2ZPFB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 18min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpfB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpfB02
3LW5E 2DXCA 2PVOB 2ZPEB 2ZPFB 4OB2B 2D0QB 2QDYB 2PVDB 3A8MB 3X28B 2WSEE 3QYGB 2CZ6B 2PUOB 1AHJB 1UGPB 1UGSB 3X26B 2ZPIB 4ZGEB 1V29B 3WVDB 2PUKB 1PSFA 3A8GB 2DPPB 3QZ5B 1IREB 2PU9B 1GXIE 2DXBA 4KT0E 2ZPGB 4OB0B 3VYGA 2ZPBB 2CZ1B 4OB3B 1UGRB 3X20B 2DD5A 2DXBB 4L6V5 4ZGJB 3WVEB 2CZ0B 2PVGB 2AHJB 1PSEA 4RKUE 3A8HB 4FM4B 2ZPHB 4Y28E 5L8RE 3VYGB 4OB1B 2DXCB 3QZ9B 1UGQB 2CYZB 2ZCFB 1QP3A 2WSCE 2ZZDA 2WSFE 4XK8E 1JB0E 3X25B 2DD4B 3VYHB 3A8LB 2O01E 2CZ7B 2DD4A 4ZGDB 3QYHB 1QP2A 2DD5B 1DJ7B 3A8OB 3QXEB 3HHTB 2ZZDB 3X24B
chains in the Genus database with same CATH superfamily
3QHRB 3E19A 3CMET 3LWHA 1YBYA 1FX7A 4WCIA 4FW2A 2IVXA 4Y91A 4KGXB 1X69A 3H9NA 4AKGA 2VGNA 3JCMd 4EDUA 1SHFA 4NL3A 4F7UF 1GFCA 1N4MA 1MMDA 4JS4A 2FHDA 3OB9A 3SEMA 3MY1B 2QA4Q 2JUFA 4ELLA 1IB8A 1BU2A 1WX6A 3WVDB 2G6FX 3VU3C 2R7GA 2B86A 4Z02A 4BI3A 2RJCA 4PJOB 1NPRA 1VQ9Q 3PMIA 3UF4A 4D6WA 2P4TA 4J9FA 1KC8C 1LJOA 2L8DA 3GP8A 2COYA 2JTFA 2DLPA 3VYGA 1ZHIA 5LJ3e 1RL2A 1WA7A 2DD5A 2MOXA 2QF7A 3I55Q 2L3RA 1VQPQ 2KR3A 2KXCA 2X9HA 1NZ9A 2FPEA 1M3AA 2QA4T 3HTRA 3AHUA 5FU7C 1KHIA 4PFZA 1YITT 1M8VA 3S3MA 3CCLA 5LJ5h 4C8QC 4MZPA 4F17A 1QVGA 2QG9B 1Q82U 3M0SA 4XTZA 5GAMh 1B07A 1K8AC 4A4FA 2L0AA 1YHQQ 2WPAB 3UA7A 5FRMA 2RA2A 3VV0A 1YFNA 2J05A 3R6OA 5IAYA 2DL5A 1AZEA 1W4SA 4RCBA 1GCPA 5HNBB 1I8FA 5CKEA 1PG5B 1OL2B 3CCSQ 1KQ2A 2PNIA 9ATCB 2DD4A 3RMSA 4OGRB 3TCJA 4IUQA 3G6EA 2RI2A 3VS4A 4PLIA 1ARKA 3L2RA 1EIFA 4M7AC 4OGCA 1WI7A 2RH2A 2CP6A 4BCJB 3WXMB 3CXCS 4HT8A 4F7LB 1ZSGA 2RQTA 1BCMA 3V8JA 5IH2A 5IHKA 2ZPFB 1X6GA 2RJFA 1MV0B 2OAUA 2BE7D 1X27A 1VQ6A 1AWJA 1K4US 2LP5A 3BE3A 5DLQE 2E5QA 1YCSB 3KHIA 1T3SA 2ATCB 1JU5C 1FWZA 5FROA 2RN8A 4KGVB 2JVVA 6AT1B 4OMQA 2GQIA 5GANd 5I5ZB 3OBYA 1KIKA 2EYZA 1PKTA 1UHFA 2PZ1A 1PSFA 1D1BA 2VXEA 1JXMA 1HXDA 1VIEA 3OYMA 4EOLB 2VVKA 3RESA 4E47A 5HBEB 3DLLA 4JRIA 4D8KA 3H0HA 2FB7A 4ANJA 1XJWB 4F7UB 5LJ3d 2EAYA 2OTLQ 2J7IA 4Y28E 2CDTA 4QVCA 4M7AE 1VOMA 2RQRA 4QVZA 4M7DA 2MYSA 2LNVA 2BS2A 1UG1A 4J6XA 1VQPA 1Q81C 1VQ9A 1Y0MA 3EH1A 5FU6C 4ATOA 4HVVA 3LH0A 4FL6A 5KYYB 2JM9A 3JCMb 4HL4A 1TUDA 2R5MA 2LNHB 1M90U 1D0XA 3M0RA 2LJ3A 2C5OB 4B9WA 2K3XA 1D3BA 3FC3A 4JRQA 1WXUA 3BLQB 4ELYC 2EYYA 2XKOC 5L23A 2O01E 2X35A 2I53A 2QQ9A 1E9HB 2K9GA 4KUIA 1SSHA 2GGRA 5DY9A 4BY6C 3PIPA 2LZ6B 1MHNA 1ZP2A 1OKVB 2GFAA 2LQWA 2CT4A 5CO7A 2DFUA 2KRNA 4C5IA 2QGGA 1VQKA 3LLRA 3CD6A 2WEVB 4ZTFA 4M7DB 4BCQD 2K57A 3G4SQ 2ZPEB 1MGQA 4NC6A 4JJBA 4A4EA 4MFDA 3G6ET 2BE9B 3MI9B 4ZTJA 3LX7A 3M57A 1KQSA 2LT1A 1ZSZA 3CMEQ 3M0TA 4LD9K 2HKNA 4RG8A 1RI9A 1UGPB 2JM8A 4EMGA 1W70A 4ESRA 3I5SA 1T3LA 2BTTA 2F69A 1OULA 2JN0A 2ED1A 3SHWA 1WYXA 1KK7A 1JJ2P 4OVAA 4HVWA 3VJPA 5FWCA 2LCLA 1ZX6A 1M30A 2W10A 2XI9A 1C0MA 3CBOA 4LDVA 4DQ2A 1K9MC 2F2WA 4CRLB 2YRCA 4PLLA 4C5GA 1S72A 2OTLT 2E4HA 3C0CA 3JB9F 1TSFA 2X3WD 3BLRB 1I4K1 3CC7T 4OMNA 3OSVA 3PTAA 1TUCA 3CCVQ 3UWNA 1AD6A 2RI3A 2V26A 3AT1B 1Y7XA 2DL7A 3EFOB 4HCZA 2NUTB 1K8AR 4F7NB 1I81A 3A8HB 3M55A 4GY5A 4M77C 3NMZC 3RBBB 1UB4A 5DM7R 3PVLA 1VQ5Q 2CYZB 1G3NC 3S3NA 4RTUA 1RAFB 4BACA 4LDUA 4E7ZA 1TXQA 5A0LA 4OMFB 1Q95G 3G4ST 2J6KA 3OMCA 4PK4A 3THKA 1OU8A 4RMOA 1NJIR 2RQWA 1UNHD 2CP3A 2HBPA 3BDLA 2DD4B 3HP9A 4JPBW 3CCRT 2EYXA 1M2OA 3FIFA 4M77B 4J8OA 3CXCA 1OX9A 3M58A 4YOZA 4C8QE 3URGA 3IQLA 1H26B 4Y72B 1IZ6A 5FU7B 4F16A 2UUEB 3M59A 3OYEA 1H1PB 4EOKB 4FYXB 4M7AF 1PHTA 1I1JA 2F2CA 1XOVA 1GUXA 3QYEA 4XU0A 1E6GA 1HYOA 4KH0B 2KT8A 2JT4A 2K3BA 3J80E 2I2LA 1OQKA 1ZBXA 2PQWA 1ZQ1A 3ZL7C 1PM3A 2DAQA 5GAMe 1Y71A 1MNDA 4VUBA 5GAN6 3FEOA 2SRCA 4FYYB 1YWOA 5C6SA 1YN8A 3QYGB 4F6WB 4XU1A 1WNLA 4C92E 4MDXA 4JS5A 1VQLQ 5HK0A 2QGSA 4ZNXA 3LQ5B 1D1AA 2AT1B 2GQVA 3QJ6A 2EBPA 1HJDA 2R5AA 2QASA 4KRDB 1QWFA 1VQ6T 3UT1A 3GIBA 4M7AB 2L5QA 4RTZA 2ENMA 3HRUA 1IREB 4X9CA 3QKJA 1Z9ZA 3JCMg 1QVGS 4CC4B 2RJEA 2M0OA 4F6UB 3M03A 2WMAB 3SFMA 2O9VA 5GMKi 1EX4A 1IRXA 4MMKA 3OYBA 2CZ0B 2YDLA 3QWXX 1VQ4A 5L2WB 2AHJB 1KD1C 2X4JA 3JAME 2R57A 1FVVB 3CC2A 5AT1B 2O4XA 1NG2A 1LPLA 2A36A 3CCMA 1VINA 3GTMS 4LDYA 5HK3A 4FT4A 1WXTA 4KH1B 3G33B 1VQOT 2WJ9A 4F6SB 5D6YA 2VKNA 5GJWB 2G3RA 3OS2A 1OI9B 3EAEA 1QVPA 2RHYA 1BK2A 2O2OA 3PFSA 1I0CA 2BZXA 5GMKm 1UECA 2XDPA 4FCYA 3RKYA 4ZGDB 1OV3A 2DD5B 4BUGA 5FU6B 4YTLA 2B8AA 3MO8A 3EG9B 2H3JA 2DXTA 4F7SB 5LJ5e 1M90R 1S1NA 2YHTA 4BE1A 4F04B 3M54A 2EQJA 4M7AD 5DLOA 2DBKA 2DXCA 2C4GB 1WHLA 2FZCB 2KT1A 3LYIA 1SF9A 1N5ZA 1Q86U 3E1SA 5LJ3h 4J9BA 2JTEA 3X28B 3REBB 4M77G 4BXXX 4DEYA 4JJCA 2XICA 3L42A 1XO2A 2HAXA 1GBRA 4BDYA 4E7IA 2LDMA 2JOYA 5LMKB 1TU0B 3T9NA 3OS5A 2M1HA 2WFYB 1WGSA 1GL5A 1KQ1A 5ECAA 3CMAT 3A8GB 3MIAB 1KSWA 1RABB 5BNJB 4PJJA 3TREA 3PMTA 5FLXE 1H3HA 3DB3A 1O9KB 3CMEA 4MDWA 2EPDA 3OYCA 1K73U 4DEXA 4L6V5 5GANg 2HMAA 4QVDA 1CSKA 3G71A 4FM4B 1H27B 1FKMA 4BY7X 3VS7A 4C92G 4DBRA 3BLHB 4OB1B 2JXBA 5I2SA 1G2BA 3EG1A 3EGUA 3E9GA 2DTOA 4R56A 3L2QA 4F14A 2YLCA 5GAMf 2WIPB 3C95A 4AG2C 1G3YA 1JB0E 5DQVA 2C06A 1VQLT 3X25B 2IIMA 5LJ5j 2DZCA 4GLMA 3EFSA 2ROLA 2AKKA 3M0QA 5J26A 2JS0A 3CXCP 1WQ7A 5GAN5 1M3CA 1OYXA 1I5LA 1H3ZA 4LNPA 1K1ZA 1N9RA 3RIRA 1C9BA 5GAMj 1OI1A 4J7IA 1A0NB 2C5NB 4N0AA 3CCVA 2QA4A 3NHNA 2COZA 2F5KA 1YJ9A 4DOWA 3FDRA 2GTOA 3OYFA 4MFEA 2FVUA 2IPOB 1EZZB 3EGXB 2ABLA 2EUFA 2DKGA 1NLPC 3EGDB 2EGEA 4IUVA 2CP0A 2YWWA 1SRLA 2XDBA 2K79A 5GMKh 3BHVB 3VS6A 1K8AU 2DL4A 1YIJQ 1AHJB 4FW1A 3REAB 2X51A 1N27A 1UGSB 2DJZA 2D0NA 3GNFB 3JCMf 2BZYA 1YP5A 2EWNA 3MJXA 4M7DE 4PFOA 3VS2A 4EOOB 2EQIA 2PHGA 1U1SA 4C0GA 3OS0A 2PK9B 4M7DF 3I55A 2QGFB 1PWTA 3TNWB 4QW2A 2LVMA 3JB9G 3QPHA 3EJ1B 4EOPB 1X2KA 2HQXA 2Y4XA 5I22A 1YNZA 4J6YA 3F5XB 1D3BB 4M77D 2LTOA 2CJMB 1QP3A 4Y92A 1VQ8A 1UDLA 2OI3A 4FSXA 4DBHA 1VYVA 1YHQA 2HL5C 2DEUA 1MNEA 5CKBA 4PJLA 4F70B 3MCAB 4M77E 4KBMB 2VB6A 1KHCA 1U3OA 4FU6A 1QQJA 4XTYA 2W2HA 1UJYA 2PTKA 4C0DC 1WXBA 1ZBJA 1YJWA 2P0KA 4NL2A 1FMKA 1VQ4Q 2LQKA 3A8LB 1NJIU 1IGUA 1VQ6Q 1X2QA 3BG9A 2L89A 2DILA 4N4GA 3TNIB 2YUPA 2J06A 4LUEA 4M7AA 3JB9I 2DA9A 3PE0A 2VUBA 2EKOA 2KI7A 2ZZDB 1PC0A 1UUEA 1WZOA 3LGLA 8ATCB 3OYJA 3HB9A 2HBWA 4LD6A 1VQPT 2RHXA 1OZ2A 3BHTB 2RNAA 3TNHB 3CCVT 1KFZA 4M75G 5FRNA 1GBQA 1AVZC 4IIOA 1QWEA 2RM4A 1Q7YR 2LQNA 3E9FA 3CCEQ 2MWPA 3FRNA 1PRLC 5IHNA 3QHWB 4N0AC 2QXFA 3KFVA 5GAMd 3RR6A 4J9CA 3HRSA 1H641 4BCFB 1N8RC 3C12A 3JCMJ 4BI8B 2G9XB 1CKBA 3DDPB 2C0IA 2C0TA 1KQSS 3CC2T 1D0YA 2D9TA 4JX6A 2M16A 3L2WA 5HBHB 1VUBA 2DXBB 3OYLA 2M9UA 4LUDA 2E41A 2GCXA 4CFXB 1GFDA 4D8DA 3CPWS 2E1HA 1Q86R 3PIOA 4EIKA 2EW3A 4TVRA 1YI2T 3JB9H 3BG5A 3VRZA 4M7DG 5LJ5g 1H25B 3TU4K 3HPWA 2LC4A 3DOGB 2I40B 5LL6S 2WXVB 4QKUA 4C92D 3FB9A 3VUBA 1Z9QA 4M78B 4FX3B 4IUUA 2UZDB 2RQUA 5GAOl 3CBMA 3P8BB 2HKQB 2CZ7B 1SEMA 2KNBB 1QLBA 2XK0A 4QQGA 3GBQA 5HVYB 3QXEB 3VKHA 3FLGA 2UZLB 2A0FB 3F70A 5GAOp 4M75C 3N5BB 4OMOA 1OEBA 2C0OA 2BUDA 3O8VA 2BIVA 3G71Q 1SPKA 1VQKT 4JX4A 3JCMX 4O6JA 1BI2A 3BG3A 2CP5A 3CCSA 2CSIA 5LJ3j 4ELJA 2D0QB 4PJOA 5KYUA 1UHCA 1VQNA 2RHIA 1HD3A 1OU9A 4ZN3A 2DYIA 4F7UA 5A2QE 2DVJA 2CZ6B 1SKUB 1IGQA 2EJ9A 4M78G 3INZA 2DIGA 5GAN4 3NDQA 1B34B 1NM7A 2RK1A 2RI5A 1T0JA 2HEQA 2W0ZA 4ZGEB 2RHUA 5KH6A 2KEAA 1D0ZA 4BCOB 5M9OA 4E7HA 2QQAA 5LQFB 2JMCA 5IN1A 2DK3A 4AFZC 1M1FA 3SDZA 1G8XA 4C0ZA 1W2BS 1KJWA 4YOOA 1LCKA 5C0MA 3CC4Q 3O0GD 5A0DA 3JCMh 4KRTA 3RUXA 1R0CB 2EJGA 3OSSC 2CZ1B 3GPLA 2QK0A 1K76A 5CKDA 1ZSZB 2KR6A 2V22B 4BCMB 2A7YA 4LOCA 1M1KU 3NGPA 3WVEB 2PVGB 4C92F 1JOWA 4QQDA 2HNIA 1QVFS 4E7KA 2EGAA 2QQRA 2LX7A 1M27C 1JJ2S 1VIFA 2M0YA 2WSCE 1UNGD 1BI1A 2QTXA 4FYVB 4XU2A 2W99A 4RCCA 2FEIA 3A98A 5CR2A 1LVKA 1YJNQ 3OY9A 2OTJT 3I56A 3JRZA 3I9QA 3PO3S 1Y07A 5KCOA 3QDRB 5CKHA 3RERA 4C8QF 2IVWA 2F2VA 2PK2A 3UDCA 4BCGB 1UE9A 2YUQA 1UTIA 1VQ4T 2ROTA 1NYGA 4AKIA 3HHTB 3PT9A 2DEQA 4M75F 2FRWA 2DMEA 4CFUB 2VYTA 4AI6A 1YJNT 3OA6A 1KD1U 2ECZA 3TSZA 5IHYA 2QDYB 4PFPA 4DBQA 1KQSP 3ASKA 1TTHB 2V8KA 5HBJB 1K73R 3CD6Q 5GMKj 4OGEA 2JNGA 1BBZA 1GCQA 2J6OA 2HD0A 3A5ZB 1H8KA 4CFNB 3VRYA 3OYKA 1VQNQ 2IG0A 2NUZA 1I07A 4M6VA 2RF0A 2FPDA 2PUKB 3BDUA 3PVQA 1VQMQ 2EJFA 3H6ZA 1F1BB 3CCRQ 2K2VA 2V1QA 3CCMQ 1E7OA 3H4CA 2JMAA 4J9GA 3OBWA 2DXBA 1J3TA 2QDJA 2ZPBB 4Z6YA 4OB3B 1UGRB 4ZN1A 3Q1JA 1TH7A 3ZFJA 4JZ4A 2CH4W 1FMWA 2JTMA 3HRTA 4IIMA 1VQ7A 1NPPA 4F7JB 3RKXA 4RTVA 1QCFA 4II1A 2CGHA 2MMPA 4ROEA 2DXCB 2X1NB 4PNOA 4IKFA 3EHRA 3K7AM 1D09B 1VQOQ 3M4GA 2DMOA 2E5KA 3TQ7P 1GUXB 3QIIA 3M53A 4IURA 4BE2A 4O5VA 1N9SA 2YRVA 3VKIA 1IHVA 3I56Q 2MAMA 2E3HA 3RMQA 3J81E 1I5OB 1AWOA 2RQVA 1YJNA 3KBGA 3VS5A 1QP2A 2CS7A 3RDVA 1JJ2A 1JO8A 1XTDA 1M2VA 5CIUA 1P92A 2LMJA 3ZEHA 3QDFA 4M75A 1JRIA 4DOVA 4HXJA 4M78C 1X6OA 5KYXB 2PVOB 3I35A 5HKCA 1O9SA 4OB2B 4A54A 2GF7A 2XG8D 1VQ8Q 1T0HA 2KRSA 1NE8A 3EFRA 3OMGA 2HL3A 2DYBA 2MPXC 3QYBA 3CCLQ 3P8DA 4DA4A 1W2BA 3RNJA 4EC9B 3HBLA 4LDWA 1G83A 3LGFA 2DJQA 2OJ2A 1F5QB 1OL1B 3M56A 1M90C 2P0PA 1BIAA 1RAGB 1WJQA 1KC8R 1WJSA 4EORB 4JLIA 2E70A 2K7AA 1ABQA 2Y4YA 4BE0A 1AISB 4AFUC 3MHXA 3OYHA 1QLYA 4ELZC 3CC7A 2E65A 2WIHB 4N4IA 3I55T 1K0XA 2KSSA 1IO6A 2RD1A 4BD3A 2W9FA 3G7ZA 3TW6A 2HQEA 5DQWA 5LJ5f 2WHBB 2AK5A 4C0DB 4BI4A 2PJQA 4C8QD 3ULRB 1X01A 3M0UA 2V8IA 3PGGA 3QZ9B 2VC8A 4J7FA 3JSCA 3DJBA 3O5ZA 4EMKA 3DDQB 3G4SA 3S3OA 2X4XA 1RADB 2CSQA 3D7SB 1XNIA 2GTJA 2UZBB 4RTXA 5IDPB 1GH6B 4G6LB 2YUOA 1PD1A 1MUZA 4AT1B 4C92C 4BY1X 3JV3A 5GMKl 1AWWA 1M4ZA 1ZUYA 2MF2A 4EC8B 2DZ9A 4FYWB 3CCQQ 1VQMT 3OYGA 2NUPA 4NOYA 2DTIA 2W96A 3A8OB 4EONB 2LX9A 4KGZB 4QT7A 3I5RA 3MEAA 4HNTA 4JZ3A 3TSWA 1Y96B 2FRYA 5GAOn 3CCEA 1YJ9Q 1ZLMA 1H1QB 3CC4A 5LJ5d 2BKZB 5KYYA 1G3SA 4HNUA 4B6MA 1K0SA 1H24B 4F7UG 4J6WA 4IUTA 3CPFA 2EGCA 1BKBA 5EJCA 2QI2A 5ACBA 4Z8AA 2H8HA 1U8RA 1M3BA 1K9MR 1X75C 3EG0A 3MEUA 3X26B 4BCPB 3L2VA 4BCMD 5GANe 2BS4A 1Y57A 4OMLA 1KC8U 4HVUA 1S72T 5GAN3 5CVIA 3VKGA 2KBTA 3G71T 1VQKQ 3CC7Q 4M4ZA 2QEXT 2K5IA 1C1AA 2E12A 5GANf 1WDXA 2QTVA 3MPUB 4AMCA 2QAZA 2ED0A 2KGTA 2MCNA 1KXUA 4BDZA 5GAN8 2JW4A 4AG1C 1FXXA 1M5Q1 3VS3A 3J7AF 1QKXA 2FZGB 1QMCA 1YJWT 2K3YA 1Q82C 4JJDA 1PNJA 3I56T 1ZUUA 1ZA2B 2RK2A 1BB9A 4UC4A 2YLBA 5IDNB 5AYFA 4A4KA 2ZZDA 3V8KA 2D6FA 4PKCC 2ZGWA 3CCQT 1B7TA 2BS3A 1JSUB 4WF2A 4LN2A 2JGZB 3CCLT 4J9IA 3CCET 3B57A 1WFWA 3HSBA 4IMYB 2X4WA 2CREA 3V8LA 3V7RA 4E7JA 2NUTA 3BHUB 3CCRA 1FMVA 2FG0A 3A1PA 4CC2A 2KDSA 1JEGA 2WACA 2VASA 4EMKC 4BBRM 1JKWA 1S72Q 4J9EA 4QQ6A 2L3PA 1OZ3A 3GLXA 5IHIA 2LCSA 3CC2Q 2CUBA 4PJNA 5CYIB 1ACMB 1PD0A 1Q7YC 1ABOA 1V1CA 2EFIA 2D8JA 1ZA1B 3EHQA 3L2ZA 4X34A 3RGFB 1Q81R 3RKWA 4J9HA 3E2UA 5D7UA 2O88A 1KG1A 2MIOA 1RI0A 2O4XB 1JQQA 2AZVA 4F7UE 1U5SA 3DLMA 1M1KR 1GRIA 2D8HA 4M78E 4AKHA 1H1SB 1GCQC 4V2SA 2EVRA 1VQOA 5ICPB 3JB9D 1R77A 3CMAA 2XMFA 4E7LA 4KRCB 1AT1B 2HCKA 4MZMA 2AIRB 1O9KA 2DPPB 3QZ5B 1OKWB 4OF1A 4EOSB 1K9MU 2LJ0A 1TUGB 2OTLA 2LRQA 4L5GA 2YT6A 1AZGB 1YCYA 4QSHA 1BI0A 4R0KA 2DX1A 2LJ1A 1X6BA 4HCCA 1NLOC 2LCCA 1D3UB 4CFVB 3H8ZA 2QQ8A 2QEXA 2DBMA 4LE9A 1RAAB 3META 2FPFA 1RAIB 1EFNA 4E6RA 1HSQA 2MK5A 1Q81U 4CC3A 4TTHA 4OR5B 4B9XA 2MWOA 3BFMA 4A4HA 3L2UA 3SB2A 1LNXA 2KY9A 2RO0A 2WSFE 4NSTB 1WHHA 3UA6A 1BU1A 2OTJA 3HO8A 5CCAA 3ME9A 3OYNA 2GFUA 4M78F 1BCOA 4M75E 5LJ3f 4CC7A 4AFQC 1VYUA 2L3QA 2CUDA 1PCXA 3EG9A 2IW8B 1WIEA 4PJOE 3V7CA 1P5EB 3SWNC 1VQNT 2A28A 2E6ZA 2KK4A 3OS1A 1VOLA 3CCUQ 3GNGA 4JRPA 4JDSA 2YSQA 3CCJQ 2KVQG 1WQWA 1JXOA 2I0NA 1K73C 4OMMA 2CP2A 2CT3A 3EG3A 4EOMB 5GAMg 1WHGA 3BW1A 3CCMT 1WHKA 3OYDA 2WMBB 1N6AA 1VQMA 1OX8A 4HCKA 3JCMW 4J9DA 1PKDB 3QWYA 1H4LD 4C92A 4Z89A 2RMOA 1QMZB 4BB7A 3P8HA 2DM1A 1RAEB 3CPWA 2WSEE 5CAIA 1M1GA 2RJDA 4K11A 3DTOA 4EOQB 4EMKB 4C8QB 4JX5A 2HDAA 4BCIB 3GF5A 1QCOA 1Y96A 4ME7A 4LDXA 2CH4A 3OYAA 1H92A 2XU8A 2PU9B 1GXIE 4AFSC 4OB0B 2BZ8A 4PJOC 3QSUA 4PJOF 4PJOD 3CCQA 5GANh 5KYXA 4ROCA 2BKDN 2L2PA 4C5HA 1GY3B 3H0FA 4JLGA 4RKUE 1YWPA 5KYUB 1FINB 1Q86C 5KYWB 3CCJT 3MY5B 2G77A 1D1CA 1JBMA 1V76A 3VYGB 3VS1A 3OYIA 3OQ5A 2VV5A 4BY6B 4M77A 5CK9A 3QJYA 2C6TB 1SG5A 5GAOr 4E7SA 7AT1B 1VQ5A 3QHSA 4PL6A 1U06A 4XK8E 3JCMP 3QO3A 1M8MA 4XTVA 1BIBA 5D6WA 4CXAB 5CKFA 5I2MA 4HKEA 2YXYA 1XQHA 4C5EA 4GLKA 4I3ZB 3QYHB 2RB6A 5HCKA 1DJ7B 3G1JA 5FWBA 1QVFP 2ZAEA 3UATA 1K9AA 2KRMA 2RHZA 3C94A 5IXFA 1W98B 1LOJA 4Z88A 2BPMB 8AT1B 2EQUA 4CI0C 2V1RA 4M78D 4PJMA 1W6XA 5CEIB 1WHMA 3CCUA 2CCIB 2F1LA 2CP7A 4NS5A 4BBSM 4YOSA 3NTKA 4HNVA 1AWXA 3UPUA 3EGXA 3JCMQ 3ER0A 3NTIA 3SWNB 3EFOA 1YIJT 2DETA 2PUOB 3PNWC 4M75B 2KE9A 3QWLA 1VQ9T 2J6FA 1VQ7Q 4M7DD 2ZPIB 5I11A 1UJ0A 1OPLA 1UGVA 2LW4A 3LH5A 4XQ3A 2XIDA 1O75A 2E3IA 3M5AA 3NFCA 3C4SA 5I21A 3L1AA 4FIBA 2NYSA 2ZPGB 4XTUA 2P84A 4KUDK 4M7AG 2EIFA 1BYMA 1UNLD 1RUWA 1G3WA 2D1XA 3TVTA 2K4YA 1IXDA 3MP1A 5KE3A 1M1KC 4X1VA 2IW6B 2E6NA 2OX7A 2P0QA 4IUPA 4N4HA 2ZPHB 2GBQA 2AZSA 5A0GA 2XD0A 1X43A 1MMGA 1U1TA 3SWNA 5CQXA 5GANj 1H28B 2DF6A 2ZCFB 1BI3A 2IN3A 1KD1R 4JRKA 2DVEA 2DTHA 1IHWA 1NEBA 5EFQB 2O9SA 4BCNB 3M4YA 1VQ8T 1AOJA 4JUVA 2VWFA 3U23A 2H3EB 2HZYA 2A08A 2W9ZA 2MI6A 5GMKe 3TEEA 4BCQB 3HFOA 4FT2A 4HA8A 3VYHB 1MV3A 3KUFA 3CMAQ 2QQBA 2CKKA 5GAOm 2PMIB 1H1RB 1SRMA 1VQ7T 1RAHB 3SD4A 3TN8B 1UEBA 1TWBA 5IXBA 3EGDA 2V8JA 5EG2A 3X24B 3EG2A 3LW5E 4OMPA 1CKAA 3NTHA 3MEWA 2VXFA 1YJ9T 1B34A 2NWMA 1WJRA 4BCKB 5GAOq 3VS0A 4MIMA 3DL1A 1FYNA 2HSPA 4J5YA 3R6NA 2VGMA 1NEGA 2PVDB 2JZ2A 2O31A 2KROA 5GAN7 2YUNA 1AEYA 1C6VX 1OOTA 2NLUA 2KMGA 4HCBA 2K5LA 5LJ3g 2EKHA 4RG2A 2A3LA 3H0IA 2AKLA 2OTJQ 3ZBDA 2HSEB 1V29B 1MMNA 4XTXA 2FO0A 4GBQA 4EOIB 2K5FA 4RUGA 2DRKA 1VYWB 5J3BA 2E10A 3CC4T 1RACB 2L3SA 2P4RA 4R55A 1RLPC 3G6EQ 2NUPB 2XHCA 3CCUT 3M0PA 4HT9A 2DXUA 4RTWA 2KQWA 2KMTA 4ZGJB 1TD6A 1RLQC 4YC3B 4C0FA 3LWIA 1PSEA 1WLPB 3MP8A 3OW2S 5KCHA 5L8RE 3HZJA 2DRMA 3EIDB 2M51A 1TFBA 2Y90A 5GAN2 4CFWB 2FYKA 1UGQB 2X4YA 3NPFA 2EQMA 3EOCB 4Q5WA 4PJOG 3MKDA 4E2FB 1E7PA 3CEYA 3DKMA 2F2XA 1OGUB 1YI2Q 2HQHA 1HK9A 1SHGA 4A53A 4XU3A 3CCST 2K6DA 4OP0A 2QFZA 3JB9J 4M78A 5FGKB 3OW2P 3OW2A 3EH2A 4FSSA 3CPWP 1QW1A 1QKWA 1YITA 1WPYA 2CCHB 4M77F 1N8RU 1QCNA 1TG0A 5CQYA 2DL3A 5IF1B 1WHJA 2LT4A 3MP6A 1NJIC 1N8RR 3S6WA 5KYWA 4RODA 1ZUKA 3QUIA 4C8QA 3OYYA 2KYBA 1YITQ 1YIJA 3MEVA 4CFMB 1NBEB 1B3QA 1E6HA 2LQ8A 2QYZA 3KXTA 1VYTA 2QEXQ 4EPCA 1R8OB 2M02A 1VA7A 5IT9E 2KYMA 4DBFA 2EYWA 2QDLA 2SEMA 3JCMc 2QQSA 1Q82R 3FJPA 1PRMC 1OIYB 4II5B 5KYNA 3CBPA 3HL8A 3A8MB 3CD6T 3CQTA 2EYQA 2DERA 4A63B 5D6XA 5J39A 4EMHA 4L59A 4JJNK 2B9RA 2Z0WA 3V7SA 1QVGP 2RPNA 2DE0X 1TS9A 1AD5A 1PKSA 2K2MA 4LXCA 5HY6A 3VUZA 2KAFA 2IW9B 1UFFA 3QG1A 5FW9A 5GJVB 1OPKA 4J83A 2JJ9A 3POMA 1M2VB 5EC7A 4C8QG 3JCMe 4HLQA 2JS2A 4KT0E 2UZEB 3CCJA 2GNCA 2E64A 3X20B 2KXDA 4BCHB 4EOJB 2DL8A 2C5VB 3H41A 4MMLA 3QBYA 2DO3A 4BCND 2ESWA 4XAXB 4RTTA 1QVFA 1R0BG 1Q7YU 2C5XB 4M75D 1VQ5T 3HFNA 1ENWA 1NYFA 2DNUA 2EQKA 1YJWQ 1W2BP 1SSFA 3TW7A 2OAWA 4CRIA 3BY7A 4KULA 1JSTB 4RTYA 4X9DA 2R58A 4UN0A 3M9QA 1YI2A 3JCMV 4M7DC 2X3XD 4P5NA 3GOXA 2F5TX 5HQ0B 2COWA 1VQLA 3HKSA 2FL7A 2DIQA 3DB4A 1G3TA 1OIUB 4CFUD 1YHQT 1ZSZC 2FZKB 1W1FA 4ORZA 2A37A 2XDDA 1TOVA 4MZTA 5KE2A 4A4GA 1G5VA 4C92B 4WTOB 4XTWA 3FJ5A 2YRDA 1URCB 1M9SA 1MMAA
chains in the Genus database with same CATH topology
3E19A 1K73C 3M54A 2EQJA 4M7AD 3CMET 3LWHA 5DLOA 1YBYA 2VYTA 3BW1A 2DXCA 5GAMg 3CCMT 4AI6A 3OYDA 1N6AA 1FX7A 3LYIA 1YJNT 3OA6A 4Y91A 1KD1U 1VQMA 3JCMW 1Q86U 4AKGA 3E1SA 2VGNA 3JCMd 2QDYB 5LJ3h 4C92A 4EDUA 3ASKA 4BB7A 2V8KA 3P8HA 4F7UF 4NL3A 3X28B 5GMKj 4M77G 3CPWA 2WSEE 4OGEA 1M1GA 2JNGA 5CAIA 2RJDA 4JS4A 2FHDA 3OB9A 4EMKB 2HD0A 3A5ZB 4C8QB 2XICA 4JX5A 3L42A 3OYKA 2JUFA 2HAXA 2IG0A 4BDYA 4E7IA 2LDMA 2JOYA 3GF5A 4M6VA 1Y96A 3WVDB 3VU3C 2PUKB 3BDUA 4BI3A 4Z02A 4PJOB 2RJCA 3T9NA 1NPRA 3OS5A 2M1HA 2EJFA 4ME7A 3H6ZA 1WGSA 3PMIA 1KQ1A 4D6WA 2K2VA 2P4TA 1KC8C 4LDXA 3CMAT 3A8GB 3OYAA 1LJOA 3H4CA 2L8DA 2XU8A 3GP8A 2JTFA 2PU9B 1GXIE 3OBWA 3TREA 2DXBA 3PMTA 5FLXE 4OB0B 1ZHIA 3VYGA 3DB3A 3CMEA 4PJOC 3QSUA 2QDJA 2ZPBB 1RL2A 4PJOF 4Z6YA 5LJ3e 4OB3B 1UGRB 4MDWA 4ZN1A 4PJOD 3Q1JA 1TH7A 2DD5A 3ZFJA 2QF7A 3OYCA 3CCQA 1K73U 3JB9H 5GANh 4L6V5 5GANg 2JTMA 2BKDN 2L3RA 3HRTA 1VQ7A 4QVDA 1NPPA 4C5HA 3G71A 1NZ9A 3RKXA 4JLGA 4RKUE 2QA4T 4FM4B 1FKMA 3AHUA 5FU7C 1KHIA 4II1A 1Q86C 3CCJT 2G77A 4C92G 3S3MA 1JBMA 2CGHA 2MMPA 1YITT 3CCLA 3VYGB 4OB1B 4C8QC 2DXCB 5LJ5h 4MZPA 3OYIA 1QVGA 1Q82U 3OQ5A 4XTZA 4PNOA 5I2SA 2VV5A 4BY6B 4M77A 5CK9A 5GAMh 4IKFA 3QJYA 1K8AC 3E9GA 2DTOA 5GAOr 4A4FA 3M4GA 4R56A 3L2QA 3QIIA 2YLCA 5GAMf 1VQ5A 5FRMA 3M53A 2RA2A 3QHSA 3C95A 3VV0A 4PL6A 4IURA 4BE2A 4O5VA 1G3YA 1N9SA 2YRVA 3R6OA 4XK8E 1JB0E 3VKIA 5IAYA 2C06A 1W4SA 4RCBA 3JCMP 2MAMA 3QO3A 1I8FA 3X25B 3RMQA 1VQLT 4XTVA 3J81E 1BIBA 5D6WA 5CKFA 5CKEA 5I2MA 2DZCA 5LJ5j 3EFSA 4HKEA 5J26A 1YJNA 1XQHA 1KQ2A 3KBGA 2DD4A 4C5EA 4GLKA 3RMSA 1WQ7A 5GAN5 3QYHB 1OYXA 1QP2A 2CS7A 2RB6A 1I5LA 1H3ZA 1DJ7B 1N9RA 3RIRA 5GAMj 1JJ2A 1OI1A 4J7IA 3TCJA 1XTDA 4IUQA 4N0AA 2RI2A 5CIUA 4PLIA 3G6EA 3CCVA 2RHZA 3C94A 2QA4A 1LOJA 3L2RA 1EIFA 1P92A 4M7AC 3ZEHA 2EQUA 4OGCA 2RH2A 2F5KA 4CI0C 4M78D 3WXMB 4DOWA 3CXCS 3FDRA 1YJ9A 4M75A 4HT8A 3OYFA 1JRIA 4MFEA 2FVUA 4DOVA 4M78C 1X6OA 3V8JA 2PVOB 5HKCA 3CCUA 1O9SA 2ZPFB 4OB2B 2RJFA 4A54A 2GF7A 2OAUA 4NS5A 4BBSM 2XG8D 2DKGA 1VQ6A 5DLQE 3NTKA 2E5QA 4HNVA 1NE8A 3EFRA 4IUVA 3UPUA 3OMGA 3JCMQ 3KHIA 3ER0A 4M75F 3NTIA 2XDBA 3SWNB 1FWZA 5FROA 3QYBA 5GMKh 3P8DA 1YIJT 4DA4A 2JVVA 1W2BA 1K8AU 3HBLA 2PUOB 5GANd 3PNWC 4M75B 1AHJB 4LDWA 3OBYA 3QWLA 3LGFA 1VQ9T 1VQPA 1N27A 1UGSB 2DJZA 4M7DD 2ZPIB 3M56A 1M90C 2P0PA 1BIAA 1WJQA 1WJSA 4JLIA 4XQ3A 2E70A 3GNFB 3JCMf 2XIDA 2EWNA 1O75A 2Y4YA 4M7DE 4BE0A 1PSFA 3M5AA 3NFCA 3C4SA 3MHXA 2VXEA 3OYHA 5I21A 3L1AA 4ELZC 3CC7A 4FIBA 1HXDA 2E65A 1U1SA 1VIEA 3OYMA 4C0GA 2ZPGB 4N4IA 4XTUA 3OS0A 3I55T 3RESA 4E47A 3DLLA 1M8VA 4M7DF 4KUDK 4JRIA 2KSSA 2EIFA 3I55A 4M7AG 4BD3A 2RD1A 1BYMA 2FB7A 3G7ZA 3TW6A 1G3WA 4QW2A 2HQEA 2LVMA 3JB9G 2K4YA 3QPHA 4F7UB 3MP1A 5LJ3d 2EAYA 5LJ5f 5KE3A 1M1KC 2E6NA 2P0QA 4N4HA 4IUPA 4BI4A 4C0DB 2ZPHB 4Y28E 2HQXA 4C8QD 5A0GA 2Y4XA 4QVCA 2XD0A 4M7AE 1X01A 1U1TA 2V8IA 3PGGA 4J6YA 3SWNA 3QZ9B 4QVZA 5CQXA 4M77D 1D3BB 5GANj 4M7DA 2LTOA 2VC8A 2ZCFB 2BS2A 1BI3A 1QP3A 2LNVA 3JSCA 2DVEA 2DTHA 4J6XA 4J7FA 4JRKA 4EMKA 1VQ8A 1VQ9A 4FSXA 5FU6C 4ATOA 1YHQA 3M4YA 1VQ8T 3LH0A 5CKBA 4FL6A 3G4SA 4JUVA 3S3OA 3JCMb 4HL4A 2X4XA 3MCAB 4M77E 4KBMB 2R5MA 1XNIA 1KHCA 4FU6A 2MI6A 5GMKe 1M90U 3TEEA 4XTYA 2KVQG 4B9WA 2K3XA 4C0DC 1D3BA 3HFOA 4FT2A 4HA8A 4C92C 3VYHB 4ELYC 3FC3A 4JRQA 1YJWA 2P0KA 4NL2A 3KUFA 5GMKl 2XKOC 1M4ZA 2LQKA 2MF2A 3A8LB 2QQBA 1NJIU 2DZ9A 2O01E 2X35A 3BG9A 2QQ9A 3OYGA 2CKKA 1VQMT 2L89A 4NOYA 5GAOm 2DTIA 4N4GA 4KUIA 5DY9A 4BY6C 3A8OB 3PIPA 1VQ7T 2LX9A 4M7AA 3JB9I 3SD4A 1MHNA 1UEBA 4HNTA 3MEAA 1Y96B 2GFAA 2VUBA 2EKOA 2V8JA 5GAOn 5EG2A 3CCEA 2ZZDB 3X24B 5CO7A 3CC4A 5LJ5d 4C5IA 1VQKA 3CD6A 3LLRA 3LGLA 3LW5E 3OYJA 3HB9A 3NTHA 4LD6A 3MEWA 2VXFA 4ZTFA 1B34A 2RHXA 1YJ9T 1VQPT 2K57A 4M7DB 1OZ2A 1G3SA 1WJRA 4HNUA 2ZPEB 1MGQA 5GAOq 4NC6A 4A4EA 4MFDA 4MIMA 3G6ET 3DL1A 3CCVT 4F7UG 4J6WA 4M75G 4IUTA 3CPFA 3LX7A 4ZTJA 5FRNA 4J5YA 2VGMA 2PVDB 1BKBA 2JZ2A 2LT1A 3M57A 1KQSA 5EJCA 2RM4A 5GAN7 4LD9K 2QI2A 3E9FA 4RG8A 2MWPA 2NLUA 3FRNA 1U8RA 2KMGA 4HCBA 1UGPB 4EMGA 2K5LA 5LJ3g 4RG2A 2A3LA 1X75C 3MEUA 4N0AC 3ZBDA 3X26B 2QXFA 2F69A 1V29B 5GAMd 2JN0A 4XTXA 3L2VA 5GANe 2BS4A 3HRSA 1H641 4OVAA 3VJPA 2LCLA 1KC8U 2K5FA 1S72T 2XI9A 3CBOA 4LDVA 5J3BA 4DQ2A 2E10A 5GAN3 5CVIA 1N8RC 1K9MC 3VKGA 3G71T 3C12A 4PLLA 4C5GA 3JCMJ 1S72A 2OTLT 4BI8B 2QEXT 2K5IA 3JB9F 2E12A 3CC4T 3CC7T 1I4K1 5GANf 3OSVA 1KQSS 3PTAA 3CC2T 4R55A 2D9TA 4JX6A 2M16A 3UWNA 3L2WA 2RI3A 2XHCA 3CCUT 4HT9A 1VUBA 2DXBB 1Y7XA 3OYLA 2DXUA 2M9UA 4BDZA 2KQWA 4HCZA 2E41A 2KMTA 4ZGJB 5GAN8 1I81A 2GCXA 3LWIA 4C0FA 3OW2S 1PSEA 3MP8A 3A8HB 3M55A 5KCHA 1FXXA 1M5Q1 4GY5A 3HZJA 5L8RE 3CPWS 4BE1A 3J7AF 4M77C 5GAN2 2Y90A 1YJWT 2K3YA 1Q82C 1UB4A 2E1HA 2FYKA 5DM7R 1UGQB 3I56T 2X4YA 2CYZB 2RK2A 3PIOA 2EQMA 4UC4A 2YLBA 4TVRA 4Q5WA 5AYFA 4PJOG 3S3NA 1YI2T 4A4KA 1E7PA 2ZZDA 3CEYA 3DKMA 4PKCC 3V8KA 4BACA 2D6FA 4LDUA 2ZGWA 1HK9A 4A53A 3BG5A 4MDXA 4XU3A 3CCST 3CCQT 4OP0A 5A0LA 4M7DG 5LJ5g 2BS3A 3TU4K 2QFZA 3HPWA 4OMFB 4WF2A 2LC4A 3G4ST 3JB9J 4M78A 3CCLT 5LL6S 3CCET 3HSBA 3OMCA 3OW2A 4RMOA 4C92D 3FB9A 3VUBA 1QW1A 2X4WA 2HBPA 3BDLA 2DD4B 3HP9A 1WPYA 4M78B 4IUUA 3CCRT 1YITA 4M77F 3V8LA 3FIFA 4M77B 3V7RA 5GAOl 4E7JA 4J8OA 1N8RU 3CCRA 3CBMA 5CQYA 3CXCA 3P8BB 2LT4A 3MP6A 2CZ7B 1NJIC 3S6WA 1QLBA 2XK0A 3M58A 4QQGA 3QUIA 4C8QA 4C8QE 3URGA 3QXEB 3OYYA 3VKHA 1IZ6A 2KDSA 3FLGA 5FU7B 2WACA 3M59A 3F70A 5GAOp 4EMKC 3OYEA 4BBRM 4M75C 1YIJA 3MEVA 4M7AF 4QQ6A 1OZ3A 2LQ8A 3GLXA 3KXTA 3N5BB 1XOVA 1Q7YC 4EPCA 3QYEA 2BUDA 4XU0A 2EFIA 2BIVA 1R8OB 3O8VA 1VQKT 5IT9E 4JX4A 3JCMX 3J80E 4O6JA 2I2LA 1BI2A 3JCMc 3BG3A 1ZBXA 2PQWA 2QQSA 3L2ZA 3FJPA 4X34A 3CCSA 3RKWA 5LJ3j 4ELJA 2D0QB 1ZQ1A 4PJOA 3CBPA 1VQNA 2DAQA 2RHIA 1KG1A 5GAMe 1Y71A 3A8MB 3HL8A 1RI0A 4VUBA 5GAN6 3FEOA 4ZN3A 2O4XB 3CD6T 5C6SA 2EYQA 4F7UA 3QYGB 5D6XA 4F7UE 2CZ6B 5A2QE 3DLMA 2EJ9A 4M78G 4XU1A 1WNLA 4C92E 4EMHA 4L59A 4M78E 3INZA 5J39A 4AKHA 2DIGA 5GAN4 1B34B 4JJNK 4JS5A 3V7SA 5HK0A 2RI5A 2RK1A 1Q81C 2GQVA 4ZGEB 4V2SA 2RHUA 3QJ6A 5HY6A 3VUZA 5KH6A 2KAFA 2R5AA 1VQOA 3JB9D 3QG1A 3CMAA 1VQ6T 4E7LA 5M9OA 4E7HA 2QQAA 3UT1A 5IN1A 2DK3A 1M1FA 4J83A 3SDZA 3GIBA 4MZMA 4M7AB 2L5QA 2DPPB 4C0ZA 3QZ5B 3HRUA 1W2BS 4OF1A 1K9MU 4C8QG 5C0MA 1IREB 5A0DA 4X9CA 3JCMh 3RUXA 4HLQA 3JCMe 3QKJA 2EJGA 3OSSC 4KT0E 2LRQA 3JCMg 1QVGS 4L5GA 3CCJA 2RJEA 2OTLA 2M0OA 1YCYA 4QSHA 2CZ1B 3GPLA 2E64A 3SFMA 3X20B 1BI0A 5CKDA 5GMKi 2KR6A 4MMLA 2DO3A 3QBYA 2A7YA 4LOCA 4MMKA 3OYBA 1M1KU 4XAXB 4HCCA 3WVEB 2CZ0B 1QVFA 2LCCA 3H8ZA 1Q7YU 2PVGB 4M75D 2AHJB 1VQ4A 2QQ8A 2QEXA 1KD1C 3HFNA 1VQ5T 2EQKA 2X4JA 2R57A 3META 4QQDA 4C92F 3JAME 2HNIA 3CC2A 1SSFA 3TW7A 1QVFS 4E7KA 2O4XA 2QQRA 4CRIA 1Q81U 3BY7A 4KULA 3CCMA 4B9XA 2MWOA 1JJ2S 3BFMA 1VIFA 4A4HA 4X9DA 2WSCE 1BI1A 2QTXA 2R58A 4XU2A 3L2UA 4LDYA 3M9QA 4RCCA 1YI2A 5HK3A 3SB2A 1LNXA 4FT4A 3JCMV 4M7DC 2KY9A 2RO0A 2WSFE 5CR2A 1VQOT 4P5NA 2WJ9A 3GOXA 5D6YA 2OTJA 2F5TX 3HO8A 5CCAA 3ME9A 1VQLA 3HKSA 2G3RA 2FL7A 3OY9A 3I56A 3OS2A 3OYNA 2OTJT 2GFUA 3JRZA 2DIQA 4M78F 3DB4A 3EAEA 1Y07A 4M75E 1G3TA 1QVPA 2RHYA 5KCOA 5LJ3f 3QDRB 5CKHA 1YHQT 3RERA 3PFSA 4C8QF 5GMKm 2XDPA 2XDDA 3RKYA 4ZGDB 2IVWA 4PJOE 3UDCA 2DD5B 4MZTA 5FU6B 3V7CA 4A4GA 4BUGA 3SWNC 4YTLA 2B8AA 5KE2A 1VQNT 1G5VA 3MO8A 2E6ZA 2H3JA 2KK4A 4C92B 3OS1A 2DXTA 3GNGA 1VQ4T 4XTWA 5LJ5e 4JRPA 4AKIA 4JDSA 3HHTB 2YHTA 3PT9A 2DEQA 1WQWA 1M9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 E;  2DXC A;  2PVO B;  2ZPE B;  2ZPF B;  4OB2 B;  2D0Q B;  2QDY B;  2PVD B;  3A8M B;  3X28 B;  2WSE E;  3QYG B;  2CZ6 B;  2PUO B;  1AHJ B;  1UGP B;  1UGS B;  3X26 B;  2ZPI B;  4ZGE B;  1V29 B;  3WVD B;  2PUK B;  1PSF A;  3A8G B;  2DPP B;  3QZ5 B;  1IRE B;  2PU9 B;  1GXI E;  2DXB A;  4KT0 E;  2ZPG B;  4OB0 B;  3VYG A;  2ZPB B;  2CZ1 B;  4OB3 B;  1UGR B;  3X20 B;  2DD5 A;  2DXB B;  4L6V 5;  4ZGJ B;  3WVE B;  2CZ0 B;  2PVG B;  2AHJ B;  1PSE A;  4RKU E;  3A8H B;  4FM4 B;  2ZPH B;  4Y28 E;  5L8R E;  3VYG B;  4OB1 B;  2DXC B;  3QZ9 B;  1UGQ B;  2CYZ B;  2ZCF B;  1QP3 A;  2WSC E;  2ZZD A;  2WSF E;  4XK8 E;  1JB0 E;  3X25 B;  2DD4 B;  3VYH B;  3A8L B;  2O01 E;  2CZ7 B;  2DD4 A;  4ZGD B;  3QYH B;  1QP2 A;  2DD5 B;  1DJ7 B;  3A8O B;  3QXE B;  3HHT B;  2ZZD B;  3X24 B; 
#chains in the Genus database with same CATH topology
 3QHR B;  3E19 A;  3CME T;  3LWH A;  1YBY A;  1FX7 A;  4WCI A;  4FW2 A;  2IVX A;  4Y91 A;  4KGX B;  1X69 A;  3H9N A;  4AKG A;  2VGN A;  3JCM d;  4EDU A;  1SHF A;  4NL3 A;  4F7U F;  1GFC A;  1N4M A;  1MMD A;  4JS4 A;  2FHD A;  3OB9 A;  3SEM A;  3MY1 B;  2QA4 Q;  2JUF A;  4ELL A;  1IB8 A;  1BU2 A;  1WX6 A;  3WVD B;  2G6F X;  3VU3 C;  2R7G A;  2B86 A;  4Z02 A;  4BI3 A;  2RJC A;  4PJO B;  1NPR A;  1VQ9 Q;  3PMI A;  3UF4 A;  4D6W A;  2P4T A;  4J9F A;  1KC8 C;  1LJO A;  2L8D A;  3GP8 A;  2COY A;  2JTF A;  2DLP A;  3VYG A;  1ZHI A;  5LJ3 e;  1RL2 A;  1WA7 A;  2DD5 A;  2MOX A;  2QF7 A;  3I55 Q;  2L3R A;  1VQP Q;  2KR3 A;  2KXC A;  2X9H A;  1NZ9 A;  2FPE A;  1M3A A;  2QA4 T;  3HTR A;  3AHU A;  5FU7 C;  1KHI A;  4PFZ A;  1YIT T;  1M8V A;  3S3M A;  3CCL A;  5LJ5 h;  4C8Q C;  4MZP A;  4F17 A;  1QVG A;  2QG9 B;  1Q82 U;  3M0S A;  4XTZ A;  5GAM h;  1B07 A;  1K8A C;  4A4F A;  2L0A A;  1YHQ Q;  2WPA B;  3UA7 A;  5FRM A;  2RA2 A;  3VV0 A;  1YFN A;  2J05 A;  3R6O A;  5IAY A;  2DL5 A;  1AZE A;  1W4S A;  4RCB A;  1GCP A;  5HNB B;  1I8F A;  5CKE A;  1PG5 B;  1OL2 B;  3CCS Q;  1KQ2 A;  2PNI A;  9ATC B;  2DD4 A;  3RMS A;  4OGR B;  3TCJ A;  4IUQ A;  3G6E A;  2RI2 A;  3VS4 A;  4PLI A;  1ARK A;  3L2R A;  1EIF A;  4M7A C;  4OGC A;  1WI7 A;  2RH2 A;  2CP6 A;  4BCJ B;  3WXM B;  3CXC S;  4HT8 A;  4F7L B;  1ZSG A;  2RQT A;  1BCM A;  3V8J A;  5IH2 A;  5IHK A;  2ZPF B;  1X6G A;  2RJF A;  1MV0 B;  2OAU A;  2BE7 D;  1X27 A;  1VQ6 A;  1AWJ A;  1K4U S;  2LP5 A;  3BE3 A;  5DLQ E;  2E5Q A;  1YCS B;  3KHI A;  1T3S A;  2ATC B;  1JU5 C;  1FWZ A;  5FRO A;  2RN8 A;  4KGV B;  2JVV A;  6AT1 B;  4OMQ A;  2GQI A;  5GAN d;  5I5Z B;  3OBY A;  1KIK A;  2EYZ A;  1PKT A;  1UHF A;  2PZ1 A;  1PSF A;  1D1B A;  2VXE A;  1JXM A;  1HXD A;  1VIE A;  3OYM A;  4EOL B;  2VVK A;  3RES A;  4E47 A;  5HBE B;  3DLL A;  4JRI A;  4D8K A;  3H0H A;  2FB7 A;  4ANJ A;  1XJW B;  4F7U B;  5LJ3 d;  2EAY A;  2OTL Q;  2J7I A;  4Y28 E;  2CDT A;  4QVC A;  4M7A E;  1VOM A;  2RQR A;  4QVZ A;  4M7D A;  2MYS A;  2LNV A;  2BS2 A;  1UG1 A;  4J6X A;  1VQP A;  1Q81 C;  1VQ9 A;  1Y0M A;  3EH1 A;  5FU6 C;  4ATO A;  4HVV A;  3LH0 A;  4FL6 A;  5KYY B;  2JM9 A;  3JCM b;  4HL4 A;  1TUD A;  2R5M A;  2LNH B;  1M90 U;  1D0X A;  3M0R A;  2LJ3 A;  2C5O B;  4B9W A;  2K3X A;  1D3B A;  3FC3 A;  4JRQ A;  1WXU A;  3BLQ B;  4ELY C;  2EYY A;  2XKO C;  5L23 A;  2O01 E;  2X35 A;  2I53 A;  2QQ9 A;  1E9H B;  2K9G A;  4KUI A;  1SSH A;  2GGR A;  5DY9 A;  4BY6 C;  3PIP A;  2LZ6 B;  1MHN A;  1ZP2 A;  1OKV B;  2GFA A;  2LQW A;  2CT4 A;  5CO7 A;  2DFU A;  2KRN A;  4C5I A;  2QGG A;  1VQK A;  3LLR A;  3CD6 A;  2WEV B;  4ZTF A;  4M7D B;  4BCQ D;  2K57 A;  3G4S Q;  2ZPE B;  1MGQ A;  4NC6 A;  4JJB A;  4A4E A;  4MFD A;  3G6E T;  2BE9 B;  3MI9 B;  4ZTJ A;  3LX7 A;  3M57 A;  1KQS A;  2LT1 A;  1ZSZ A;  3CME Q;  3M0T A;  4LD9 K;  2HKN A;  4RG8 A;  1RI9 A;  1UGP B;  2JM8 A;  4EMG A;  1W70 A;  4ESR A;  3I5S A;  1T3L A;  2BTT A;  2F69 A;  1OUL A;  2JN0 A;  2ED1 A;  3SHW A;  1WYX A;  1KK7 A;  1JJ2 P;  4OVA A;  4HVW A;  3VJP A;  5FWC A;  2LCL A;  1ZX6 A;  1M30 A;  2W10 A;  2XI9 A;  1C0M A;  3CBO A;  4LDV A;  4DQ2 A;  1K9M C;  2F2W A;  4CRL B;  2YRC A;  4PLL A;  4C5G A;  1S72 A;  2OTL T;  2E4H A;  3C0C A;  3JB9 F;  1TSF A;  2X3W D;  3BLR B;  1I4K 1;  3CC7 T;  4OMN A;  3OSV A;  3PTA A;  1TUC A;  3CCV Q;  3UWN A;  1AD6 A;  2RI3 A;  2V26 A;  3AT1 B;  1Y7X A;  2DL7 A;  3EFO B;  4HCZ A;  2NUT B;  1K8A R;  4F7N B;  1I81 A;  3A8H B;  3M55 A;  4GY5 A;  4M77 C;  3NMZ C;  3RBB B;  1UB4 A;  5DM7 R;  3PVL A;  1VQ5 Q;  2CYZ B;  1G3N C;  3S3N A;  4RTU A;  1RAF B;  4BAC A;  4LDU A;  4E7Z A;  1TXQ A;  5A0L A;  4OMF B;  1Q95 G;  3G4S T;  2J6K A;  3OMC A;  4PK4 A;  3THK A;  1OU8 A;  4RMO A;  1NJI R;  2RQW A;  1UNH D;  2CP3 A;  2HBP A;  3BDL A;  2DD4 B;  3HP9 A;  4JPB W;  3CCR T;  2EYX A;  1M2O A;  3FIF A;  4M77 B;  4J8O A;  3CXC A;  1OX9 A;  3M58 A;  4YOZ A;  4C8Q E;  3URG A;  3IQL A;  1H26 B;  4Y72 B;  1IZ6 A;  5FU7 B;  4F16 A;  2UUE B;  3M59 A;  3OYE A;  1H1P B;  4EOK B;  4FYX B;  4M7A F;  1PHT A;  1I1J A;  2F2C A;  1XOV A;  1GUX A;  3QYE A;  4XU0 A;  1E6G A;  1HYO A;  4KH0 B;  2KT8 A;  2JT4 A;  2K3B A;  3J80 E;  2I2L A;  1OQK A;  1ZBX A;  2PQW A;  1ZQ1 A;  3ZL7 C;  1PM3 A;  2DAQ A;  5GAM e;  1Y71 A;  1MND A;  4VUB A;  5GAN 6;  3FEO A;  2SRC A;  4FYY B;  1YWO A;  5C6S A;  1YN8 A;  3QYG B;  4F6W B;  4XU1 A;  1WNL A;  4C92 E;  4MDX A;  4JS5 A;  1VQL Q;  5HK0 A;  2QGS A;  4ZNX A;  3LQ5 B;  1D1A A;  2AT1 B;  2GQV A;  3QJ6 A;  2EBP A;  1HJD A;  2R5A A;  2QAS A;  4KRD B;  1QWF A;  1VQ6 T;  3UT1 A;  3GIB A;  4M7A B;  2L5Q A;  4RTZ A;  2ENM A;  3HRU A;  1IRE B;  4X9C A;  3QKJ A;  1Z9Z A;  3JCM g;  1QVG S;  4CC4 B;  2RJE A;  2M0O A;  4F6U B;  3M03 A;  2WMA B;  3SFM A;  2O9V A;  5GMK i;  1EX4 A;  1IRX A;  4MMK A;  3OYB A;  2CZ0 B;  2YDL A;  3QWX X;  1VQ4 A;  5L2W B;  2AHJ B;  1KD1 C;  2X4J A;  3JAM E;  2R57 A;  1FVV B;  3CC2 A;  5AT1 B;  2O4X A;  1NG2 A;  1LPL A;  2A36 A;  3CCM A;  1VIN A;  3GTM S;  4LDY A;  5HK3 A;  4FT4 A;  1WXT A;  4KH1 B;  3G33 B;  1VQO T;  2WJ9 A;  4F6S B;  5D6Y A;  2VKN A;  5GJW B;  2G3R A;  3OS2 A;  1OI9 B;  3EAE A;  1QVP A;  2RHY A;  1BK2 A;  2O2O A;  3PFS A;  1I0C A;  2BZX A;  5GMK m;  1UEC A;  2XDP A;  4FCY A;  3RKY A;  4ZGD B;  1OV3 A;  2DD5 B;  4BUG A;  5FU6 B;  4YTL A;  2B8A A;  3MO8 A;  3EG9 B;  2H3J A;  2DXT A;  4F7S B;  5LJ5 e;  1M90 R;  1S1N A;  2YHT A;  4BE1 A;  4F04 B;  3M54 A;  2EQJ A;  4M7A D;  5DLO A;  2DBK A;  2DXC A;  2C4G B;  1WHL A;  2FZC B;  2KT1 A;  3LYI A;  1SF9 A;  1N5Z A;  1Q86 U;  3E1S A;  5LJ3 h;  4J9B A;  2JTE A;  3X28 B;  3REB B;  4M77 G;  4BXX X;  4DEY A;  4JJC A;  2XIC A;  3L42 A;  1XO2 A;  2HAX A;  1GBR A;  4BDY A;  4E7I A;  2LDM A;  2JOY A;  5LMK B;  1TU0 B;  3T9N A;  3OS5 A;  2M1H A;  2WFY B;  1WGS A;  1GL5 A;  1KQ1 A;  5ECA A;  3CMA T;  3A8G B;  3MIA B;  1KSW A;  1RAB B;  5BNJ B;  4PJJ A;  3TRE A;  3PMT A;  5FLX E;  1H3H A;  3DB3 A;  1O9K B;  3CME A;  4MDW A;  2EPD A;  3OYC A;  1K73 U;  4DEX A;  4L6V 5;  5GAN g;  2HMA A;  4QVD A;  1CSK A;  3G71 A;  4FM4 B;  1H27 B;  1FKM A;  4BY7 X;  3VS7 A;  4C92 G;  4DBR A;  3BLH B;  4OB1 B;  2JXB A;  5I2S A;  1G2B A;  3EG1 A;  3EGU A;  3E9G A;  2DTO A;  4R56 A;  3L2Q A;  4F14 A;  2YLC A;  5GAM f;  2WIP B;  3C95 A;  4AG2 C;  1G3Y A;  1JB0 E;  5DQV A;  2C06 A;  1VQL T;  3X25 B;  2IIM A;  5LJ5 j;  2DZC A;  4GLM A;  3EFS A;  2ROL A;  2AKK A;  3M0Q A;  5J26 A;  2JS0 A;  3CXC P;  1WQ7 A;  5GAN 5;  1M3C A;  1OYX A;  1I5L A;  1H3Z A;  4LNP A;  1K1Z A;  1N9R A;  3RIR A;  1C9B A;  5GAM j;  1OI1 A;  4J7I A;  1A0N B;  2C5N B;  4N0A A;  3CCV A;  2QA4 A;  3NHN A;  2COZ A;  2F5K A;  1YJ9 A;  4DOW A;  3FDR A;  2GTO A;  3OYF A;  4MFE A;  2FVU A;  2IPO B;  1EZZ B;  3EGX B;  2ABL A;  2EUF A;  2DKG A;  1NLP C;  3EGD B;  2EGE A;  4IUV A;  2CP0 A;  2YWW A;  1SRL A;  2XDB A;  2K79 A;  5GMK h;  3BHV B;  3VS6 A;  1K8A U;  2DL4 A;  1YIJ Q;  1AHJ B;  4FW1 A;  3REA B;  2X51 A;  1N27 A;  1UGS B;  2DJZ A;  2D0N A;  3GNF B;  3JCM f;  2BZY A;  1YP5 A;  2EWN A;  3MJX A;  4M7D E;  4PFO A;  3VS2 A;  4EOO B;  2EQI A;  2PHG A;  1U1S A;  4C0G A;  3OS0 A;  2PK9 B;  4M7D F;  3I55 A;  2QGF B;  1PWT A;  3TNW B;  4QW2 A;  2LVM A;  3JB9 G;  3QPH A;  3EJ1 B;  4EOP B;  1X2K A;  2HQX A;  2Y4X A;  5I22 A;  1YNZ A;  4J6Y A;  3F5X B;  1D3B B;  4M77 D;  2LTO A;  2CJM B;  1QP3 A;  4Y92 A;  1VQ8 A;  1UDL A;  2OI3 A;  4FSX A;  4DBH A;  1VYV A;  1YHQ A;  2HL5 C;  2DEU A;  1MNE A;  5CKB A;  4PJL A;  4F70 B;  3MCA B;  4M77 E;  4KBM B;  2VB6 A;  1KHC A;  1U3O A;  4FU6 A;  1QQJ A;  4XTY A;  2W2H A;  1UJY A;  2PTK A;  4C0D C;  1WXB A;  1ZBJ A;  1YJW A;  2P0K A;  4NL2 A;  1FMK A;  1VQ4 Q;  2LQK A;  3A8L B;  1NJI U;  1IGU A;  1VQ6 Q;  1X2Q A;  3BG9 A;  2L89 A;  2DIL A;  4N4G A;  3TNI B;  2YUP A;  2J06 A;  4LUE A;  4M7A A;  3JB9 I;  2DA9 A;  3PE0 A;  2VUB A;  2EKO A;  2KI7 A;  2ZZD B;  1PC0 A;  1UUE A;  1WZO A;  3LGL A;  8ATC B;  3OYJ A;  3HB9 A;  2HBW A;  4LD6 A;  1VQP T;  2RHX A;  1OZ2 A;  3BHT B;  2RNA A;  3TNH B;  3CCV T;  1KFZ A;  4M75 G;  5FRN A;  1GBQ A;  1AVZ C;  4IIO A;  1QWE A;  2RM4 A;  1Q7Y R;  2LQN A;  3E9F A;  3CCE Q;  2MWP A;  3FRN A;  1PRL C;  5IHN A;  3QHW B;  4N0A C;  2QXF A;  3KFV A;  5GAM d;  3RR6 A;  4J9C A;  3HRS A;  1H64 1;  4BCF B;  1N8R C;  3C12 A;  3JCM J;  4BI8 B;  2G9X B;  1CKB A;  3DDP B;  2C0I A;  2C0T A;  1KQS S;  3CC2 T;  1D0Y A;  2D9T A;  4JX6 A;  2M16 A;  3L2W A;  5HBH B;  1VUB A;  2DXB B;  3OYL A;  2M9U A;  4LUD A;  2E41 A;  2GCX A;  4CFX B;  1GFD A;  4D8D A;  3CPW S;  2E1H A;  1Q86 R;  3PIO A;  4EIK A;  2EW3 A;  4TVR A;  1YI2 T;  3JB9 H;  3BG5 A;  3VRZ A;  4M7D G;  5LJ5 g;  1H25 B;  3TU4 K;  3HPW A;  2LC4 A;  3DOG B;  2I40 B;  5LL6 S;  2WXV B;  4QKU A;  4C92 D;  3FB9 A;  3VUB A;  1Z9Q A;  4M78 B;  4FX3 B;  4IUU A;  2UZD B;  2RQU A;  5GAO l;  3CBM A;  3P8B B;  2HKQ B;  2CZ7 B;  1SEM A;  2KNB B;  1QLB A;  2XK0 A;  4QQG A;  3GBQ A;  5HVY B;  3QXE B;  3VKH A;  3FLG A;  2UZL B;  2A0F B;  3F70 A;  5GAO p;  4M75 C;  3N5B B;  4OMO A;  1OEB A;  2C0O A;  2BUD A;  3O8V A;  2BIV A;  3G71 Q;  1SPK A;  1VQK T;  4JX4 A;  3JCM X;  4O6J A;  1BI2 A;  3BG3 A;  2CP5 A;  3CCS A;  2CSI A;  5LJ3 j;  4ELJ A;  2D0Q B;  4PJO A;  5KYU A;  1UHC A;  1VQN A;  2RHI A;  1HD3 A;  1OU9 A;  4ZN3 A;  2DYI A;  4F7U A;  5A2Q E;  2DVJ A;  2CZ6 B;  1SKU B;  1IGQ A;  2EJ9 A;  4M78 G;  3INZ A;  2DIG A;  5GAN 4;  3NDQ A;  1B34 B;  1NM7 A;  2RK1 A;  2RI5 A;  1T0J A;  2HEQ A;  2W0Z A;  4ZGE B;  2RHU A;  5KH6 A;  2KEA A;  1D0Z A;  4BCO B;  5M9O A;  4E7H A;  2QQA A;  5LQF B;  2JMC A;  5IN1 A;  2DK3 A;  4AFZ C;  1M1F A;  3SDZ A;  1G8X A;  4C0Z A;  1W2B S;  1KJW A;  4YOO A;  1LCK A;  5C0M A;  3CC4 Q;  3O0G D;  5A0D A;  3JCM h;  4KRT A;  3RUX A;  1R0C B;  2EJG A;  3OSS C;  2CZ1 B;  3GPL A;  2QK0 A;  1K76 A;  5CKD A;  1ZSZ B;  2KR6 A;  2V22 B;  4BCM B;  2A7Y A;  4LOC A;  1M1K U;  3NGP A;  3WVE B;  2PVG B;  4C92 F;  1JOW A;  4QQD A;  2HNI A;  1QVF S;  4E7K A;  2EGA A;  2QQR A;  2LX7 A;  1M27 C;  1JJ2 S;  1VIF A;  2M0Y A;  2WSC E;  1UNG D;  1BI1 A;  2QTX A;  4FYV B;  4XU2 A;  2W99 A;  4RCC A;  2FEI A;  3A98 A;  5CR2 A;  1LVK A;  1YJN Q;  3OY9 A;  2OTJ T;  3I56 A;  3JRZ A;  3I9Q A;  3PO3 S;  1Y07 A;  5KCO A;  3QDR B;  5CKH A;  3RER A;  4C8Q F;  2IVW A;  2F2V A;  2PK2 A;  3UDC A;  4BCG B;  1UE9 A;  2YUQ A;  1UTI A;  1VQ4 T;  2ROT A;  1NYG A;  4AKI A;  3HHT B;  3PT9 A;  2DEQ A;  4M75 F;  2FRW A;  2DME A;  4CFU B;  2VYT A;  4AI6 A;  1YJN T;  3OA6 A;  1KD1 U;  2ECZ A;  3TSZ A;  5IHY A;  2QDY B;  4PFP A;  4DBQ A;  1KQS P;  3ASK A;  1TTH B;  2V8K A;  5HBJ B;  1K73 R;  3CD6 Q;  5GMK j;  4OGE A;  2JNG A;  1BBZ A;  1GCQ A;  2J6O A;  2HD0 A;  3A5Z B;  1H8K A;  4CFN B;  3VRY A;  3OYK A;  1VQN Q;  2IG0 A;  2NUZ A;  1I07 A;  4M6V A;  2RF0 A;  2FPD A;  2PUK B;  3BDU A;  3PVQ A;  1VQM Q;  2EJF A;  3H6Z A;  1F1B B;  3CCR Q;  2K2V A;  2V1Q A;  3CCM Q;  1E7O A;  3H4C A;  2JMA A;  4J9G A;  3OBW A;  2DXB A;  1J3T A;  2QDJ A;  2ZPB B;  4Z6Y A;  4OB3 B;  1UGR B;  4ZN1 A;  3Q1J A;  1TH7 A;  3ZFJ A;  4JZ4 A;  2CH4 W;  1FMW A;  2JTM A;  3HRT A;  4IIM A;  1VQ7 A;  1NPP A;  4F7J B;  3RKX A;  4RTV A;  1QCF A;  4II1 A;  2CGH A;  2MMP A;  4ROE A;  2DXC B;  2X1N B;  4PNO A;  4IKF A;  3EHR A;  3K7A M;  1D09 B;  1VQO Q;  3M4G A;  2DMO A;  2E5K A;  3TQ7 P;  1GUX B;  3QII A;  3M53 A;  4IUR A;  4BE2 A;  4O5V A;  1N9S A;  2YRV A;  3VKI A;  1IHV A;  3I56 Q;  2MAM A;  2E3H A;  3RMQ A;  3J81 E;  1I5O B;  1AWO A;  2RQV A;  1YJN A;  3KBG A;  3VS5 A;  1QP2 A;  2CS7 A;  3RDV A;  1JJ2 A;  1JO8 A;  1XTD A;  1M2V A;  5CIU A;  1P92 A;  2LMJ A;  3ZEH A;  3QDF A;  4M75 A;  1JRI A;  4DOV A;  4HXJ A;  4M78 C;  1X6O A;  5KYX B;  2PVO B;  3I35 A;  5HKC A;  1O9S A;  4OB2 B;  4A54 A;  2GF7 A;  2XG8 D;  1VQ8 Q;  1T0H A;  2KRS A;  1NE8 A;  3EFR A;  3OMG A;  2HL3 A;  2DYB A;  2MPX C;  3QYB A;  3CCL Q;  3P8D A;  4DA4 A;  1W2B A;  3RNJ A;  4EC9 B;  3HBL A;  4LDW A;  1G83 A;  3LGF A;  2DJQ A;  2OJ2 A;  1F5Q B;  1OL1 B;  3M56 A;  1M90 C;  2P0P A;  1BIA A;  1RAG B;  1WJQ A;  1KC8 R;  1WJS A;  4EOR B;  4JLI A;  2E70 A;  2K7A A;  1ABQ A;  2Y4Y A;  4BE0 A;  1AIS B;  4AFU C;  3MHX A;  3OYH A;  1QLY A;  4ELZ C;  3CC7 A;  2E65 A;  2WIH B;  4N4I A;  3I55 T;  1K0X A;  2KSS A;  1IO6 A;  2RD1 A;  4BD3 A;  2W9F A;  3G7Z A;  3TW6 A;  2HQE A;  5DQW A;  5LJ5 f;  2WHB B;  2AK5 A;  4C0D B;  4BI4 A;  2PJQ A;  4C8Q D;  3ULR B;  1X01 A;  3M0U A;  2V8I A;  3PGG A;  3QZ9 B;  2VC8 A;  4J7F A;  3JSC A;  3DJB A;  3O5Z A;  4EMK A;  3DDQ B;  3G4S A;  3S3O A;  2X4X A;  1RAD B;  2CSQ A;  3D7S B;  1XNI A;  2GTJ A;  2UZB B;  4RTX A;  5IDP B;  1GH6 B;  4G6L B;  2YUO A;  1PD1 A;  1MUZ A;  4AT1 B;  4C92 C;  4BY1 X;  3JV3 A;  5GMK l;  1AWW A;  1M4Z A;  1ZUY A;  2MF2 A;  4EC8 B;  2DZ9 A;  4FYW B;  3CCQ Q;  1VQM T;  3OYG A;  2NUP A;  4NOY A;  2DTI A;  2W96 A;  3A8O B;  4EON B;  2LX9 A;  4KGZ B;  4QT7 A;  3I5R A;  3MEA A;  4HNT A;  4JZ3 A;  3TSW A;  1Y96 B;  2FRY A;  5GAO n;  3CCE A;  1YJ9 Q;  1ZLM A;  1H1Q B;  3CC4 A;  5LJ5 d;  2BKZ B;  5KYY A;  1G3S A;  4HNU A;  4B6M A;  1K0S A;  1H24 B;  4F7U G;  4J6W A;  4IUT A;  3CPF A;  2EGC A;  1BKB A;  5EJC A;  2QI2 A;  5ACB A;  4Z8A A;  2H8H A;  1U8R A;  1M3B A;  1K9M R;  1X75 C;  3EG0 A;  3MEU A;  3X26 B;  4BCP B;  3L2V A;  4BCM D;  5GAN e;  2BS4 A;  1Y57 A;  4OML A;  1KC8 U;  4HVU A;  1S72 T;  5GAN 3;  5CVI A;  3VKG A;  2KBT A;  3G71 T;  1VQK Q;  3CC7 Q;  4M4Z A;  2QEX T;  2K5I A;  1C1A A;  2E12 A;  5GAN f;  1WDX A;  2QTV A;  3MPU B;  4AMC A;  2QAZ A;  2ED0 A;  2KGT A;  2MCN A;  1KXU A;  4BDZ A;  5GAN 8;  2JW4 A;  4AG1 C;  1FXX A;  1M5Q 1;  3VS3 A;  3J7A F;  1QKX A;  2FZG B;  1QMC A;  1YJW T;  2K3Y A;  1Q82 C;  4JJD A;  1PNJ A;  3I56 T;  1ZUU A;  1ZA2 B;  2RK2 A;  1BB9 A;  4UC4 A;  2YLB A;  5IDN B;  5AYF A;  4A4K A;  2ZZD A;  3V8K A;  2D6F A;  4PKC C;  2ZGW A;  3CCQ T;  1B7T A;  2BS3 A;  1JSU B;  4WF2 A;  4LN2 A;  2JGZ B;  3CCL T;  4J9I A;  3CCE T;  3B57 A;  1WFW A;  3HSB A;  4IMY B;  2X4W A;  2CRE A;  3V8L A;  3V7R A;  4E7J A;  2NUT A;  3BHU B;  3CCR A;  1FMV A;  2FG0 A;  3A1P A;  4CC2 A;  2KDS A;  1JEG A;  2WAC A;  2VAS A;  4EMK C;  4BBR M;  1JKW A;  1S72 Q;  4J9E A;  4QQ6 A;  2L3P A;  1OZ3 A;  3GLX A;  5IHI A;  2LCS A;  3CC2 Q;  2CUB A;  4PJN A;  5CYI B;  1ACM B;  1PD0 A;  1Q7Y C;  1ABO A;  1V1C A;  2EFI A;  2D8J A;  1ZA1 B;  3EHQ A;  3L2Z A;  4X34 A;  3RGF B;  1Q81 R;  3RKW A;  4J9H A;  3E2U A;  5D7U A;  2O88 A;  1KG1 A;  2MIO A;  1RI0 A;  2O4X B;  1JQQ A;  2AZV A;  4F7U E;  1U5S A;  3DLM A;  1M1K R;  1GRI A;  2D8H A;  4M78 E;  4AKH A;  1H1S B;  1GCQ C;  4V2S A;  2EVR A;  1VQO A;  5ICP B;  3JB9 D;  1R77 A;  3CMA A;  2XMF A;  4E7L A;  4KRC B;  1AT1 B;  2HCK A;  4MZM A;  2AIR B;  1O9K A;  2DPP B;  3QZ5 B;  1OKW B;  4OF1 A;  4EOS B;  1K9M U;  2LJ0 A;  1TUG B;  2OTL A;  2LRQ A;  4L5G A;  2YT6 A;  1AZG B;  1YCY A;  4QSH A;  1BI0 A;  4R0K A;  2DX1 A;  2LJ1 A;  1X6B A;  4HCC A;  1NLO C;  2LCC A;  1D3U B;  4CFV B;  3H8Z A;  2QQ8 A;  2QEX A;  2DBM A;  4LE9 A;  1RAA B;  3MET A;  2FPF A;  1RAI B;  1EFN A;  4E6R A;  1HSQ A;  2MK5 A;  1Q81 U;  4CC3 A;  4TTH A;  4OR5 B;  4B9X A;  2MWO A;  3BFM A;  4A4H A;  3L2U A;  3SB2 A;  1LNX A;  2KY9 A;  2RO0 A;  2WSF E;  4NST B;  1WHH A;  3UA6 A;  1BU1 A;  2OTJ A;  3HO8 A;  5CCA A;  3ME9 A;  3OYN A;  2GFU A;  4M78 F;  1BCO A;  4M75 E;  5LJ3 f;  4CC7 A;  4AFQ C;  1VYU A;  2L3Q A;  2CUD A;  1PCX A;  3EG9 A;  2IW8 B;  1WIE A;  4PJO E;  3V7C A;  1P5E B;  3SWN C;  1VQN T;  2A28 A;  2E6Z A;  2KK4 A;  3OS1 A;  1VOL A;  3CCU Q;  3GNG A;  4JRP A;  4JDS A;  2YSQ A;  3CCJ Q;  2KVQ G;  1WQW A;  1JXO A;  2I0N A;  1K73 C;  4OMM A;  2CP2 A;  2CT3 A;  3EG3 A;  4EOM B;  5GAM g;  1WHG A;  3BW1 A;  3CCM T;  1WHK A;  3OYD A;  2WMB B;  1N6A A;  1VQM A;  1OX8 A;  4HCK A;  3JCM W;  4J9D A;  1PKD B;  3QWY A;  1H4L D;  4C92 A;  4Z89 A;  2RMO A;  1QMZ B;  4BB7 A;  3P8H A;  2DM1 A;  1RAE B;  3CPW A;  2WSE E;  5CAI A;  1M1G A;  2RJD A;  4K11 A;  3DTO A;  4EOQ B;  4EMK B;  4C8Q B;  4JX5 A;  2HDA A;  4BCI B;  3GF5 A;  1QCO A;  1Y96 A;  4ME7 A;  4LDX A;  2CH4 A;  3OYA A;  1H92 A;  2XU8 A;  2PU9 B;  1GXI E;  4AFS C;  4OB0 B;  2BZ8 A;  4PJO C;  3QSU A;  4PJO F;  4PJO D;  3CCQ A;  5GAN h;  5KYX A;  4ROC A;  2BKD N;  2L2P A;  4C5H A;  1GY3 B;  3H0F A;  4JLG A;  4RKU E;  1YWP A;  5KYU B;  1FIN B;  1Q86 C;  5KYW B;  3CCJ T;  3MY5 B;  2G77 A;  1D1C A;  1JBM A;  1V76 A;  3VYG B;  3VS1 A;  3OYI A;  3OQ5 A;  2VV5 A;  4BY6 B;  4M77 A;  5CK9 A;  3QJY A;  2C6T B;  1SG5 A;  5GAO r;  4E7S A;  7AT1 B;  1VQ5 A;  3QHS A;  4PL6 A;  1U06 A;  4XK8 E;  3JCM P;  3QO3 A;  1M8M A;  4XTV A;  1BIB A;  5D6W A;  4CXA B;  5CKF A;  5I2M A;  4HKE A;  2YXY A;  1XQH A;  4C5E A;  4GLK A;  4I3Z B;  3QYH B;  2RB6 A;  5HCK A;  1DJ7 B;  3G1J A;  5FWB A;  1QVF P;  2ZAE A;  3UAT A;  1K9A A;  2KRM A;  2RHZ A;  3C94 A;  5IXF A;  1W98 B;  1LOJ A;  4Z88 A;  2BPM B;  8AT1 B;  2EQU A;  4CI0 C;  2V1R A;  4M78 D;  4PJM A;  1W6X A;  5CEI B;  1WHM A;  3CCU A;  2CCI B;  2F1L A;  2CP7 A;  4NS5 A;  4BBS M;  4YOS A;  3NTK A;  4HNV A;  1AWX A;  3UPU A;  3EGX A;  3JCM Q;  3ER0 A;  3NTI A;  3SWN B;  3EFO A;  1YIJ T;  2DET A;  2PUO B;  3PNW C;  4M75 B;  2KE9 A;  3QWL A;  1VQ9 T;  2J6F A;  1VQ7 Q;  4M7D D;  2ZPI B;  5I11 A;  1UJ0 A;  1OPL A;  1UGV A;  2LW4 A;  3LH5 A;  4XQ3 A;  2XID A;  1O75 A;  2E3I A;  3M5A A;  3NFC A;  3C4S A;  5I21 A;  3L1A A;  4FIB A;  2NYS A;  2ZPG B;  4XTU A;  2P84 A;  4KUD K;  4M7A G;  2EIF A;  1BYM A;  1UNL D;  1RUW A;  1G3W A;  2D1X A;  3TVT A;  2K4Y A;  1IXD A;  3MP1 A;  5KE3 A;  1M1K C;  4X1V A;  2IW6 B;  2E6N A;  2OX7 A;  2P0Q A;  4IUP A;  4N4H A;  2ZPH B;  2GBQ A;  2AZS A;  5A0G A;  2XD0 A;  1X43 A;  1MMG A;  1U1T A;  3SWN A;  5CQX A;  5GAN j;  1H28 B;  2DF6 A;  2ZCF B;  1BI3 A;  2IN3 A;  1KD1 R;  4JRK A;  2DVE A;  2DTH A;  1IHW A;  1NEB A;  5EFQ B;  2O9S A;  4BCN B;  3M4Y A;  1VQ8 T;  1AOJ A;  4JUV A;  2VWF A;  3U23 A;  2H3E B;  2HZY A;  2A08 A;  2W9Z A;  2MI6 A;  5GMK e;  3TEE A;  4BCQ B;  3HFO A;  4FT2 A;  4HA8 A;  3VYH B;  1MV3 A;  3KUF A;  3CMA Q;  2QQB A;  2CKK A;  5GAO m;  2PMI B;  1H1R B;  1SRM A;  1VQ7 T;  1RAH B;  3SD4 A;  3TN8 B;  1UEB A;  1TWB A;  5IXB A;  3EGD A;  2V8J A;  5EG2 A;  3X24 B;  3EG2 A;  3LW5 E;  4OMP A;  1CKA A;  3NTH A;  3MEW A;  2VXF A;  1YJ9 T;  1B34 A;  2NWM A;  1WJR A;  4BCK B;  5GAO q;  3VS0 A;  4MIM A;  3DL1 A;  1FYN A;  2HSP A;  4J5Y A;  3R6N A;  2VGM A;  1NEG A;  2PVD B;  2JZ2 A;  2O31 A;  2KRO A;  5GAN 7;  2YUN A;  1AEY A;  1C6V X;  1OOT A;  2NLU A;  2KMG A;  4HCB A;  2K5L A;  5LJ3 g;  2EKH A;  4RG2 A;  2A3L A;  3H0I A;  2AKL A;  2OTJ Q;  3ZBD A;  2HSE B;  1V29 B;  1MMN A;  4XTX A;  2FO0 A;  4GBQ A;  4EOI B;  2K5F A;  4RUG A;  2DRK A;  1VYW B;  5J3B A;  2E10 A;  3CC4 T;  1RAC B;  2L3S A;  2P4R A;  4R55 A;  1RLP C;  3G6E Q;  2NUP B;  2XHC A;  3CCU T;  3M0P A;  4HT9 A;  2DXU A;  4RTW A;  2KQW A;  2KMT A;  4ZGJ B;  1TD6 A;  1RLQ C;  4YC3 B;  4C0F A;  3LWI A;  1PSE A;  1WLP B;  3MP8 A;  3OW2 S;  5KCH A;  5L8R E;  3HZJ A;  2DRM A;  3EID B;  2M51 A;  1TFB A;  2Y90 A;  5GAN 2;  4CFW B;  2FYK A;  1UGQ B;  2X4Y A;  3NPF A;  2EQM A;  3EOC B;  4Q5W A;  4PJO G;  3MKD A;  4E2F B;  1E7P A;  3CEY A;  3DKM A;  2F2X A;  1OGU B;  1YI2 Q;  2HQH A;  1HK9 A;  1SHG A;  4A53 A;  4XU3 A;  3CCS T;  2K6D A;  4OP0 A;  2QFZ A;  3JB9 J;  4M78 A;  5FGK B;  3OW2 P;  3OW2 A;  3EH2 A;  4FSS A;  3CPW P;  1QW1 A;  1QKW A;  1YIT A;  1WPY A;  2CCH B;  4M77 F;  1N8R U;  1QCN A;  1TG0 A;  5CQY A;  2DL3 A;  5IF1 B;  1WHJ A;  2LT4 A;  3MP6 A;  1NJI C;  1N8R R;  3S6W A;  5KYW A;  4ROD A;  1ZUK A;  3QUI A;  4C8Q A;  3OYY A;  2KYB A;  1YIT Q;  1YIJ A;  3MEV A;  4CFM B;  1NBE B;  1B3Q A;  1E6H A;  2LQ8 A;  2QYZ A;  3KXT A;  1VYT A;  2QEX Q;  4EPC A;  1R8O B;  2M02 A;  1VA7 A;  5IT9 E;  2KYM A;  4DBF A;  2EYW A;  2QDL A;  2SEM A;  3JCM c;  2QQS A;  1Q82 R;  3FJP A;  1PRM C;  1OIY B;  4II5 B;  5KYN A;  3CBP A;  3HL8 A;  3A8M B;  3CD6 T;  3CQT A;  2EYQ A;  2DER A;  4A63 B;  5D6X A;  5J39 A;  4EMH A;  4L59 A;  4JJN K;  2B9R A;  2Z0W A;  3V7S A;  1QVG P;  2RPN A;  2DE0 X;  1TS9 A;  1AD5 A;  1PKS A;  2K2M A;  4LXC A;  5HY6 A;  3VUZ A;  2KAF A;  2IW9 B;  1UFF A;  3QG1 A;  5FW9 A;  5GJV B;  1OPK A;  4J83 A;  2JJ9 A;  3POM A;  1M2V B;  5EC7 A;  4C8Q G;  3JCM e;  4HLQ A;  2JS2 A;  4KT0 E;  2UZE B;  3CCJ A;  2GNC A;  2E64 A;  3X20 B;  2KXD A;  4BCH B;  4EOJ B;  2DL8 A;  2C5V B;  3H41 A;  4MML A;  3QBY A;  2DO3 A;  4BCN D;  2ESW A;  4XAX B;  4RTT A;  1QVF A;  1R0B G;  1Q7Y U;  2C5X B;  4M75 D;  1VQ5 T;  3HFN A;  1ENW A;  1NYF A;  2DNU A;  2EQK A;  1YJW Q;  1W2B P;  1SSF A;  3TW7 A;  2OAW A;  4CRI A;  3BY7 A;  4KUL A;  1JST B;  4RTY A;  4X9D A;  2R58 A;  4UN0 A;  3M9Q A;  1YI2 A;  3JCM V;  4M7D C;  2X3X D;  4P5N A;  3GOX A;  2F5T X;  5HQ0 B;  2COW A;  1VQL A;  3HKS A;  2FL7 A;  2DIQ A;  3DB4 A;  1G3T A;  1OIU B;  4CFU D;  1YHQ T;  1ZSZ C;  2FZK B;  1W1F A;  4ORZ A;  2A37 A;  2XDD A;  1TOV A;  4MZT A;  5KE2 A;  4A4G A;  1G5V A;  4C92 B;  4WTO B;  4XTW A;  3FJ5 A;  2YRD A;  1URC B;  1M9S A;  1MMA A; 
#chains in the Genus database with same CATH homology
 3E19 A;  1K73 C;  3M54 A;  2EQJ A;  4M7A D;  3CME T;  3LWH A;  5DLO A;  1YBY A;  2VYT A;  3BW1 A;  2DXC A;  5GAM g;  3CCM T;  4AI6 A;  3OYD A;  1N6A A;  1FX7 A;  3LYI A;  1YJN T;  3OA6 A;  4Y91 A;  1KD1 U;  1VQM A;  3JCM W;  1Q86 U;  4AKG A;  3E1S A;  2VGN A;  3JCM d;  2QDY B;  5LJ3 h;  4C92 A;  4EDU A;  3ASK A;  4BB7 A;  2V8K A;  3P8H A;  4F7U F;  4NL3 A;  3X28 B;  5GMK j;  4M77 G;  3CPW A;  2WSE E;  4OGE A;  1M1G A;  2JNG A;  5CAI A;  2RJD A;  4JS4 A;  2FHD A;  3OB9 A;  4EMK B;  2HD0 A;  3A5Z B;  4C8Q B;  2XIC A;  4JX5 A;  3L42 A;  3OYK A;  2JUF A;  2HAX A;  2IG0 A;  4BDY A;  4E7I A;  2LDM A;  2JOY A;  3GF5 A;  4M6V A;  1Y96 A;  3WVD B;  3VU3 C;  2PUK B;  3BDU A;  4BI3 A;  4Z02 A;  4PJO B;  2RJC A;  3T9N A;  1NPR A;  3OS5 A;  2M1H A;  2EJF A;  4ME7 A;  3H6Z A;  1WGS A;  3PMI A;  1KQ1 A;  4D6W A;  2K2V A;  2P4T A;  1KC8 C;  4LDX A;  3CMA T;  3A8G B;  3OYA A;  1LJO A;  3H4C A;  2L8D A;  2XU8 A;  3GP8 A;  2JTF A;  2PU9 B;  1GXI E;  3OBW A;  3TRE A;  2DXB A;  3PMT A;  5FLX E;  4OB0 B;  1ZHI A;  3VYG A;  3DB3 A;  3CME A;  4PJO C;  3QSU A;  2QDJ A;  2ZPB B;  1RL2 A;  4PJO F;  4Z6Y A;  5LJ3 e;  4OB3 B;  1UGR B;  4MDW A;  4ZN1 A;  4PJO D;  3Q1J A;  1TH7 A;  2DD5 A;  3ZFJ A;  2QF7 A;  3OYC A;  3CCQ A;  1K73 U;  3JB9 H;  5GAN h;  4L6V 5;  5GAN g;  2JTM A;  2BKD N;  2L3R A;  3HRT A;  1VQ7 A;  4QVD A;  1NPP A;  4C5H A;  3G71 A;  1NZ9 A;  3RKX A;  4JLG A;  4RKU E;  2QA4 T;  4FM4 B;  1FKM A;  3AHU A;  5FU7 C;  1KHI A;  4II1 A;  1Q86 C;  3CCJ T;  2G77 A;  4C92 G;  3S3M A;  1JBM A;  2CGH A;  2MMP A;  1YIT T;  3CCL A;  3VYG B;  4OB1 B;  4C8Q C;  2DXC B;  5LJ5 h;  4MZP A;  3OYI A;  1QVG A;  1Q82 U;  3OQ5 A;  4XTZ A;  4PNO A;  5I2S A;  2VV5 A;  4BY6 B;  4M77 A;  5CK9 A;  5GAM h;  4IKF A;  3QJY A;  1K8A C;  3E9G A;  2DTO A;  5GAO r;  4A4F A;  3M4G A;  4R56 A;  3L2Q A;  3QII A;  2YLC A;  5GAM f;  1VQ5 A;  5FRM A;  3M53 A;  2RA2 A;  3QHS A;  3C95 A;  3VV0 A;  4PL6 A;  4IUR A;  4BE2 A;  4O5V A;  1G3Y A;  1N9S A;  2YRV A;  3R6O A;  4XK8 E;  1JB0 E;  3VKI A;  5IAY A;  2C06 A;  1W4S A;  4RCB A;  3JCM P;  2MAM A;  3QO3 A;  1I8F A;  3X25 B;  3RMQ A;  1VQL T;  4XTV A;  3J81 E;  1BIB A;  5D6W A;  5CKF A;  5CKE A;  5I2M A;  2DZC A;  5LJ5 j;  3EFS A;  4HKE A;  5J26 A;  1YJN A;  1XQH A;  1KQ2 A;  3KBG A;  2DD4 A;  4C5E A;  4GLK A;  3RMS A;  1WQ7 A;  5GAN 5;  3QYH B;  1OYX A;  1QP2 A;  2CS7 A;  2RB6 A;  1I5L A;  1H3Z A;  1DJ7 B;  1N9R A;  3RIR A;  5GAM j;  1JJ2 A;  1OI1 A;  4J7I A;  3TCJ A;  1XTD A;  4IUQ A;  4N0A A;  2RI2 A;  5CIU A;  4PLI A;  3G6E A;  3CCV A;  2RHZ A;  3C94 A;  2QA4 A;  1LOJ A;  3L2R A;  1EIF A;  1P92 A;  4M7A C;  3ZEH A;  2EQU A;  4OGC A;  2RH2 A;  2F5K A;  4CI0 C;  4M78 D;  3WXM B;  4DOW A;  3CXC S;  3FDR A;  1YJ9 A;  4M75 A;  4HT8 A;  3OYF A;  1JRI A;  4MFE A;  2FVU A;  4DOV A;  4M78 C;  1X6O A;  3V8J A;  2PVO B;  5HKC A;  3CCU A;  1O9S A;  2ZPF B;  4OB2 B;  2RJF A;  4A54 A;  2GF7 A;  2OAU A;  4NS5 A;  4BBS M;  2XG8 D;  2DKG A;  1VQ6 A;  5DLQ E;  3NTK A;  2E5Q A;  4HNV A;  1NE8 A;  3EFR A;  4IUV A;  3UPU A;  3OMG A;  3JCM Q;  3KHI A;  3ER0 A;  4M75 F;  3NTI A;  2XDB A;  3SWN B;  1FWZ A;  5FRO A;  3QYB A;  5GMK h;  3P8D A;  1YIJ T;  4DA4 A;  2JVV A;  1W2B A;  1K8A U;  3HBL A;  2PUO B;  5GAN d;  3PNW C;  4M75 B;  1AHJ B;  4LDW A;  3OBY A;  3QWL A;  3LGF A;  1VQ9 T;  1VQP A;  1N27 A;  1UGS B;  2DJZ A;  4M7D D;  2ZPI B;  3M56 A;  1M90 C;  2P0P A;  1BIA A;  1WJQ A;  1WJS A;  4JLI A;  4XQ3 A;  2E70 A;  3GNF B;  3JCM f;  2XID A;  2EWN A;  1O75 A;  2Y4Y A;  4M7D E;  4BE0 A;  1PSF A;  3M5A A;  3NFC A;  3C4S A;  3MHX A;  2VXE A;  3OYH A;  5I21 A;  3L1A A;  4ELZ C;  3CC7 A;  4FIB A;  1HXD A;  2E65 A;  1U1S A;  1VIE A;  3OYM A;  4C0G A;  2ZPG B;  4N4I A;  4XTU A;  3OS0 A;  3I55 T;  3RES A;  4E47 A;  3DLL A;  1M8V A;  4M7D F;  4KUD K;  4JRI A;  2KSS A;  2EIF A;  3I55 A;  4M7A G;  4BD3 A;  2RD1 A;  1BYM A;  2FB7 A;  3G7Z A;  3TW6 A;  1G3W A;  4QW2 A;  2HQE A;  2LVM A;  3JB9 G;  2K4Y A;  3QPH A;  4F7U B;  3MP1 A;  5LJ3 d;  2EAY A;  5LJ5 f;  5KE3 A;  1M1K C;  2E6N A;  2P0Q A;  4N4H A;  4IUP A;  4BI4 A;  4C0D B;  2ZPH B;  4Y28 E;  2HQX A;  4C8Q D;  5A0G A;  2Y4X A;  4QVC A;  2XD0 A;  4M7A E;  1X01 A;  1U1T A;  2V8I A;  3PGG A;  4J6Y A;  3SWN A;  3QZ9 B;  4QVZ A;  5CQX A;  4M77 D;  1D3B B;  5GAN j;  4M7D A;  2LTO A;  2VC8 A;  2ZCF B;  2BS2 A;  1BI3 A;  1QP3 A;  2LNV A;  3JSC A;  2DVE A;  2DTH A;  4J6X A;  4J7F A;  4JRK A;  4EMK A;  1VQ8 A;  1VQ9 A;  4FSX A;  5FU6 C;  4ATO A;  1YHQ A;  3M4Y A;  1VQ8 T;  3LH0 A;  5CKB A;  4FL6 A;  3G4S A;  4JUV A;  3S3O A;  3JCM b;  4HL4 A;  2X4X A;  3MCA B;  4M77 E;  4KBM B;  2R5M A;  1XNI A;  1KHC A;  4FU6 A;  2MI6 A;  5GMK e;  1M90 U;  3TEE A;  4XTY A;  2KVQ G;  4B9W A;  2K3X A;  4C0D C;  1D3B A;  3HFO A;  4FT2 A;  4HA8 A;  4C92 C;  3VYH B;  4ELY C;  3FC3 A;  4JRQ A;  1YJW A;  2P0K A;  4NL2 A;  3KUF A;  5GMK l;  2XKO C;  1M4Z A;  2LQK A;  2MF2 A;  3A8L B;  2QQB A;  1NJI U;  2DZ9 A;  2O01 E;  2X35 A;  3BG9 A;  2QQ9 A;  3OYG A;  2CKK A;  1VQM T;  2L89 A;  4NOY A;  5GAO m;  2DTI A;  4N4G A;  4KUI A;  5DY9 A;  4BY6 C;  3A8O B;  3PIP A;  1VQ7 T;  2LX9 A;  4M7A A;  3JB9 I;  3SD4 A;  1MHN A;  1UEB A;  4HNT A;  3MEA A;  1Y96 B;  2GFA A;  2VUB A;  2EKO A;  2V8J A;  5GAO n;  5EG2 A;  3CCE A;  2ZZD B;  3X24 B;  5CO7 A;  3CC4 A;  5LJ5 d;  4C5I A;  1VQK A;  3CD6 A;  3LLR A;  3LGL A;  3LW5 E;  3OYJ A;  3HB9 A;  3NTH A;  4LD6 A;  3MEW A;  2VXF A;  4ZTF A;  1B34 A;  2RHX A;  1YJ9 T;  1VQP T;  2K57 A;  4M7D B;  1OZ2 A;  1G3S A;  1WJR A;  4HNU A;  2ZPE B;  1MGQ A;  5GAO q;  4NC6 A;  4A4E A;  4MFD A;  4MIM A;  3G6E T;  3DL1 A;  3CCV T;  4F7U G;  4J6W A;  4M75 G;  4IUT A;  3CPF A;  3LX7 A;  4ZTJ A;  5FRN A;  4J5Y A;  2VGM A;  2PVD B;  1BKB A;  2JZ2 A;  2LT1 A;  3M57 A;  1KQS A;  5EJC A;  2RM4 A;  5GAN 7;  4LD9 K;  2QI2 A;  3E9F A;  4RG8 A;  2MWP A;  2NLU A;  3FRN A;  1U8R A;  2KMG A;  4HCB A;  1UGP B;  4EMG A;  2K5L A;  5LJ3 g;  4RG2 A;  2A3L A;  1X75 C;  3MEU A;  4N0A C;  3ZBD A;  3X26 B;  2QXF A;  2F69 A;  1V29 B;  5GAM d;  2JN0 A;  4XTX A;  3L2V A;  5GAN e;  2BS4 A;  3HRS A;  1H64 1;  4OVA A;  3VJP A;  2LCL A;  1KC8 U;  2K5F A;  1S72 T;  2XI9 A;  3CBO A;  4LDV A;  5J3B A;  4DQ2 A;  2E10 A;  5GAN 3;  5CVI A;  1N8R C;  1K9M C;  3VKG A;  3G71 T;  3C12 A;  4PLL A;  4C5G A;  3JCM J;  1S72 A;  2OTL T;  4BI8 B;  2QEX T;  2K5I A;  3JB9 F;  2E12 A;  3CC4 T;  3CC7 T;  1I4K 1;  5GAN f;  3OSV A;  1KQS S;  3PTA A;  3CC2 T;  4R55 A;  2D9T A;  4JX6 A;  2M16 A;  3UWN A;  3L2W A;  2RI3 A;  2XHC A;  3CCU T;  4HT9 A;  1VUB A;  2DXB B;  1Y7X A;  3OYL A;  2DXU A;  2M9U A;  4BDZ A;  2KQW A;  4HCZ A;  2E41 A;  2KMT A;  4ZGJ B;  5GAN 8;  1I81 A;  2GCX A;  3LWI A;  4C0F A;  3OW2 S;  1PSE A;  3MP8 A;  3A8H B;  3M55 A;  5KCH A;  1FXX A;  1M5Q 1;  4GY5 A;  3HZJ A;  5L8R E;  3CPW S;  4BE1 A;  3J7A F;  4M77 C;  5GAN 2;  2Y90 A;  1YJW T;  2K3Y A;  1Q82 C;  1UB4 A;  2E1H A;  2FYK A;  5DM7 R;  1UGQ B;  3I56 T;  2X4Y A;  2CYZ B;  2RK2 A;  3PIO A;  2EQM A;  4UC4 A;  2YLB A;  4TVR A;  4Q5W A;  5AYF A;  4PJO G;  3S3N A;  1YI2 T;  4A4K A;  1E7P A;  2ZZD A;  3CEY A;  3DKM A;  4PKC C;  3V8K A;  4BAC A;  2D6F A;  4LDU A;  2ZGW A;  1HK9 A;  4A53 A;  3BG5 A;  4MDX A;  4XU3 A;  3CCS T;  3CCQ T;  4OP0 A;  5A0L A;  4M7D G;  5LJ5 g;  2BS3 A;  3TU4 K;  2QFZ A;  3HPW A;  4OMF B;  4WF2 A;  2LC4 A;  3G4S T;  3JB9 J;  4M78 A;  3CCL T;  5LL6 S;  3CCE T;  3HSB A;  3OMC A;  3OW2 A;  4RMO A;  4C92 D;  3FB9 A;  3VUB A;  1QW1 A;  2X4W A;  2HBP A;  3BDL A;  2DD4 B;  3HP9 A;  1WPY A;  4M78 B;  4IUU A;  3CCR T;  1YIT A;  4M77 F;  3V8L A;  3FIF A;  4M77 B;  3V7R A;  5GAO l;  4E7J A;  4J8O A;  1N8R U;  3CCR A;  3CBM A;  5CQY A;  3CXC A;  3P8B B;  2LT4 A;  3MP6 A;  2CZ7 B;  1NJI C;  3S6W A;  1QLB A;  2XK0 A;  3M58 A;  4QQG A;  3QUI A;  4C8Q A;  4C8Q E;  3URG A;  3QXE B;  3OYY A;  3VKH A;  1IZ6 A;  2KDS A;  3FLG A;  5FU7 B;  2WAC A;  3M59 A;  3F70 A;  5GAO p;  4EMK C;  3OYE A;  4BBR M;  4M75 C;  1YIJ A;  3MEV A;  4M7A F;  4QQ6 A;  1OZ3 A;  2LQ8 A;  3GLX A;  3KXT A;  3N5B B;  1XOV A;  1Q7Y C;  4EPC A;  3QYE A;  2BUD A;  4XU0 A;  2EFI A;  2BIV A;  1R8O B;  3O8V A;  1VQK T;  5IT9 E;  4JX4 A;  3JCM X;  3J80 E;  4O6J A;  2I2L A;  1BI2 A;  3JCM c;  3BG3 A;  1ZBX A;  2PQW A;  2QQS A;  3L2Z A;  3FJP A;  4X34 A;  3CCS A;  3RKW A;  5LJ3 j;  4ELJ A;  2D0Q B;  1ZQ1 A;  4PJO A;  3CBP A;  1VQN A;  2DAQ A;  2RHI A;  1KG1 A;  5GAM e;  1Y71 A;  3A8M B;  3HL8 A;  1RI0 A;  4VUB A;  5GAN 6;  3FEO A;  4ZN3 A;  2O4X B;  3CD6 T;  5C6S A;  2EYQ A;  4F7U A;  3QYG B;  5D6X A;  4F7U E;  2CZ6 B;  5A2Q E;  3DLM A;  2EJ9 A;  4M78 G;  4XU1 A;  1WNL A;  4C92 E;  4EMH A;  4L59 A;  4M78 E;  3INZ A;  5J39 A;  4AKH A;  2DIG A;  5GAN 4;  1B34 B;  4JJN K;  4JS5 A;  3V7S A;  5HK0 A;  2RI5 A;  2RK1 A;  1Q81 C;  2GQV A;  4ZGE B;  4V2S A;  2RHU A;  3QJ6 A;  5HY6 A;  3VUZ A;  5KH6 A;  2KAF A;  2R5A A;  1VQO A;  3JB9 D;  3QG1 A;  3CMA A;  1VQ6 T;  4E7L A;  5M9O A;  4E7H A;  2QQA A;  3UT1 A;  5IN1 A;  2DK3 A;  1M1F A;  4J83 A;  3SDZ A;  3GIB A;  4MZM A;  4M7A B;  2L5Q A;  2DPP B;  4C0Z A;  3QZ5 B;  3HRU A;  1W2B S;  4OF1 A;  1K9M U;  4C8Q G;  5C0M A;  1IRE B;  5A0D A;  4X9C A;  3JCM h;  3RUX A;  4HLQ A;  3JCM e;  3QKJ A;  2EJG A;  3OSS C;  4KT0 E;  2LRQ A;  3JCM g;  1QVG S;  4L5G A;  3CCJ A;  2RJE A;  2OTL A;  2M0O A;  1YCY A;  4QSH A;  2CZ1 B;  3GPL A;  2E64 A;  3SFM A;  3X20 B;  1BI0 A;  5CKD A;  5GMK i;  2KR6 A;  4MML A;  2DO3 A;  3QBY A;  2A7Y A;  4LOC A;  4MMK A;  3OYB A;  1M1K U;  4XAX B;  4HCC A;  3WVE B;  2CZ0 B;  1QVF A;  2LCC A;  3H8Z A;  1Q7Y U;  2PVG B;  4M75 D;  2AHJ B;  1VQ4 A;  2QQ8 A;  2QEX A;  1KD1 C;  3HFN A;  1VQ5 T;  2EQK A;  2X4J A;  2R57 A;  3MET A;  4QQD A;  4C92 F;  3JAM E;  2HNI A;  3CC2 A;  1SSF A;  3TW7 A;  1QVF S;  4E7K A;  2O4X A;  2QQR A;  4CRI A;  1Q81 U;  3BY7 A;  4KUL A;  3CCM A;  4B9X A;  2MWO A;  1JJ2 S;  3BFM A;  1VIF A;  4A4H A;  4X9D A;  2WSC E;  1BI1 A;  2QTX A;  2R58 A;  4XU2 A;  3L2U A;  4LDY A;  3M9Q A;  4RCC A;  1YI2 A;  5HK3 A;  3SB2 A;  1LNX A;  4FT4 A;  3JCM V;  4M7D C;  2KY9 A;  2RO0 A;  2WSF E;  5CR2 A;  1VQO T;  4P5N A;  2WJ9 A;  3GOX A;  5D6Y A;  2OTJ A;  2F5T X;  3HO8 A;  5CCA A;  3ME9 A;  1VQL A;  3HKS A;  2G3R A;  2FL7 A;  3OY9 A;  3I56 A;  3OS2 A;  3OYN A;  2OTJ T;  2GFU A;  3JRZ A;  2DIQ A;  4M78 F;  3DB4 A;  3EAE A;  1Y07 A;  4M75 E;  1G3T A;  1QVP A;  2RHY A;  5KCO A;  5LJ3 f;  3QDR B;  5CKH A;  1YHQ T;  3RER A;  3PFS A;  4C8Q F;  5GMK m;  2XDP A;  2XDD A;  3RKY A;  4ZGD B;  2IVW A;  4PJO E;  3UDC A;  2DD5 B;  4MZT A;  5FU6 B;  3V7C A;  4A4G A;  4BUG A;  3SWN C;  4YTL A;  2B8A A;  5KE2 A;  1VQN T;  1G5V A;  3MO8 A;  2E6Z A;  2H3J A;  2KK4 A;  4C92 B;  3OS1 A;  2DXT A;  3GNG A;  1VQ4 T;  4XTW A;  5LJ5 e;  4JRP A;  4AKI A;  4JDS A;  3HHT B;  2YHT A;  3PT9 A;  2DEQ A;  1WQW A;  1M9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...