 1MV3A 2QTXA 2LX7A 2B8AA 2DILA 5M9OA 3JB9I 3A8LB 3MIAB 3MEAA 3SD4A 1KG1A 3M0SA 2LQNA 2PHGA 5FGKB 2X3WD 2AHJB 4AG2C 3PGGA 1QMZB 4PKCC 2EKOA 5BNJB 1YWPA 3EFOB 3JCMb 2D8HA 3MI9B 1I0CA 4PJLA 3C95A 1WHJA 2BIVA 5DM7R 1U1TA 4AFQC 3IQLA 4MZMA 4CFWB 1M1KR 4M77C 3MY1B 4F7SB 3OYEA 4RMOA 2HCKA 5KYYA 1WLPB 1VQOA 3X28B 2HKQB 5CCAA 1UGQB 3BE3A 1HD3A 4PJOD 3BFMA 3MJXA 2ZGWA 2DBMA 1ABQA 2JUFA 4EDUA 2FPEA 1JOWA 4M7DF 2ZCFB 2CP0A 3QYHB 4C0FA 4BE2A 1VQ4Q 2JMAA 3LW5E 5CKEA 4MIMA 4Y92A 1NEBA 2YRVA 1YCSB 3EG2A 2LQWA 5HKCA 2C5XB 1VQ9A 1I5LA 4M78C 2J6FA 5FRMA 4BCHB 4RCBA 1AWJA 2JW4A 3GNFB 1JSTB 1OYXA 2MMPA 1UECA 3FDRA 4O6JA 5GAN8 4F7UF 2EYWA 2L8DA 2EJ9A 1QVGA 2CT4A 1H28B 1X2QA 2MPXC 4O5VA 1VQ8T 1M1KU 2L3RA 2K2MA 4M75F 4XU2A 2XKOC 4CFUD 4EOJB 1X69A 1G5VA 4EPCA 4J9DA 3LH5A 4QQDA 5CAIA 2D6FA 4A4HA 4AG1C 3EGUA 1SPKA 1MNDA 4ZN1A 2DTOA 3DLLA 3OQ5A 1VQNQ 5J39A 4JRPA 5LJ3g 1F5QB 4CFVB 4RTZA 1QVFS
chains in the Genus database with same CATH topology
4Y91A 2DTHA 2DZ9A 2PUOB 4DQ2A 5KE2A 2DK3A 3CMEA 1BIAA 2WSFE 3KHIA 3G7ZA 3PMIA 4M78B 4C8QC 4EMKA 2R5AA 1K73U 3BG3A 5CKDA 3V7SA 1NZ9A 4RG2A 4OB1B 2LNVA 5LJ5j 3V7RA 4FM4B 2DZCA 3MHXA 3OSVA 3FIFA 3M4GA 2OAUA 2IVWA 5LJ3d 3LGLA 2BS3A 1QP2A 2V8KA 4OB0B 3OB9A 4C92F 5A0LA 2K57A 3KBGA 3N5BB 4MMKA 4OB2B 1M1KC 1VQ4A 2C06A 4IUTA 3OSSC 3OBWA 2ZPEB 3PNWC 3ZFJA 4M7DA 3INZA 1XNIA 1VQ4T 3O8VA 5GAOn 4OVAA 4DA4A 2PVOB 3MCAB 2R58A 4M78F 3E1SA 3QDRB 4XU1A 5A2QE 4DOWA 2RI2A 3LX7A 4GY5A 5A0DA 5GANg 1YI2T 2DD5B 2E41A 4BY6C 2LQKA 2QXFA 3OS2A 3OYKA 4M7AC 4QVDA 4KBMB 2FVUA 3OS1A 1K8AU 5GMKi 3C94A 1MHNA 3CC2A 3MEWA 4PJOA 2VUBA 3OYFA 3JB9G 2QDYB 4PJOG 4HLQA 4J7IA 4JRIA 1YJWA 3L2QA 3HP9A 3UWNA 3CC2T 1N8RU 4II1A 4A4FA 2EFIA 4JJNK 3UT1A 2CGHA 2BKDN 3JCMf 5I2SA 1YJWT 3JCMW 1K73C 2KDSA 1AHJB 3ZBDA 2P0QA 4C8QD 1S72T 4NC6A 5D6WA 3KXTA 3CC4T 3OW2A 4C8QB 2JVVA 1KQSS 5IN1A 4J6WA 3P8BB 2GFAA 3CCQA 2ZZDB 4QVZA 1VQ5T 3V8LA 1ZBXA 4NOYA 4C5HA 4AKGA 1VQOT 4M75A 4XU3A 1E7PA 3SWNC 2XDBA 4QQ6A 3CCQT 5I21A 3M59A 2Y4YA 2VV5A 2DEQA 3PFSA 4QSHA 2XK0A 3J80E 1WNLA 3DLMA 3FC3A 1VQPA 4BI4A 1ZQ1A 4LD9K 4N0AA 1VQNA 1HK9A 2LTOA 4M77A 1JB0E 3HZJA 2LX9A 4MFDA 4M77G 2QQAA 4ZN3A 1VQNT 2XDPA 5HK3A 4C8QF 4F7UB 2X4JA 4E47A 1K8AC 2M16A 3JCMV 2RHXA 2NLUA 3JCMg 1UB4A 2M0OA 2G77A 4BY6B 4J7FA 2XG8D 4M7AB 3OYNA 2E1HA 4IUUA 2KMTA 2OTJA 3BW1A 3OMGA 1N8RC 2DVEA 1VIEA 2RD1A 1XTDA 5GAN6 3OYAA 2KVQG 3L2VA 2RHYA 4E7HA 2DXCB 5CKFA 4Z02A 4L5GA 3CCSA 2OTJT 1OZ2A 4KUIA 5CQXA 2MWOA 4MDWA 3QZ9B 4A53A 5CVIA 4HT9A 2XU8A 2OTLA 3CCST 3V7CA 3QIIA 4HCBA 3QYEA 3J7AF 5EJCA 4C92A 2HQEA 4HCCA 3MO8A 4L59A 2E5QA 5GAMf 3I56A 4ME7A 2O4XB 2E10A 1WJRA 2QQSA 2WACA 3H6ZA 4J83A 2LDMA 4A4KA 4WF2A 1VQKA 3TW6A 5GMKl 3WXMB 3LGFA 3OYDA 3CCLA 1NJIU 3QZ5B 1MGQA 1H3ZA 3H4CA 3I56T 3CCVA 3MEUA 4M7AF 1YIJA 1Y71A 1QVFA 3HFNA 4M7DE 3GOXA 3L42A 3CD6A 4M78A 3RUXA 2WSCE 4C5GA 2CKKA 5FU6C 4N4HA 4M78G 3CCVT 1I8FA 1VIFA 3SWNB 2K5LA 4C0ZA 1YIJT 3HO8A 2KY9A 1QW1A 3OMCA 3OS0A 3CD6T 4KUDK 3GP8A 3CPFA 4R56A 3QO3A 2QI2A 4QW2A 3RMQA 5A0GA 2Y4XA 3C4SA 1DJ7B 4KULA 1X01A 5D6YA 3BG5A 2X4XA 3CXCS 4AKIA 1OI1A 3HPWA 3L1AA 4LOCA 2RK1A 4C5IA 1KD1U 4ELZC 1KQ2A 3OYBA 2RH2A 4PJOE 2RA2A 3M57A 4ZGDB 2RHUA 3T9NA 4IUQA 3JCMc 4ZGEB 3Q1JA 3LH0A 3CBOA 1FWZA 3JCMQ 1M1FA 3OYCA 2QF7A 3S3MA 4BBRM 3AHUA 3GF5A 1G3SA 5KE3A 3L2UA 1FXXA 2E65A 1O9SA 5CQYA 1YITA 2DD5A 5GAMg 3VYHB 2DO3A 2BS4A 4BBSM 1O75A 4MZPA 1B34B 5LJ3e 2JTMA 1N9RA 5GAOl 3HSBA 4N4IA 4PNOA 3TU4K 3BDLA 1IZ6A 4A4EA 3CMET 3RKXA 1YHQA 4HL4A 2E12A 3G6EA 1YITT 1Q7YU 1PSFA 1VQLT 2CYZB 4XK8E 4ZTJA 1Q82U 1BI0A 3QYBA 1YHQT 2Y90A 3G6ET 1NJIC 2LVMA 4M75E 1X6OA 1U8RA 1GXIE 1WQWA 4LDYA 2QA4A 4BB7A 2DPPB 1KHCA 2PU9B 3GNGA 4DOVA 4P5NA 4E7LA 2BUDA 3EFSA 1RL2A 5GAMd 5L8RE 4M7DG 2KSSA 2RI5A 2VXFA 3JCMJ 1N27A 4J6XA 4M77E 4C0GA 5CO7A 3HRTA 3GIBA 4C8QA 5D6XA 3HRSA 3TW7A 2DKGA 2R5MA 5FU6B 3SB2A 1Y96B 2ZZDA 3EAEA 5CKHA 5LJ3j 3KUFA 1KQSA 5CKBA 3BG9A 4FIBA 2JTFA 4FL6A 4OMFB 3F70A 1HXDA 2FL7A 2R57A 3DKMA 3VJPA 4XQ3A 2LCLA 4JRKA 3CMAA 4QQGA 4A4GA 4HNUA 2FB7A 4ZTFA 2XI9A 1M90U 1BI1A 4NL2A 2XICA 3URGA 3JCMP 3CBMA 3CMAT 2EJFA 4XAXB 3LWIA 2V8JA 5GANd 5C0MA 3MP8A 4MMLA 2LQ8A 4IURA 4F7UA 3GLXA 1TH7A 4JLGA 1P92A 1Q7YC 2YHTA 3A5ZB 2HD0A 3L2RA 2EQMA 2VGMA 2A7YA 4C92E 4F7UG 5FRNA 2VXEA 2RJCA 2YLBA 1Q82C 2LC4A 4MDXA 3X26B 3M9QA 3H8ZA 4J6YA 1Q86U 4M7AA 4RKUE 1I81A 3P8HA 3CC7A 2EQJA 2K3XA 3EFRA 3TEEA 4M7AG 4CRIA 4AI6A 1VUBA 3A8OB 4XTWA 2K5FA 2RHZA 3VV0A 3G71A 2DXCA 2HQXA 4M78E 4M75G 3OY9A 4FT2A 4N4GA 2DXBB 3CC7T 1JJ2S 4IUVA 1M9SA 3HB9A 3FLGA 4FT4A 4ZGJB 5GANj 5C6SA 3G71T 3LLRA 1W4SA 4LDVA 3P8DA 2BS2A 2JOYA 1VQPT 4LDUA 3A8HB 4JX5A 5FROA 3JAME 2LCCA 4XU0A 3LWHA 3QXEB 2O4XA 5CIUA 4IKFA 2MWPA 3NTIA 2F69A 4J5YA 4TVRA 3CCMA 5LJ5h 4FSXA 4YTLA 1NE8A 3HBLA 5GAN4 2P4TA 3X20B 4AKHA 2VYTA 4EMGA 3J81E 4BE0A 3MP1A 3JB9D 1M90C 3WVEB 1RI0A 3CCMT 4BE1A 2QFZA 3QKJA 2D9TA 4BDYA 1YJ9A 1I4K1 2QQBA 5HY6A 3SWNA 3A8GB 3MP6A 3TCJA 4BI8B 2HBPA 3QWLA 1N9SA 3FEOA 4ELYC 4LDWA 3CCRA 4JUVA 2X35A 1YJ9T 2PQWA 5LJ5f 3M54A 3R6OA 3JCMe 3E9FA 5DLOA 2DAQA 2CS7A 3VKHA 5GAOr 3JCMX 4JRQA 3CCRT 2OTLT 1G3YA 4C5EA 5LJ3h 3VUBA 3CXCA 1Q86C 3VKIA 3HHTB 4C92G 1D3BB 3S3OA 2D0QB 2M9UA 1U1SA 2KQWA 2LRQA 3TREA 1NPPA 2KAFA 3RIRA 1K9MU 4HCZA 1VQKT 3JB9F 2DJZA 3MEVA 4RCCA 4XTZA 1B34A 4XTVA 1W2BS 3RESA 4OF1A 2XD0A 4Z6YA 3QUIA 3GPLA 4C8QE 5GAN2 1WJQA 3CPWA 3CCJA 2H3JA 4QVCA 3QJYA 1UGPB 2O01E 2XIDA 4PL6A 3VUZA 2EQUA 2K3YA 2RJDA 4BD3A 3M58A 3OYJA 3VYGB 3QBYA 3DB4A 2K5IA 2JN0A 1VQMA 1V29B 2ZPIB 3M56A 3QYGB 5LJ5g 2EJGA 1XOVA 1WJSA 3V8KA 1BI2A 5IT9E 2P0KA 4MZTA 2GFUA 5CK9A 3X25B 2MF2A 1VQMT 1KC8U 1KQ1A 4Y28E 3ZEHA 1FX7A 3G4SA 2EQKA 1FKMA 4E7JA 4X9DA 5GMKe 4NL3A 3OYIA 2F5KA 2K4YA 2JNGA 2KK4A 2ZPFB 1EIFA 1Y96A 3HFOA 2QDJA 4EMKC 4F7UE 3CPWS 2FHDA 3G4ST 4XTUA 1SSFA 1BI3A 1WQ7A 3L2ZA 3JB9J 4BUGA 4M7AE 4E7IA 2FYKA 2ZPGB 2DIGA 5LJ5d 4PLIA 5GAMe 2G3RA 3HKSA 4HKEA 5J26A 1QVGS 1LNXA 3PIPA 3UPUA 2RJFA 2EYQA 4M7DC 3RKYA 1JBMA 2DXUA 2QEXA 4JS4A 1QLBA 2ZPHB 2QQ9A 4BI3A 4JX4A 2YLCA 4M78D 2QA4T 2DD4B 3M53A 3SDZA 1OZ3A 3FB9A 4BDZA 2QEXT 3VKGA 1ZHIA 1QVPA 3PMTA 4V2SA 3M55A 3PIOA 3HL8A 3QHSA 2P0PA 2L89A 4C8QG 5GMKj 3BDUA 4X34A 5GAN7 1YCYA 1Y07A 2LT1A 2PVDB 3S3NA 3X24B 1M4ZA 2CZ1B 1PSEA 2MI6A 2RM4A 3ASKA 4IUPA 3OYHA 2QTXA 1VQ6A 3JB9H 4PJOC 1BIBA 5KCHA 1KHIA 2B8AA 2DXBA 5AYFA 5GANe 4JLIA 4R55A 3LYIA 3CCLT 1Q81U 3NTHA 5M9OA 3SFMA 1KC8C 1UGSB 5KCOA 5GAMj 3JB9I 1VQ6T 3A8LB 3QG1A 2KR6A 1JJ2A 1X75C 2V8IA 3PTAA 1YI2A 4HT8A 5LL6S 1M8VA 1G3WA 3OBYA 4EMHA 3MEAA 1WPYA 3SD4A 1KG1A 1UGRB 3PT9A 4LD6A 2RHIA 3OYYA 2AHJB 2KMGA 5KH6A 4EMKB 3PGGA 4VUBA 3JCMh 3JCMd 5GAOq 4PKCC 4BACA 4ATOA 1VQLA 2EKOA 2E6ZA 3JCMb 4M75C 2HNIA 4JDSA 2E70A 4OGCA 4NS5A 3CEYA 3C95A 1BKBA 4C0DC 2RB6A 5FU7C 3JRZA 2ZPBB 2BIVA 3E19A 2GF7A 5DM7R 1BYMA 1U1TA 4N0AC 3QPHA 4M7DD 3M5AA 4MZMA 5DLQE 1S72A 1UEBA 5GMKm 1N6AA 2PVGB 4M77C 3CC4A 4M7DB 2VGNA 3VU3C 3DL1A 4B9WA 4RMOA 3OYEA 5J3BA 2CZ7B 1VQ7A 3CBPA 1M5Q1 3RMSA 2GCXA 1LOJA 4J8OA 3WVDB 4UC4A 1D3BA 1VQOA 1VQ5A 3BY7A 3X28B 2EIFA 5CCAA 4M6VA 3NFCA 1UGQB 1VQ7T 1WGSA 3UDCA 3FJPA 5CR2A 3E9GA 5DY9A 1Q81C 4OGEA 3L2WA 4PJOD 3BFMA 5FLXE 2ZGWA 2I2LA 2JUFA 4PJOB 4EDUA 4MFEA 3DB3A 3OS5A 2EAYA 4D6WA 1W2BA 1XQHA 2LT4A 1H641 4JX6A 4M7DF 2RJEA 2ZCFB 3S6WA 3QYHB 1Y7XA 3CCUA 4C0FA 3A8MB 5I2MA 3VYGA 4BE2A 2M1HA 2F5TX 3ER0A 4C92C 5GMKh 1M1GA 2DTIA 3LW5E 4MIMA 5CKEA 3OW2S 1YJNA 2HAXA 4E7KA 3CCUT 5GAOm 2DIQA 2YRVA 4M7AD 2A3LA 3C12A 2QQRA 1NPRA 3OYGA 4Q5WA 1YJNT 2XHCA 5HKCA 1VQ9A 1I5LA 3OYLA 4M75D 4CI0C 3I55A 2GQVA 4M78C 3OYMA 3HRUA 4XTYA 4PJOF 5GAMh 2WJ9A 4M75B 3OA6A 2MAMA 1VQ9T 5FRMA 4C0DB 5LJ3f 4HNTA 5FU7B 4ELJA 3I55T 2VC8A 4RCBA 4GLKA 3RKWA 3GNFB 4XTXA 4HNVA 4KT0E 1OYXA 1YBYA 1LJOA 2MMPA 2RO0A 4M77D 3FDRA 2IG0A 5EG2A 1QP3A 2E6NA 3META 4M77B 4O6JA 4F7UF 5GAN8 3CCEA 3CCJT 4LDXA 1VQ8A 4X9CA 4JS5A 2L8DA 3QJ6A 5GAOp 2EJ9A 4A54A 3NTKA 4RG8A 1QVGA 3CCET 3FRNA 3M4YA 2RI3A 3ME9A 2E64A 4O5VA 1VQ8T 4OB3B 2DD4A 2K2VA 2L3RA 1M1KU 2XDDA 4M75F 5GAN3 5GAN5 4PLLA 4XU2A 5HK0A 2XKOC 3V8JA 5GANh 2QQ8A 1G5VA 4EPCA 2CZ0B 1G3TA 5LJ5e 3JSCA 1KD1C 2X4WA 3QSUA 2RK2A 2WSEE 4L6V5 4QQDA 5CAIA 2D6FA 4M77F 4A4HA 3RERA 1IREB 4B9XA 4C92D 2JZ2A 4ZN1A 1R8OB 2DTOA 2L5QA 2CZ6B 3DLLA 1JRIA 3OQ5A 4C92B 2PUKB 2EWNA 5IAYA 5J39A 2DXTA 5LJ3g 5GANf 4JRPA 1K9MC 4HA8A 4OP0A 2X4YA 1QVFS 4FU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGR B;  2PUO B;  3QZ5 B;  2WSF E;  3X20 B;  2AHJ B;  2WSC E;  3WVE B;  3A8G B;  4OB1 B;  4FM4 B;  2ZPB B;  1QP2 A;  4OB0 B;  1DJ7 B;  4OB2 B;  2PVG B;  2ZPE B;  4ZGD B;  3HHT B;  2CZ7 B;  4ZGE B;  2PVO B;  3WVD B;  2D0Q B;  3X28 B;  1UGQ B;  2DD5 B;  2DD5 A;  3VYH B;  1PSF A;  2CYZ B;  4XK8 E;  1UGP B;  2QDY B;  2O01 E;  2ZCF B;  1GXI E;  3QYH B;  3VYG B;  3A8M B;  3VYG A;  2DPP B;  2PU9 B;  1V29 B;  2ZPI B;  3LW5 E;  1AHJ B;  3QYG B;  5L8R E;  3X25 B;  4Y28 E;  2ZZD B;  2ZZD A;  2ZPF B;  4KT0 E;  2ZPG B;  1QP3 A;  1JB0 E;  2ZPH B;  2DD4 B;  4OB3 B;  2DD4 A;  3X26 B;  4RKU E;  2CZ0 B;  2PVD B;  3X24 B;  3A8O B;  2CZ1 B;  1PSE A;  2DXC B;  2DXC A;  2WSE E;  4L6V 5;  3QZ9 B;  2DXB B;  2DXB A;  1IRE B;  4ZGJ B;  2CZ6 B;  1UGS B;  2PUK B;  3A8L B;  3A8H B;  3QXE B; 
#chains in the Genus database with same CATH topology
 4DQ2 A;  1KQS P;  1WX6 A;  3H41 A;  1BIA A;  2WSF E;  4C8Q C;  3PVQ A;  1AWW A;  4JJD A;  4RTV A;  4NST B;  3MHX A;  2OAU A;  2B86 A;  2BS3 A;  1QP2 A;  4C92 F;  3N5B B;  4KH0 B;  4OB2 B;  1VQ4 A;  3OSS C;  3PNW C;  1CKA A;  4M7D A;  2DE0 X;  2DBK A;  4ORZ A;  5CYI B;  4DA4 A;  3E1S A;  2RI2 A;  3EG1 A;  3LX7 A;  4GY5 A;  5GAN g;  2M51 A;  2DD5 B;  3HTR A;  3OS2 A;  3CD6 Q;  1QWF A;  4QVD A;  3MEW A;  2VUB A;  2CP5 A;  2L2P A;  1BCO A;  4JJN K;  1GBQ A;  2FO0 A;  2CGH A;  1OPK A;  2BE9 B;  5I2S A;  1YJW T;  3JCM W;  1K73 C;  4NC6 A;  1KK7 A;  5D6W A;  4J6W A;  3P8B B;  2ZZD B;  1EX4 A;  1FIN B;  3V8L A;  1Z9Z A;  1VQL Q;  4M75 A;  4XU3 A;  1KJW A;  1YWO A;  2Y4Y A;  2VV5 A;  2QDL A;  3PFS A;  1PRM C;  3RNJ A;  4LD9 K;  1VQN A;  1HK9 A;  2MCN A;  3HZJ A;  5IHN A;  2BZ8 A;  2QA4 Q;  2YUO A;  1Q95 G;  4M77 G;  1QVF P;  2LJ0 A;  4AFS C;  4F7U B;  4AFZ C;  4E47 A;  2YWW A;  2A28 A;  4BY6 B;  3FJ5 A;  3H0H A;  4J7F A;  4M7A B;  1Q82 R;  4IUU A;  2KMT A;  2DVE A;  2UUE B;  1XTD A;  2KVQ G;  2OTJ T;  1OZ2 A;  1RAD B;  2ZAE A;  1E6H A;  1IXD A;  1TSF A;  2KR3 A;  2W96 A;  3H0F A;  3QII A;  3V7C A;  3CCS T;  5EJC A;  4C92 A;  3RGF B;  1WZO A;  2HQE A;  4HCC A;  4L59 A;  4ME7 A;  2QQS A;  1SRM A;  1WJR A;  1IGQ A;  2FG0 A;  3QHR B;  3EH2 A;  3QZ5 B;  3HFN A;  3ULR B;  3L42 A;  3CD6 A;  1UG1 A;  1QQJ A;  2WSC E;  5FU6 C;  4M78 G;  1VIF A;  1YIJ T;  1H27 B;  1AD5 A;  3L1A A;  4F6S B;  4LOC A;  1UJY A;  1KQ2 A;  4BY7 X;  1M3C A;  3M57 A;  4F6U B;  3JCM c;  1D0X A;  2DL5 A;  1ENW A;  1FMW A;  2Z0W A;  4LUD A;  3CCM Q;  1VQL A;  3VS6 A;  4DEX A;  5LJ3 e;  1Y57 A;  1GBR A;  1B34 B;  2I53 A;  4PNO A;  2K3B A;  3BDL A;  4A4E A;  2E12 A;  2CYZ B;  1Q82 U;  1YHQ T;  1UHF A;  3G6E T;  1U8R A;  2QA4 A;  4LDY A;  2X3X D;  4ANJ A;  1KHC A;  2O31 A;  2PU9 B;  3GNG A;  2EUF A;  2OX7 A;  3QWY A;  4E7L A;  2MOX A;  2DEU A;  1RL2 A;  3EGD A;  5L8R E;  2GBQ A;  4M77 E;  5CO7 A;  3HRS A;  2JT4 A;  5KYX A;  5KYU B;  1KQS A;  2A08 A;  3BG9 A;  3F70 A;  1AWO A;  3VJP A;  3TVT A;  2VAS A;  4HNU A;  4ZTF A;  2XIC A;  3URG A;  1NEG A;  3CMA T;  2EJF A;  3LWI A;  2C0T A;  2FEI A;  2RN8 A;  4IUR A;  1Q7Y C;  3A5Z B;  2EQM A;  1I1J A;  2RJC A;  2L3Q A;  4YOZ A;  4RKU E;  5I22 A;  1PCX A;  1TOV A;  2GGR A;  4QKU A;  3EFR A;  3TEE A;  5HNB B;  1VUB A;  3A8O B;  2RHZ A;  1AVZ C;  4M78 E;  4FT2 A;  3UA7 A;  1QCF A;  1K4U S;  3FLG A;  5C6S A;  2DFU A;  3LLR A;  5IF1 B;  1JSU B;  2JOY A;  1VQP T;  3JAM E;  1WYX A;  2WMB B;  5I5Z B;  2F2V A;  3NTI A;  1W70 A;  3CCM A;  4FSX A;  4YTL A;  1NE8 A;  1ZUY A;  5GAN 4;  2P4T A;  3X20 B;  4AKH A;  4K11 A;  4EMG A;  1M90 C;  1RI0 A;  4BE1 A;  2QFZ A;  1D3U B;  3QKJ A;  1I4K 1;  3SWN A;  1QKX A;  4BI8 B;  3FEO A;  4ELY C;  4LDW A;  2X35 A;  2JM8 A;  2CS7 A;  3VKH A;  2AT1 B;  1TS9 A;  4ESR A;  4F6W B;  1K73 R;  3HHT B;  1E9H B;  1YI2 Q;  1D3B B;  2O2O A;  1RAB B;  3S3O A;  2C0O A;  2M9U A;  2V1R A;  1X2K A;  4HCZ A;  1ZSZ A;  4Z88 A;  1BCM A;  1X43 A;  4XTV A;  1EFN A;  1K9A A;  3GPL A;  2NUP A;  4C8Q E;  1WJQ A;  3QJY A;  4PL6 A;  2EQU A;  2K3Y A;  2RJD A;  4E7S A;  3VYG B;  5LQF B;  3DB4 A;  1S72 Q;  1V29 B;  2ZPI B;  5LJ5 g;  3V8K A;  2P0K A;  2GFU A;  1VQ7 Q;  1KQ1 A;  4Y28 E;  3ZEH A;  3M0T A;  4X9D A;  2M02 A;  1H1R B;  2KK4 A;  1Y96 A;  4ZNX A;  1UNL D;  1SG5 A;  2ENM A;  3JB9 J;  4BUG A;  4E7I A;  2DIG A;  4J9F A;  3QHW B;  1QVG S;  3VRY A;  1N4M A;  4M7D C;  1X27 A;  4J9C A;  4JS4 A;  2ZPH B;  4JX4 A;  2YLC A;  1YJN Q;  3NMZ C;  1O9K B;  3A1P A;  2QEX T;  1D0Z A;  3M55 A;  1T3S A;  1CSK A;  1YCY A;  1Y07 A;  2LT1 A;  4FW1 A;  3X24 B;  2CZ1 B;  3ASK A;  1BIB A;  2DXB A;  1CKB A;  4JLI A;  4R55 A;  4BCJ B;  3LYI A;  3CCJ Q;  3NTH A;  1Q81 U;  3SFM A;  1KC8 C;  5KCO A;  2KR6 A;  4D8K A;  3CCE Q;  1X75 C;  3PTA A;  1YI2 A;  1M8V A;  4EOP B;  2LCS A;  2K79 A;  3PT9 A;  2EW3 A;  2RHI A;  4FYY B;  1G2B A;  2LMJ A;  2KMG A;  5KH6 A;  4EMK B;  3JCM h;  2E6Z A;  1VYW B;  4M75 C;  4AMC A;  4JDS A;  2E70 A;  1D1A A;  4OGC A;  5FU7 C;  3M03 A;  2ZPB B;  2P84 A;  1XJW B;  2GF7 A;  5DLQ E;  1S72 A;  2ED0 A;  3VU3 C;  3DL1 A;  2CZ7 B;  1VQ7 A;  3RMS A;  4J8O A;  4YC3 B;  2DX1 A;  4UC4 A;  3BHT B;  1D1B A;  2M0Y A;  2LZ6 B;  3FJP A;  4OGE A;  1H1S B;  5EC7 A;  2WXV B;  5FLX E;  4EON B;  1PKS A;  1VOM A;  4PJO B;  4MFE A;  3DB3 A;  2LT4 A;  2KI7 A;  4G6L B;  2BTT A;  2W10 A;  2YXY A;  2M1H A;  3ER0 A;  4C92 C;  5GMK h;  3DJB A;  5KYW A;  1YJN A;  4E7K A;  2HL5 C;  5GJW B;  2DIQ A;  1NPR A;  3M0U A;  4Q5W A;  4CFN B;  3OYL A;  4CI0 C;  4RTX A;  3HRU A;  5GAM h;  3OA6 A;  1VQ9 T;  4C0D B;  3VS0 A;  4ELJ A;  2VC8 A;  2DRK A;  3RKW A;  3O0G D;  4KT0 E;  4M77 D;  1H92 A;  2E6N A;  3CCE A;  2CH4 A;  3MPU B;  5FWB A;  4LDX A;  4JS5 A;  1QKW A;  2OJ2 A;  2FZK B;  4A54 A;  4RG8 A;  3M4Y A;  3ME9 A;  2DD4 A;  2DL3 A;  3VS5 A;  3TSZ A;  1IB8 A;  2E4H A;  5GAN 5;  4PLL A;  2KBT A;  1GY3 B;  1M8M A;  4RTT A;  5IHI A;  3CCQ Q;  5LJ5 e;  4CFU B;  3JSC A;  1N8R R;  3EG9 A;  1KD1 C;  3QSU A;  4EC9 B;  2RK2 A;  4L6V 5;  2E3I A;  2O9V A;  1UNH D;  1G8X A;  4Z89 A;  1M2O A;  1IHV A;  2PUK B;  1H1P B;  5HBH B;  2EWN A;  2DXT A;  5IAY A;  1K9M C;  4OP0 A;  1IGU A;  4BCF B;  4FU6 A;  4Y91 A;  2DTH A;  1UFF A;  2DZ9 A;  3CME A;  1QWE A;  3G7Z A;  3BG3 A;  3V7S A;  1VYV A;  1NZ9 A;  4E2F B;  3EFO A;  2D0N A;  1UHC A;  2JS2 A;  2DZC A;  4HVW A;  3OB9 A;  2MK5 A;  1VOL A;  2OTL Q;  2ZPE B;  1ABO A;  2H3E B;  3SEM A;  1VYU A;  4JZ3 A;  1VQ4 T;  3O8V A;  1NBE B;  1OPL A;  5A2Q E;  4XU1 A;  3CCV Q;  3OYK A;  4KBM B;  2FVU A;  1K8A U;  5GMK i;  1AD6 A;  2CP6 A;  3C94 A;  4I3Z B;  3D7S B;  2QDY B;  2A0F B;  3L2Q A;  1N8R U;  4II1 A;  2IVX A;  2EFI A;  4LN2 A;  4A4F A;  3UT1 A;  2BKD N;  1PKT A;  2KDS A;  4C8Q D;  1ZX6 A;  3CC4 T;  2JVV A;  4BCN D;  1KQS S;  3DDQ B;  2EYX A;  2QG9 B;  3CCQ A;  3G33 B;  2ESW A;  4QVZ A;  1VQ5 T;  1K0S A;  4AKG A;  3SWN C;  5I21 A;  3M59 A;  3TQ7 P;  2JM9 A;  1PWT A;  3DLM A;  3FC3 A;  4X1V A;  3CXC P;  4BCQ D;  4N0A A;  1R77 A;  1KC8 R;  1RLQ C;  2QQA A;  1VQN T;  2XDP A;  2RMO A;  1ZA2 B;  1FVV B;  2X4J A;  4PFP A;  3JCM V;  1SHF A;  1X6B A;  2NLU A;  2M0O A;  2G77 A;  2UZD B;  1ZSZ C;  2E1H A;  2QK0 A;  2K7A A;  3I5S A;  4E7Z A;  2DXC B;  1MMA A;  4J9B A;  2MWO A;  4MDW A;  3CQT A;  2XU8 A;  2OTL A;  3QYE A;  4OML A;  5ACB A;  2E5Q A;  3JCM d;  2LDM A;  2RQU A;  1OKV B;  5GMK l;  2K9G A;  1ZUK A;  3OYD A;  4M7A F;  3CCV A;  4FYV B;  1RAF B;  4M7D E;  2DNU A;  3GOX A;  1B07 A;  4EOR B;  2KYM A;  1QCO A;  2QGF B;  1I8F A;  1B7T A;  1JXO A;  3HO8 A;  2KY9 A;  1QW1 A;  3OMC A;  3CD6 T;  3CC7 Q;  4KUD K;  3QO3 A;  2Y4X A;  3G71 Q;  2RK1 A;  4C5I A;  3OYB A;  2DVJ A;  2A37 A;  1GRI A;  2RHU A;  2HSE B;  2KXC A;  1BBZ A;  4TTH A;  4CFX B;  1M1F A;  2QF7 A;  3AHU A;  4PK4 A;  3GF5 A;  5HQ0 B;  1G3S A;  5KE3 A;  1FXX A;  3VRZ A;  2DD5 A;  1O75 A;  2X1N B;  2JTM A;  3TU4 K;  2DYB A;  1U06 A;  3UF4 A;  1VQL T;  2ABL A;  2CP3 A;  4XK8 E;  3CCR Q;  2DA9 A;  1NJI C;  2LVM A;  4M75 E;  1X6O A;  1H25 B;  2KXD A;  3RR6 A;  4F14 A;  1N5Z A;  4BB7 A;  2DPP B;  1SHG A;  4ELL A;  4P5N A;  4BCM D;  2BUD A;  5GAM d;  1H4L D;  3REB B;  1E6G A;  2RI5 A;  3VS1 A;  3HRT A;  3GIB A;  2DLP A;  3G1J A;  4JPB W;  2ZZD A;  3EAE A;  3KUF A;  2V22 B;  4OMF B;  2KRN A;  1KD1 R;  1WI7 A;  4JRK A;  4A4G A;  2FB7 A;  2SRC A;  2XI9 A;  1BI1 A;  2AKL A;  1AZE A;  1K9M R;  1D09 B;  3MP8 A;  4MML A;  2LQ8 A;  4F7U A;  1VQM Q;  1FMK A;  4JLG A;  2KT1 A;  3L2R A;  2VGM A;  4C92 E;  4JJC A;  1GUX B;  2YLB A;  4MDX A;  5AT1 B;  1R0C B;  3M9Q A;  4IIO A;  4M7A A;  1WHM A;  2EPD A;  3CC7 A;  2FRW A;  4F7J B;  4XTW A;  2LJ1 A;  3G71 A;  4OMP A;  1AWX A;  4N4G A;  1GCP A;  1V1C A;  1M9S A;  3HB9 A;  4LUE A;  2D8J A;  2BS2 A;  4JX5 A;  2LCC A;  3VS3 A;  3QXE B;  1JQQ A;  3HBL A;  1GH6 B;  4D8D A;  4BE0 A;  3MP1 A;  3JB9 D;  3CCM T;  2HBP A;  3QWL A;  3CCL Q;  1OX9 A;  3RDV A;  3CCR A;  2PQW A;  1VQ6 Q;  3R6O A;  4CC2 A;  3E9F A;  2DAQ A;  5GAO r;  4JRQ A;  2IW6 B;  1G3Y A;  5LJ3 h;  1Q86 C;  3CXC A;  2VWF A;  5FW9 A;  5IHK A;  2NUZ A;  1PC0 A;  2IW9 B;  2KQW A;  1K9M U;  1ZUU A;  1VQK T;  4BXX X;  3MEV A;  4XTZ A;  1B34 A;  4PFO A;  2UZL B;  3QUI A;  5GAN 2;  3CPW A;  2CSQ A;  3M0P A;  3UAT A;  1BU2 A;  3VUZ A;  4BD3 A;  1EZZ B;  4BY1 X;  3QBY A;  1VQM A;  2EJG A;  1XOV A;  1BI2 A;  5IT9 E;  2F2W A;  1NLO C;  2FRY A;  1FX7 A;  1FKM A;  4E7J A;  2IN3 A;  4KRC B;  2QAZ A;  3THK A;  2BZY A;  5KYU A;  1UNG D;  1SSF A;  1BI3 A;  1OL2 B;  2ZPG B;  2EGC A;  4PLI A;  4CXA B;  3HKS A;  2RJF A;  2EYQ A;  3CCU Q;  2MYS A;  4BI3 A;  1RLP C;  4Z8A A;  2G6F X;  1ZHI A;  3PMT A;  1HJD A;  2ROL A;  4V2S A;  3PVL A;  5GMK j;  2P0P A;  4C8Q G;  1X6G A;  3I55 Q;  2KE9 A;  4X34 A;  5GAN 7;  1YP5 A;  4IKF A;  2PVD B;  3CCL A;  3S3N A;  1PG5 B;  3NGP A;  1VQ6 A;  3JB9 H;  5KCH A;  1KHI A;  5AYF A;  5GAN e;  1I07 A;  1OU9 A;  1UGS B;  4BCO B;  5GAM j;  4F70 B;  1ARK A;  4FSS A;  2DMO A;  2V8I A;  4HT8 A;  5LL6 S;  2B9R A;  5HBE B;  1JEG A;  4CFM B;  4LD6 A;  1OI9 B;  3C0C A;  3OYY A;  4VUB A;  4BAC A;  4FYX B;  4ATO A;  1M2V B;  2HNI A;  1JXM A;  4RUG A;  3CEY A;  1BKB A;  3JRZ A;  2HEQ A;  4JZ4 A;  3E19 A;  2PZ1 A;  5IXF A;  1BYM A;  4N0A C;  4M7D D;  2IPO B;  3BLH B;  2KYB A;  1N6A A;  5GMK m;  1MNE A;  1NYG A;  1JKW A;  1G3N C;  2O9S A;  5J3B A;  4F7N B;  4DEY A;  1M5Q 1;  2GCX A;  1LOJ A;  3WVD B;  1D3B A;  3BY7 A;  1OV3 A;  2EIF A;  4M6V A;  3NFC A;  1VQ7 T;  1SF9 A;  3UDC A;  5DY9 A;  1YN8 A;  2QYZ A;  3RBB B;  5KYN A;  2R7G A;  1SEM A;  5DQV A;  2EAY A;  1W2B A;  1XQH A;  2J7I A;  2RJE A;  2ED1 A;  3VS2 A;  2RQV A;  1UUE A;  3CCU A;  3A8M B;  2VB6 A;  3VYG A;  3TSW A;  2DTI A;  5DQW A;  1TTH B;  2RPN A;  2DET A;  4M7A D;  2A3L A;  2C0I A;  3C12 A;  1YJN T;  4M75 D;  3I55 A;  3OYM A;  2EKH A;  4XTY A;  4PJO F;  4PJN A;  2MAM A;  4GLK A;  4HNV A;  3CC2 Q;  1YBY A;  2GTO A;  5EG2 A;  1QP3 A;  3MET A;  1M27 C;  4M77 B;  3CCJ T;  1GFD A;  5GAO p;  3NTK A;  3F5X B;  3CCE T;  4OB3 B;  2SEM A;  1O9K A;  4LE9 A;  1H1Q B;  1UTI A;  3V8J A;  2QQ8 A;  2NUT B;  1G3T A;  3DDP B;  2YRC A;  2X4W A;  3DTO A;  4IIM A;  2X51 A;  3RER A;  4C92 D;  1VQP Q;  2MIO A;  2JZ2 A;  2CZ6 B;  1C0M A;  2CT3 A;  2X4Y A;  1HSQ A;  4F16 A;  1OIU B;  1WXT A;  2NYS A;  2COY A;  3KHI A;  4M78 B;  2UZE B;  4F04 B;  4EMK A;  1K73 U;  2JXB A;  1TUC A;  4BCP B;  3KFV A;  8ATC B;  3V7R A;  4FM4 B;  1F1B B;  5LJ3 d;  1V76 A;  2IVW A;  5A0L A;  2JTE A;  3EGX B;  4MMK A;  1M1K C;  1QCN A;  4R0K A;  4KGZ B;  3ZFJ A;  3INZ A;  1XNI A;  1OIY B;  1M30 A;  3I56 Q;  2PVO B;  6AT1 B;  4HXJ A;  2KRO A;  2E41 A;  4BY6 C;  2LQK A;  2QXF A;  4CC7 A;  2BZX A;  4M7A C;  2L0A A;  4FW2 A;  2O88 A;  1MHN A;  3CC2 A;  4PJO A;  3JB9 G;  1WHL A;  8AT1 B;  4J7I A;  3HP9 A;  3JCM f;  1LCK A;  3ZBD A;  1AHJ B;  3KXT A;  3OW2 A;  4C8Q B;  5IN1 A;  1HYO A;  4BCN B;  1Y0M A;  3CME Q;  1YIT Q;  1VQO T;  1S1N A;  1XO2 A;  5HCK A;  1E7P A;  2XDB A;  4QQ6 A;  3CCQ T;  4QSH A;  2F2C A;  2XK0 A;  1VQP A;  5IDP B;  2HL3 A;  4BI4 A;  1ZQ1 A;  3MKD A;  4MFD A;  4LNP A;  5HK3 A;  1OL1 B;  1T0J A;  2M16 A;  2KRS A;  2RHX A;  1Q7Y R;  1MV0 B;  9ATC B;  3BW1 A;  1G83 A;  1D0Y A;  4RTY A;  2RD1 A;  4DBF A;  3L2V A;  2RHY A;  4AFU C;  1OX8 A;  5CKF A;  4Z02 A;  4L5G A;  4ROC A;  2DME A;  4HCB A;  3J7A F;  2EGE A;  3I56 A;  5GAM f;  2O4X B;  2WHB B;  2E10 A;  2OTL T;  2WAC A;  1SSH A;  4WF2 A;  4A4K A;  3TW6 A;  3WXM B;  3LGF A;  1H3Z A;  1MGQ A;  4DBR A;  1PD0 A;  1OUL A;  1Y71 A;  5IXB A;  3RUX A;  4C5G A;  1C6V X;  1M90 R;  4N4H A;  3CCV T;  4C0Z A;  2PJQ A;  4EOK B;  3OS0 A;  3GP8 A;  2JJ9 A;  2QI2 A;  4QW2 A;  4YOO A;  3C4S A;  1C1A A;  1DJ7 B;  5D6Y A;  3BG5 A;  3CXC S;  4AKI A;  1OI1 A;  3HPW A;  2E3H A;  4J9I A;  1KIK A;  4ZGD B;  1MMN A;  3T9N A;  1IRX A;  2HDA A;  3Q1J A;  2ATC B;  2DL7 A;  3CBO A;  1FWZ A;  3JCM Q;  3OYC A;  1WDX A;  2E65 A;  1O9S A;  1PNJ A;  4RTU A;  5CQY A;  2GTJ A;  1YIT A;  2BS4 A;  2X9H A;  5GAO l;  1N9R A;  3BLR B;  4N4I A;  3RKX A;  1YJ9 Q;  1Q7Y U;  3QDF A;  4IMY B;  1BI0 A;  3QYB A;  2Y90 A;  5D7U A;  5HBJ B;  1GXI E;  1WQW A;  2EYZ A;  3AT1 B;  4BCI B;  4DBH A;  1C9B A;  1OKW B;  1PHT A;  2I0N A;  4M7D G;  1FMV A;  2VXF A;  1J3T A;  3TW7 A;  2DKG A;  4A63 B;  5FU6 B;  3SB2 A;  5CKH A;  5LJ3 j;  1H26 B;  2HQH A;  2IW8 B;  5CKB A;  3EHR A;  4FIB A;  2JTF A;  1HXD A;  3DKM A;  2WMA B;  4XQ3 A;  1M90 U;  2COZ A;  2JGZ B;  4XAX B;  1ZP2 A;  3GLX A;  1P92 A;  2YHT A;  1UJ0 A;  2EBP A;  2W0Z A;  1TUG B;  2A7Y A;  4F7U G;  5FRN A;  1Q82 C;  2LC4 A;  3X26 B;  3G4S Q;  4J6Y A;  1I81 A;  2EQJ A;  2K3X A;  4M7A G;  4CRI A;  2K5F A;  2DXC A;  4M75 G;  3OY9 A;  3H9N A;  3CC7 T;  1H24 B;  4IUV A;  5GAN j;  1UE9 A;  3G71 T;  1OQK A;  3LQ5 B;  2PNI A;  1W4S A;  1NM7 A;  2DL4 A;  4LDV A;  5FRO A;  3A8H B;  4E6R A;  3LWH A;  4XU0 A;  1LPL A;  2J6O A;  2PMI B;  4J5Y A;  2EGA A;  1TWB A;  2F2X A;  2F1L A;  3CPW P;  1ZSG A;  2RF0 A;  5I11 A;  3WVE B;  3U23 A;  1YJ9 A;  2D9T A;  2QQB A;  2VKN A;  3EG3 A;  3MP6 A;  1P5E B;  3TCJ A;  2AZV A;  4FCY A;  3VS7 A;  1GCQ A;  3M54 A;  3R6N A;  3H0I A;  2CH4 W;  3CCR T;  1RAA B;  3VUB A;  1GFC A;  5KYY B;  4C92 G;  5IDN B;  2D0Q B;  1SRL A;  1Z9Q A;  3TRE A;  1NPP A;  2DJZ A;  3M0Q A;  1WHH A;  4OR5 B;  2HMA A;  1W2B S;  3BHV B;  2XD0 A;  4M4Z A;  2W99 A;  5ECA A;  1E7O A;  2AK5 A;  2O01 E;  2HKN A;  2KGT A;  2HBW A;  1UGV A;  2K5I A;  1QMC A;  3CC4 Q;  3QYG B;  3EJ1 B;  4MZT A;  2WIP B;  3X25 B;  1KC8 U;  1VQM T;  1VQ5 Q;  3G4S A;  1W98 B;  3I9Q A;  4NL3 A;  2RQW A;  2K4Y A;  2ZPF B;  2V1Q A;  4EMK C;  4F7U E;  3PE0 A;  2COW A;  2C4G B;  2BPM B;  1WQ7 A;  3REA B;  2OI3 A;  2FZG B;  1W1F A;  4M7A E;  4EOO B;  5LJ5 d;  1UDL A;  4LXC A;  2G3R A;  1A0N B;  2DF6 A;  1T0H A;  2P4R A;  3RKY A;  1OGU B;  2DXU A;  1QLB A;  2QQ9 A;  2QA4 T;  3FB9 A;  1QVP A;  1U3O A;  1GUX A;  1TU0 B;  1W6X A;  3QHS A;  2L89 A;  3BDU A;  1OOT A;  5L23 A;  1PSE A;  1QLY A;  2MI6 A;  2RM4 A;  4IUP A;  4AT1 B;  4PJO C;  1OU8 A;  2CDT A;  3CCL T;  2CCI B;  1JO8 A;  1VQ6 T;  3QG1 A;  1JJ2 A;  1G3W A;  1MUZ A;  1VQ8 Q;  3OBY A;  4EMH A;  3I35 A;  1WPY A;  2L3S A;  1UGR B;  3NDQ A;  2YRD A;  4F17 A;  2CCH B;  1BK2 A;  5GAO q;  4II5 B;  5FWC A;  1W2B P;  2WPA B;  4EC8 B;  3TN8 B;  2DL8 A;  4NS5 A;  4C0D C;  2RB6 A;  4EOS B;  2D1X A;  2J05 A;  3O5Z A;  4DBQ A;  3QPH A;  3M5A A;  1UEB A;  3A98 A;  2PVG B;  3CC4 A;  1RAC B;  4M7D B;  2VGN A;  1FYN A;  4B9W A;  3CBP A;  3MY5 B;  2NWM A;  2DER A;  1VQ5 A;  3TNI B;  2PTK A;  4J9E A;  2WEV B;  2YDL A;  1GL5 A;  1WGS A;  5CR2 A;  3E9G A;  1MMG A;  1Q81 C;  3L2W A;  4KH1 B;  2I2L A;  4HVV A;  3M0R A;  2JMC A;  4EIK A;  1IO6 A;  3EH1 A;  3OS5 A;  4D6W A;  1H64 1;  4JX6 A;  3S6W A;  2CSI A;  1Y7X A;  1TFB A;  5I2M A;  1KD1 U;  2F5T X;  3OW2 S;  1M1G A;  2HAX A;  3CCU T;  1AEY A;  5GAO m;  2QQR A;  3OYG A;  2XHC A;  4J9G A;  2GQV A;  2J06 A;  2WJ9 A;  4M75 B;  5LJ3 f;  4HNT A;  5FU7 B;  3I55 T;  4OMM A;  4XTX A;  1LJO A;  2RO0 A;  1ZA1 B;  2IG0 A;  5CEI B;  1YJW Q;  1PKD B;  1VQ8 A;  4X9C A;  2C5N B;  2DM1 A;  2BKZ B;  2KT8 A;  3QJ6 A;  3FRN A;  2RI3 A;  2E64 A;  2K2V A;  2V26 A;  2RQR A;  2XDD A;  5GAN 3;  1MMD A;  1RAI B;  5HK0 A;  5GAN h;  3GTM S;  2FZC B;  2CZ0 B;  2G9X B;  2RNA A;  2WSE E;  4M77 F;  1IRE B;  4B9X A;  1KXU A;  1R8O B;  2L5Q A;  4GLM A;  1JRI A;  4C92 B;  5GAN f;  1TXQ A;  2BE7 D;  1VYT A;  4HA8 A;  2PK2 A;  2PUO B;  5KE2 A;  1KFZ A;  2DK3 A;  3PMI A;  1VA7 A;  2QGG A;  4GBQ A;  2R5A A;  3EG0 A;  5CKD A;  3TNW B;  4RG2 A;  1RI9 A;  2OTJ Q;  4OB1 B;  4ROD A;  1M2V A;  2LNV A;  5LJ5 j;  3OSV A;  3FIF A;  3M4G A;  4KGV B;  3LGL A;  1URC B;  3NHN A;  2V8K A;  4OB0 B;  7AT1 B;  3CCS Q;  1AT1 B;  2K57 A;  3KBG A;  2C06 A;  4IUT A;  4RTW A;  5EFQ B;  3OBW A;  3EHQ A;  3OW2 P;  5GAO n;  4OVA A;  4CRL B;  3MCA B;  1VQK Q;  1BB9 A;  2R58 A;  4M78 F;  3QDR B;  4DOW A;  2YUN A;  2CJM B;  3UA6 A;  5A0D A;  1YI2 T;  1YIJ Q;  1K0X A;  3OS1 A;  2WFY B;  4PJM A;  3EOC B;  1ZBJ A;  3OYF A;  1WA7 A;  4PJO G;  4HLQ A;  2LP5 A;  4JRI A;  1YJW A;  3UWN A;  3CC2 T;  1NJI R;  3EGD B;  1VIN A;  2P0Q A;  1S72 T;  1M3A A;  1OEB A;  2GFA A;  5KYX B;  4EOM B;  1ZBX A;  1B3Q A;  4NOY A;  4C5H A;  4Y72 B;  2ROT A;  2GQI A;  1YHQ Q;  2DEQ A;  1NG2 A;  2DYI A;  3G6E Q;  3J80 E;  1WNL A;  2AKK A;  1GCQ C;  1TG0 A;  2LTO A;  4M77 A;  1JB0 E;  2LX9 A;  1YFN A;  4ZN3 A;  2A36 A;  1I5O B;  5LMK B;  2KNB B;  3ZL7 C;  4C8Q F;  4KRD B;  5IHY A;  2LW4 A;  1H3H A;  1K8A C;  3K7A M;  2DRM A;  4WTO B;  4F7L B;  4J9H A;  3VS4 A;  1K76 A;  1UB4 A;  1WXU A;  1NYF A;  3JCM g;  2XG8 D;  3OYN A;  4OMO A;  2OTJ A;  3OMG A;  1N8R C;  1VIE A;  2NUT A;  3I5R A;  5GAN 6;  3OYA A;  4E7H A;  3CCS A;  4KUI A;  5CQX A;  3QZ9 B;  4B6M A;  4A53 A;  5CVI A;  3CMA Q;  4FX3 B;  4HT9 A;  1U5S A;  2YT6 A;  4EOL B;  2C5V B;  4PJJ A;  3MO8 A;  1VQK A;  5HVY B;  3H6Z A;  2KEA A;  4J83 A;  3BHU B;  1NJI U;  3H4C A;  3I56 T;  3MEU A;  3SHW A;  1YIJ A;  3QWX X;  1QVF A;  2FPD A;  4M78 A;  2EVR A;  5GJV B;  4YOS A;  2CKK A;  1Q81 R;  3SWN B;  2J6K A;  2K5L A;  1AOJ A;  2AIR B;  4QT7 A;  3CPF A;  3TNH B;  4R56 A;  1YNZ A;  3RMQ A;  5A0G A;  3EGX A;  4KUL A;  1X01 A;  2OAW A;  2X4X A;  4ELZ C;  2RH2 A;  4PJO E;  2RA2 A;  2CP7 A;  5IH2 A;  1SKU B;  4BCK B;  4IUQ A;  1Q86 R;  4ZGE B;  2K6D A;  3LH0 A;  1WXB A;  3S3M A;  4BBR M;  2LNH B;  3L2U A;  1ZSZ B;  4HVU A;  5GAM g;  3VYH B;  1TD6 A;  2DO3 A;  4BBS M;  4MZP A;  3HSB A;  4CC3 A;  1IZ6 A;  3CME T;  1YHQ A;  4HL4 A;  3G6E A;  2NUP B;  1YIT T;  1PSF A;  4ZTJ A;  2CUD A;  4OGR B;  1D1C A;  1PM3 A;  2QGS A;  1AIS B;  4DOV A;  1T3L A;  1LVK A;  2JS0 A;  1WHG A;  3EFS A;  2W9F A;  2KSS A;  3JCM J;  1N27 A;  4J6X A;  4C0G A;  4C8Q A;  5D6X A;  2RQT A;  1IHW A;  2R5M A;  1H8K A;  2C5O B;  1Y96 B;  3BLQ B;  4FL6 A;  3OYJ A;  2FL7 A;  2R57 A;  2LCL A;  3CMA A;  4QQG A;  4WCI A;  2HZY A;  4NL2 A;  3JCM P;  3CBM A;  2KRM A;  4JJB A;  3DOG B;  4OMQ A;  2V8J A;  3EID B;  5C0M A;  5GAN d;  1TH7 A;  1K1Z A;  2HD0 A;  2VXE A;  3POM A;  5L2W B;  3H8Z A;  1Q86 U;  2C6T B;  3P8H A;  2EYY A;  4OMN A;  2CRE A;  2WIH B;  4AI6 A;  3VV0 A;  2HQX A;  2E5K A;  2DXB B;  1JJ2 S;  4FT4 A;  4ZGJ B;  4BCQ B;  2QAS A;  3P8D A;  4LDU A;  3PO3 S;  2O4X A;  5CIU A;  4PFZ A;  2UZB B;  2MWP A;  2QEX Q;  2F69 A;  4TVR A;  5LJ5 h;  1RAH B;  1WFW A;  2VYT A;  3J81 E;  1ZLM A;  2ECZ A;  2HSP A;  4BDY A;  4KGX B;  5HY6 A;  2YSQ A;  3A8G B;  1RAG B;  1N9S A;  2IIM A;  1KSW A;  4JUV A;  1YJ9 T;  5LJ5 f;  3B57 A;  3JCM e;  1QVG P;  5DLO A;  4EOI B;  1BU1 A;  3JCM X;  1R0B G;  4UN0 A;  1NLP C;  2W9Z A;  4C5E A;  1WIE A;  3VKI A;  1JU5 C;  2CUB A;  1U1S A;  2LRQ A;  2KAF A;  3RIR A;  3JB9 F;  2YUP A;  4RCC A;  4EOQ B;  3RES A;  4OF1 A;  4Z6Y A;  3CCJ A;  2H3J A;  4QVC A;  2PK9 B;  2XMF A;  1UGP B;  4HCK A;  2XID A;  4KRT A;  4CC4 B;  2W2H A;  3M58 A;  2JN0 A;  5KYW B;  1M3B A;  3M56 A;  1PD1 A;  1TUD A;  1WJS A;  3NPF A;  1K8A R;  5CK9 A;  2I40 B;  2QTV A;  2MF2 A;  1VQO Q;  2YUQ A;  2EQK A;  1ACM B;  2EQI A;  3OYI A;  5GMK e;  2F5K A;  2VVK A;  2JNG A;  3HFO A;  1EIF A;  3CPW S;  2QDJ A;  2FHD A;  3G4S T;  2AZS A;  4XTU A;  2CP2 A;  3L2Z A;  1PRL C;  1AZG B;  1JJ2 P;  5ICP B;  2FYK A;  5GAM e;  2LJ3 A;  4HKE A;  5J26 A;  1LNX A;  3JV3 A;  3PIP A;  3UPU A;  1RUW A;  4ROE A;  1JBM A;  2QEX A;  3E2U A;  4M78 D;  3GBQ A;  4BCM B;  2DD4 B;  2L3P A;  3M53 A;  1OZ3 A;  3SDZ A;  2GNC A;  4BDZ A;  2FPF A;  4BCG B;  3VKG A;  2DJQ A;  1VQ9 Q;  3PIO A;  3HL8 A;  4FYW B;  2H8H A;  3EG9 B;  1M4Z A;  3OYH A;  1RAE B;  1WHK A;  1MV3 A;  2QTX A;  2LX7 A;  2B8A A;  2DIL A;  5M9O A;  3JB9 I;  3A8L B;  3MIA B;  3MEA A;  3SD4 A;  1KG1 A;  3M0S A;  2LQN A;  2PHG A;  5FGK B;  2X3W D;  2AHJ B;  4AG2 C;  3PGG A;  1QMZ B;  4PKC C;  2EKO A;  5BNJ B;  1YWP A;  3EFO B;  3JCM b;  2D8H A;  3MI9 B;  1I0C A;  4PJL A;  3C95 A;  1WHJ A;  2BIV A;  5DM7 R;  1U1T A;  4AFQ C;  3IQL A;  4MZM A;  4CFW B;  1M1K R;  4M77 C;  3MY1 B;  4F7S B;  3OYE A;  4RMO A;  2HCK A;  5KYY A;  1WLP B;  1VQO A;  3X28 B;  2HKQ B;  5CCA A;  1UGQ B;  3BE3 A;  1HD3 A;  4PJO D;  3BFM A;  3MJX A;  2ZGW A;  2DBM A;  1ABQ A;  2JUF A;  4EDU A;  2FPE A;  1JOW A;  4M7D F;  2ZCF B;  2CP0 A;  3QYH B;  4C0F A;  4BE2 A;  1VQ4 Q;  2JMA A;  3LW5 E;  5CKE A;  4MIM A;  4Y92 A;  1NEB A;  2YRV A;  1YCS B;  3EG2 A;  2LQW A;  5HKC A;  2C5X B;  1VQ9 A;  1I5L A;  4M78 C;  2J6F A;  5FRM A;  4BCH B;  4RCB A;  1AWJ A;  2JW4 A;  3GNF B;  1JST B;  1OYX A;  2MMP A;  1UEC A;  3FDR A;  4O6J A;  5GAN 8;  4F7U F;  2EYW A;  2L8D A;  2EJ9 A;  1QVG A;  2CT4 A;  1H28 B;  1X2Q A;  2MPX C;  4O5V A;  1VQ8 T;  1M1K U;  2L3R A;  2K2M A;  4M75 F;  4XU2 A;  2XKO C;  4CFU D;  4EOJ B;  1X69 A;  1G5V A;  4EPC A;  4J9D A;  3LH5 A;  4QQD A;  5CAI A;  2D6F A;  4A4H A;  4AG1 C;  3EGU A;  1SPK A;  1MND A;  4ZN1 A;  2DTO A;  3DLL A;  3OQ5 A;  1VQN Q;  5J39 A;  4JRP A;  5LJ3 g;  1F5Q B;  4CFV B;  4RTZ A;  1QVF S; 
#chains in the Genus database with same CATH homology
 4Y91 A;  2DTH A;  2DZ9 A;  2PUO B;  4DQ2 A;  5KE2 A;  2DK3 A;  3CME A;  1BIA A;  2WSF E;  3KHI A;  3G7Z A;  3PMI A;  4M78 B;  4C8Q C;  4EMK A;  2R5A A;  1K73 U;  3BG3 A;  5CKD A;  3V7S A;  1NZ9 A;  4RG2 A;  4OB1 B;  2LNV A;  5LJ5 j;  3V7R A;  4FM4 B;  2DZC A;  3MHX A;  3OSV A;  3FIF A;  3M4G A;  2OAU A;  2IVW A;  5LJ3 d;  3LGL A;  2BS3 A;  1QP2 A;  2V8K A;  4OB0 B;  3OB9 A;  4C92 F;  5A0L A;  2K57 A;  3KBG A;  3N5B B;  4MMK A;  4OB2 B;  1M1K C;  1VQ4 A;  2C06 A;  4IUT A;  3OSS C;  3OBW A;  2ZPE B;  3PNW C;  3ZFJ A;  4M7D A;  3INZ A;  1XNI A;  1VQ4 T;  3O8V A;  5GAO n;  4OVA A;  4DA4 A;  2PVO B;  3MCA B;  2R58 A;  4M78 F;  3E1S A;  3QDR B;  4XU1 A;  5A2Q E;  4DOW A;  2RI2 A;  3LX7 A;  4GY5 A;  5A0D A;  5GAN g;  1YI2 T;  2DD5 B;  2E41 A;  4BY6 C;  2LQK A;  2QXF A;  3OS2 A;  3OYK A;  4M7A C;  4QVD A;  4KBM B;  2FVU A;  3OS1 A;  1K8A U;  5GMK i;  3C94 A;  1MHN A;  3CC2 A;  3MEW A;  4PJO A;  2VUB A;  3OYF A;  3JB9 G;  2QDY B;  4PJO G;  4HLQ A;  4J7I A;  4JRI A;  1YJW A;  3L2Q A;  3HP9 A;  3UWN A;  3CC2 T;  1N8R U;  4II1 A;  4A4F A;  2EFI A;  4JJN K;  3UT1 A;  2CGH A;  2BKD N;  3JCM f;  5I2S A;  1YJW T;  3JCM W;  1K73 C;  2KDS A;  1AHJ B;  3ZBD A;  2P0Q A;  4C8Q D;  1S72 T;  4NC6 A;  5D6W A;  3KXT A;  3CC4 T;  3OW2 A;  4C8Q B;  2JVV A;  1KQS S;  5IN1 A;  4J6W A;  3P8B B;  2GFA A;  3CCQ A;  2ZZD B;  4QVZ A;  1VQ5 T;  3V8L A;  1ZBX A;  4NOY A;  4C5H A;  4AKG A;  1VQO T;  4M75 A;  4XU3 A;  1E7P A;  3SWN C;  2XDB A;  4QQ6 A;  3CCQ T;  5I21 A;  3M59 A;  2Y4Y A;  2VV5 A;  2DEQ A;  3PFS A;  4QSH A;  2XK0 A;  3J80 E;  1WNL A;  3DLM A;  3FC3 A;  1VQP A;  4BI4 A;  1ZQ1 A;  4LD9 K;  4N0A A;  1VQN A;  1HK9 A;  2LTO A;  4M77 A;  1JB0 E;  3HZJ A;  2LX9 A;  4MFD A;  4M77 G;  2QQA A;  4ZN3 A;  1VQN T;  2XDP A;  5HK3 A;  4C8Q F;  4F7U B;  2X4J A;  4E47 A;  1K8A C;  2M16 A;  3JCM V;  2RHX A;  2NLU A;  3JCM g;  1UB4 A;  2M0O A;  2G77 A;  4BY6 B;  4J7F A;  2XG8 D;  4M7A B;  3OYN A;  2E1H A;  4IUU A;  2KMT A;  2OTJ A;  3BW1 A;  3OMG A;  1N8R C;  2DVE A;  1VIE A;  2RD1 A;  1XTD A;  5GAN 6;  3OYA A;  2KVQ G;  3L2V A;  2RHY A;  4E7H A;  2DXC B;  5CKF A;  4Z02 A;  4L5G A;  3CCS A;  2OTJ T;  1OZ2 A;  4KUI A;  5CQX A;  2MWO A;  4MDW A;  3QZ9 B;  4A53 A;  5CVI A;  4HT9 A;  2XU8 A;  2OTL A;  3CCS T;  3V7C A;  3QII A;  4HCB A;  3QYE A;  3J7A F;  5EJC A;  4C92 A;  2HQE A;  4HCC A;  3MO8 A;  4L59 A;  2E5Q A;  5GAM f;  3I56 A;  4ME7 A;  2O4X B;  2E10 A;  1WJR A;  2QQS A;  2WAC A;  3H6Z A;  4J83 A;  2LDM A;  4A4K A;  4WF2 A;  1VQK A;  3TW6 A;  5GMK l;  3WXM B;  3LGF A;  3OYD A;  3CCL A;  1NJI U;  3QZ5 B;  1MGQ A;  1H3Z A;  3H4C A;  3I56 T;  3CCV A;  3MEU A;  4M7A F;  1YIJ A;  1Y71 A;  1QVF A;  3HFN A;  4M7D E;  3GOX A;  3L42 A;  3CD6 A;  4M78 A;  3RUX A;  2WSC E;  4C5G A;  2CKK A;  5FU6 C;  4N4H A;  4M78 G;  3CCV T;  1I8F A;  1VIF A;  3SWN B;  2K5L A;  4C0Z A;  1YIJ T;  3HO8 A;  2KY9 A;  1QW1 A;  3OMC A;  3OS0 A;  3CD6 T;  4KUD K;  3GP8 A;  3CPF A;  4R56 A;  3QO3 A;  2QI2 A;  4QW2 A;  3RMQ A;  5A0G A;  2Y4X A;  3C4S A;  1DJ7 B;  4KUL A;  1X01 A;  5D6Y A;  3BG5 A;  2X4X A;  3CXC S;  4AKI A;  1OI1 A;  3HPW A;  3L1A A;  4LOC A;  2RK1 A;  4C5I A;  1KD1 U;  4ELZ C;  1KQ2 A;  3OYB A;  2RH2 A;  4PJO E;  2RA2 A;  3M57 A;  4ZGD B;  2RHU A;  3T9N A;  4IUQ A;  3JCM c;  4ZGE B;  3Q1J A;  3LH0 A;  3CBO A;  1FWZ A;  3JCM Q;  1M1F A;  3OYC A;  2QF7 A;  3S3M A;  4BBR M;  3AHU A;  3GF5 A;  1G3S A;  5KE3 A;  3L2U A;  1FXX A;  2E65 A;  1O9S A;  5CQY A;  1YIT A;  2DD5 A;  5GAM g;  3VYH B;  2DO3 A;  2BS4 A;  4BBS M;  1O75 A;  4MZP A;  1B34 B;  5LJ3 e;  2JTM A;  1N9R A;  5GAO l;  3HSB A;  4N4I A;  4PNO A;  3TU4 K;  3BDL A;  1IZ6 A;  4A4E A;  3CME T;  3RKX A;  1YHQ A;  4HL4 A;  2E12 A;  3G6E A;  1YIT T;  1Q7Y U;  1PSF A;  1VQL T;  2CYZ B;  4XK8 E;  4ZTJ A;  1Q82 U;  1BI0 A;  3QYB A;  1YHQ T;  2Y90 A;  3G6E T;  1NJI C;  2LVM A;  4M75 E;  1X6O A;  1U8R A;  1GXI E;  1WQW A;  4LDY A;  2QA4 A;  4BB7 A;  2DPP B;  1KHC A;  2PU9 B;  3GNG A;  4DOV A;  4P5N A;  4E7L A;  2BUD A;  3EFS A;  1RL2 A;  5GAM d;  5L8R E;  4M7D G;  2KSS A;  2RI5 A;  2VXF A;  3JCM J;  1N27 A;  4J6X A;  4M77 E;  4C0G A;  5CO7 A;  3HRT A;  3GIB A;  4C8Q A;  5D6X A;  3HRS A;  3TW7 A;  2DKG A;  2R5M A;  5FU6 B;  3SB2 A;  1Y96 B;  2ZZD A;  3EAE A;  5CKH A;  5LJ3 j;  3KUF A;  1KQS A;  5CKB A;  3BG9 A;  4FIB A;  2JTF A;  4FL6 A;  4OMF B;  3F70 A;  1HXD A;  2FL7 A;  2R57 A;  3DKM A;  3VJP A;  4XQ3 A;  2LCL A;  4JRK A;  3CMA A;  4QQG A;  4A4G A;  4HNU A;  2FB7 A;  4ZTF A;  2XI9 A;  1M90 U;  1BI1 A;  4NL2 A;  2XIC A;  3URG A;  3JCM P;  3CBM A;  3CMA T;  2EJF A;  4XAX B;  3LWI A;  2V8J A;  5GAN d;  5C0M A;  3MP8 A;  4MML A;  2LQ8 A;  4IUR A;  4F7U A;  3GLX A;  1TH7 A;  4JLG A;  1P92 A;  1Q7Y C;  2YHT A;  3A5Z B;  2HD0 A;  3L2R A;  2EQM A;  2VGM A;  2A7Y A;  4C92 E;  4F7U G;  5FRN A;  2VXE A;  2RJC A;  2YLB A;  1Q82 C;  2LC4 A;  4MDX A;  3X26 B;  3M9Q A;  3H8Z A;  4J6Y A;  1Q86 U;  4M7A A;  4RKU E;  1I81 A;  3P8H A;  3CC7 A;  2EQJ A;  2K3X A;  3EFR A;  3TEE A;  4M7A G;  4CRI A;  4AI6 A;  1VUB A;  3A8O B;  4XTW A;  2K5F A;  2RHZ A;  3VV0 A;  3G71 A;  2DXC A;  2HQX A;  4M78 E;  4M75 G;  3OY9 A;  4FT2 A;  4N4G A;  2DXB B;  3CC7 T;  1JJ2 S;  4IUV A;  1M9S A;  3HB9 A;  3FLG A;  4FT4 A;  4ZGJ B;  5GAN j;  5C6S A;  3G71 T;  3LLR A;  1W4S A;  4LDV A;  3P8D A;  2BS2 A;  2JOY A;  1VQP T;  4LDU A;  3A8H B;  4JX5 A;  5FRO A;  3JAM E;  2LCC A;  4XU0 A;  3LWH A;  3QXE B;  2O4X A;  5CIU A;  4IKF A;  2MWP A;  3NTI A;  2F69 A;  4J5Y A;  4TVR A;  3CCM A;  5LJ5 h;  4FSX A;  4YTL A;  1NE8 A;  3HBL A;  5GAN 4;  2P4T A;  3X20 B;  4AKH A;  2VYT A;  4EMG A;  3J81 E;  4BE0 A;  3MP1 A;  3JB9 D;  1M90 C;  3WVE B;  1RI0 A;  3CCM T;  4BE1 A;  2QFZ A;  3QKJ A;  2D9T A;  4BDY A;  1YJ9 A;  1I4K 1;  2QQB A;  5HY6 A;  3SWN A;  3A8G B;  3MP6 A;  3TCJ A;  4BI8 B;  2HBP A;  3QWL A;  1N9S A;  3FEO A;  4ELY C;  4LDW A;  3CCR A;  4JUV A;  2X35 A;  1YJ9 T;  2PQW A;  5LJ5 f;  3M54 A;  3R6O A;  3JCM e;  3E9F A;  5DLO A;  2DAQ A;  2CS7 A;  3VKH A;  5GAO r;  3JCM X;  4JRQ A;  3CCR T;  2OTL T;  1G3Y A;  4C5E A;  5LJ3 h;  3VUB A;  3CXC A;  1Q86 C;  3VKI A;  3HHT B;  4C92 G;  1D3B B;  3S3O A;  2D0Q B;  2M9U A;  1U1S A;  2KQW A;  2LRQ A;  3TRE A;  1NPP A;  2KAF A;  3RIR A;  1K9M U;  4HCZ A;  1VQK T;  3JB9 F;  2DJZ A;  3MEV A;  4RCC A;  4XTZ A;  1B34 A;  4XTV A;  1W2B S;  3RES A;  4OF1 A;  2XD0 A;  4Z6Y A;  3QUI A;  3GPL A;  4C8Q E;  5GAN 2;  1WJQ A;  3CPW A;  3CCJ A;  2H3J A;  4QVC A;  3QJY A;  1UGP B;  2O01 E;  2XID A;  4PL6 A;  3VUZ A;  2EQU A;  2K3Y A;  2RJD A;  4BD3 A;  3M58 A;  3OYJ A;  3VYG B;  3QBY A;  3DB4 A;  2K5I A;  2JN0 A;  1VQM A;  1V29 B;  2ZPI B;  3M56 A;  3QYG B;  5LJ5 g;  2EJG A;  1XOV A;  1WJS A;  3V8K A;  1BI2 A;  5IT9 E;  2P0K A;  4MZT A;  2GFU A;  5CK9 A;  3X25 B;  2MF2 A;  1VQM T;  1KC8 U;  1KQ1 A;  4Y28 E;  3ZEH A;  1FX7 A;  3G4S A;  2EQK A;  1FKM A;  4E7J A;  4X9D A;  5GMK e;  4NL3 A;  3OYI A;  2F5K A;  2K4Y A;  2JNG A;  2KK4 A;  2ZPF B;  1EIF A;  1Y96 A;  3HFO A;  2QDJ A;  4EMK C;  4F7U E;  3CPW S;  2FHD A;  3G4S T;  4XTU A;  1SSF A;  1BI3 A;  1WQ7 A;  3L2Z A;  3JB9 J;  4BUG A;  4M7A E;  4E7I A;  2FYK A;  2ZPG B;  2DIG A;  5LJ5 d;  4PLI A;  5GAM e;  2G3R A;  3HKS A;  4HKE A;  5J26 A;  1QVG S;  1LNX A;  3PIP A;  3UPU A;  2RJF A;  2EYQ A;  4M7D C;  3RKY A;  1JBM A;  2DXU A;  2QEX A;  4JS4 A;  1QLB A;  2ZPH B;  2QQ9 A;  4BI3 A;  4JX4 A;  2YLC A;  4M78 D;  2QA4 T;  2DD4 B;  3M53 A;  3SDZ A;  1OZ3 A;  3FB9 A;  4BDZ A;  2QEX T;  3VKG A;  1ZHI A;  1QVP A;  3PMT A;  4V2S A;  3M55 A;  3PIO A;  3HL8 A;  3QHS A;  2P0P A;  2L89 A;  4C8Q G;  5GMK j;  3BDU A;  4X34 A;  5GAN 7;  1YCY A;  1Y07 A;  2LT1 A;  2PVD B;  3S3N A;  3X24 B;  1M4Z A;  2CZ1 B;  1PSE A;  2MI6 A;  2RM4 A;  3ASK A;  4IUP A;  3OYH A;  2QTX A;  1VQ6 A;  3JB9 H;  4PJO C;  1BIB A;  5KCH A;  1KHI A;  2B8A A;  2DXB A;  5AYF A;  5GAN e;  4JLI A;  4R55 A;  3LYI A;  3CCL T;  1Q81 U;  3NTH A;  5M9O A;  3SFM A;  1KC8 C;  1UGS B;  5KCO A;  5GAM j;  3JB9 I;  1VQ6 T;  3A8L B;  3QG1 A;  2KR6 A;  1JJ2 A;  1X75 C;  2V8I A;  3PTA A;  1YI2 A;  4HT8 A;  5LL6 S;  1M8V A;  1G3W A;  3OBY A;  4EMH A;  3MEA A;  1WPY A;  3SD4 A;  1KG1 A;  1UGR B;  3PT9 A;  4LD6 A;  2RHI A;  3OYY A;  2AHJ B;  2KMG A;  5KH6 A;  4EMK B;  3PGG A;  4VUB A;  3JCM h;  3JCM d;  5GAO q;  4PKC C;  4BAC A;  4ATO A;  1VQL A;  2EKO A;  2E6Z A;  3JCM b;  4M75 C;  2HNI A;  4JDS A;  2E70 A;  4OGC A;  4NS5 A;  3CEY A;  3C95 A;  1BKB A;  4C0D C;  2RB6 A;  5FU7 C;  3JRZ A;  2ZPB B;  2BIV A;  3E19 A;  2GF7 A;  5DM7 R;  1BYM A;  1U1T A;  4N0A C;  3QPH A;  4M7D D;  3M5A A;  4MZM A;  5DLQ E;  1S72 A;  1UEB A;  5GMK m;  1N6A A;  2PVG B;  4M77 C;  3CC4 A;  4M7D B;  2VGN A;  3VU3 C;  3DL1 A;  4B9W A;  4RMO A;  3OYE A;  5J3B A;  2CZ7 B;  1VQ7 A;  3CBP A;  1M5Q 1;  3RMS A;  2GCX A;  1LOJ A;  4J8O A;  3WVD B;  4UC4 A;  1D3B A;  1VQO A;  1VQ5 A;  3BY7 A;  3X28 B;  2EIF A;  5CCA A;  4M6V A;  3NFC A;  1UGQ B;  1VQ7 T;  1WGS A;  3UDC A;  3FJP A;  5CR2 A;  3E9G A;  5DY9 A;  1Q81 C;  4OGE A;  3L2W A;  4PJO D;  3BFM A;  5FLX E;  2ZGW A;  2I2L A;  2JUF A;  4PJO B;  4EDU A;  4MFE A;  3DB3 A;  3OS5 A;  2EAY A;  4D6W A;  1W2B A;  1XQH A;  2LT4 A;  1H64 1;  4JX6 A;  4M7D F;  2RJE A;  2ZCF B;  3S6W A;  3QYH B;  1Y7X A;  3CCU A;  4C0F A;  3A8M B;  5I2M A;  3VYG A;  4BE2 A;  2M1H A;  2F5T X;  3ER0 A;  4C92 C;  5GMK h;  1M1G A;  2DTI A;  3LW5 E;  4MIM A;  5CKE A;  3OW2 S;  1YJN A;  2HAX A;  4E7K A;  3CCU T;  5GAO m;  2DIQ A;  2YRV A;  4M7A D;  2A3L A;  3C12 A;  2QQR A;  1NPR A;  3OYG A;  4Q5W A;  1YJN T;  2XHC A;  5HKC A;  1VQ9 A;  1I5L A;  3OYL A;  4M75 D;  4CI0 C;  3I55 A;  2GQV A;  4M78 C;  3OYM A;  3HRU A;  4XTY A;  4PJO F;  5GAM h;  2WJ9 A;  4M75 B;  3OA6 A;  2MAM A;  1VQ9 T;  5FRM A;  4C0D B;  5LJ3 f;  4HNT A;  5FU7 B;  4ELJ A;  3I55 T;  2VC8 A;  4RCB A;  4GLK A;  3RKW A;  3GNF B;  4XTX A;  4HNV A;  4KT0 E;  1OYX A;  1YBY A;  1LJO A;  2MMP A;  2RO0 A;  4M77 D;  3FDR A;  2IG0 A;  5EG2 A;  1QP3 A;  2E6N A;  3MET A;  4M77 B;  4O6J A;  4F7U F;  5GAN 8;  3CCE A;  3CCJ T;  4LDX A;  1VQ8 A;  4X9C A;  4JS5 A;  2L8D A;  3QJ6 A;  5GAO p;  2EJ9 A;  4A54 A;  3NTK A;  4RG8 A;  1QVG A;  3CCE T;  3FRN A;  3M4Y A;  2RI3 A;  3ME9 A;  2E64 A;  4O5V A;  1VQ8 T;  4OB3 B;  2DD4 A;  2K2V A;  2L3R A;  1M1K U;  2XDD A;  4M75 F;  5GAN 3;  5GAN 5;  4PLL A;  4XU2 A;  5HK0 A;  2XKO C;  3V8J A;  5GAN h;  2QQ8 A;  1G5V A;  4EPC A;  2CZ0 B;  1G3T A;  5LJ5 e;  3JSC A;  1KD1 C;  2X4W A;  3QSU A;  2RK2 A;  2WSE E;  4L6V 5;  4QQD A;  5CAI A;  2D6F A;  4M77 F;  4A4H A;  3RER A;  1IRE B;  4B9X A;  4C92 D;  2JZ2 A;  4ZN1 A;  1R8O B;  2DTO A;  2L5Q A;  2CZ6 B;  3DLL A;  1JRI A;  3OQ5 A;  4C92 B;  2PUK B;  2EWN A;  5IAY A;  5J39 A;  2DXT A;  5LJ3 g;  5GAN f;  4JRP A;  1K9M C;  4HA8 A;  4OP0 A;  2X4Y A;  1QVF S;  4FU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...