2ZPFB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 18min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpfB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpfB02
3VYHB 2ZZDB 1DJ7B 4FM4B 4ZGDB 2PUKB 3QZ9B 2ZPGB 2WSCE 2DD4B 2DD4A 3X20B 2D0QB 1QP2A 3QXEB 3A8HB 1PSFA 2DXCB 2DXCA 2DD5A 3A8MB 3X25B 2ZZDA 2CZ1B 3LW5E 3QZ5B 2O01E 4Y28E 2PVGB 2CZ6B 2ZPFB 2DPPB 2CYZB 4OB3B 2CZ7B 2DXBA 2ZPIB 2DXBB 2AHJB 1UGSB 2PUOB 3X26B 4OB1B 1UGRB 2QDYB 2WSEE 3HHTB 1IREB 4OB0B 2PU9B 5L8RE 2ZPEB 3X24B 2WSFE 1V29B 4L6V5 2DD5B 3A8GB 4OB2B 4ZGJB 1PSEA 3VYGB 3VYGA 4RKUE 1QP3A 2PVOB 3QYHB 1UGPB 3WVEB 2PVDB 4XK8E 2ZPHB 3QYGB 2CZ0B 1AHJB 4ZGEB 1UGQB 2ZPBB 4KT0E 3WVDB 3A8OB 2ZCFB 3X28B 3A8LB 1JB0E 1GXIE
chains in the Genus database with same CATH superfamily
4HNVA 3SWNA 2HMAA 2EGEA 1KQSP 4HLQA 3TN8B 4RTYA 1QQJA 3G4SQ 1VQOQ 1K73R 1BB9A 3OB9A 1GCQC 4BE0A 3QZ9B 1IHWA 3UA7A 4F7UG 1YI2A 4M78D 2DD4B 2DD4A 1GCPA 2KDSA 2D0QB 3G71Q 1TWBA 2K57A 3EFOB 3A8HB 4Z88A 4XTVA 3UF4A 2GTJA 1G3SA 1TUDA 1R77A 2KRMA 3CCMQ 2X51A 3M0RA 1U1TA 2CCHB 4XTWA 1W2BP 1JXOA 2E70A 1MNEA 1EFNA 2V1QA 1E6HA 1Q82C 3IQLA 3BLQB 4EOMB 4JJNK 4OMLA 2C5XB 1QCOA 3TU4K 2DILA 3PTAA 1VQ5A 1BI0A 2JM8A 2YXYA 3VS7A 1K8AU 2ATCB 3EGXA 5CR2A 3TVTA 2DYBA 4XU3A 1NZ9A 5D6YA 1S72Q 4MZPA 2XDBA 2BZ8A 1IXDA 4X9CA 2FG0A 1VQ5T 2KY9A 2JNGA 2GFUA 2LMJA 1PM3A 1U3OA 2BPMB 1CSKA 2C0IA 2OX7A 4JRQA 1KFZA 4PFOA 3CCLT 2PTKA 5LJ5d 3GP8A 3TEEA 1Q7YU 1V29B 1YJNQ 2DXUA 2FEIA 2QI2A 2XKOC 5GMKe 4E7KA 4R55A 4RG2A 3PO3S 1X75C 2JS2A 4RKUE 2PVOB 4RUGA 1K8AR 1UGPB 1RAGB 3GLXA 5IN1A 5FU6B 2EQUA 3L2UA 1UNHD 1YWPA 2C06A 2E6ZA 4IIMA 1OGUB 3EG3A 1ZUUA 3DDPB 3FEOA 1BCMA 1M30A 2ROTA 4HCKA 3JB9G 4BCGB 3A8OB 1UB4A 2AZVA 4JZ4A 3RBBB 1ZSZB 2K3XA 5HBEB 4YOOA 1SF9A 3O8VA 2OTJQ 3GNGA 1G3NC 4C92F 1WHKA 1TU0B 1H28B 4EOOB 1K9AA 3MCAB 1H1PB 2M02A 4E7IA 2VC8A 4M77C 4DBRA 2CP7A 1H641 4AI6A 4MDXA 5KYWB 2CUBA 5C0MA 1SG5A 4E7JA 1BI1A 2JW4A 5KYYB 4M77E 4PJJA 1TXQA 5GAOl 4C8QE 4NL3A 1WI7A 3QXEB 3EG0A 5KYUA 1Y0MA 1R0CB 3NHNA 2VGMA 2DL5A 2HZYA 4BI3A 3GBQA 2D9TA 3M4YA 2KMGA 3PMIA 2CH4A 5GAMe 2VKNA 2D8JA 2CSQA 2E12A 4J9GA 1AWOA 4ELLA 2KI7A 4YTLA 3MI9B 2JN0A 4M78F 2RPNA 3M56A 3F5XB 8ATCB 3I56A 2A3LA 3E9GA 1VQ9A 1UJYA 3JB9J 4E47A 4BB7A 2ED1A 4JRKA 3FC3A 3QDFA 4C5EA 3HFNA 2EUFA 5HQ0B 3VS1A 1H25B 3RKXA 1OL2B 2JZ2A 1I8FA 2L3SA 3E19A 2DD5B 3E9FA 2PQWA 1P5EB 1Q7YR 4DEYA 2COYA 3JCMb 1TD6A 5GJVB 1YITQ 2EJ9A 1U06A 2QA4A 2O4XA 2K9GA 3EG1A 4DBQA 1MMGA 4BY6B 1ABQA 4J9IA 4FYYB 2SRCA 3ME9A 3CC4T 3OW2P 4BCQD 1B34A 1VQMT 2LX9A 4HT8A 1PNJA 1KQSS 1WYXA 4RTVA 3H0FA 5DY9A 1GXIE 5LJ3h 5I11A 1NYGA 2K4YA 3UA6A 2E4HA 4Y92A 2WSCE 4XTXA 1QCFA 2BS4A 3ER0A 4A4HA 3X20B 2FRYA 4JX5A 2X35A 4C5GA 3OYAA 4EC8B 1EIFA 2VASA 3DDQB 2QDLA 4M78C 3OYFA 4J8OA 3CXCA 1I0CA 2XIDA 2AK5A 1T3SA 4EOKB 4A4FA 2M9UA 4M75C 1VYTA 2ABLA 4J9HA 2BTTA 3QZ5B 4EOLB 2KT8A 5HNBB 3I55A 2DX1A 3M58A 2GGRA 2RN8A 2GFAA 4PLIA 4I3ZB 2WXVB 4GBQA 3TW7A 2MIOA 1VQ6A 3G6EA 3X26B 3GF5A 3M54A 4N4IA 1X6BA 2O9SA 4JDSA 4J7FA 1VQPT 2A08A 1YHQT 1Q82U 2KYMA 2HNIA 2E5QA 3ZL7C 1Y07A 4AMCA 2KNBB 2LQNA 1RAEB 2EGCA 2KR3A 4HNUA 2YRDA 4AFQC 2X3WD 1WDXA 1OIUB 3QSUA 4BI8B 3CBOA 1Y71A 4ORZA 4EIKA 1GBQA 2F5TX 3GPLA 1W4SA 2BE7D 1S72T 4ZN1A 4M7DC 1JSTB 2DMOA 1C6VX 4M7AE 4BY1X 4PK4A 2YDLA 1WX6A 1D0XA 2D1XA 3TSZA 1K76A 2PHGA 2G9XB 1M1FA 1AVZC 1S1NA 3BDUA 2FO0A 2EQIA 4BCMD 1ZSZC 2LT1A 2KEAA 1KC8R 4EOJB 1TSFA 4EMKA 2R7GA 4DA4A 2EBPA 2LX7A 3QYBA 2L3RA 4C92D 3NPFA 1MV3A 2YHTA 2WPAB 2QXFA 3OBYA 2CP2A 1VQMA 1WXTA 4L5GA 4EOSB 2W0ZA 4BDZA 5GAOr 2XDDA 2EKHA 5FLXE 1SHGA 2Y4XA 2XU8A 1E9HB 4E7HA 3S6WA 4ROEA 5IT9E 4E2FB 2F2CA 3MP6A 5GANe 5HK0A 2QA4T 4ZTFA 1AD5A 4N4GA 5CEIB 1Y96A 1JO8A 1GUXB 2HKNA 1VUBA 2A36A 3CC7A 3RDVA 1W6XA 3DB3A 4CRIA 3CCMA 2DETA 3CC7Q 3I5SA 2QDJA 4NC6A 2KVQG 1VQ8Q 3OBWA 5A0GA 1C9BA 2QTXA 3RKWA 1G8XA 2ZPFB 2DPPB 1OYXA 1EZZB 3B57A 1Y96B 4GLKA 1WJSA 1O9KA 3MJXA 4IUUA 3KXTA 1OI1A 2D0NA 4NS5A 5GAOp 3PNWC 2DO3A 2KXCA 3CCRT 1XQHA 3JCMf 1YFNA 3EGUA 4F7UB 1VQ7T 5CO7A 5L8RE 1GBRA 2AT1B 1YJ9T 3CD6T 2I40B 2SEMA 1RACB 4KULA 2YUOA 2L5QA 4OB2B 2I2LA 2WMAB 5C6SA 2DTHA 3QYHB 3LLRA 2XDPA 4F6UB 1G83A 3OYEA 1VIFA 1N9SA 3QDRB 3VS6A 2CGHA 5KE3A 3P8DA 2E5KA 4ZGEB 1WHJA 2RH2A 1Y7XA 4ZTJA 2P0QA 2LRQA 2ZPBB 5BNJB 2IW6B 3JV3A 3EIDB 5FRMA 5CAIA 1YITT 2XK0A 5IHIA 1GFCA 1Q81R 1D0ZA 2B9RA 2CP3A 1UUEA 3VYHB 5HCKA 4RTTA 5CVIA 1UJ0A 3EOCB 2PUKB 1K0XA 4D8DA 3AHUA 3C4SA 1M90R 2W99A 3BG5A 4M78B 4JRPA 1M1KU 1K73C 1QP2A 3OQ5A 1WPYA 3RIRA 1MV0B 1FWZA 3RMSA 3EH2A 3PE0A 4AG2C 4CRLB 3QIIA 2YUQA 4IUPA 1XTDA 1WIEA 4UN0A 1VYUA 3I56Q 4AFZC 1Q81U 5LJ5f 4F04B 5DQVA 5HK3A 2BUDA 3OS5A 4IIOA 1H27B 2LZ6B 3FDRA 2RI2A 2HKQB 4TVRA 4RCBA 2WIPB 1M90U 2OTLQ 1PWTA 4BD3A 1QMZB 4OB1B 3CD6A 4HVUA 2HQXA 2JXBA 4C92G 4XU2A 1KJWA 3E1SA 2QFZA 2RD1A 1WHMA 3M53A 4XAXB 5HBHB 2G77A 1WHHA 3D7SB 3FJ5A 4B6MA 4BUGA 1LOJA 2EW3A 3J81E 4M7DB 2DM1A 5CK9A 1VQPQ 1X01A 3VYGB 2P4RA 3V7SA 3POMA 1M2OA 2LNHB 4FW2A 1KXUA 1M4ZA 4C92B 2X1NB 2HDAA 5KYXB 5GMKh 4KRDB 2O31A 3CCST 3Q1JA 1H3ZA 2QAZA 1X6GA 2EJGA 1VQNA 3P8BB 3S3MA 3BDLA 1YI2T 4MZTA 1D09B 1SSHA 2R5AA 5IAYA 3MIAB 4M75F 2P0KA 3C95A 2EYWA 2QK0A 3JCMd 1VQLT 2RHIA 2EVRA 2K3BA 1HD3A 4E6RA 1UHCA 2AKKA 1E7PA 1YBYA 1ZA2B 3A98A 2CP0A 1YHQA 3JCMh 3CC2T 5KYXA 1O9KB 3ULRB 4EMHA 4FM4B 1W98B 4C8QC 1N8RC 3OYBA 1YJ9Q 4QVZA 2E41A 2BZXA 1RAFB 3LGLA 1R8OB 4HVVA 2RJDA 2VUBA 4M7AG 1H1QB 5FU7C 1K9MR 4IUVA 4AKIA 1OOTA 4J9FA 4AFSC 3INZA 4ZN3A 1M8VA 3A8MB 2QGFB 1WHLA 4OMMA 3H4CA 2C5OB 3CCUA 5KE2A 1QVGS 4J6XA 1BKBA 4E7SA 4OR5B 4Y28E 1HK9A 2PVGB 5CIUA 4BCND 5FROA 1VIEA 4GY5A 4RMOA 4M7DE 3TNIB 1B34B 5KYNA 4O6JA 5D6XA 3VS0A 1I81A 1D0YA 1QVFP 2LTOA 2QTVA 3MHXA 5GAMj 2PUOB 5HY6A 2V22B 1AZEA 5D7UA 1RADB 3SB2A 2CP5A 1AISB 1JOWA 2HBWA 2NUPB 3EG9B 2DFUA 4BXXX 5GAOm 1ZSGA 4WCIA 3CBMA 1YCYA 3OYIA 2F5KA 2PK2A 2XD0A 5FWCA 1RAHB 4FT4A 1M3BA 3PVLA 2WSFE 2COZA 3A5ZB 5J26A 2J6FA 1NBEB 1Q95G 4HL4A 1VQ6T 3A8GB 3H6ZA 2WHBB 1B7TA 4JZ3A 4FU6A 5LJ3d 3M0SA 1URCB 2YWWA 4K11A 1U8RA 1VQ7Q 3GIBA 4XK8E 5I2SA 2YRCA 3CCEQ 3QJ6A 3EHRA 3LWHA 2OTLT 2W2HA 3VS5A 1YJWQ 1AEYA 1I1JA 2FPDA 4II5B 5GMKl 4ELYC 4BCNB 2BKDN 2ZCFB 5GANg 1FXXA 1X2KA 4M4ZA 4EPCA 1GL5A 2K79A 4LUEA 2XMFA 3BE3A 4AFUC 2LCSA 5KCOA 2KK4A 4B9WA 2IW9B 5LJ3j 3VRYA 3QWYA 2D8HA 1K9MC 2CH4W 2RO0A 1RAAB 1X2QA 2DNUA 1A0NB 1N5ZA 1N9RA 2JMCA 4OP0A 4EOQB 1QVGA 2B8AA 4N4HA 1OULA 3TW6A 1VQKA 4YOZA 2DXCA 1UE9A 1SRLA 3CCSQ 5A0DA 2OAUA 1WLPB 2O88A 5LJ5j 1QWFA 2M16A 1KQ2A 3PFSA 3M0PA 2VYTA 3G7ZA 2ESWA 5AT1B 1FVVB 1WHGA 1V76A 3HB9A 1VQLQ 3CCQT 2LCCA 7AT1B 2J6OA 2E65A 4C0FA 1VQ8A 2ZPIB 5IDNB 1T0JA 2JM9A 3HSBA 3G4SA 4OGRB 1Q86U 3HZJA 5L2WB 2Y4YA 1H24B 1KHIA 3L1AA 5I22A 3HRTA 2EQKA 1OPKA 2C0TA 2P4TA 2F2XA 4A4EA 5GAMg 4MDWA 4M7DD 1VYWB 4NOYA 1RUWA 2FB7A 4L6V5 2J06A 5LQFB 4PFPA 4C92C 4M7AD 1WXBA 2ECZA 3JCMJ 2Z0WA 4FSSA 1QP3A 1WJRA 4C8QG 5CCAA 4OMNA 1M3AA 4M77G 4OVAA 4M77F 3GTMS 3RMQA 3VV0A 1ZUYA 4WF2A 2FPFA 4A4KA 3ASKA 4FYVB 1I4K1 2VVKA 2HQHA 1K8AC 2DJZA 4ELZC 3LH0A 3U23A 3I35A 1M2VB 4XU1A 3V8KA 3SEMA 2DLPA 4GLMA 2J7IA 5IDPB 1UFFA 5FW9A 3CCQA 1WGSA 1XO2A 2K2MA 2L3QA 1OKVB 5J3BA 2RHYA 4AG1C 1JJ2P 3K7AM 4KRTA 2DL4A 1JJ2A 3J80E 1VQNQ 3HL8A 1VQKT 4XTYA 1SSFA 2ED0A 5KYYA 3JCMP 2QEXA 3RESA 3VU3C 2HSPA 2P84A 2YUPA 1J3TA 4FX3B 3OYDA 4JS5A 1OZ3A 2KAFA 1M1KR 3X25B 1VQ4T 4M7AB 3CXCP 2HBPA 4QQDA 2FPEA 4X9DA 1WQWA 2JGZB 4J9BA 4FCYA 2KE9A 2CSIA 4B9XA 2PZ1A 3VJPA 4G6LB 3DKMA 2EQJA 4PJMA 4M75G 1OZ2A 4QQ6A 3CCVA 4CFNB 5GAN2 1QLYA 2A37A 2EKOA 1BBZA 3MP1A 3DTOA 2WSEE 1I07A 3OS0A 4PJOD 1X69A 1MMNA 2PU9B 3MEUA 3BLHB 2UZBB 1D3BB 5CKFA 5M9OA 2QYZA 3NFCA 5CQXA 5HVYB 2QA4Q 1H1RB 3LQ5B 2HCKA 3V7CA 3OYMA 4QVCA 2H3EB 2RHUA 3WVEB 1VINA 3NMZC 3CCQQ 1MMAA 1PD1A 4KUDK 4C0ZA 2JT4A 1AHJB 1IZ6A 4F7UE 1G5VA 1PKTA 3G4ST 4FSXA 3G6ET 2DEUA 3PIOA 2UZLB 4KT0E 1UNLD 1VQ8T 4EORB 4LDVA 3A1PA 5GAN5 3GNFB 3RR6A 2DRKA 5I5ZB 3CEYA 1OU9A 1YWOA 1QVGP 3A8LB 1YP5A 3FIFA 5D6WA 3OYCA 2ZAEA 1PD0A 4BACA 3R6OA 2GQIA 4UC4A 3OW2A 1JU5C 4J5YA 1FX7A 2X4JA 5CKDA 2DXTA 5EG2A 5EJCA 2WEVB 3CPWA 1FMKA 1O9SA 2DYIA 2LJ3A 2X4WA 1NPRA 1BU2A 1P92A 1Z9ZA 2DXCB 2PMIB 1WZOA 2FRWA 1M90C 1QMCA 2DEQA 3CD6Q 4C8QD 1FYNA 2BIVA 2LNVA 4M77D 3SWNB 4NSTB 4AKGA 4DOWA 4VUBA 3LW5E 2RMOA 2O01E 2COWA 4OGEA 1VQ5Q 1ZUKA 2L2PA 3H0IA 4RTWA 3KFVA 1BCOA 3EH1A 1O75A 4M78G 1FKMA 4JPBW 4M7DF 2K2VA 2L8DA 4FYWB 2WMBB 3CCLQ 1W1FA 5DLQE 1GH6B 3JCMg 2G3RA 4QKUA 2MYSA 3HFOA 3CPFA 4CFWB 1B07A 4LN2A 2KROA 3G71A 3SFMA 4OB0B 3O5ZA 1QLBA 2RQRA 4CI0C 1WFWA 4V2SA 1F5QB 1ABOA 2O2OA 3JB9D 2QGGA 1M1GA 5L23A 4FT2A 2JVVA 2RJCA 5GAN3 3OY9A 2W9FA 1PSEA 2RI5A 2BE9B 3AT1B 3REAB 4EMKB 3VS3A 3JAME 1QVFS 4DQ2A 1IHVA 4II1A 2E10A 2GQVA 4F17A 3C94A 4LD6A 4Y91A 4QQGA 4MIMA 4M6VA 5DLOA 1U1SA 1SKUB 1JRIA 1N8RU 1YN8A 2CREA 2HL3A 4XU0A 3QYEA 2K3YA 4OMPA 2CDTA 1H3HA 3QKJA 4BE2A 4CFMB 2LCLA 2DAQA 4MFDA 4CFUD 2MMPA 3DB4A 4HT9A 3RUXA 3VUZA 4JX6A 1N4MA 3MY1B 1VA7A 3QPHA 2DKGA 2A0FB 1NM7A 3DLMA 1WA7A 4M75B 1CKBA 3M4GA 4X34A 3J7AF 3O0GD 1SPKA 1ZA1B 1U5SA 1GCQA 3PGGA 5KCHA 4PLLA 3UPUA 1JEGA 1W2BS 4M7AC 1OX8A 1RI9A 4LDXA 4HXJA 4C8QF 3TNHB 4BCMB 1Q86C 3M57A 1UG1A 1M3CA 2R5MA 4CXAB 4F7UA 4EONB 2MK5A 1QVPA 1Y57A 2VV5A 2DVJA 1M2VA 2MWOA 2CYZB 1VQLA 4OB3B 1TTHB 3HPWA 1X43A 1Q82R 5GAMh 3OS2A 3H9NA 3VS2A 4IMYB 2J05A 2Y90A 2NYSA 1FMWA 4IUTA 3HHTB 1OU8A 4CFUB 4HCZA 3EGDA 2X4YA 2AZSA 3KHIA 2QGSA 2LDMA 3ZBDA 2WACA 3X24B 3TSWA 3EFSA 3DLLA 3JCMe 2R57A 2FVUA 1BIBA 3LH5A 3VYGA 1OIYB 3JCMQ 4HCBA 3LX7A 2LVMA 2NUZA 2PVDB 4C8QA 2RM4A 4J9EA 2RA2A 4FW1A 2BKZB 4AT1B 4MMLA 4N0AC 4JUVA 1KHCA 3CBPA 4LDYA 2D6FA 2E6NA 1YIJQ 3QWLA 4J6WA 1T3LA 2DBKA 5LL6S 5FU6C 4XTUA 2NLUA 3VRZA 1H4LD 3TNWB 3SDZA 1PCXA 3G6EQ 2C4GB 4LE9A 4KBMB 3DL1A 3EGDB 3REBB 2M51A 4F7SB 1LJOA 2B86A 1OQKA 3FLGA 2VXFA 2HEQA 4PJOA 3I55Q 2E3IA 2KRNA 4EOPB 3L2ZA 1ZQ1A 4HVWA 2LC4A 4KGVB 1UDLA 3SWNC 2DL8A 2HSEB 1W2BA 4E7LA 1X27A 2RF0A 3HP9A 4M77B 4M7AA 4MZMA 2JS0A 2YUNA 2BS3A 2JTMA 2KMTA 1LNXA 4JJCA 2QG9B 3FB9A 3QUIA 3EAEA 3OMGA 2GNCA 1AZGB 4PNOA 1IRXA 3MY5B 1WXUA 4C0DB 4J9DA 2ZGWA 3SHWA 1YJWT 5J39A 1W70A 1TUGB 3CCVQ 3CCLA 2HQEA 4MMKA 4O5VA 1LVKA 3UWNA 1RLQC 3C12A 2H8HA 5KYWA 4OMOA 1WJQA 4ZNXA 4CC4B 3CCJQ 2C0OA 2LJ1A 1HYOA 2YLCA 3QHRB 2DA9A 3EHQA 4DBFA 1TG0A 2JJ9A 2X3XD 2EYQA 2DF6A 2LJ0A 2WFYB 3P8HA 3E2UA 2KT1A 2IIMA 2HAXA 2OTJA 3M0UA 2H3JA 1YCSB 3EG9A 4J83A 2JTFA 1AWJA 2BS2A 2YLBA 1VQPA 1IO6A 5LJ3f 1VYVA 2DJQA 2CS7A 1G2BA 2QASA 1WQ7A 1NJIU 4KUIA 1CKAA 2IN3A 5LJ3e 1JJ2S 1RL2A 2EYYA 4J9CA 2LP5A 2RNAA 4NL2A 3TCJA 2V8JA 4FIBA 2EGAA 5ECAA 1PRLC 1VQ9Q 1PKSA 3R6NA 1JBMA 3JCMW 3PT9A 2OTLA 2ZPGB 3QHWB 3CC7T 2RHXA 4BI4A 5CKHA 1NJIC 2CUDA 1Q81C 2VXEA 2RHZA 2DRMA 5LJ5e 2YRVA 3HRSA 2HD0A 1N8RR 3MEAA 3NDQA 4KGZB 1GUXA 2ROLA 4LUDA 2QF7A 1NJIR 3BHUB 3M55A 3CCUQ 2L89A 2DD5A 2O9VA 3CPWS 2EFIA 3OA6A 5GANj 1JQQA 1ARKA 1UTIA 2ZZDA 5A2QE 3LWIA 3VKGA 3CMET 1UECA 5CKEA 4DOVA 1LPLA 2KR6A 3CCRQ 2O4XB 2I0NA 4IURA 2CZ7B 5KYUB 5I21A 4KRCB 1ZBJA 5GAN4 1VOMA 1ZHIA 2P0PA 3PVQA 3UATA 2GCXA 2DIQA 3V8JA 4C5HA 1ZP2A 1V1CA 3DOGB 4F6WB 1OPLA 3QO3A 2K5FA 3I55T 3G71T 2WIHB 3OYNA 4EC9B 3M5AA 5GANd 3MPUB 5LJ5h 1NG2A 3OYHA 2MWPA 4A54A 4C5IA 2DZ9A 1PRMC 2MAMA 3OSVA 3CCSA 2DTIA 4DEXA 2I53A 3HO8A 3VS4A 2AKLA 1K1ZA 4N0AA 2AIRB 8AT1B 2G6FX 4LOCA 4QVDA 2V26A 3QBYA 4HNTA 2VGNA 4BBRM 1Z9QA 1IGUA 2LQWA 1G3YA 3LGFA 4OMFB 4M78E 4EDUA 2W10A 2V1RA 2WJ9A 3L42A 5EC7A 4A4GA 3VKHA 2MF2A 1QCNA 1ZSZA 2MPXC 2JTEA 3RGFB 3JB9I 3CCJT 2RB6A 5FU7B 1KC8C 1JB0E 2ZZDB 1OV3A 1RI0A 1KD1R 3F70A 5GAOq 1YIJT 2KRSA 2F1LA 4JX4A 4M78A 5LJ3g 3CCJA 2FZCB 2ENMA 4LDUA 1AD6A 3FJPA 2FHDA 2F2VA 5KH6A 2RI3A 2QQSA 2NWMA 3CXCS 2DBMA 3QG1A 3JRZA 2JOYA 2X4XA 4FL6A 5AYFA 1PC0A 1RAIB 2NUPA 2XHCA 3META 1KQ1A 1KIKA 2CZ1B 4ESRA 4PJNA 3OS1A 2EYXA 4C0DC 3HBLA 3RKYA 2KSSA 2PJQA 2V8KA 4R56A 4PJOF 2OTJT 2DXBA 2EAYA 3CC4A 2DXBB 2PK9B 3EFOA 1VQ9T 1TUCA 3EGXB 4ANJA 1VQOA 2F2WA 2CT4A 3I56T 2LW4A 3N5BB 1I5LA 3QHSA 3NTIA 2VWFA 3BFMA 3BG9A 2GBQA 3CMAT 2YT6A 5IF1B 1NEBA 1YI2Q 3EG2A 4Z02A 2DVEA 3CCUT 4C92E 1T0HA 3RNJA 3CCVT 4JJBA 4PL6A 3CCEA 2FL7A 1QW1A 4JJDA 4YOSA 2JMAA 2RQWA 3V8LA 4DBHA 1AWXA 3OSSC 4PFZA 9ATCB 3JSCA 4JLGA 4EMGA 4IKFA 2KQWA 2DTOA 5GAOn 1ZX6A 3CMEA 1K9MU 5GANf 1UGQB 5IH2A 2F69A 1C1AA 4F14A 3BG3A 4J7IA 1TH7A 4M75E 2CT3A 3I9QA 3OYGA 1I5OB 4AKHA 3L2RA 2QQ8A 2IVXA 3TREA 1DJ7B 3M03A 1YJWA 1UNGD 1B3QA 1D1CA 1KQSA 2L0AA 2L3PA 4M7DA 1NYFA 1XJWB 5HKCA 2QQAA 4PJOB 3DJBA 1N6AA 2FZKB 4WTOB 3VKIA 1VOLA 3CC2Q 1D1BA 2C5VB 3MP8A 3L2WA 3OYLA 2XICA 3JB9H 4PKCC 4M7AF 2IW8B 1OX9A 1AOJA 1MMDA 2RJEA 4OMQA 2NUTA 5FRNA 3HRUA 3CC4Q 5CQYA 2QEXT 1SRMA 2FYKA 2EQMA 1QWEA 4CC2A 4F7JB 3PIPA 3CCRA 1H26B 4EOIB 5GMKm 4ROCA 1F1BB 5GAMd 4BDYA 4CFXB 4RG8A 5IHNA 3OMCA 1VQ6Q 1UGRB 4QT7A 1EX4A 1E6GA 2C6TB 3ZFJA 4D8KA 3M0QA 3G1JA 1GFDA 4M75A 5GMKi 1ENWA 1HXDA 3HTRA 4CFVB 2C5NB 1ACMB 2RQUA 3CCET 2OAWA 4BCKB 3SD4A 2DL3A 4X1VA 1YJ9A 5DQWA 1IB8A 4FYXB 2A28A 5GAN8 4F7LB 3CMAA 4ZGJB 1VQ7A 1K73U 2DERA 2UUEB 1G3TA 4A63B 4QSHA 3UDCA 3JB9F 2QQRA 5I2MA 3MEVA 2ZPHB 1H92A 1KK7A 5GAN6 1GRIA 1VQOT 5ICPB 1PHTA 4KGXB 4JS4A 4E7ZA 5GAMf 5CYIB 1YHQQ 4PJLA 2E64A 5IXFA 4Z89A 1KC8U 2M0YA 2GTOA 1MGQA 1YITA 1R0BG 1RLPC 4OGCA 4KH0B 3V7RA 2K7AA 2E3HA 5LMKB 3L2QA 3KUFA 3CCMT 1HJDA 5A0LA 3CMAQ 4OF1A 1BYMA 1KG1A 4ZGDB 2DZCA 3JCMX 1FINB 5IHYA 1BIAA 2K6DA 1OKWB 5FGKB 4Y72B 1Q86R 1NEGA 1KD1C 4KH1B 2DMEA 1PSFA 3CPWP 3C0CA 4C8QB 1S72A 3OYYA 3VUBA 3MEWA 1FMVA 2LT4A 2XI9A 4PJOE 2RJFA 3BHTB 3KBGA 3NTHA 4HKEA 4J6YA 4LXCA 1QVFA 5HBJB 2OI3A 2NUTB 1OL1B 2W96A 1JSUB 2CZ6B 1UHFA 2MOXA 3M9QA 2R58A 2EPDA 1NPPA 1KD1U 4CC7A 2UZDB 3FRNA 4Z6YA 2DE0X 3BHVB 2UZEB 3QWXX 1UGVA 5IXBA 4HA8A 5GANh 2QDYB 3THKA 1JKWA 4BBSM 1IGQA 3NTKA 1LCKA 4JLIA 3ZEHA 3H41A 1IREB 4F7NB 1WNLA 1TS9A 4BE1A 4TTHA 3PMTA 4F7UF 2XG8D 3BY7A 3BW1A 2A7YA 4XQ3A 2KBTA 2ZPEB 5ACBA 2M1HA 2X9HA 3EFRA 2E1HA 3T9NA 1K0SA 1RABB 1MUZA 1G3WA 3EJ1B 1JXMA 1N27A 2CP6A 1M27C 2QEXQ 1M5Q1 3QJYA 5GMKj 3OYJA 4C0GA 3JCMc 3WXMB 4LDWA 5CKBA 6AT1B 2CZ0B 4BCPB 3H8ZA 4JRIA 4F16A 3UT1A 3LYIA 1ZBXA 4RCCA 2LQ8A 4BCHB 2JUFA 2GF7A 2LQKA 3NGPA 3RERA 1TFBA 1PG5B 2J6KA 4M7DG 1MHNA 2KYBA 3MKDA 4CC3A 4C92A 3M59A 5IHKA 4BCOB 3X28B 3OW2S 2KGTA 2KXDA 1SEMA 1YIJA 5GJWB 2IPOB 1AWWA 1VQ4Q 4RTUA 1OI9B 4PJOC 4M75D 3MO8A 1BI3A 1YJNA 1NLPC 1H1SB 4HCCA 4R0KA 4BY7X 1BU1A 1MNDA 5GAN7 3S3OA 2RQTA 4P5NA 4RTXA 1K4US 2RQVA 2K5IA 3H0HA 1KSWA 5DM7R 2CJMB 1YJNT 1ZLMA 2EIFA 4M77A 4PJOG 4RTZA 2RK2A 2YSQA 3TQ7P 4RODA 1VQNT 4MFEA 1VQKQ 1NE8A 1M1KC 4ATOA 3BLRB 3JCMV 2CCIB 5EFQB 1D3BA 1QKWA 1UEBA 2EJFA 3OYKA 1D1AA 4ME7A 1OEBA 2AHJB 1UGSB 3G33B 2EYZA 4Z8AA 5LJ5g 2BZYA 2K5LA 2MI6A 2DIGA 1BI2A 3HKSA 4BCFB 3CC2A 3L2VA 1HSQA 2HL5C 1PKDB 2DL7A 1QKXA 2FZGB 4Q5WA 2MCNA 1TOVA 4EMKC 4QW2A 4YC3B 2CKKA 2QQ9A 2DK3A 4XTZA 2RK1A 1M8MA 3CQTA 1NLOC 1SHFA 4BCJB 4LD9K 1BK2A 1XOVA 3I5RA 3M0TA 4L59A 2IG0A 1D3UB 4ELJA 1E7OA 2QQBA 1VQMQ 3URGA 1GY3B 3S3NA 3QYGB 4D6WA 1Q7YC 2EWNA 2M0OA 1AT1B 1XNIA 2W9ZA 1C0MA 4IUQA 1VQ4A 3CMEQ 4F6SB 4F70B 4A53A 1X6OA 2V8IA 5FWBA 3WVDB 2PNIA 4LNPA 4BY6C 2VB6A 1M9SA 1YNZA 4BCQB 2IVWA 2OJ2A 3GOXA 1H8KA 4BCIB
chains in the Genus database with same CATH topology
4HNVA 3VYHB 3SWNA 2ZZDB 4HLQA 1RI0A 4BACA 3R6OA 5CVIA 3OB9A 4UC4A 3F70A 2PUKB 3OW2A 5GAOq 4BE0A 3QZ9B 1YIJT 4F7UG 1YI2A 3AHUA 4M78D 4JX4A 3C4SA 4J5YA 2DD4B 3BG5A 4M78A 5LJ3g 2DD4A 1FX7A 4M78B 2X4JA 5CKDA 2DXTA 4LDUA 5EG2A 3CCJA 5EJCA 4JRPA 1M1KU 2KDSA 2D0QB 2FHDA 3FJPA 3CPWA 5KH6A 1O9SA 2RI3A 1QP2A 1K73C 2K57A 2QQSA 2X4WA 1NPRA 1P92A 3OQ5A 1WPYA 3RIRA 3QG1A 3A8HB 3CXCS 2DXCB 3JRZA 1FWZA 2JOYA 2X4XA 4FL6A 4XTVA 5AYFA 3RMSA 1M90C 1G3SA 3QIIA 2DEQA 4IUPA 1XTDA 2XHCA 3META 4C8QD 1U1TA 2BIVA 4XTWA 2LNVA 4M77D 3SWNB 1KQ1A 4AKGA 4DOWA 4VUBA 2CZ1B 3LW5E 2E70A 2O01E 1Q81U 5LJ5f 1Q82C 3OS1A 4OGEA 4C0DC 5HK3A 3HBLA 2BUDA 3RKYA 4JJNK 2KSSA 3OS5A 2V8KA 4R56A 3TU4K 4PJOF 3PTAA 3FDRA 1O75A 4M78G 1VQ5A 1FKMA 1BI0A 2DXBA 2EAYA 2DXBB 2RI2A 4RCBA 4TVRA 3CC4A 2K2VA 2L8DA 4M7DF 1M90U 1K8AU 4BD3A 1VQ9T 5DLQE 4OB1B 3CD6A 3JCMg 2G3RA 2HQXA 5CR2A 1VQOA 4C92G 3HFOA 3CPFA 3I56T 4XU3A 1NZ9A 5D6YA 4XU2A 4MZPA 2XDBA 3E1SA 2QFZA 3G71A 4X9CA 1VQ5T 2RD1A 3SFMA 2KY9A 2JNGA 4OB0B 2GFUA 1QLBA 3M53A 4XAXB 3N5BB 1I5LA 2G77A 3QHSA 4CI0C 3NTIA 4V2SA 3BFMA 4JRQA 3BG9A 3JB9D 3CMAT 3CCLT 4BUGA 1LOJA 5LJ5d 1M1GA 3TEEA 3J81E 4FT2A 1V29B 3GP8A 2JVVA 4Z02A 2DVEA 3CCUT 2RJCA 5GAN3 4M7DB 2DXUA 2XKOC 2QI2A 4C92E 5GMKe 3OY9A 4E7KA 5CK9A 3CCVT 4PL6A 4R55A 1PSEA 4RG2A 1X01A 3VYGB 1QW1A 1X75C 2FL7A 2RI5A 3V7SA 3CCEA 4EMKB 3V8LA 4RKUE 3OYCA 1M4ZA 2PVOB 3OSSC 4C92B 3JAME 2OTJT 3JSCA 1UGPB 3GLXA 4DQ2A 1QVFS 5IN1A 5FU6B 4JLGA 4EMGA 2EQUA 4II1A 5GMKh 3L2UA 2KQWA 2C06A 4IKFA 2E10A 2E6ZA 2GQVA 3Q1JA 3C94A 4LD6A 3CCST 1H3ZA 2DTOA 5GAOn 4Y91A 4QQGA 1VQNA 2EJGA 3CMEA 4MIMA 4M6VA 3P8BB 3S3MA 5DLOA 3BDLA 1YI2T 1U1SA 1JRIA 4MZTA 5GANf 1K9MU 1UGQB 2R5AA 4M75F 5IAYA 2F69A 1N8RU 3FEOA 2P0KA 4XU0A 3QYEA 2K3YA 3C95A 3BG3A 4J7IA 3JCMd 3JB9G 1TH7A 1VQLT 2RHIA 3A8OB 3QKJA 4M75E 1UB4A 4BE2A 2LCLA 3OYGA 2DAQA 2K3XA 3O8VA 4MFDA 2MMPA 3DB4A 4HT9A 3GNGA 1E7PA 3RUXA 1YBYA 4C92F 1YHQA 3VUZA 4JX6A 4AKHA 3JCMh 3L2RA 3CC2T 2QQ8A 3TREA 1DJ7B 3MCAB 4EMHA 4FM4B 4C8QC 1YJWA 3QPHA 4KUDK 3OA6A 4E7IA 3OYBA 1N8RC 2DKGA 1KQSA 2VC8A 4M77C 1H641 4AI6A 4MDXA 3DLMA 4QVZA 5C0MA 4M7DA 2E41A 4M75B 3M4GA 4X34A 4E7JA 1BI1A 5HKCA 3J7AF 3LGLA 1R8OB 2QQAA 2RJDA 2VUBA 4M7AG 4PJOB 3PGGA 4M77E 5KCHA 4PLLA 3UPUA 5FU7C 1N6AA 4IUVA 5GAOl 1W2BS 4C8QE 3VKIA 4NL3A 4M7AC 3QXEB 4AKIA 4LDXA 3MP8A 3L2WA 3INZA 4ZN3A 3OYLA 3A8MB 2XICA 4C8QF 3JB9H 1M8VA 2VGMA 4PKCC 3H4CA 4BI3A 1Q86C 4M7AF 2D9TA 3M57A 3CCUA 5KE2A 1QVGS 2RJEA 3M4YA 2R5MA 4J6XA 2KMGA 3PMIA 1BKBA 5GAMe 5FRNA 3HRUA 4F7UA 4Y28E 1QVPA 1HK9A 2PVGB 5CIUA 2VV5A 5CQYA 2E12A 2QEXT 2FYKA 5FROA 1VIEA 4GY5A 4RMOA 2EQMA 4M7DE 2MWOA 1B34B 4YTLA 2CYZB 2JN0A 4M78F 4O6JA 5D6XA 4OB3B 3HPWA 3PIPA 3M56A 3CCRA 1VQLA 1I81A 5GMKm 2LTOA 3MHXA 5GAMj 2PUOB 5HY6A 3I56A 2A3LA 5GAMh 5GAMd 3OS2A 4BDYA 4RG8A 3SB2A 3OMCA 3E9GA 1VQ9A 1UGRB 2Y90A 3JB9J 4E47A 4IUTA 3ZFJA 4BB7A 5GAOm 4JRKA 3HHTB 3FC3A 4M75A 5GMKi 4C5EA 1HXDA 4HCZA 3HFNA 3CBMA 1YCYA 2X4YA 3OYIA 3KHIA 2F5KA 2XD0A 2LDMA 3ZBDA 4FT4A 3CCET 2WACA 3RKXA 4C8QA 2JZ2A 1Q7YU 3SD4A 3X24B 2WSFE 1I8FA 3A5ZB 5J26A 1YJ9A 3EFSA 3DLLA 3JCMe 2R57A 4HL4A 3E19A 2DD5B 2FVUA 3E9FA 1BIBA 2PQWA 5GAN8 3CMAA 3A8GB 4ZGJB 3VYGA 3H6ZA 3JCMQ 1VQ7A 1K73U 3JCMb 4FU6A 5LJ3d 4HCBA 3LX7A 2LVMA 1G5VA 1G3TA 4QSHA 2PVDB 3UDCA 2EJ9A 2QQRA 2RM4A 2O4XA 5I2MA 4XK8E 2RA2A 3MEVA 2ZPHB 5I2SA 2QA4A 3GIBA 3QJ6A 5GAN6 4MMLA 4BY6B 1VQOT 3LWHA 4N0AC 4JUVA 2OTLT 1KHCA 3CBPA 4LDYA 2D6FA 2E6NA 4JS4A 3QWLA 5GAMf 3ME9A 4J6WA 3CC4T 5GMKl 4ELYC 5LL6S 1B34A 2BKDN 1VQMT 5FU6C 2ZCFB 2E64A 4XTUA 2LX9A 1FXXA 2NLUA 5GANg 1KC8U 1KQSS 4HT8A 4EPCA 1MGQA 1YITA 4OGCA 5DY9A 3SDZA 3V7RA 5KCOA 1GXIE 2KK4A 4B9WA 3L2QA 5LJ3h 3KUFA 5LJ3j 3CCMT 5A0LA 4OF1A 1BYMA 1K9MC 1KG1A 4ZGDB 2DZCA 4KBMB 2RO0A 3JCMX 1N9RA 2K4YA 1BIAA 4OP0A 3DL1A 2WSCE 1QVGA 4XTXA 2B8AA 4N4HA 2BS4A 3ER0A 1LJOA 3X20B 2VXFA 3FLGA 3TW6A 4JX5A 4A4HA 1KD1C 4PJOA 2X35A 4C5GA 3OYAA 3L2ZA 1ZQ1A 1EIFA 2LC4A 1PSFA 3SWNC 1VQKA 4M78C 3OYFA 4J8OA 2DXCA 3CXCA 2XIDA 5A0DA 1W2BA 4C8QB 1S72A 4E7LA 3OYYA 2OAUA 3MEWA 3VUBA 5LJ5j 3HP9A 4M77B 2LT4A 2XI9A 4PJOE 2RJFA 2M16A 3KBGA 3NTHA 4HKEA 2M9UA 4J6YA 4M75C 4MZMA 3PFSA 4A4FA 1KQ2A 1QVFA 2VYTA 3G7ZA 2BS3A 3QZ5B 2JTMA 2KMTA 1LNXA 3HB9A 3FB9A 3EAEA 2CZ6B 3M58A 3QUIA 3M9QA 3I55A 2R58A 3OMGA 1NPPA 2GFAA 2LCCA 4PLIA 1KD1U 3FRNA 2E65A 4C0FA 1VQ8A 4Z6YA 4PNOA 2ZPIB 4C0DB 2ZGWA 3TW7A 1YJWT 3HSBA 5J39A 4HA8A 3G6EA 1VQ6A 3X26B 3GF5A 3M54A 4N4IA 4JDSA 4J7FA 3G4SA 1Q86U 3HZJA 1VQPT 5GANh 2Y4YA 3CCLA 2HQEA 4MMKA 4O5VA 1YHQT 1KHIA 3L1AA 2QDYB 3UWNA 1Q82U 3C12A 4BBSM 3HRTA 2HNIA 3NTKA 4JLIA 2E5QA 3ZEHA 1IREB 2EQKA 1WNLA 1WJQA 1Y07A 4BE1A 2P4TA 2YLCA 3PMTA 4F7UF 2XG8D 3BY7A 4HNUA 3BW1A 4A4EA 5GAMg 2A7YA 4MDWA 4M7DD 4XQ3A 4NOYA 2ZPEB 2M1HA 3QSUA 2EYQA 2E1HA 2FB7A 3EFRA 3T9NA 4BI8B 4L6V5 3CBOA 4C92C 1Y71A 4M7AD 3P8HA 2F5TX 3JCMJ 3GPLA 1W4SA 2HAXA 1S72T 1G3WA 4ZN1A 1N27A 1QP3A 1WJRA 4C8QG 5CCAA 4M7DC 2OTJA 4M77G 4OVAA 4M77F 3RMQA 2H3JA 3VV0A 4M7AE 1M5Q1 3QJYA 4J83A 5GMKj 2JTFA 3OYJA 4WF2A 4C0GA 3JCMc 3WXMB 3ASKA 4LDWA 5CKBA 4A4KA 2BS2A 2CZ0B 2YLBA 3H8ZA 4JRIA 1VQPA 3UT1A 3LYIA 5LJ3f 1I4K1 1M1FA 1ZBXA 4RCCA 2LQ8A 3BDUA 3CCQT 1K8AC 2CS7A 2DJZA 2JUFA 2LT1A 2GF7A 2LQKA 4ELZC 3LH0A 1WQ7A 3RERA 1NJIU 4KUIA 4EMKA 5LJ3e 1MHNA 4M7DG 4XU1A 3V8KA 4DA4A 4C92A 3M59A 3QYBA 1JJ2S 2L3RA 3X28B 4C92D 3CCQA 1RL2A 3OW2S 2YHTA 1WGSA 4NL2A 3TCJA 2QXFA 3OBYA 2V8JA 4FIBA 1VQMA 5J3BA 2RHYA 4L5GA 1U8RA 1YIJA 4BDZA 5GAOr 1JBMA 3JCMW 3PT9A 2XDDA 4M7AA 4PJOC 4M75D 3MO8A 1BI3A 2ZPGB 1YJNA 5FLXE 2RHXA 1JJ2A 2OTLA 3CC7T 4HCCA 3J80E 4BI4A 3HL8A 5CKHA 2Y4XA 2XU8A 1Q81C 2VXEA 1NJIC 4XTYA 1SSFA 1VQKT 2RHZA 5LJ5e 3S6WA 4E7HA 2YRVA 5GAN7 5IT9E 3MP6A 5GANe 3HRSA 5HK0A 2QA4T 2HD0A 2QEXA 3JCMP 3RESA 3S3OA 4ZTFA 4P5NA 3VU3C 4N4GA 2K5IA 1Y96A 3MEAA 3OYDA 4JS5A 1OZ3A 2KAFA 1VUBA 5DM7R 2QF7A 3CC7A 3M55A 1YJNT 2L89A 2DD5A 3CPWS 3X25B 1VQ4T 2EIFA 2EFIA 3DB3A 4M77A 4PJOG 2HBPA 4QQDA 4M7AB 2RK2A 1WQWA 4X9DA 4CRIA 3CCMA 5A2QE 2ZZDA 3LWIA 2QDJA 3VKGA 3CMET 4MFEA 5CKEA 4DOVA 1VQNT 2KR6A 1NE8A 4B9XA 3VJPA 4NC6A 2KVQG 1M1KC 4ATOA 2O4XB 3DKMA 3OBWA 3JCMV 5A0GA 2QTXA 3RKWA 2EQJA 4IURA 2ZPFB 4M75G 2DPPB 1D3BA 1UEBA 1OYXA 2EJFA 3OYKA 1OZ2A 2CZ7B 4ME7A 4QQ6A 5I21A 2AHJB 1UGSB 5GAN4 5LJ5g 3CCVA 2K5LA 2MI6A 5GAN2 1ZHIA 1Y96B 2P0PA 2DIGA 2EKOA 1BI2A 1VQ6T 4GLKA 1WJSA 2GCXA 3HKSA 2DIQA 4IUUA 3V8JA 4C5HA 3KXTA 1OI1A 3MP1A 3L2VA 3CC2A 4NS5A 5GAOp 3PNWC 2DO3A 2WSEE 3CCRT 4Q5WA 1XQHA 3OS0A 4EMKC 4QW2A 4PJOD 2CKKA 3QO3A 3JCMf 2QQ9A 5GANj 2K5FA 2DK3A 2PU9B 3MEUA 4XTZA 2RK1A 4F7UB 1VQ7T 3I55T 3G71T 3OYNA 3M5AA 5CO7A 5L8RE 5GANd 5LJ5h 1D3BB 5CKFA 3OYHA 4LD9K 2MWPA 1YJ9T 5M9OA 4A54A 3CD6T 4C5IA 1XOVA 2DZ9A 2MAMA 4KULA 2L5QA 3OSVA 4L59A 4OB2B 2I2LA 3NFCA 3CCSA 2IG0A 2DTIA 5CQXA 5C6SA 3HO8A 4ELJA 2DTHA 2QQBA 3JB9F 3QYHB 3V7CA 3LLRA 3OYMA 2XDPA 4QVCA 2RHUA 4N0AA 3WVEB 3URGA 3OYEA 1VIFA 4LOCA 1N9SA 3QDRB 4C0ZA 3QYGB 2CGHA 4QVDA 3P8DA 3QBYA 4D6WA 5KE3A 3S3NA 1AHJB 4HNTA 1IZ6A 2EWNA 4ZGEB 2VGNA 4BBRM 4F7UE 1Q7YC 3G4ST 2M0OA 4FSXA 2RH2A 1XNIA 1Y7XA 3G6ET 4IUQA 4ZTJA 1VQ4A 2P0QA 2LRQA 4A53A 2ZPBB 3PIOA 1G3YA 1X6OA 3LGFA 4OMFB 4M78E 4KT0E 4EDUA 2V8IA 3WVDB 4BY6C 1VQ8T 2WJ9A 4LDVA 5GAN5 3GNFB 3L42A 4A4GA 3CEYA 5FRMA 5CAIA 3VKHA 1M9SA 2MF2A 2IVWA 1YITT 2XK0A 3A8LB 3GOXA 3JB9I 3CCJT 2RB6A 5FU7B 1KC8C 3FIFA 5D6WA 1JB0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYH B;  2ZZD B;  1DJ7 B;  4FM4 B;  4ZGD B;  2PUK B;  3QZ9 B;  2ZPG B;  2WSC E;  2DD4 B;  2DD4 A;  3X20 B;  2D0Q B;  1QP2 A;  3QXE B;  3A8H B;  1PSF A;  2DXC B;  2DXC A;  2DD5 A;  3A8M B;  3X25 B;  2ZZD A;  2CZ1 B;  3LW5 E;  3QZ5 B;  2O01 E;  4Y28 E;  2PVG B;  2CZ6 B;  2ZPF B;  2DPP B;  2CYZ B;  4OB3 B;  2CZ7 B;  2DXB A;  2ZPI B;  2DXB B;  2AHJ B;  1UGS B;  2PUO B;  3X26 B;  4OB1 B;  1UGR B;  2QDY B;  2WSE E;  3HHT B;  1IRE B;  4OB0 B;  2PU9 B;  5L8R E;  2ZPE B;  3X24 B;  2WSF E;  1V29 B;  4L6V 5;  2DD5 B;  3A8G B;  4OB2 B;  4ZGJ B;  1PSE A;  3VYG B;  3VYG A;  4RKU E;  1QP3 A;  2PVO B;  3QYH B;  1UGP B;  3WVE B;  2PVD B;  4XK8 E;  2ZPH B;  3QYG B;  2CZ0 B;  1AHJ B;  4ZGE B;  1UGQ B;  2ZPB B;  4KT0 E;  3WVD B;  3A8O B;  2ZCF B;  3X28 B;  3A8L B;  1JB0 E;  1GXI E; 
#chains in the Genus database with same CATH topology
 4HNV A;  3SWN A;  2HMA A;  2EGE A;  1KQS P;  4HLQ A;  3TN8 B;  4RTY A;  1QQJ A;  3G4S Q;  1VQO Q;  1K73 R;  1BB9 A;  3OB9 A;  1GCQ C;  4BE0 A;  3QZ9 B;  1IHW A;  3UA7 A;  4F7U G;  1YI2 A;  4M78 D;  2DD4 B;  2DD4 A;  1GCP A;  2KDS A;  2D0Q B;  3G71 Q;  1TWB A;  2K57 A;  3EFO B;  3A8H B;  4Z88 A;  4XTV A;  3UF4 A;  2GTJ A;  1G3S A;  1TUD A;  1R77 A;  2KRM A;  3CCM Q;  2X51 A;  3M0R A;  1U1T A;  2CCH B;  4XTW A;  1W2B P;  1JXO A;  2E70 A;  1MNE A;  1EFN A;  2V1Q A;  1E6H A;  1Q82 C;  3IQL A;  3BLQ B;  4EOM B;  4JJN K;  4OML A;  2C5X B;  1QCO A;  3TU4 K;  2DIL A;  3PTA A;  1VQ5 A;  1BI0 A;  2JM8 A;  2YXY A;  3VS7 A;  1K8A U;  2ATC B;  3EGX A;  5CR2 A;  3TVT A;  2DYB A;  4XU3 A;  1NZ9 A;  5D6Y A;  1S72 Q;  4MZP A;  2XDB A;  2BZ8 A;  1IXD A;  4X9C A;  2FG0 A;  1VQ5 T;  2KY9 A;  2JNG A;  2GFU A;  2LMJ A;  1PM3 A;  1U3O A;  2BPM B;  1CSK A;  2C0I A;  2OX7 A;  4JRQ A;  1KFZ A;  4PFO A;  3CCL T;  2PTK A;  5LJ5 d;  3GP8 A;  3TEE A;  1Q7Y U;  1V29 B;  1YJN Q;  2DXU A;  2FEI A;  2QI2 A;  2XKO C;  5GMK e;  4E7K A;  4R55 A;  4RG2 A;  3PO3 S;  1X75 C;  2JS2 A;  4RKU E;  2PVO B;  4RUG A;  1K8A R;  1UGP B;  1RAG B;  3GLX A;  5IN1 A;  5FU6 B;  2EQU A;  3L2U A;  1UNH D;  1YWP A;  2C06 A;  2E6Z A;  4IIM A;  1OGU B;  3EG3 A;  1ZUU A;  3DDP B;  3FEO A;  1BCM A;  1M30 A;  2ROT A;  4HCK A;  3JB9 G;  4BCG B;  3A8O B;  1UB4 A;  2AZV A;  4JZ4 A;  3RBB B;  1ZSZ B;  2K3X A;  5HBE B;  4YOO A;  1SF9 A;  3O8V A;  2OTJ Q;  3GNG A;  1G3N C;  4C92 F;  1WHK A;  1TU0 B;  1H28 B;  4EOO B;  1K9A A;  3MCA B;  1H1P B;  2M02 A;  4E7I A;  2VC8 A;  4M77 C;  4DBR A;  2CP7 A;  1H64 1;  4AI6 A;  4MDX A;  5KYW B;  2CUB A;  5C0M A;  1SG5 A;  4E7J A;  1BI1 A;  2JW4 A;  5KYY B;  4M77 E;  4PJJ A;  1TXQ A;  5GAO l;  4C8Q E;  4NL3 A;  1WI7 A;  3QXE B;  3EG0 A;  5KYU A;  1Y0M A;  1R0C B;  3NHN A;  2VGM A;  2DL5 A;  2HZY A;  4BI3 A;  3GBQ A;  2D9T A;  3M4Y A;  2KMG A;  3PMI A;  2CH4 A;  5GAM e;  2VKN A;  2D8J A;  2CSQ A;  2E12 A;  4J9G A;  1AWO A;  4ELL A;  2KI7 A;  4YTL A;  3MI9 B;  2JN0 A;  4M78 F;  2RPN A;  3M56 A;  3F5X B;  8ATC B;  3I56 A;  2A3L A;  3E9G A;  1VQ9 A;  1UJY A;  3JB9 J;  4E47 A;  4BB7 A;  2ED1 A;  4JRK A;  3FC3 A;  3QDF A;  4C5E A;  3HFN A;  2EUF A;  5HQ0 B;  3VS1 A;  1H25 B;  3RKX A;  1OL2 B;  2JZ2 A;  1I8F A;  2L3S A;  3E19 A;  2DD5 B;  3E9F A;  2PQW A;  1P5E B;  1Q7Y R;  4DEY A;  2COY A;  3JCM b;  1TD6 A;  5GJV B;  1YIT Q;  2EJ9 A;  1U06 A;  2QA4 A;  2O4X A;  2K9G A;  3EG1 A;  4DBQ A;  1MMG A;  4BY6 B;  1ABQ A;  4J9I A;  4FYY B;  2SRC A;  3ME9 A;  3CC4 T;  3OW2 P;  4BCQ D;  1B34 A;  1VQM T;  2LX9 A;  4HT8 A;  1PNJ A;  1KQS S;  1WYX A;  4RTV A;  3H0F A;  5DY9 A;  1GXI E;  5LJ3 h;  5I11 A;  1NYG A;  2K4Y A;  3UA6 A;  2E4H A;  4Y92 A;  2WSC E;  4XTX A;  1QCF A;  2BS4 A;  3ER0 A;  4A4H A;  3X20 B;  2FRY A;  4JX5 A;  2X35 A;  4C5G A;  3OYA A;  4EC8 B;  1EIF A;  2VAS A;  3DDQ B;  2QDL A;  4M78 C;  3OYF A;  4J8O A;  3CXC A;  1I0C A;  2XID A;  2AK5 A;  1T3S A;  4EOK B;  4A4F A;  2M9U A;  4M75 C;  1VYT A;  2ABL A;  4J9H A;  2BTT A;  3QZ5 B;  4EOL B;  2KT8 A;  5HNB B;  3I55 A;  2DX1 A;  3M58 A;  2GGR A;  2RN8 A;  2GFA A;  4PLI A;  4I3Z B;  2WXV B;  4GBQ A;  3TW7 A;  2MIO A;  1VQ6 A;  3G6E A;  3X26 B;  3GF5 A;  3M54 A;  4N4I A;  1X6B A;  2O9S A;  4JDS A;  4J7F A;  1VQP T;  2A08 A;  1YHQ T;  1Q82 U;  2KYM A;  2HNI A;  2E5Q A;  3ZL7 C;  1Y07 A;  4AMC A;  2KNB B;  2LQN A;  1RAE B;  2EGC A;  2KR3 A;  4HNU A;  2YRD A;  4AFQ C;  2X3W D;  1WDX A;  1OIU B;  3QSU A;  4BI8 B;  3CBO A;  1Y71 A;  4ORZ A;  4EIK A;  1GBQ A;  2F5T X;  3GPL A;  1W4S A;  2BE7 D;  1S72 T;  4ZN1 A;  4M7D C;  1JST B;  2DMO A;  1C6V X;  4M7A E;  4BY1 X;  4PK4 A;  2YDL A;  1WX6 A;  1D0X A;  2D1X A;  3TSZ A;  1K76 A;  2PHG A;  2G9X B;  1M1F A;  1AVZ C;  1S1N A;  3BDU A;  2FO0 A;  2EQI A;  4BCM D;  1ZSZ C;  2LT1 A;  2KEA A;  1KC8 R;  4EOJ B;  1TSF A;  4EMK A;  2R7G A;  4DA4 A;  2EBP A;  2LX7 A;  3QYB A;  2L3R A;  4C92 D;  3NPF A;  1MV3 A;  2YHT A;  2WPA B;  2QXF A;  3OBY A;  2CP2 A;  1VQM A;  1WXT A;  4L5G A;  4EOS B;  2W0Z A;  4BDZ A;  5GAO r;  2XDD A;  2EKH A;  5FLX E;  1SHG A;  2Y4X A;  2XU8 A;  1E9H B;  4E7H A;  3S6W A;  4ROE A;  5IT9 E;  4E2F B;  2F2C A;  3MP6 A;  5GAN e;  5HK0 A;  2QA4 T;  4ZTF A;  1AD5 A;  4N4G A;  5CEI B;  1Y96 A;  1JO8 A;  1GUX B;  2HKN A;  1VUB A;  2A36 A;  3CC7 A;  3RDV A;  1W6X A;  3DB3 A;  4CRI A;  3CCM A;  2DET A;  3CC7 Q;  3I5S A;  2QDJ A;  4NC6 A;  2KVQ G;  1VQ8 Q;  3OBW A;  5A0G A;  1C9B A;  2QTX A;  3RKW A;  1G8X A;  2ZPF B;  2DPP B;  1OYX A;  1EZZ B;  3B57 A;  1Y96 B;  4GLK A;  1WJS A;  1O9K A;  3MJX A;  4IUU A;  3KXT A;  1OI1 A;  2D0N A;  4NS5 A;  5GAO p;  3PNW C;  2DO3 A;  2KXC A;  3CCR T;  1XQH A;  3JCM f;  1YFN A;  3EGU A;  4F7U B;  1VQ7 T;  5CO7 A;  5L8R E;  1GBR A;  2AT1 B;  1YJ9 T;  3CD6 T;  2I40 B;  2SEM A;  1RAC B;  4KUL A;  2YUO A;  2L5Q A;  4OB2 B;  2I2L A;  2WMA B;  5C6S A;  2DTH A;  3QYH B;  3LLR A;  2XDP A;  4F6U B;  1G83 A;  3OYE A;  1VIF A;  1N9S A;  3QDR B;  3VS6 A;  2CGH A;  5KE3 A;  3P8D A;  2E5K A;  4ZGE B;  1WHJ A;  2RH2 A;  1Y7X A;  4ZTJ A;  2P0Q A;  2LRQ A;  2ZPB B;  5BNJ B;  2IW6 B;  3JV3 A;  3EID B;  5FRM A;  5CAI A;  1YIT T;  2XK0 A;  5IHI A;  1GFC A;  1Q81 R;  1D0Z A;  2B9R A;  2CP3 A;  1UUE A;  3VYH B;  5HCK A;  4RTT A;  5CVI A;  1UJ0 A;  3EOC B;  2PUK B;  1K0X A;  4D8D A;  3AHU A;  3C4S A;  1M90 R;  2W99 A;  3BG5 A;  4M78 B;  4JRP A;  1M1K U;  1K73 C;  1QP2 A;  3OQ5 A;  1WPY A;  3RIR A;  1MV0 B;  1FWZ A;  3RMS A;  3EH2 A;  3PE0 A;  4AG2 C;  4CRL B;  3QII A;  2YUQ A;  4IUP A;  1XTD A;  1WIE A;  4UN0 A;  1VYU A;  3I56 Q;  4AFZ C;  1Q81 U;  5LJ5 f;  4F04 B;  5DQV A;  5HK3 A;  2BUD A;  3OS5 A;  4IIO A;  1H27 B;  2LZ6 B;  3FDR A;  2RI2 A;  2HKQ B;  4TVR A;  4RCB A;  2WIP B;  1M90 U;  2OTL Q;  1PWT A;  4BD3 A;  1QMZ B;  4OB1 B;  3CD6 A;  4HVU A;  2HQX A;  2JXB A;  4C92 G;  4XU2 A;  1KJW A;  3E1S A;  2QFZ A;  2RD1 A;  1WHM A;  3M53 A;  4XAX B;  5HBH B;  2G77 A;  1WHH A;  3D7S B;  3FJ5 A;  4B6M A;  4BUG A;  1LOJ A;  2EW3 A;  3J81 E;  4M7D B;  2DM1 A;  5CK9 A;  1VQP Q;  1X01 A;  3VYG B;  2P4R A;  3V7S A;  3POM A;  1M2O A;  2LNH B;  4FW2 A;  1KXU A;  1M4Z A;  4C92 B;  2X1N B;  2HDA A;  5KYX B;  5GMK h;  4KRD B;  2O31 A;  3CCS T;  3Q1J A;  1H3Z A;  2QAZ A;  1X6G A;  2EJG A;  1VQN A;  3P8B B;  3S3M A;  3BDL A;  1YI2 T;  4MZT A;  1D09 B;  1SSH A;  2R5A A;  5IAY A;  3MIA B;  4M75 F;  2P0K A;  3C95 A;  2EYW A;  2QK0 A;  3JCM d;  1VQL T;  2RHI A;  2EVR A;  2K3B A;  1HD3 A;  4E6R A;  1UHC A;  2AKK A;  1E7P A;  1YBY A;  1ZA2 B;  3A98 A;  2CP0 A;  1YHQ A;  3JCM h;  3CC2 T;  5KYX A;  1O9K B;  3ULR B;  4EMH A;  4FM4 B;  1W98 B;  4C8Q C;  1N8R C;  3OYB A;  1YJ9 Q;  4QVZ A;  2E41 A;  2BZX A;  1RAF B;  3LGL A;  1R8O B;  4HVV A;  2RJD A;  2VUB A;  4M7A G;  1H1Q B;  5FU7 C;  1K9M R;  4IUV A;  4AKI A;  1OOT A;  4J9F A;  4AFS C;  3INZ A;  4ZN3 A;  1M8V A;  3A8M B;  2QGF B;  1WHL A;  4OMM A;  3H4C A;  2C5O B;  3CCU A;  5KE2 A;  1QVG S;  4J6X A;  1BKB A;  4E7S A;  4OR5 B;  4Y28 E;  1HK9 A;  2PVG B;  5CIU A;  4BCN D;  5FRO A;  1VIE A;  4GY5 A;  4RMO A;  4M7D E;  3TNI B;  1B34 B;  5KYN A;  4O6J A;  5D6X A;  3VS0 A;  1I81 A;  1D0Y A;  1QVF P;  2LTO A;  2QTV A;  3MHX A;  5GAM j;  2PUO B;  5HY6 A;  2V22 B;  1AZE A;  5D7U A;  1RAD B;  3SB2 A;  2CP5 A;  1AIS B;  1JOW A;  2HBW A;  2NUP B;  3EG9 B;  2DFU A;  4BXX X;  5GAO m;  1ZSG A;  4WCI A;  3CBM A;  1YCY A;  3OYI A;  2F5K A;  2PK2 A;  2XD0 A;  5FWC A;  1RAH B;  4FT4 A;  1M3B A;  3PVL A;  2WSF E;  2COZ A;  3A5Z B;  5J26 A;  2J6F A;  1NBE B;  1Q95 G;  4HL4 A;  1VQ6 T;  3A8G B;  3H6Z A;  2WHB B;  1B7T A;  4JZ3 A;  4FU6 A;  5LJ3 d;  3M0S A;  1URC B;  2YWW A;  4K11 A;  1U8R A;  1VQ7 Q;  3GIB A;  4XK8 E;  5I2S A;  2YRC A;  3CCE Q;  3QJ6 A;  3EHR A;  3LWH A;  2OTL T;  2W2H A;  3VS5 A;  1YJW Q;  1AEY A;  1I1J A;  2FPD A;  4II5 B;  5GMK l;  4ELY C;  4BCN B;  2BKD N;  2ZCF B;  5GAN g;  1FXX A;  1X2K A;  4M4Z A;  4EPC A;  1GL5 A;  2K79 A;  4LUE A;  2XMF A;  3BE3 A;  4AFU C;  2LCS A;  5KCO A;  2KK4 A;  4B9W A;  2IW9 B;  5LJ3 j;  3VRY A;  3QWY A;  2D8H A;  1K9M C;  2CH4 W;  2RO0 A;  1RAA B;  1X2Q A;  2DNU A;  1A0N B;  1N5Z A;  1N9R A;  2JMC A;  4OP0 A;  4EOQ B;  1QVG A;  2B8A A;  4N4H A;  1OUL A;  3TW6 A;  1VQK A;  4YOZ A;  2DXC A;  1UE9 A;  1SRL A;  3CCS Q;  5A0D A;  2OAU A;  1WLP B;  2O88 A;  5LJ5 j;  1QWF A;  2M16 A;  1KQ2 A;  3PFS A;  3M0P A;  2VYT A;  3G7Z A;  2ESW A;  5AT1 B;  1FVV B;  1WHG A;  1V76 A;  3HB9 A;  1VQL Q;  3CCQ T;  2LCC A;  7AT1 B;  2J6O A;  2E65 A;  4C0F A;  1VQ8 A;  2ZPI B;  5IDN B;  1T0J A;  2JM9 A;  3HSB A;  3G4S A;  4OGR B;  1Q86 U;  3HZJ A;  5L2W B;  2Y4Y A;  1H24 B;  1KHI A;  3L1A A;  5I22 A;  3HRT A;  2EQK A;  1OPK A;  2C0T A;  2P4T A;  2F2X A;  4A4E A;  5GAM g;  4MDW A;  4M7D D;  1VYW B;  4NOY A;  1RUW A;  2FB7 A;  4L6V 5;  2J06 A;  5LQF B;  4PFP A;  4C92 C;  4M7A D;  1WXB A;  2ECZ A;  3JCM J;  2Z0W A;  4FSS A;  1QP3 A;  1WJR A;  4C8Q G;  5CCA A;  4OMN A;  1M3A A;  4M77 G;  4OVA A;  4M77 F;  3GTM S;  3RMQ A;  3VV0 A;  1ZUY A;  4WF2 A;  2FPF A;  4A4K A;  3ASK A;  4FYV B;  1I4K 1;  2VVK A;  2HQH A;  1K8A C;  2DJZ A;  4ELZ C;  3LH0 A;  3U23 A;  3I35 A;  1M2V B;  4XU1 A;  3V8K A;  3SEM A;  2DLP A;  4GLM A;  2J7I A;  5IDP B;  1UFF A;  5FW9 A;  3CCQ A;  1WGS A;  1XO2 A;  2K2M A;  2L3Q A;  1OKV B;  5J3B A;  2RHY A;  4AG1 C;  1JJ2 P;  3K7A M;  4KRT A;  2DL4 A;  1JJ2 A;  3J80 E;  1VQN Q;  3HL8 A;  1VQK T;  4XTY A;  1SSF A;  2ED0 A;  5KYY A;  3JCM P;  2QEX A;  3RES A;  3VU3 C;  2HSP A;  2P84 A;  2YUP A;  1J3T A;  4FX3 B;  3OYD A;  4JS5 A;  1OZ3 A;  2KAF A;  1M1K R;  3X25 B;  1VQ4 T;  4M7A B;  3CXC P;  2HBP A;  4QQD A;  2FPE A;  4X9D A;  1WQW A;  2JGZ B;  4J9B A;  4FCY A;  2KE9 A;  2CSI A;  4B9X A;  2PZ1 A;  3VJP A;  4G6L B;  3DKM A;  2EQJ A;  4PJM A;  4M75 G;  1OZ2 A;  4QQ6 A;  3CCV A;  4CFN B;  5GAN 2;  1QLY A;  2A37 A;  2EKO A;  1BBZ A;  3MP1 A;  3DTO A;  2WSE E;  1I07 A;  3OS0 A;  4PJO D;  1X69 A;  1MMN A;  2PU9 B;  3MEU A;  3BLH B;  2UZB B;  1D3B B;  5CKF A;  5M9O A;  2QYZ A;  3NFC A;  5CQX A;  5HVY B;  2QA4 Q;  1H1R B;  3LQ5 B;  2HCK A;  3V7C A;  3OYM A;  4QVC A;  2H3E B;  2RHU A;  3WVE B;  1VIN A;  3NMZ C;  3CCQ Q;  1MMA A;  1PD1 A;  4KUD K;  4C0Z A;  2JT4 A;  1AHJ B;  1IZ6 A;  4F7U E;  1G5V A;  1PKT A;  3G4S T;  4FSX A;  3G6E T;  2DEU A;  3PIO A;  2UZL B;  4KT0 E;  1UNL D;  1VQ8 T;  4EOR B;  4LDV A;  3A1P A;  5GAN 5;  3GNF B;  3RR6 A;  2DRK A;  5I5Z B;  3CEY A;  1OU9 A;  1YWO A;  1QVG P;  3A8L B;  1YP5 A;  3FIF A;  5D6W A;  3OYC A;  2ZAE A;  1PD0 A;  4BAC A;  3R6O A;  2GQI A;  4UC4 A;  3OW2 A;  1JU5 C;  4J5Y A;  1FX7 A;  2X4J A;  5CKD A;  2DXT A;  5EG2 A;  5EJC A;  2WEV B;  3CPW A;  1FMK A;  1O9S A;  2DYI A;  2LJ3 A;  2X4W A;  1NPR A;  1BU2 A;  1P92 A;  1Z9Z A;  2DXC B;  2PMI B;  1WZO A;  2FRW A;  1M90 C;  1QMC A;  2DEQ A;  3CD6 Q;  4C8Q D;  1FYN A;  2BIV A;  2LNV A;  4M77 D;  3SWN B;  4NST B;  4AKG A;  4DOW A;  4VUB A;  3LW5 E;  2RMO A;  2O01 E;  2COW A;  4OGE A;  1VQ5 Q;  1ZUK A;  2L2P A;  3H0I A;  4RTW A;  3KFV A;  1BCO A;  3EH1 A;  1O75 A;  4M78 G;  1FKM A;  4JPB W;  4M7D F;  2K2V A;  2L8D A;  4FYW B;  2WMB B;  3CCL Q;  1W1F A;  5DLQ E;  1GH6 B;  3JCM g;  2G3R A;  4QKU A;  2MYS A;  3HFO A;  3CPF A;  4CFW B;  1B07 A;  4LN2 A;  2KRO A;  3G71 A;  3SFM A;  4OB0 B;  3O5Z A;  1QLB A;  2RQR A;  4CI0 C;  1WFW A;  4V2S A;  1F5Q B;  1ABO A;  2O2O A;  3JB9 D;  2QGG A;  1M1G A;  5L23 A;  4FT2 A;  2JVV A;  2RJC A;  5GAN 3;  3OY9 A;  2W9F A;  1PSE A;  2RI5 A;  2BE9 B;  3AT1 B;  3REA B;  4EMK B;  3VS3 A;  3JAM E;  1QVF S;  4DQ2 A;  1IHV A;  4II1 A;  2E10 A;  2GQV A;  4F17 A;  3C94 A;  4LD6 A;  4Y91 A;  4QQG A;  4MIM A;  4M6V A;  5DLO A;  1U1S A;  1SKU B;  1JRI A;  1N8R U;  1YN8 A;  2CRE A;  2HL3 A;  4XU0 A;  3QYE A;  2K3Y A;  4OMP A;  2CDT A;  1H3H A;  3QKJ A;  4BE2 A;  4CFM B;  2LCL A;  2DAQ A;  4MFD A;  4CFU D;  2MMP A;  3DB4 A;  4HT9 A;  3RUX A;  3VUZ A;  4JX6 A;  1N4M A;  3MY1 B;  1VA7 A;  3QPH A;  2DKG A;  2A0F B;  1NM7 A;  3DLM A;  1WA7 A;  4M75 B;  1CKB A;  3M4G A;  4X34 A;  3J7A F;  3O0G D;  1SPK A;  1ZA1 B;  1U5S A;  1GCQ A;  3PGG A;  5KCH A;  4PLL A;  3UPU A;  1JEG A;  1W2B S;  4M7A C;  1OX8 A;  1RI9 A;  4LDX A;  4HXJ A;  4C8Q F;  3TNH B;  4BCM B;  1Q86 C;  3M57 A;  1UG1 A;  1M3C A;  2R5M A;  4CXA B;  4F7U A;  4EON B;  2MK5 A;  1QVP A;  1Y57 A;  2VV5 A;  2DVJ A;  1M2V A;  2MWO A;  2CYZ B;  1VQL A;  4OB3 B;  1TTH B;  3HPW A;  1X43 A;  1Q82 R;  5GAM h;  3OS2 A;  3H9N A;  3VS2 A;  4IMY B;  2J05 A;  2Y90 A;  2NYS A;  1FMW A;  4IUT A;  3HHT B;  1OU8 A;  4CFU B;  4HCZ A;  3EGD A;  2X4Y A;  2AZS A;  3KHI A;  2QGS A;  2LDM A;  3ZBD A;  2WAC A;  3X24 B;  3TSW A;  3EFS A;  3DLL A;  3JCM e;  2R57 A;  2FVU A;  1BIB A;  3LH5 A;  3VYG A;  1OIY B;  3JCM Q;  4HCB A;  3LX7 A;  2LVM A;  2NUZ A;  2PVD B;  4C8Q A;  2RM4 A;  4J9E A;  2RA2 A;  4FW1 A;  2BKZ B;  4AT1 B;  4MML A;  4N0A C;  4JUV A;  1KHC A;  3CBP A;  4LDY A;  2D6F A;  2E6N A;  1YIJ Q;  3QWL A;  4J6W A;  1T3L A;  2DBK A;  5LL6 S;  5FU6 C;  4XTU A;  2NLU A;  3VRZ A;  1H4L D;  3TNW B;  3SDZ A;  1PCX A;  3G6E Q;  2C4G B;  4LE9 A;  4KBM B;  3DL1 A;  3EGD B;  3REB B;  2M51 A;  4F7S B;  1LJO A;  2B86 A;  1OQK A;  3FLG A;  2VXF A;  2HEQ A;  4PJO A;  3I55 Q;  2E3I A;  2KRN A;  4EOP B;  3L2Z A;  1ZQ1 A;  4HVW A;  2LC4 A;  4KGV B;  1UDL A;  3SWN C;  2DL8 A;  2HSE B;  1W2B A;  4E7L A;  1X27 A;  2RF0 A;  3HP9 A;  4M77 B;  4M7A A;  4MZM A;  2JS0 A;  2YUN A;  2BS3 A;  2JTM A;  2KMT A;  1LNX A;  4JJC A;  2QG9 B;  3FB9 A;  3QUI A;  3EAE A;  3OMG A;  2GNC A;  1AZG B;  4PNO A;  1IRX A;  3MY5 B;  1WXU A;  4C0D B;  4J9D A;  2ZGW A;  3SHW A;  1YJW T;  5J39 A;  1W70 A;  1TUG B;  3CCV Q;  3CCL A;  2HQE A;  4MMK A;  4O5V A;  1LVK A;  3UWN A;  1RLQ C;  3C12 A;  2H8H A;  5KYW A;  4OMO A;  1WJQ A;  4ZNX A;  4CC4 B;  3CCJ Q;  2C0O A;  2LJ1 A;  1HYO A;  2YLC A;  3QHR B;  2DA9 A;  3EHQ A;  4DBF A;  1TG0 A;  2JJ9 A;  2X3X D;  2EYQ A;  2DF6 A;  2LJ0 A;  2WFY B;  3P8H A;  3E2U A;  2KT1 A;  2IIM A;  2HAX A;  2OTJ A;  3M0U A;  2H3J A;  1YCS B;  3EG9 A;  4J83 A;  2JTF A;  1AWJ A;  2BS2 A;  2YLB A;  1VQP A;  1IO6 A;  5LJ3 f;  1VYV A;  2DJQ A;  2CS7 A;  1G2B A;  2QAS A;  1WQ7 A;  1NJI U;  4KUI A;  1CKA A;  2IN3 A;  5LJ3 e;  1JJ2 S;  1RL2 A;  2EYY A;  4J9C A;  2LP5 A;  2RNA A;  4NL2 A;  3TCJ A;  2V8J A;  4FIB A;  2EGA A;  5ECA A;  1PRL C;  1VQ9 Q;  1PKS A;  3R6N A;  1JBM A;  3JCM W;  3PT9 A;  2OTL A;  2ZPG B;  3QHW B;  3CC7 T;  2RHX A;  4BI4 A;  5CKH A;  1NJI C;  2CUD A;  1Q81 C;  2VXE A;  2RHZ A;  2DRM A;  5LJ5 e;  2YRV A;  3HRS A;  2HD0 A;  1N8R R;  3MEA A;  3NDQ A;  4KGZ B;  1GUX A;  2ROL A;  4LUD A;  2QF7 A;  1NJI R;  3BHU B;  3M55 A;  3CCU Q;  2L89 A;  2DD5 A;  2O9V A;  3CPW S;  2EFI A;  3OA6 A;  5GAN j;  1JQQ A;  1ARK A;  1UTI A;  2ZZD A;  5A2Q E;  3LWI A;  3VKG A;  3CME T;  1UEC A;  5CKE A;  4DOV A;  1LPL A;  2KR6 A;  3CCR Q;  2O4X B;  2I0N A;  4IUR A;  2CZ7 B;  5KYU B;  5I21 A;  4KRC B;  1ZBJ A;  5GAN 4;  1VOM A;  1ZHI A;  2P0P A;  3PVQ A;  3UAT A;  2GCX A;  2DIQ A;  3V8J A;  4C5H A;  1ZP2 A;  1V1C A;  3DOG B;  4F6W B;  1OPL A;  3QO3 A;  2K5F A;  3I55 T;  3G71 T;  2WIH B;  3OYN A;  4EC9 B;  3M5A A;  5GAN d;  3MPU B;  5LJ5 h;  1NG2 A;  3OYH A;  2MWP A;  4A54 A;  4C5I A;  2DZ9 A;  1PRM C;  2MAM A;  3OSV A;  3CCS A;  2DTI A;  4DEX A;  2I53 A;  3HO8 A;  3VS4 A;  2AKL A;  1K1Z A;  4N0A A;  2AIR B;  8AT1 B;  2G6F X;  4LOC A;  4QVD A;  2V26 A;  3QBY A;  4HNT A;  2VGN A;  4BBR M;  1Z9Q A;  1IGU A;  2LQW A;  1G3Y A;  3LGF A;  4OMF B;  4M78 E;  4EDU A;  2W10 A;  2V1R A;  2WJ9 A;  3L42 A;  5EC7 A;  4A4G A;  3VKH A;  2MF2 A;  1QCN A;  1ZSZ A;  2MPX C;  2JTE A;  3RGF B;  3JB9 I;  3CCJ T;  2RB6 A;  5FU7 B;  1KC8 C;  1JB0 E;  2ZZD B;  1OV3 A;  1RI0 A;  1KD1 R;  3F70 A;  5GAO q;  1YIJ T;  2KRS A;  2F1L A;  4JX4 A;  4M78 A;  5LJ3 g;  3CCJ A;  2FZC B;  2ENM A;  4LDU A;  1AD6 A;  3FJP A;  2FHD A;  2F2V A;  5KH6 A;  2RI3 A;  2QQS A;  2NWM A;  3CXC S;  2DBM A;  3QG1 A;  3JRZ A;  2JOY A;  2X4X A;  4FL6 A;  5AYF A;  1PC0 A;  1RAI B;  2NUP A;  2XHC A;  3MET A;  1KQ1 A;  1KIK A;  2CZ1 B;  4ESR A;  4PJN A;  3OS1 A;  2EYX A;  4C0D C;  3HBL A;  3RKY A;  2KSS A;  2PJQ A;  2V8K A;  4R56 A;  4PJO F;  2OTJ T;  2DXB A;  2EAY A;  3CC4 A;  2DXB B;  2PK9 B;  3EFO A;  1VQ9 T;  1TUC A;  3EGX B;  4ANJ A;  1VQO A;  2F2W A;  2CT4 A;  3I56 T;  2LW4 A;  3N5B B;  1I5L A;  3QHS A;  3NTI A;  2VWF A;  3BFM A;  3BG9 A;  2GBQ A;  3CMA T;  2YT6 A;  5IF1 B;  1NEB A;  1YI2 Q;  3EG2 A;  4Z02 A;  2DVE A;  3CCU T;  4C92 E;  1T0H A;  3RNJ A;  3CCV T;  4JJB A;  4PL6 A;  3CCE A;  2FL7 A;  1QW1 A;  4JJD A;  4YOS A;  2JMA A;  2RQW A;  3V8L A;  4DBH A;  1AWX A;  3OSS C;  4PFZ A;  9ATC B;  3JSC A;  4JLG A;  4EMG A;  4IKF A;  2KQW A;  2DTO A;  5GAO n;  1ZX6 A;  3CME A;  1K9M U;  5GAN f;  1UGQ B;  5IH2 A;  2F69 A;  1C1A A;  4F14 A;  3BG3 A;  4J7I A;  1TH7 A;  4M75 E;  2CT3 A;  3I9Q A;  3OYG A;  1I5O B;  4AKH A;  3L2R A;  2QQ8 A;  2IVX A;  3TRE A;  1DJ7 B;  3M03 A;  1YJW A;  1UNG D;  1B3Q A;  1D1C A;  1KQS A;  2L0A A;  2L3P A;  4M7D A;  1NYF A;  1XJW B;  5HKC A;  2QQA A;  4PJO B;  3DJB A;  1N6A A;  2FZK B;  4WTO B;  3VKI A;  1VOL A;  3CC2 Q;  1D1B A;  2C5V B;  3MP8 A;  3L2W A;  3OYL A;  2XIC A;  3JB9 H;  4PKC C;  4M7A F;  2IW8 B;  1OX9 A;  1AOJ A;  1MMD A;  2RJE A;  4OMQ A;  2NUT A;  5FRN A;  3HRU A;  3CC4 Q;  5CQY A;  2QEX T;  1SRM A;  2FYK A;  2EQM A;  1QWE A;  4CC2 A;  4F7J B;  3PIP A;  3CCR A;  1H26 B;  4EOI B;  5GMK m;  4ROC A;  1F1B B;  5GAM d;  4BDY A;  4CFX B;  4RG8 A;  5IHN A;  3OMC A;  1VQ6 Q;  1UGR B;  4QT7 A;  1EX4 A;  1E6G A;  2C6T B;  3ZFJ A;  4D8K A;  3M0Q A;  3G1J A;  1GFD A;  4M75 A;  5GMK i;  1ENW A;  1HXD A;  3HTR A;  4CFV B;  2C5N B;  1ACM B;  2RQU A;  3CCE T;  2OAW A;  4BCK B;  3SD4 A;  2DL3 A;  4X1V A;  1YJ9 A;  5DQW A;  1IB8 A;  4FYX B;  2A28 A;  5GAN 8;  4F7L B;  3CMA A;  4ZGJ B;  1VQ7 A;  1K73 U;  2DER A;  2UUE B;  1G3T A;  4A63 B;  4QSH A;  3UDC A;  3JB9 F;  2QQR A;  5I2M A;  3MEV A;  2ZPH B;  1H92 A;  1KK7 A;  5GAN 6;  1GRI A;  1VQO T;  5ICP B;  1PHT A;  4KGX B;  4JS4 A;  4E7Z A;  5GAM f;  5CYI B;  1YHQ Q;  4PJL A;  2E64 A;  5IXF A;  4Z89 A;  1KC8 U;  2M0Y A;  2GTO A;  1MGQ A;  1YIT A;  1R0B G;  1RLP C;  4OGC A;  4KH0 B;  3V7R A;  2K7A A;  2E3H A;  5LMK B;  3L2Q A;  3KUF A;  3CCM T;  1HJD A;  5A0L A;  3CMA Q;  4OF1 A;  1BYM A;  1KG1 A;  4ZGD B;  2DZC A;  3JCM X;  1FIN B;  5IHY A;  1BIA A;  2K6D A;  1OKW B;  5FGK B;  4Y72 B;  1Q86 R;  1NEG A;  1KD1 C;  4KH1 B;  2DME A;  1PSF A;  3CPW P;  3C0C A;  4C8Q B;  1S72 A;  3OYY A;  3VUB A;  3MEW A;  1FMV A;  2LT4 A;  2XI9 A;  4PJO E;  2RJF A;  3BHT B;  3KBG A;  3NTH A;  4HKE A;  4J6Y A;  4LXC A;  1QVF A;  5HBJ B;  2OI3 A;  2NUT B;  1OL1 B;  2W96 A;  1JSU B;  2CZ6 B;  1UHF A;  2MOX A;  3M9Q A;  2R58 A;  2EPD A;  1NPP A;  1KD1 U;  4CC7 A;  2UZD B;  3FRN A;  4Z6Y A;  2DE0 X;  3BHV B;  2UZE B;  3QWX X;  1UGV A;  5IXB A;  4HA8 A;  5GAN h;  2QDY B;  3THK A;  1JKW A;  4BBS M;  1IGQ A;  3NTK A;  1LCK A;  4JLI A;  3ZEH A;  3H41 A;  1IRE B;  4F7N B;  1WNL A;  1TS9 A;  4BE1 A;  4TTH A;  3PMT A;  4F7U F;  2XG8 D;  3BY7 A;  3BW1 A;  2A7Y A;  4XQ3 A;  2KBT A;  2ZPE B;  5ACB A;  2M1H A;  2X9H A;  3EFR A;  2E1H A;  3T9N A;  1K0S A;  1RAB B;  1MUZ A;  1G3W A;  3EJ1 B;  1JXM A;  1N27 A;  2CP6 A;  1M27 C;  2QEX Q;  1M5Q 1;  3QJY A;  5GMK j;  3OYJ A;  4C0G A;  3JCM c;  3WXM B;  4LDW A;  5CKB A;  6AT1 B;  2CZ0 B;  4BCP B;  3H8Z A;  4JRI A;  4F16 A;  3UT1 A;  3LYI A;  1ZBX A;  4RCC A;  2LQ8 A;  4BCH B;  2JUF A;  2GF7 A;  2LQK A;  3NGP A;  3RER A;  1TFB A;  1PG5 B;  2J6K A;  4M7D G;  1MHN A;  2KYB A;  3MKD A;  4CC3 A;  4C92 A;  3M59 A;  5IHK A;  4BCO B;  3X28 B;  3OW2 S;  2KGT A;  2KXD A;  1SEM A;  1YIJ A;  5GJW B;  2IPO B;  1AWW A;  1VQ4 Q;  4RTU A;  1OI9 B;  4PJO C;  4M75 D;  3MO8 A;  1BI3 A;  1YJN A;  1NLP C;  1H1S B;  4HCC A;  4R0K A;  4BY7 X;  1BU1 A;  1MND A;  5GAN 7;  3S3O A;  2RQT A;  4P5N A;  4RTX A;  1K4U S;  2RQV A;  2K5I A;  3H0H A;  1KSW A;  5DM7 R;  2CJM B;  1YJN T;  1ZLM A;  2EIF A;  4M77 A;  4PJO G;  4RTZ A;  2RK2 A;  2YSQ A;  3TQ7 P;  4ROD A;  1VQN T;  4MFE A;  1VQK Q;  1NE8 A;  1M1K C;  4ATO A;  3BLR B;  3JCM V;  2CCI B;  5EFQ B;  1D3B A;  1QKW A;  1UEB A;  2EJF A;  3OYK A;  1D1A A;  4ME7 A;  1OEB A;  2AHJ B;  1UGS B;  3G33 B;  2EYZ A;  4Z8A A;  5LJ5 g;  2BZY A;  2K5L A;  2MI6 A;  2DIG A;  1BI2 A;  3HKS A;  4BCF B;  3CC2 A;  3L2V A;  1HSQ A;  2HL5 C;  1PKD B;  2DL7 A;  1QKX A;  2FZG B;  4Q5W A;  2MCN A;  1TOV A;  4EMK C;  4QW2 A;  4YC3 B;  2CKK A;  2QQ9 A;  2DK3 A;  4XTZ A;  2RK1 A;  1M8M A;  3CQT A;  1NLO C;  1SHF A;  4BCJ B;  4LD9 K;  1BK2 A;  1XOV A;  3I5R A;  3M0T A;  4L59 A;  2IG0 A;  1D3U B;  4ELJ A;  1E7O A;  2QQB A;  1VQM Q;  3URG A;  1GY3 B;  3S3N A;  3QYG B;  4D6W A;  1Q7Y C;  2EWN A;  2M0O A;  1AT1 B;  1XNI A;  2W9Z A;  1C0M A;  4IUQ A;  1VQ4 A;  3CME Q;  4F6S B;  4F70 B;  4A53 A;  1X6O A;  2V8I A;  5FWB A;  3WVD B;  2PNI A;  4LNP A;  4BY6 C;  2VB6 A;  1M9S A;  1YNZ A;  4BCQ B;  2IVW A;  2OJ2 A;  3GOX A;  1H8K A;  4BCI B; 
#chains in the Genus database with same CATH homology
 4HNV A;  3VYH B;  3SWN A;  2ZZD B;  4HLQ A;  1RI0 A;  4BAC A;  3R6O A;  5CVI A;  3OB9 A;  4UC4 A;  3F70 A;  2PUK B;  3OW2 A;  5GAO q;  4BE0 A;  3QZ9 B;  1YIJ T;  4F7U G;  1YI2 A;  3AHU A;  4M78 D;  4JX4 A;  3C4S A;  4J5Y A;  2DD4 B;  3BG5 A;  4M78 A;  5LJ3 g;  2DD4 A;  1FX7 A;  4M78 B;  2X4J A;  5CKD A;  2DXT A;  4LDU A;  5EG2 A;  3CCJ A;  5EJC A;  4JRP A;  1M1K U;  2KDS A;  2D0Q B;  2FHD A;  3FJP A;  3CPW A;  5KH6 A;  1O9S A;  2RI3 A;  1QP2 A;  1K73 C;  2K57 A;  2QQS A;  2X4W A;  1NPR A;  1P92 A;  3OQ5 A;  1WPY A;  3RIR A;  3QG1 A;  3A8H B;  3CXC S;  2DXC B;  3JRZ A;  1FWZ A;  2JOY A;  2X4X A;  4FL6 A;  4XTV A;  5AYF A;  3RMS A;  1M90 C;  1G3S A;  3QII A;  2DEQ A;  4IUP A;  1XTD A;  2XHC A;  3MET A;  4C8Q D;  1U1T A;  2BIV A;  4XTW A;  2LNV A;  4M77 D;  3SWN B;  1KQ1 A;  4AKG A;  4DOW A;  4VUB A;  2CZ1 B;  3LW5 E;  2E70 A;  2O01 E;  1Q81 U;  5LJ5 f;  1Q82 C;  3OS1 A;  4OGE A;  4C0D C;  5HK3 A;  3HBL A;  2BUD A;  3RKY A;  4JJN K;  2KSS A;  3OS5 A;  2V8K A;  4R56 A;  3TU4 K;  4PJO F;  3PTA A;  3FDR A;  1O75 A;  4M78 G;  1VQ5 A;  1FKM A;  1BI0 A;  2DXB A;  2EAY A;  2DXB B;  2RI2 A;  4RCB A;  4TVR A;  3CC4 A;  2K2V A;  2L8D A;  4M7D F;  1M90 U;  1K8A U;  4BD3 A;  1VQ9 T;  5DLQ E;  4OB1 B;  3CD6 A;  3JCM g;  2G3R A;  2HQX A;  5CR2 A;  1VQO A;  4C92 G;  3HFO A;  3CPF A;  3I56 T;  4XU3 A;  1NZ9 A;  5D6Y A;  4XU2 A;  4MZP A;  2XDB A;  3E1S A;  2QFZ A;  3G71 A;  4X9C A;  1VQ5 T;  2RD1 A;  3SFM A;  2KY9 A;  2JNG A;  4OB0 B;  2GFU A;  1QLB A;  3M53 A;  4XAX B;  3N5B B;  1I5L A;  2G77 A;  3QHS A;  4CI0 C;  3NTI A;  4V2S A;  3BFM A;  4JRQ A;  3BG9 A;  3JB9 D;  3CMA T;  3CCL T;  4BUG A;  1LOJ A;  5LJ5 d;  1M1G A;  3TEE A;  3J81 E;  4FT2 A;  1V29 B;  3GP8 A;  2JVV A;  4Z02 A;  2DVE A;  3CCU T;  2RJC A;  5GAN 3;  4M7D B;  2DXU A;  2XKO C;  2QI2 A;  4C92 E;  5GMK e;  3OY9 A;  4E7K A;  5CK9 A;  3CCV T;  4PL6 A;  4R55 A;  1PSE A;  4RG2 A;  1X01 A;  3VYG B;  1QW1 A;  1X75 C;  2FL7 A;  2RI5 A;  3V7S A;  3CCE A;  4EMK B;  3V8L A;  4RKU E;  3OYC A;  1M4Z A;  2PVO B;  3OSS C;  4C92 B;  3JAM E;  2OTJ T;  3JSC A;  1UGP B;  3GLX A;  4DQ2 A;  1QVF S;  5IN1 A;  5FU6 B;  4JLG A;  4EMG A;  2EQU A;  4II1 A;  5GMK h;  3L2U A;  2KQW A;  2C06 A;  4IKF A;  2E10 A;  2E6Z A;  2GQV A;  3Q1J A;  3C94 A;  4LD6 A;  3CCS T;  1H3Z A;  2DTO A;  5GAO n;  4Y91 A;  4QQG A;  1VQN A;  2EJG A;  3CME A;  4MIM A;  4M6V A;  3P8B B;  3S3M A;  5DLO A;  3BDL A;  1YI2 T;  1U1S A;  1JRI A;  4MZT A;  5GAN f;  1K9M U;  1UGQ B;  2R5A A;  4M75 F;  5IAY A;  2F69 A;  1N8R U;  3FEO A;  2P0K A;  4XU0 A;  3QYE A;  2K3Y A;  3C95 A;  3BG3 A;  4J7I A;  3JCM d;  3JB9 G;  1TH7 A;  1VQL T;  2RHI A;  3A8O B;  3QKJ A;  4M75 E;  1UB4 A;  4BE2 A;  2LCL A;  3OYG A;  2DAQ A;  2K3X A;  3O8V A;  4MFD A;  2MMP A;  3DB4 A;  4HT9 A;  3GNG A;  1E7P A;  3RUX A;  1YBY A;  4C92 F;  1YHQ A;  3VUZ A;  4JX6 A;  4AKH A;  3JCM h;  3L2R A;  3CC2 T;  2QQ8 A;  3TRE A;  1DJ7 B;  3MCA B;  4EMH A;  4FM4 B;  4C8Q C;  1YJW A;  3QPH A;  4KUD K;  3OA6 A;  4E7I A;  3OYB A;  1N8R C;  2DKG A;  1KQS A;  2VC8 A;  4M77 C;  1H64 1;  4AI6 A;  4MDX A;  3DLM A;  4QVZ A;  5C0M A;  4M7D A;  2E41 A;  4M75 B;  3M4G A;  4X34 A;  4E7J A;  1BI1 A;  5HKC A;  3J7A F;  3LGL A;  1R8O B;  2QQA A;  2RJD A;  2VUB A;  4M7A G;  4PJO B;  3PGG A;  4M77 E;  5KCH A;  4PLL A;  3UPU A;  5FU7 C;  1N6A A;  4IUV A;  5GAO l;  1W2B S;  4C8Q E;  3VKI A;  4NL3 A;  4M7A C;  3QXE B;  4AKI A;  4LDX A;  3MP8 A;  3L2W A;  3INZ A;  4ZN3 A;  3OYL A;  3A8M B;  2XIC A;  4C8Q F;  3JB9 H;  1M8V A;  2VGM A;  4PKC C;  3H4C A;  4BI3 A;  1Q86 C;  4M7A F;  2D9T A;  3M57 A;  3CCU A;  5KE2 A;  1QVG S;  2RJE A;  3M4Y A;  2R5M A;  4J6X A;  2KMG A;  3PMI A;  1BKB A;  5GAM e;  5FRN A;  3HRU A;  4F7U A;  4Y28 E;  1QVP A;  1HK9 A;  2PVG B;  5CIU A;  2VV5 A;  5CQY A;  2E12 A;  2QEX T;  2FYK A;  5FRO A;  1VIE A;  4GY5 A;  4RMO A;  2EQM A;  4M7D E;  2MWO A;  1B34 B;  4YTL A;  2CYZ B;  2JN0 A;  4M78 F;  4O6J A;  5D6X A;  4OB3 B;  3HPW A;  3PIP A;  3M56 A;  3CCR A;  1VQL A;  1I81 A;  5GMK m;  2LTO A;  3MHX A;  5GAM j;  2PUO B;  5HY6 A;  3I56 A;  2A3L A;  5GAM h;  5GAM d;  3OS2 A;  4BDY A;  4RG8 A;  3SB2 A;  3OMC A;  3E9G A;  1VQ9 A;  1UGR B;  2Y90 A;  3JB9 J;  4E47 A;  4IUT A;  3ZFJ A;  4BB7 A;  5GAO m;  4JRK A;  3HHT B;  3FC3 A;  4M75 A;  5GMK i;  4C5E A;  1HXD A;  4HCZ A;  3HFN A;  3CBM A;  1YCY A;  2X4Y A;  3OYI A;  3KHI A;  2F5K A;  2XD0 A;  2LDM A;  3ZBD A;  4FT4 A;  3CCE T;  2WAC A;  3RKX A;  4C8Q A;  2JZ2 A;  1Q7Y U;  3SD4 A;  3X24 B;  2WSF E;  1I8F A;  3A5Z B;  5J26 A;  1YJ9 A;  3EFS A;  3DLL A;  3JCM e;  2R57 A;  4HL4 A;  3E19 A;  2DD5 B;  2FVU A;  3E9F A;  1BIB A;  2PQW A;  5GAN 8;  3CMA A;  3A8G B;  4ZGJ B;  3VYG A;  3H6Z A;  3JCM Q;  1VQ7 A;  1K73 U;  3JCM b;  4FU6 A;  5LJ3 d;  4HCB A;  3LX7 A;  2LVM A;  1G5V A;  1G3T A;  4QSH A;  2PVD B;  3UDC A;  2EJ9 A;  2QQR A;  2RM4 A;  2O4X A;  5I2M A;  4XK8 E;  2RA2 A;  3MEV A;  2ZPH B;  5I2S A;  2QA4 A;  3GIB A;  3QJ6 A;  5GAN 6;  4MML A;  4BY6 B;  1VQO T;  3LWH A;  4N0A C;  4JUV A;  2OTL T;  1KHC A;  3CBP A;  4LDY A;  2D6F A;  2E6N A;  4JS4 A;  3QWL A;  5GAM f;  3ME9 A;  4J6W A;  3CC4 T;  5GMK l;  4ELY C;  5LL6 S;  1B34 A;  2BKD N;  1VQM T;  5FU6 C;  2ZCF B;  2E64 A;  4XTU A;  2LX9 A;  1FXX A;  2NLU A;  5GAN g;  1KC8 U;  1KQS S;  4HT8 A;  4EPC A;  1MGQ A;  1YIT A;  4OGC A;  5DY9 A;  3SDZ A;  3V7R A;  5KCO A;  1GXI E;  2KK4 A;  4B9W A;  3L2Q A;  5LJ3 h;  3KUF A;  5LJ3 j;  3CCM T;  5A0L A;  4OF1 A;  1BYM A;  1K9M C;  1KG1 A;  4ZGD B;  2DZC A;  4KBM B;  2RO0 A;  3JCM X;  1N9R A;  2K4Y A;  1BIA A;  4OP0 A;  3DL1 A;  2WSC E;  1QVG A;  4XTX A;  2B8A A;  4N4H A;  2BS4 A;  3ER0 A;  1LJO A;  3X20 B;  2VXF A;  3FLG A;  3TW6 A;  4JX5 A;  4A4H A;  1KD1 C;  4PJO A;  2X35 A;  4C5G A;  3OYA A;  3L2Z A;  1ZQ1 A;  1EIF A;  2LC4 A;  1PSF A;  3SWN C;  1VQK A;  4M78 C;  3OYF A;  4J8O A;  2DXC A;  3CXC A;  2XID A;  5A0D A;  1W2B A;  4C8Q B;  1S72 A;  4E7L A;  3OYY A;  2OAU A;  3MEW A;  3VUB A;  5LJ5 j;  3HP9 A;  4M77 B;  2LT4 A;  2XI9 A;  4PJO E;  2RJF A;  2M16 A;  3KBG A;  3NTH A;  4HKE A;  2M9U A;  4J6Y A;  4M75 C;  4MZM A;  3PFS A;  4A4F A;  1KQ2 A;  1QVF A;  2VYT A;  3G7Z A;  2BS3 A;  3QZ5 B;  2JTM A;  2KMT A;  1LNX A;  3HB9 A;  3FB9 A;  3EAE A;  2CZ6 B;  3M58 A;  3QUI A;  3M9Q A;  3I55 A;  2R58 A;  3OMG A;  1NPP A;  2GFA A;  2LCC A;  4PLI A;  1KD1 U;  3FRN A;  2E65 A;  4C0F A;  1VQ8 A;  4Z6Y A;  4PNO A;  2ZPI B;  4C0D B;  2ZGW A;  3TW7 A;  1YJW T;  3HSB A;  5J39 A;  4HA8 A;  3G6E A;  1VQ6 A;  3X26 B;  3GF5 A;  3M54 A;  4N4I A;  4JDS A;  4J7F A;  3G4S A;  1Q86 U;  3HZJ A;  1VQP T;  5GAN h;  2Y4Y A;  3CCL A;  2HQE A;  4MMK A;  4O5V A;  1YHQ T;  1KHI A;  3L1A A;  2QDY B;  3UWN A;  1Q82 U;  3C12 A;  4BBS M;  3HRT A;  2HNI A;  3NTK A;  4JLI A;  2E5Q A;  3ZEH A;  1IRE B;  2EQK A;  1WNL A;  1WJQ A;  1Y07 A;  4BE1 A;  2P4T A;  2YLC A;  3PMT A;  4F7U F;  2XG8 D;  3BY7 A;  4HNU A;  3BW1 A;  4A4E A;  5GAM g;  2A7Y A;  4MDW A;  4M7D D;  4XQ3 A;  4NOY A;  2ZPE B;  2M1H A;  3QSU A;  2EYQ A;  2E1H A;  2FB7 A;  3EFR A;  3T9N A;  4BI8 B;  4L6V 5;  3CBO A;  4C92 C;  1Y71 A;  4M7A D;  3P8H A;  2F5T X;  3JCM J;  3GPL A;  1W4S A;  2HAX A;  1S72 T;  1G3W A;  4ZN1 A;  1N27 A;  1QP3 A;  1WJR A;  4C8Q G;  5CCA A;  4M7D C;  2OTJ A;  4M77 G;  4OVA A;  4M77 F;  3RMQ A;  2H3J A;  3VV0 A;  4M7A E;  1M5Q 1;  3QJY A;  4J83 A;  5GMK j;  2JTF A;  3OYJ A;  4WF2 A;  4C0G A;  3JCM c;  3WXM B;  3ASK A;  4LDW A;  5CKB A;  4A4K A;  2BS2 A;  2CZ0 B;  2YLB A;  3H8Z A;  4JRI A;  1VQP A;  3UT1 A;  3LYI A;  5LJ3 f;  1I4K 1;  1M1F A;  1ZBX A;  4RCC A;  2LQ8 A;  3BDU A;  3CCQ T;  1K8A C;  2CS7 A;  2DJZ A;  2JUF A;  2LT1 A;  2GF7 A;  2LQK A;  4ELZ C;  3LH0 A;  1WQ7 A;  3RER A;  1NJI U;  4KUI A;  4EMK A;  5LJ3 e;  1MHN A;  4M7D G;  4XU1 A;  3V8K A;  4DA4 A;  4C92 A;  3M59 A;  3QYB A;  1JJ2 S;  2L3R A;  3X28 B;  4C92 D;  3CCQ A;  1RL2 A;  3OW2 S;  2YHT A;  1WGS A;  4NL2 A;  3TCJ A;  2QXF A;  3OBY A;  2V8J A;  4FIB A;  1VQM A;  5J3B A;  2RHY A;  4L5G A;  1U8R A;  1YIJ A;  4BDZ A;  5GAO r;  1JBM A;  3JCM W;  3PT9 A;  2XDD A;  4M7A A;  4PJO C;  4M75 D;  3MO8 A;  1BI3 A;  2ZPG B;  1YJN A;  5FLX E;  2RHX A;  1JJ2 A;  2OTL A;  3CC7 T;  4HCC A;  3J80 E;  4BI4 A;  3HL8 A;  5CKH A;  2Y4X A;  2XU8 A;  1Q81 C;  2VXE A;  1NJI C;  4XTY A;  1SSF A;  1VQK T;  2RHZ A;  5LJ5 e;  3S6W A;  4E7H A;  2YRV A;  5GAN 7;  5IT9 E;  3MP6 A;  5GAN e;  3HRS A;  5HK0 A;  2QA4 T;  2HD0 A;  2QEX A;  3JCM P;  3RES A;  3S3O A;  4ZTF A;  4P5N A;  3VU3 C;  4N4G A;  2K5I A;  1Y96 A;  3MEA A;  3OYD A;  4JS5 A;  1OZ3 A;  2KAF A;  1VUB A;  5DM7 R;  2QF7 A;  3CC7 A;  3M55 A;  1YJN T;  2L89 A;  2DD5 A;  3CPW S;  3X25 B;  1VQ4 T;  2EIF A;  2EFI A;  3DB3 A;  4M77 A;  4PJO G;  2HBP A;  4QQD A;  4M7A B;  2RK2 A;  1WQW A;  4X9D A;  4CRI A;  3CCM A;  5A2Q E;  2ZZD A;  3LWI A;  2QDJ A;  3VKG A;  3CME T;  4MFE A;  5CKE A;  4DOV A;  1VQN T;  2KR6 A;  1NE8 A;  4B9X A;  3VJP A;  4NC6 A;  2KVQ G;  1M1K C;  4ATO A;  2O4X B;  3DKM A;  3OBW A;  3JCM V;  5A0G A;  2QTX A;  3RKW A;  2EQJ A;  4IUR A;  2ZPF B;  4M75 G;  2DPP B;  1D3B A;  1UEB A;  1OYX A;  2EJF A;  3OYK A;  1OZ2 A;  2CZ7 B;  4ME7 A;  4QQ6 A;  5I21 A;  2AHJ B;  1UGS B;  5GAN 4;  5LJ5 g;  3CCV A;  2K5L A;  2MI6 A;  5GAN 2;  1ZHI A;  1Y96 B;  2P0P A;  2DIG A;  2EKO A;  1BI2 A;  1VQ6 T;  4GLK A;  1WJS A;  2GCX A;  3HKS A;  2DIQ A;  4IUU A;  3V8J A;  4C5H A;  3KXT A;  1OI1 A;  3MP1 A;  3L2V A;  3CC2 A;  4NS5 A;  5GAO p;  3PNW C;  2DO3 A;  2WSE E;  3CCR T;  4Q5W A;  1XQH A;  3OS0 A;  4EMK C;  4QW2 A;  4PJO D;  2CKK A;  3QO3 A;  3JCM f;  2QQ9 A;  5GAN j;  2K5F A;  2DK3 A;  2PU9 B;  3MEU A;  4XTZ A;  2RK1 A;  4F7U B;  1VQ7 T;  3I55 T;  3G71 T;  3OYN A;  3M5A A;  5CO7 A;  5L8R E;  5GAN d;  5LJ5 h;  1D3B B;  5CKF A;  3OYH A;  4LD9 K;  2MWP A;  1YJ9 T;  5M9O A;  4A54 A;  3CD6 T;  4C5I A;  1XOV A;  2DZ9 A;  2MAM A;  4KUL A;  2L5Q A;  3OSV A;  4L59 A;  4OB2 B;  2I2L A;  3NFC A;  3CCS A;  2IG0 A;  2DTI A;  5CQX A;  5C6S A;  3HO8 A;  4ELJ A;  2DTH A;  2QQB A;  3JB9 F;  3QYH B;  3V7C A;  3LLR A;  3OYM A;  2XDP A;  4QVC A;  2RHU A;  4N0A A;  3WVE B;  3URG A;  3OYE A;  1VIF A;  4LOC A;  1N9S A;  3QDR B;  4C0Z A;  3QYG B;  2CGH A;  4QVD A;  3P8D A;  3QBY A;  4D6W A;  5KE3 A;  3S3N A;  1AHJ B;  4HNT A;  1IZ6 A;  2EWN A;  4ZGE B;  2VGN A;  4BBR M;  4F7U E;  1Q7Y C;  3G4S T;  2M0O A;  4FSX A;  2RH2 A;  1XNI A;  1Y7X A;  3G6E T;  4IUQ A;  4ZTJ A;  1VQ4 A;  2P0Q A;  2LRQ A;  4A53 A;  2ZPB B;  3PIO A;  1G3Y A;  1X6O A;  3LGF A;  4OMF B;  4M78 E;  4KT0 E;  4EDU A;  2V8I A;  3WVD B;  4BY6 C;  1VQ8 T;  2WJ9 A;  4LDV A;  5GAN 5;  3GNF B;  3L42 A;  4A4G A;  3CEY A;  5FRM A;  5CAI A;  3VKH A;  1M9S A;  2MF2 A;  2IVW A;  1YIT T;  2XK0 A;  3A8L B;  3GOX A;  3JB9 I;  3CCJ T;  2RB6 A;  5FU7 B;  1KC8 C;  3FIF A;  5D6W A;  1JB0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...