2ZPHB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 340min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zphB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zphB02
2WSFE 1AHJB 2D0QB 2DXCB 4ZGJB 4OB2B 4OB3B 3VYHB 3X26B 2ZCFB 3QYGB 2ZZDA 3X25B 3X20B 3QZ5B 2PVOB 2CYZB 3A8HB 4ZGEB 3HHTB 1DJ7B 1JB0E 3QZ9B 2ZPEB 3A8OB 2DD5B 2DD4B 1QP3A 2PUKB 1IREB 2ZPHB 3VYGB 3WVDB 4Y28E 2DXCA 1UGPB 2AHJB 1UGQB 2PVGB 1PSFA 3A8MB 3VYGA 4FM4B 2ZPBB 1QP2A 2PUOB 4KT0E 2DPPB 2ZPGB 2CZ0B 4RKUE 4OB1B 2QDYB 3X28B 4ZGDB 2DD5A 3WVEB 2CZ1B 2DD4A 1PSEA 5L8RE 4XK8E 2CZ6B 3A8LB 2ZPFB 3QXEB 3QYHB 1UGRB 1GXIE 2DXBB 2ZZDB 2PVDB 1V29B 2CZ7B 4L6V5 2DXBA 3X24B 3A8GB 2ZPIB 2WSEE 2O01E 2PU9B 2WSCE 1UGSB 4OB0B 3LW5E
chains in the Genus database with same CATH superfamily
4C92F 5GANh 1G5VA 2YHTA 3NTHA 4Q5WA 3BG9A 3EH1A 3EJ1B 4F7LB 1WYXA 3BHTB 5KYWB 2GQIA 4J6WA 4DEXA 2R57A 2ESWA 2L89A 1G83A 3H0HA 1K0SA 3CC4A 5GAOp 5KH6A 2YUNA 2K3YA 2RHIA 3HPWA 4XTYA 1GBQA 4AI6A 3CMEA 1D09B 2AKLA 2OAUA 1YITA 3OYFA 5I2SA 3E2UA 4ZTJA 1VQ9Q 3JCMP 4M77B 1YJWT 2GTOA 2YUPA 3KXTA 2DXCA 2J7IA 3I55A 1S1NA 4PJOB 1PSFA 4OMLA 2K2MA 4M75A 4M77G 2BS2A 4FM4B 2VWFA 3CC7A 2IW9B 2KT8A 3RESA 2EYZA 1KC8R 2RB6A 4V2SA 1GUXA 1UHFA 5GMKj 1LJOA 1R0BG 1VQ5T 3X28B 4E7SA 1QLBA 4YC3B 3CCMQ 3G71A 3VS4A 4A53A 3JCMW 3QDRB 4QQ6A 4C5EA 4EMKB 1M1GA 3S3NA 3MEAA 1BK2A 5GMKm 4OGRB 1W1FA 1T0JA 1K9MU 1SEMA 2LMJA 4JS4A 3R6OA 3S3MA 4M7DF 5DY9A 1K1ZA 4NSTB 3O5ZA 3SWNB 4M78C 2HKQB 3JCMd 1QVGS 2ZAEA 2K7AA 3CCLQ 1AZGB 1SSHA 3I56T 4LN2A 2RH2A 2WSEE 3FB9A 4GLMA 2E3IA 2X4JA 5DLOA 2M9UA 5KYNA 4CFVB 2O2OA 4L5GA 3EFSA 4C92B 2H3EB 4J8OA 2DL5A 1KFZA 3QKJA 4FSXA 2LQKA 1RABB 3J81E 2FPFA 3OBWA 3QWYA 1I81A 2GQVA 2CCHB 2R58A 2XHCA 1JU5C 4C92G 2JOYA 1WHGA 3G1JA 4JUVA 5LJ3g 1S72Q 3X25B 4LUDA 1VQPA 1N8RU 1VQ8A 1A0NB 2DKGA 1TUDA 3TW6A 1M9SA 2DIGA 8ATCB 1AZEA 1JB0E 2I53A 4OMQA 3C95A 2W10A 1KQ2A 1B7TA 2PK2A 2LVMA 1H1RB 1JRIA 1M3BA 1OL1B 1YIJQ 4DBHA 4QVCA 2V1RA 4MZMA 1YCSB 4M78A 2PUKB 4A63B 5FU7C 4LDXA 2LJ1A 2QI2A 1BKBA 2CP7A 2X4XA 4JPBW 1TWBA 2HDAA 5I21A 5HK3A 1VOLA 2KQWA 1KQSS 4QVZA 1MNEA 1LNXA 4AFUC 1Y96A 1PCXA 5HY6A 3LWIA 1Q86U 4CXAB 2BS3A 4OB1B 3VKHA 4BBSM 1WIEA 4AKHA 1VQMT 3E1SA 4PFZA 5DM7R 4F16A 2SEMA 4CFNB 3QXEB 4M7DB 2CKKA 1QVFS 4CRIA 5LJ5e 5GAOn 5GANj 2MI6A 1WXBA 2F69A 3M59A 4C8QD 3M0QA 3HP9A 2F5KA 3CCJT 4M7DG 1VQ9T 2QQRA 4KGVB 3UF4A 1Q82C 2YRCA 2G77A 1CSKA 1WFWA 2ZPIB 3CPWA 2FRYA 4M77E 2XU8A 3OYJA 3OY9A 4CC2A 3UA7A 4M7AE 4LE9A 2LJ3A 1M30A 4ZN1A 2COYA 2KRMA 4IUUA 1Q7YR 1M1KC 4OR5B 4JJBA 2YLCA 4NS5A 1LPLA 3HFOA 1X6GA 3OMGA 3PVQA 1UE9A 1Q81R 4J7IA 3QYGB 5GAOl 2UZLB 2ZZDA 1M8VA 2FB7A 1M8MA 2GBQA 4FT4A 4N4IA 2PMIB 1MMAA 4II1A 5CKEA 1SHGA 2DJQA 2EQJA 5GJWB 4CI0C 2DMEA 2FG0A 4Z02A 4BCMB 3M57A 2UZEB 1DJ7B 1ZA2B 2W9FA 2WIHB 3JCMQ 2GFUA 2JTEA 3CCRQ 4F7UF 4HKEA 2QA4T 2HQXA 4WCIA 3EGDA 3M0PA 1WHKA 1X6OA 4J83A 4MMKA 5IF1B 3H9NA 1M3AA 2LNHB 4MDWA 4Y92A 3TN8B 1YJNA 1YI2T 1PHTA 1H8KA 5FWCA 2QDJA 2W9ZA 2RO0A 1JOWA 2RNAA 2DL7A 3ASKA 4YOSA 5FU6C 4BCQB 1ZSZC 3LQ5B 2QAZA 2HD0A 3ER0A 3VYGA 1NJIU 3M4YA 2ZPBB 3CCSA 4EMHA 4MMLA 1O9KA 3CC2T 3BY7A 1N6AA 2Y4YA 3GTMS 3EFOA 1H4LD 4HXJA 3VS2A 1JO8A 3KBGA 1VQLT 2QDYB 3JRZA 4LD6A 4C8QC 3CD6Q 4A4FA 1PSEA 2P84A 4GBQA 2AZSA 4MDXA 5IN1A 2HQHA 2J05A 1JJ2P 1OPLA 3MJXA 5IDNB 1F1BB 3TU4K 4BCKB 1VA7A 1UUEA 4HCCA 1V76A 3QSUA 4QKUA 5LJ3h 1QVGP 3L2RA 2HBWA 2CZ7B 4L6V5 3TNIB 5GJVB 2G3RA 3OYNA 2QEXT 3VJPA 4JRIA 4N4GA 3GLXA 2MOXA 2O01E 3BHVB 4J9EA 4JLGA 1KD1U 1BIAA 1ZSZA 3P8HA 1E6HA 1UGSB 3LW5E 2WSFE 1M27C 3DLMA 4E7HA 2YWWA 3QHRB 2EGCA 4OMNA 3S3OA 3JCMf 1U06A 2R5MA 4ZTFA 4ATOA 1D3BA 2DXCB 2BKDN 2KVQG 4HVVA 2CCIB 4M75B 4B6MA 4C8QA 2RI5A 2R7GA 3QDFA 4ZNXA 4HT8A 1AD6A 1FMVA 3PMIA 3CXCS 5DQWA 1ABQA 1GUXB 4NC6A 4FL6A 2K3XA 5LL6S 4M7DE 2PTKA 5FRNA 4RTTA 1MMDA 5CKFA 4OMFB 2V22B 2JMCA 4DBQA 2C06A 4LD9K 4KULA 4ROEA 2EBPA 1YN8A 3AT1B 4R0KA 2C5OB 4FYWB 2DLPA 1UB4A 1KJWA 3OSSC 1M4ZA 2FL7A 3CBMA 2O31A 1KQSP 2AZVA 4DQ2A 1NBEB 1UHCA 2EQKA 3CMET 3H6ZA 1YITT 1KIKA 4RKUE 1NYGA 3EG1A 3OB9A 2PK9B 3M03A 1Q95G 1SRMA 4KBMB 1D0ZA 4CC4B 2F5TX 3AHUA 2MWOA 3M0UA 3I55T 3LH5A 3FRNA 1D1CA 1ARKA 4XK8E 1K9MC 4KGXB 3VRYA 1KSWA 3CC7T 3BW1A 5GANf 1AISB 3CCRT 3EH2A 4EOOB 2RJEA 2EYWA 3CCUQ 2RF0A 2DXBB 5I5ZB 1ZUKA 2FO0A 3MY5B 5CKBA 4QSHA 4A4EA 3G71T 5IHYA 1VQ9A 2KE9A 2LQWA 2GTJA 4XU1A 4PJNA 2KAFA 2L3SA 3H0IA 2WSCE 2X4YA 4M78B 3HFNA 2X51A 3KFVA 3TSWA 4F17A 3VS7A 2LQNA 1NYFA 3M5AA 2DVJA 5KYYA 1WJSA 4QVDA 1N8RC 2EJ9A 2VYTA 3I5SA 3TQ7P 2DBMA 3A8HB 4A4GA 2CH4W 3K7AM 3NPFA 4JS5A 3LLRA 3CCMA 1TSFA 2JS0A 5KCOA 3OYKA 3QZ9B 1BYMA 1F5QB 2E5QA 4GY5A 3JB9H 2WMAB 3RUXA 5LJ3d 2A37A 2P4TA 4ELYC 4F6WB 2A28A 2E6NA 3M4GA 1VQPT 2GF7A 4F6UB 3SEMA 4LNPA 4C0ZA 1VQ8T 4BE2A 3CCLA 1D0YA 1OU9A 3LGLA 2JNGA 3CCQQ 2QGSA 3DL1A 4CFMB 2PJQA 4QW2A 1Y71A 2FZCB 1Q86C 1JSUB 2LC4A 1VQ7Q 3TSZA 5LJ3j 2NUPA 2GCXA 4BY1X 4E7KA 2QGFB 1CKAA 2A0FB 1G3TA 3UT1A 4UC4A 2DD5A 2BZYA 4EONB 1TS9A 2ZGWA 4BY7X 1XTDA 3F70A 1S72A 1ZHIA 4HT9A 2EPDA 1WZOA 1K73U 4J9BA 3QYHB 2DYIA 2JM9A 1RAGB 4PJOF 2CT3A 3TW7A 4BI4A 4F7UE 5BNJB 2ZZDB 4RG8A 4O6JA 1KXUA 3OW2S 1YIJA 1G3SA 4EOSB 2D8JA 4FX3B 3EAEA 3HSBA 4YOZA 3GOXA 1HXDA 3REAB 1EFNA 2YRVA 1M90R 4I3ZB 3DLLA 2KT1A 1ZBJA 2LT4A 1EIFA 3PTAA 3RERA 2HQEA 4B9WA 1TOVA 1QMCA 4AKIA 2K6DA 2RK2A 5IHNA 1OL2B 1R8OB 2CREA 1N4MA 3RKWA 4JZ3A 1VQOQ 2OTJQ 1T3SA 1PKSA 2RK1A 3HO8A 2K9GA 4OB2B 3OYMA 4FYXB 4D8DA 3PIPA 3X20B 5L23A 3G4SQ 4DOVA 3MEUA 3BDLA 4CFXB 1O9KB 4FCYA 4FT2A 2IW6B 3CQTA 3RKXA 4BCND 2ED0A 3CPWS 3EFOB 1YFNA 1W2BA 3CXCP 1X6BA 1ZBXA 2BKZB 4QQDA 2VUBA 1VIEA 4HNVA 4DEYA 1OZ3A 2DA9A 1OPKA 4J6YA 1WHMA 3UWNA 4A4KA 5GAOm 3WVDB 4P5NA 2WEVB 1NJIC 2CUBA 2A3LA 4FSSA 2NUZA 2XD0A 3A8MB 1MV3A 3TCJA 3PO3S 2UUEB 3FJ5A 2RHXA 3LH0A 2YDLA 3OS1A 2DVEA 3H8ZA 3CCEQ 2M16A 1BCOA 1FWZA 4LDWA 2QFZA 1J3TA 4ME7A 1SHFA 1YJNT 5HBJB 1QWEA 5FU6B 1QW1A 1ZSZB 1KHCA 2AT1B 4Y91A 2KMTA 2L3PA 4Z8AA 2DXUA 4MFDA 1M1FA 2GFAA 3CCST 1IGQA 3FC3A 2YXYA 1D3BB 1NEGA 2RM4A 3CCRA 2CP0A 2EYQA 4PJOG 1G3NC 3VRZA 4C8QB 5GAMh 5ICPB 1SPKA 2DK3A 3BLRB 1X27A 3EIDB 1OQKA 3X24B 4EORB 1D0XA 3P8DA 1KD1C 2BE7D 3U23A 4C8QG 3DDQB 2WXVB 1T0HA 3M9QA 1HSQA 4RCBA 2LP5A 4IUQA 1BI1A 1K8AR 2EGAA 2W0ZA 1VOMA 2OAWA 4OB0B 3CEYA 1VQ4Q 2YUOA 2KRNA 2MWPA 2E70A 2EGEA 4N4HA 3HRUA 1AWJA 3O0GD 4ZGJB 2P4RA 2KR6A 5KYUA 4LDYA 3G6EQ 5FWBA 2JT4A 5IHIA 1NG2A 2JS2A 3CD6A 4C5HA 3KUFA 2RD1A 2D9TA 3JB9D 4Z89A 2ROTA 2GGRA 2K3BA 2E4HA 1YJ9Q 2M1HA 2DJZA 1OU8A 4IMYB 3QIIA 1OV3A 1U5SA 1H1PB 1Z9ZA 2QTXA 3OYGA 3M53A 1H28B 1R77A 5LMKB 1H3HA 5CKHA 4GLKA 1RLPC 1VYVA 3TREA 5CO7A 2RMOA 4MZTA 4OF1A 1NPRA 1UGPB 1FMKA 2EJGA 2PVGB 1U8RA 3M0TA 2DILA 1IHVA 3OYBA 4CFWB 1OI1A 1UDLA 4JJCA 5LJ3f 3GPLA 4N0AC 2C6TB 3SDZA 1D1AA 2QK0A 3QWXX 2KXCA 2WJ9A 5IT9E 3MI9B 4HA8A 3MPUB 4D8KA 2CZ1B 3EFRA 2DETA 1AWOA 2X35A 4KUDK 1B3QA 4C0DB 4LDUA 2JJ9A 2CZ6B 4IIOA 1V1CA 4RTUA 4ROCA 5D7UA 5KYYB 5GANd 5A0GA 2L8DA 1MMGA 2D8HA 1ZA1B 2FPEA 3OW2P 3TEEA 3EHRA 1H26B 2ATCB 2DZCA 2WPAB 4BE0A 1JEGA 1QWFA 4HL4A 2PZ1A 2RQRA 3OSVA 4JX5A 2PU9B 1KC8U 5I11A 3LYIA 5CR2A 1QLYA 3MP1A 2D1XA 2QXFA 4N0AA 2L2PA 3E9FA 3PMTA 4Z88A 3OYYA 6AT1B 1MHNA 3QZ5B 1K8AU 1AT1B 1AVZC 4BI8B 1NM7A 2A7YA 1N27A 3ME9A 4M7AD 1HJDA 2NUPB 3CPWP 4E7LA 2MAMA 4PJOE 3RKYA 8AT1B 2BPMB 2JTMA 5GAMd 3Q1JA 2DD5B 4XTUA 3CCUA 2VC8A 2EKOA 2DRKA 4JJNK 4R55A 1RL2A 2C0TA 2RI3A 1ZUUA 1C1AA 1BBZA 5LJ5g 2K57A 3CCMT 4J9DA 5CK9A 1WGSA 1VINA 3VUBA 1SSFA 1OKVB 3M0SA 4M75F 5DQVA 2QTVA 3QUIA 2MYSA 4J9FA 4JRKA 5ECAA 1RAAB 3CBPA 3A5ZB 4DBFA 1X43A 2KYBA 1MNDA 2F2WA 5GMKe 3JCMX 3J7AF 4YOOA 2CUDA 5GAMj 2DPPB 2D6FA 4BBRM 5IDPB 2P0KA 1AOJA 4FU6A 3VS1A 2EYXA 1U1SA 2HSEB 3PNWC 1H641 2KK4A 3CCLT 3BDUA 4CFUD 2UZDB 3WVEB 2G9XB 5KE3A 4PNOA 2VB6A 4F7JB 2IPOB 4IKFA 4OVAA 1FINB 4AKGA 2EQIA 4QQGA 4TTHA 1YHQQ 1UGVA 2NUTB 3EG3A 4XTVA 1X2KA 4C92E 2XI9A 2F2XA 3H0FA 1E7OA 5L2WB 2MK5A 4EOIB 2VXFA 4II5B 1GCQC 2RQWA 2ECZA 2OTLQ 2QG9B 4C0GA 3J80E 1S72T 4PK4A 2HCKA 3META 3H4CA 2BIVA 2QQ9A 3VS5A 5CVIA 2OJ2A 1PG5B 3MCAB 4BCGB 1K76A 5HCKA 3CCQA 3I35A 3C12A 5I22A 2MMPA 4X1VA 3JB9I 4M7AC 3JCMe 1I07A 2KSSA 2D0QB 1TXQA 1OYXA 1YIJT 3HKSA 1VQ7A 2VASA 3PGGA 1Y0MA 5KYXA 1QKWA 5CQXA 3O8VA 7AT1B 4BY6C 1RAEB 4O5VA 4X9CA 1JJ2A 4RUGA 2CYZB 5FRMA 3GNGA 1FKMA 2K5LA 1OZ2A 2CDTA 1QVGA 4RTVA 2RI2A 2LRQA 5C6SA 4M78F 1OULA 3C4SA 1I5OB 2RJDA 2DIQA 4F6SB 1GCQA 3RGFB 3CCVQ 2LCCA 5HNBB 3M55A 2IW8B 3VS0A 5A0LA 3JCMg 2ENMA 3SFMA 1G2BA 4EIKA 1JSTB 2MF2A 4M7DD 2OI3A 1Q82R 1Q7YU 3QWLA 4M75G 2M0YA 2NWMA 3PE0A 4JLIA 3V7RA 4M7AA 2XK0A 4KT0E 1Q81U 3A98A 1VQOA 3MEWA 4ZN3A 2OTJA 2A08A 2RQUA 1VIFA 1GBRA 2K5IA 2BTTA 2HNIA 2V8KA 2DEQA 2Z0WA 3G4SA 1O75A 1M1KR 1IZ6A 5GANe 1ZUYA 5GAN3 2CJMB 1BCMA 5KYUB 4HLQA 2C5VB 1OGUB 3CMAQ 4A4HA 2CP5A 2LW4A 3M0RA 2H8HA 2F2CA 1LOJA 1RADB 2LJ0A 1WXTA 1M2VA 2B8AA 2HEQA 5CQYA 2XDBA 4LOCA 4PLIA 1FXXA 3MKDA 5GAN6 4KH1B 1IHWA 1VQKQ 1RI9A 2DTHA 2QF7A 3E19A 1RAFB 1OX9A 5IXBA 2JVVA 5A0DA 1H24B 2O9SA 1YWPA 2LDMA 2CP2A 1QVFP 3OS2A 4FW2A 4MZPA 3OYDA 3LX7A 1Y7XA 2BZ8A 3THKA 4E47A 4WTOB 5J26A 4ESRA 2L3RA 3CCEA 2XICA 5LJ5h 2KGTA 1PRLC 2CP3A 1PM3A 2MCNA 1HD3A 1SKUB 1H1QB 4DA4A 3M56A 4ZGEB 3OYHA 5EJCA 1JXMA 1X2QA 3QJ6A 4HNUA 4IIMA 4TVRA 1EX4A 1JKWA 3MHXA 4BCNB 1VYUA 3WXMB 1NLPC 1RACB 1WJQA 2AIRB 1FVVB 2CP6A 1PKDB 3CBOA 3OYEA 3E9GA 4E6RA 4CC7A 5HQ0B 3N5BB 4M7DC 1UNLD 3RMQA 1ZLMA 4BDYA 1B34A 4EDUA 3M54A 2VXEA 2O88A 4M78G 2XDPA 2EQMA 3CD6T 2A36A 2GNCA 4BCPB 1Y96B 2DMOA 2RHYA 2B9RA 4HVWA 3CPFA 2DTOA 1QCNA 5GAMf 2FPDA 1RAHB 5EG2A 2RJCA 1VQ4A 5I2MA 1HYOA 4EOMB 2JN0A 1PNJA 3ZFJA 1JBMA 4KGZB 1YJWQ 2JMAA 3G6EA 3B57A 1TD6A 2IIMA 2DF6A 4AT1B 1H1SB 4BDZA 3BHUB 4PFPA 1YJ9A 4C0FA 5FU7B 1TTHB 1VQNQ 5GAN5 4M7DA 3CCVT 2EUFA 1VQ5Q 3A8GB 2WACA 1XOVA 5IAYA 1KC8C 2QGGA 2C0IA 2FEIA 4M75E 2DTIA 2V1QA 1VUBA 2QQAA 4M4ZA 2XKOC 1UFFA 1WI7A 3P8BB 1QQJA 2DE0X 3LWHA 3EGUA 3MP8A 1WQ7A 4XAXB 4KH0B 4EOKB 4NL2A 1QCOA 2DRMA 4C8QF 2QASA 4X9DA 3I56Q 2L3QA 2H3JA 3V8JA 3HHTB 5EFQB 3VS6A 1TH7A 4QT7A 3RR6A 4EOQB 2P0PA 5HVYB 2QYZA 1YBYA 1YNZA 3EGDB 1HK9A 2CSQA 4NOYA 2FHDA 2J6OA 3QHSA 3JB9G 1AD5A 4RTWA 1K9MR 1MMNA 1AWXA 4NL3A 2RHZA 1BB9A 3VS3A 3VYGB 2EVRA 3QG1A 4RTZA 1VQKT 1I0CA 1YWOA 2JGZB 1WA7A 2QQSA 3M58A 1I4K1 2BZXA 3OYIA 5EC7A 1PKTA 1Y07A 3I5RA 2F2VA 1XQHA 2PUOB 3CCUT 2KY9A 2DL3A 1G8XA 2CZ0B 1YP5A 9ATCB 4RODA 2COZA 2XDDA 1ACMB 2LCSA 2DFUA 4XTXA 2FRWA 3RBBB 2EJFA 1H92A 5GAN7 1X69A 4EPCA 5C0MA 2OX7A 2G6FX 5A2QE 5CAIA 4AFQC 2X3WD 1IB8A 3A8LB 2ZPFB 1N8RR 2FVUA 5KYXB 1ZQ1A 1GFCA 3QYBA 1WLPB 3MY1B 2C0OA 1GFDA 3FEOA 2JZ2A 3EG2A 5LQFB 5AYFA 4M78E 2KR3A 3QJYA 3UDCA 5LJ5j 3BG3A 1W4SA 2J6FA 3L2UA 3V8KA 5GAN8 4OGEA 1VQMQ 2HL3A 4E2FB 2JUFA 3NMZC 4XTWA 3HBLA 2F1LA 2DNUA 3H41A 4JRQA 2CT4A 4F04B 1QKXA 1RI0A 2WMBB 4EOLB 3OYAA 3DB3A 1TFBA 3CCJQ 3VYHB 3X26B 1Q86R 3V8LA 2L0AA 4OGCA 4G6LB 2IN3A 3QBYA 2X4WA 4PL6A 1KK7A 2E12A 1ZSGA 2MPXC 4M7AB 3CCQT 2VGNA 5FLXE 1W70A 3MIAB 3NDQA 4AG2C 1QVPA 3L2VA 2W96A 3JCMb 5IH2A 1SRLA 3SD4A 1VQNT 2UZBB 2QQBA 1VQ7T 1YHQA 4KRTA 4BY6B 2KRSA 1IGUA 4F7UA 4M7AG 4RTXA 1UTIA 2KI7A 1BI3A 2YLBA 1R0CB 1IREB 1M90U 5HK0A 1C9BA 1U1TA 2EQUA 1OKWB 2OTLA 1QCFA 5GAOq 2P0QA 1C6VX 5KCHA 1Q7YC 2B86A 4J9GA 2WHBB 2K2VA 4E7ZA 3ZBDA 1BI0A 3OYLA 1JJ2S 3S6WA 2V8IA 3HRSA 5LJ3e 1Q81C 4BCFB 1ZP2A 1M2VB 1WHLA 4EC8B 2HL5C 3BE3A 1K4US 4J6XA 2QA4Q 3C94A 3V7CA 4ELJA 3LGFA 3VKIA 1U3OA 3PFSA 4CFUB 2K79A 5AT1B 4JZ4A 2DD4A 1YI2Q 2PQWA 4LUEA 1SF9A 2DBKA 2HBPA 2HSPA 3JSCA 4BXXX 2RQVA 1XNIA 2E64A 1N9RA 2NLUA 3CC2Q 3UATA 2EYYA 1RUWA 1VQOT 2OTJT 2LCLA 1UECA 2X1NB 1VQLQ 2DXBA 4R56A 1BIBA 2I0NA 3DTOA 4BCJB 3G4ST 2RN8A 4LXCA 2M0OA 3CCVA 2HAXA 2RA2A 3BLQB 4BCOB 4WF2A 1XO2A 2W99A 1GY3B 1NLOC 3PVLA 1I5LA 4B9XA 4FYYB 5CYIB 1B34B 2ROLA 5J39A 3OBYA 3L2QA 3JCMV 1VYTA 1NJIR 1UG1A 3MP6A 1BI2A 3MO8A 4OB3B 2DM1A 1M5Q1 2DL8A 4EMGA 2MIOA 2QEXQ 2ABLA 4BUGA 3TNWB 1PRMC 1WPYA 2DX1A 3BFMA 5CKDA 3OYCA 1GCPA 3OW2A 1WJRA 1UJ0A 3GNFB 3VV0A 2HMAA 3DDPB 2Y90A 3CCET 4C5GA 3CMAA 3G33B 4KRDB 4D6WA 1SG5A 2DERA 2ZPHB 1MUZA 4FW1A 2KXDA 4M77D 2QDLA 1I1JA 2KDSA 1VQ6Q 2AHJB 1NPPA 4PJOD 2WFYB 3RMSA 3DB4A 1VQKA 2W2HA 3ZEHA 2C4GB 1KD1R 3HL8A 1QP2A 2IG0A 2NYSA 3VUZA 4AFSC 1WXUA 3QO3A 2RHUA 4ELZC 4C8QE 4BD3A 3QPHA 5M9OA 2LX7A 4M6VA 1JQQA 3GBQA 4JRPA 4E7JA 3GF5A 1UJYA 4IUTA 2M02A 2O4XA 4J9HA 3CC4Q 2O9VA 5HBHB 4XQ3A 3TNHB 3IQLA 5CEIB 1GXIE 1C0MA 1N9SA 1RAIB 1URCB 1VQ4T 1TUGB 2E41A 5FGKB 3EG9A 3CMEQ 5LJ5f 1LCKA 1YITQ 2PVDB 4PLLA 2KNBB 4CRLB 1IO6A 3G6ET 2SRCA 2X3XD 1K73C 3I55Q 3FIFA 2DL4A 1RLQC 1CKBA 1B07A 4UN0A 1YJ9T 4BCIB 4C92D 3CC7Q 2K5FA 3PT9A 2QQ8A 2JXBA 2J6KA 3EGXA 1AWWA 1X01A 3EG0A 4YTLA 3EHQA 3G71Q 1YJWA 3TVTA 1PC0A 3JV3A 2V26A 1YCYA 4M77C 1P5EB 2DO3A 1OI9B 4OMMA 3REBB 3I9QA 4PJOC 1K0XA 3A8OB 3G7ZA 4RG2A 3HTRA 1VQNA 4J5YA 1QP3A 2VGMA 1VYWB 4XU2A 1VQ5A 4XU0A 3DJBA 2EW3A 4ANJA 3JCMc 1UEBA 1PWTA 4OMOA 5KYWA 5HBEB 2EAYA 1ENWA 2FZGB 5GMKl 1M2OA 4BACA 3JCMJ 2BS4A 2ED1A 2LZ6B 4K11A 4EC9B 4EMKC 2YT6A 3R6NA 1OIUB 2YRDA 1G3WA 1KQ1A 4IUPA 1VQPQ 4ZGDB 3ULRB 3SWNC 1VQ8Q 3V7SA 2J06A 3I56A 4XU3A 1NE8A 3EOCB 1PD1A 4M77A 2KBTA 2XMFA 1WQWA 3RIRA 3GIBA 4HVUA 1I8FA 3NTKA 4AFZC 2VV5A 2CGHA 4RMOA 4PJOA 4XTZA 3OA6A 4ORZA 1FX7A 3RDVA 4C92C 2HZYA 3HB9A 4PJMA 1W2BS 4J9IA 2YSQA 3QYEA 3GP8A 3L2WA 2AK5A 1AEYA 4L59A 1VQ6T 1Y57A 2JW4A 4JX6A 4PJJA 3VU3C 1KHIA 2HKNA 1D3UB 4F7UB 3HRTA 1BU1A 4OP0A 4HCKA 3QHWB 4EMKA 2LTOA 2CSIA 4IUVA 2EIFA 4F7UG 2K4YA 4AMCA 5FW9A 2ZCFB 3T9NA 1D1BA 1WHJA 2KYMA 1KQSA 2X9HA 2PVOB 3SWNA 4BCHB 3OQ5A 3BG5A 2COWA 5GAN2 3CC4T 4ELLA 3L2ZA 1O9SA 2DEUA 4BCMD 2AKKA 4F7SB 2E65A 1E6GA 3POMA 4PFOA 2BE9B 1UNHD 4J7FA 1K73R 4C0DC 4HCZA 1OEBA 1M90C 3FDRA 1WNLA 2DD4B 4C92A 4LDVA 4EOJB 5GANg 3JAME 1E9HB 5ACBA 1M3CA 1OIYB 1X75C 1FMWA 3OS5A 4Y28E 1K9AA 1VQMA 1QVFA 2EWNA 4JJDA 1UGQB 4BCQD 2JTFA 5J3BA 3SB2A 5GAMe 3DOGB 3A1PA 1YHQT 2CH4A 3JB9F 4Z6YA 2ZPGB 5GAN4 2DZ9A 4OMPA 2KEAA 2VVKA 2EFIA 1NEBA 2OTLT 1W98B 2R5AA 2WIPB 3C0CA 3CCJA 2IVWA 4IURA 5L8RE 2DYBA 1JXOA 3DKMA 1UNGD 1H27B 2VKNA 1UGRB 4AG1C 3MEVA 2JM8A 1WX6A 4F7NB 1MGQA 1PD0A 4RTYA 1OX8A 1V29B 2RPNA 5DLQE 5GMKh 5GAMg 4A54A 5HKCA 1YJNQ 2E5KA 2YUQA 4JDSA 1IXDA 2RQTA 2E10A 1LVKA 1Q82U 1N5ZA 3URGA 2BUDA 3NHNA 3CCSQ 3KHIA 3FLGA 5GMKi 5IHKA 4DBRA 2FZKB 4Y72B 1AHJB 4FYVB 4F70B 2QA4A 2E6ZA 4HCBA 3VKGA 1M1KU 2CS7A 3SHWA 1E7PA 4M75D 4DOWA 4X34A 1T3LA 1YI2A 1WHHA 4VUBA 1BU2A 3NFCA 1FYNA 3OMCA 4HNTA 2ZPEB 1IRXA 2E3HA 2KMGA 3JB9J 3L42A 3CC2A 1WDXA 4KRCB 2DXTA 1H3ZA 1Z9QA 2I40B 3FJPA 5D6WA 3INZA 1QMZB 2XG8D 1P92A 3BLHB 1K8AC 2O4XB 2XIDA 2EKHA 3D7SB 3JCMh 2E1HA 3HZJA 1VQLA 3UA6A 4F14A 4BE1A 4M77F 1OOTA 5D6XA 4JX4A 1NZ9A 3EG9B 1XJWB 4KUIA 2LNVA 5D6YA 2PHGA 2PNIA 2DAQA 4BB7A 1TG0A 1GL5A 3PIOA 4PJLA 4M7AF 3CMAT 2C5NB 2LQ8A 4CC3A 1KG1A 2D0NA 4FIBA 4C5IA 4MIMA 5KE2A 2C5XB 1GH6B 4J9CA 2FYKA 2L5QA 5FROA 2IVXA 2QEXA 2V8JA 4MFEA 2I2LA 2Y4XA 5IXFA 2RJFA 3ZL7C 1EZZB 3EGXB 5GAOr 1W6XA 2LT1A 4PKCC 3UPUA 1MV0B 1GRIA 1ZX6A 5LJ5d 4RCCA 4BI3A 4EOPB 2NUTA 1W2BP 1TUCA 3L1AA 5CIUA 2KROA 3NTIA 3NGPA 3RNJA 3CXCA 3F5XB 1TU0B 1ABOA 1H25B 4E7IA 1VQ6A 2M51A 4M75C 3OS0A 2LX9A 4M78D 5CCAA 1G3YA
chains in the Genus database with same CATH topology
3JCMV 2MMPA 4C92F 3JB9I 4M7AC 3JCMe 5GANh 2KSSA 2D0QB 1G5VA 1OYXA 1YIJT 3HKSA 3MP6A 1VQ7A 2YHTA 3M5AA 3NTHA 1BI2A 4Q5WA 3MO8A 3PGGA 3BG9A 1WJSA 5CQXA 3O8VA 4OB3B 4QVDA 1N8RC 1M5Q1 2EJ9A 4BY6C 4O5VA 4X9CA 2VYTA 4EMGA 4J6WA 4BUGA 1JJ2A 2CYZB 4A4GA 3A8HB 2R57A 2L89A 4JS5A 3LLRA 3CCMA 1WPYA 5FRMA 3GNGA 3BFMA 5CKDA 3OYCA 1FKMA 2K5LA 3CC4A 5KCOA 5GAOp 3OYKA 5KH6A 3OW2A 3QZ9B 1WJRA 1OZ2A 1QVGA 1BYMA 3GNFB 2E5QA 2RI2A 3VV0A 2LRQA 4GY5A 3JB9H 5C6SA 3RUXA 2K3YA 2Y90A 5LJ3d 4C5GA 3CMAA 4M78F 2RHIA 3HPWA 4XTYA 3CCET 2P4TA 4ELYC 4AI6A 3C4SA 2RJDA 2DIQA 4D6WA 3CMEA 2OAUA 1YITA 3OYFA 2ZPHB 5I2SA 2E6NA 3M4GA 4ZTJA 1VQPT 2GF7A 3JCMP 2LCCA 4M77D 4M77B 3M55A 1YJWT 4C0ZA 1VQ8T 5A0LA 4BE2A 3JCMg 3CCLA 3KXTA 2DXCA 3SFMA 2KDSA 3I55A 2AHJB 1NPPA 4PJOB 4PJOD 3RMSA 3DB4A 3LGLA 2JNGA 1PSFA 1VQKA 3DL1A 2MF2A 4M75A 4M77G 2BS2A 3ZEHA 4M7DD 4FM4B 4QW2A 1Y71A 1Q7YU 3QWLA 3HL8A 4M75G 3CC7A 1Q86C 1QP2A 3RESA 4JLIA 2LC4A 3V7RA 4M7AA 2XK0A 4KT0E 2IG0A 1Q81U 2RB6A 5LJ3j 4V2SA 3VUZA 2GCXA 1VQOA 3MEWA 4ZN3A 4E7KA 5GMKj 2OTJA 1LJOA 1VIFA 3QO3A 1VQ5T 3X28B 2K5IA 2RHUA 4ELZC 1G3TA 3UT1A 2HNIA 4UC4A 2DD5A 4C8QE 2V8KA 4BD3A 3QPHA 5M9OA 2ZGWA 1QLBA 1XTDA 3F70A 4M6VA 1S72A 4JRPA 2DEQA 3G71A 4E7JA 1ZHIA 3GF5A 4A53A 3G4SA 1O75A 4HT9A 3JCMW 4IUTA 1IZ6A 3QDRB 2O4XA 4QQ6A 4C5EA 1K73U 4EMKB 5GANe 1M1GA 4XQ3A 3S3NA 3MEAA 3QYHB 5GAN3 5GMKm 4LD9K 4PJOF 1K9MU 4HLQA 1GXIE 1N9SA 3TW7A 4BI4A 1VQ4T 2E41A 4JS4A 4F7UE 3R6OA 4A4HA 3S3MA 4M7DF 5LJ5f 5DY9A 2ZZDB 4RG8A 4O6JA 1LOJA 3SWNB 2PVDB 4M78C 4PLLA 3OW2S 3JCMd 1YIJA 1QVGS 1G3SA 2B8AA 5CQYA 2XDBA 4LOCA 3EAEA 3HSBA 4PLIA 1FXXA 3I56T 3G6ET 3GOXA 1HXDA 1K73C 2RH2A 2WSEE 2YRVA 3FB9A 5GAN6 2X4JA 3FIFA 3DLLA 5DLOA 2DTHA 2LT4A 2QF7A 1EIFA 2M9UA 3PTAA 3E19A 3RERA 1YJ9T 2HQEA 4L5GA 3EFSA 4B9WA 4C92D 4C92B 2K5FA 4AKIA 2RK2A 4J8OA 2JVVA 1R8OB 3QKJA 3PT9A 4FSXA 5A0DA 2LDMA 2LQKA 3RKWA 2QQ8A 3J81E 3OBWA 3OS2A 1I81A 4MZPA 3OYDA 3LX7A 1Y7XA 4E47A 2GQVA 2XHCA 2R58A 2RK1A 2L3RA 5J26A 2JOYA 3HO8A 4C92G 1X01A 3CCEA 4OB2B 2XICA 5LJ5h 3OYMA 4JUVA 5LJ3g 3PIPA 4YTLA 3X25B 3X20B 4DA4A 1VQPA 3M56A 4ZGEB 3MEUA 4DOVA 1YJWA 3BDLA 5EJCA 3OYHA 1N8RU 1VQ8A 3QJ6A 4HNUA 4FT2A 4TVRA 1YCYA 2DKGA 3RKXA 3TW6A 1M9SA 2DIGA 3MHXA 4M77C 3WXMB 3CPWS 1WJQA 1JB0E 2DO3A 3CBOA 3C95A 3OYEA 1W2BA 1KQ2A 1ZBXA 2LVMA 3E9GA 4QQDA 4PJOC 2VUBA 3A8OB 1JRIA 3G7ZA 1VIEA 5GANj 3N5BB 4RG2A 4M7DC 4QVCA 4HNVA 1VQNA 3RMQA 4MZMA 4J5YA 1QP3A 1OZ3A 4M78A 2PUKB 1B34A 4BDYA 4EDUA 3M54A 2VGMA 5FU7C 2VXEA 4M78G 4LDXA 4J6YA 3UWNA 2QI2A 2EQMA 2XDPA 4A4KA 5GAOm 3CD6T 1BKBA 2X4XA 4XU2A 4XU0A 1VQ5A 3WVDB 4P5NA 1NJIC 3JCMc 1UEBA 2A3LA 5I21A 5HK3A 2XD0A 1Y96B 3A8MB 2KQWA 2RHYA 2EAYA 4QVZA 1KQSS 5GMKl 3TCJA 1LNXA 4BACA 3CPFA 3JCMJ 2BS4A 2DTOA 5GAMf 2RHXA 1Y96A 3LH0A 5EG2A 4EMKC 3OS1A 2DVEA 2RJCA 5HY6A 1VQ4A 3H8ZA 3LWIA 1Q86U 5I2MA 2M16A 2BS3A 1FWZA 4LDWA 2QFZA 4ME7A 4OB1B 3VKHA 4BBSM 1G3WA 1KQ1A 2JN0A 1YJNT 4IUPA 4AKHA 5FU6B 1QW1A 4ZGDB 3ZFJA 1JBMA 1VQMT 3SWNC 1KHCA 3V7SA 3E1SA 3I56A 4Y91A 4XU3A 5DM7R 2KMTA 3G6EA 1NE8A 2DXUA 4MFDA 1M1FA 2GFAA 4M77A 3CCST 3QXEB 3FC3A 4BDZA 1WQWA 4M7DB 3RIRA 3GIBA 1D3BB 1YJ9A 1I8FA 3NTKA 2CKKA 1QVFS 2VV5A 4CRIA 5LJ5e 2CGHA 5GAOn 2MI6A 4C0FA 4XTZA 4RMOA 3OA6A 5FU7B 4PJOA 2RM4A 1FX7A 2F69A 3CCRA 5GAN5 2EYQA 4PJOG 3M59A 4C8QB 4C8QD 4C92C 3HB9A 5GAMh 4M7DA 1W2BS 2DK3A 3HP9A 2F5KA 3QYEA 3CCJT 3GP8A 4M7DG 1VQ9T 3CCVT 3L2WA 2QQRA 3X24B 1Q82C 3P8DA 1KD1C 3A8GB 2G77A 2WACA 1XOVA 3CPWA 2ZPIB 5IAYA 1KC8C 4L59A 4C8QG 1VQ6T 4M77E 4JX6A 2XU8A 3M9QA 3OYJA 3OY9A 4M75E 4RCBA 3VU3C 2DTIA 1KHIA 4IUQA 4F7UB 1BI1A 3HRTA 1VUBA 2QQAA 2XKOC 1M90U 4OP0A 4OB0B 3P8BB 4M7AE 3CEYA 3LWHA 3MP8A 4EMKA 2MWPA 2E70A 1WQ7A 2LTOA 3HRUA 4IUUA 4N4HA 4XAXB 4NL2A 4IUVA 2EIFA 4ZN1A 1M1KC 4F7UG 2YLCA 4NS5A 4ZGJB 2KR6A 3HFOA 3OMGA 2K4YA 4C8QF 2ZCFB 4J7IA 3QYGB 4LDYA 3T9NA 2ZZDA 4X9DA 5GAOl 1KQSA 1M8VA 2FB7A 2H3JA 2PVOB 4FT4A 3SWNA 4N4IA 3OQ5A 3CD6A 3V8JA 3BG5A 4II1A 5CKEA 3HHTB 3KUFA 4C5HA 2RD1A 5GAN2 2EQJA 3L2ZA 1O9SA 4CI0C 3CC4T 4Z02A 2D9TA 2E65A 3M57A 3JB9D 1TH7A 1DJ7B 2M1HA 2P0PA 3JCMQ 2C06A 1YBYA 2DJZA 2GFUA 4J7FA 4C0DC 1HK9A 4HCZA 4F7UF 4NOYA 2FHDA 3QIIA 4HKEA 1M90C 3QHSA 2QA4T 2HQXA 3FDRA 1WNLA 3JB9G 2DD4B 4C92A 4LDVA 4NL3A 5GANg 3JAME 2RHZA 1X6OA 2QTXA 4J83A 4MMKA 3OYGA 1X75C 3M53A 4MDWA 5CKHA 4GLKA 3VYGB 1YI2T 3QG1A 1YJNA 3OS5A 5CO7A 4Y28E 3TREA 2QDJA 4MZTA 1VQKT 4OF1A 1VQMA 2RO0A 1QVFA 1NPRA 2EWNA 1UGPB 1UGQB 3ASKA 2QQSA 2EJGA 3M58A 2PVGB 2JTFA 1I4K1 5FU6C 2HD0A 3ER0A 5J3BA 3VYGA 3OYIA 1U8RA 3SB2A 3M4YA 1NJIU 5GAMe 2ZPBB 1Y07A 4EMHA 3CCSA 1YHQT 4MMLA 3OYBA 1XQHA 3CC2T 3JB9F 2PUOB 1OI1A 3BY7A 1N6AA 5LJ3f 3CCUT 3GPLA 2KY9A 4Z6YA 2Y4YA 4N0AC 2ZPGB 2CZ0B 3SDZA 5GAN4 2DZ9A 2XDDA 2EFIA 4XTXA 2WJ9A 3KBGA 5IT9E 1VQLT 2OTLT 2QDYB 2R5AA 4HA8A 2EJFA 3CCJA 5GAN7 3JRZA 2IVWA 4LD6A 2CZ1B 3EFRA 4A4FA 4C8QC 4IURA 4EPCA 5C0MA 1PSEA 1VQ7T 5L8RE 4MDXA 5IN1A 5A2QE 2X35A 4KUDK 5CAIA 3DKMA 4C0DB 4LDUA 2CZ6B 3A8LB 2ZPFB 2FVUA 1UGRB 3MEVA 1ZQ1A 5GANd 3QYBA 5A0GA 2L8DA 3FEOA 1MGQA 2JZ2A 3TU4K 5AYFA 4M78E 4HCCA 3QJYA 3QSUA 3UDCA 1V29B 3BG3A 5LJ5j 1W4SA 5LJ3h 3TEEA 3L2RA 5DLQE 2CZ7B 2DZCA 4L6V5 5GMKh 5GAMg 3V8KA 3L2UA 4A54A 5HKCA 4BE0A 2G3RA 3OYNA 2QEXT 5GAN8 4OGEA 4JDSA 3VJPA 2E10A 4JRIA 4HL4A 2JUFA 1Q82U 3OSVA 4JX5A 3GLXA 2O01E 4N4GA 2PU9B 4JLGA 3URGA 1KD1U 1BIAA 4XTWA 1KC8U 3HBLA 2BUDA 3LYIA 5CR2A 3P8HA 3KHIA 3FLGA 5GMKi 4JRQA 1UGSB 3LW5E 3MP1A 2WSFE 1AHJB 3DLMA 2QXFA 1RI0A 4E7HA 4N0AA 3S3OA 3JCMf 3OYAA 2R5MA 3E9FA 4ZTFA 4ATOA 3DB3A 2QA4A 2E6ZA 1D3BA 2DXCB 3PMTA 4HCBA 3VKGA 3OYYA 3VYHB 1MHNA 1M1KU 3X26B 2BKDN 2KVQG 2CS7A 3V8LA 1E7PA 4M75B 4M75D 4DOWA 3QZ5B 4C8QA 4X34A 1K8AU 4BI8B 4OGCA 2RI5A 3QBYA 2A7YA 2X4WA 1N27A 4PL6A 1YI2A 2E12A 3ME9A 4VUBA 4HT8A 3NFCA 4M7AB 3CCQT 3PMIA 4M7AD 2VGNA 5FLXE 3CXCS 3OMCA 4E7LA 4HNTA 4NC6A 3L2VA 1QVPA 2MAMA 4PJOE 3JCMb 2ZPEB 4FL6A 3RKYA 1VQNT 2K3XA 3SD4A 3JB9J 2KMGA 2QQBA 5LL6S 2JTMA 5GAMd 4BY6B 3Q1JA 2DD5B 1YHQA 3L42A 4M7DE 4XTUA 3CC2A 3CCUA 4F7UA 5FRNA 2DXTA 4M7AG 2VC8A 5CKFA 1H3ZA 3FJPA 2EKOA 4OMFB 5D6WA 3INZA 1BI3A 2YLBA 4R55A 1IREB 1P92A 1RL2A 2XG8D 4KULA 4JJNK 2RI3A 2O4XB 2XIDA 1K8AC 3JCMh 5HK0A 2E1HA 3HZJA 1U1TA 2EQUA 1VQLA 2OTLA 5LJ5g 2K57A 3CCMT 5CK9A 5GAOq 1WGSA 2P0QA 4BE1A 4M77F 3VUBA 1SSFA 5D6XA 5KCHA 4JX4A 1NZ9A 1UB4A 3OSSC 2K2VA 3QUIA 4M75F 4JRKA 4KUIA 1M4ZA 1BI0A 2FL7A 2LNVA 3CBMA 5D6YA 3ZBDA 3OYLA 1JJ2S 2DAQA 4BB7A 3S6WA 3CBPA 2V8IA 3A5ZB 3HRSA 5LJ3e 3PIOA 1Q81C 4DQ2A 4M7AF 3CMAT 5GMKe 3JCMX 2LQ8A 2EQKA 3CMET 3J7AF 1KG1A 5GAMj 2DPPB 3H6ZA 4J6XA 1YITT 4BBRM 4FIBA 4C5IA 4RKUE 2D6FA 2P0KA 3C94A 4FU6A 3V7CA 4ELJA 3LGFA 3VKIA 4MIMA 3OB9A 1U1SA 3PNWC 4KBMB 1H641 2KK4A 5KE2A 3BDUA 3PFSA 3CCLT 2F5TX 3AHUA 3WVEB 2DD4A 2MWOA 2FYKA 3I55T 2L5QA 2PQWA 5FROA 3FRNA 5KE3A 2QEXA 2V8JA 4PNOA 4MFEA 2I2LA 4XK8E 2HBPA 1K9MC 2Y4XA 3JSCA 2RJFA 4IKFA 3CC7T 3BW1A 1XNIA 2E64A 4OVAA 5GANf 5GAOr 4AKGA 1N9RA 4QQGA 3CCRT 2LT1A 2RJEA 4PKCC 3UPUA 2NLUA 4XTVA 1VQOT 2DXBB 4C92E 2XI9A 2OTJT 2LCLA 5LJ5d 4RCCA 4BI3A 2VXFA 5CKBA 3L1AA 4QSHA 5CIUA 2DXBA 4R56A 1BIBA 4C0GA 3J80E 1S72T 4A4EA 3G71T 3G4ST 3NTIA 1VQ9A 2M0OA 3CCVA 3CXCA 2HAXA 4XU1A 2RA2A 3META 2KAFA 3H4CA 2BIVA 2QQ9A 4WF2A 4E7IA 1VQ6A 5CVIA 4M75C 1I5LA 2WSCE 4B9XA 3MCAB 3OS0A 2X4YA 2LX9A 3CCQA 1Q7YC 4M78D 4M78B 3HFNA 1B34B 5CCAA 5J39A 3C12A 3OBYA 3L2QA 1G3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF E;  1AHJ B;  2D0Q B;  2DXC B;  4ZGJ B;  4OB2 B;  4OB3 B;  3VYH B;  3X26 B;  2ZCF B;  3QYG B;  2ZZD A;  3X25 B;  3X20 B;  3QZ5 B;  2PVO B;  2CYZ B;  3A8H B;  4ZGE B;  3HHT B;  1DJ7 B;  1JB0 E;  3QZ9 B;  2ZPE B;  3A8O B;  2DD5 B;  2DD4 B;  1QP3 A;  2PUK B;  1IRE B;  2ZPH B;  3VYG B;  3WVD B;  4Y28 E;  2DXC A;  1UGP B;  2AHJ B;  1UGQ B;  2PVG B;  1PSF A;  3A8M B;  3VYG A;  4FM4 B;  2ZPB B;  1QP2 A;  2PUO B;  4KT0 E;  2DPP B;  2ZPG B;  2CZ0 B;  4RKU E;  4OB1 B;  2QDY B;  3X28 B;  4ZGD B;  2DD5 A;  3WVE B;  2CZ1 B;  2DD4 A;  1PSE A;  5L8R E;  4XK8 E;  2CZ6 B;  3A8L B;  2ZPF B;  3QXE B;  3QYH B;  1UGR B;  1GXI E;  2DXB B;  2ZZD B;  2PVD B;  1V29 B;  2CZ7 B;  4L6V 5;  2DXB A;  3X24 B;  3A8G B;  2ZPI B;  2WSE E;  2O01 E;  2PU9 B;  2WSC E;  1UGS B;  4OB0 B;  3LW5 E; 
#chains in the Genus database with same CATH topology
 4C92 F;  5GAN h;  1G5V A;  2YHT A;  3NTH A;  4Q5W A;  3BG9 A;  3EH1 A;  3EJ1 B;  4F7L B;  1WYX A;  3BHT B;  5KYW B;  2GQI A;  4J6W A;  4DEX A;  2R57 A;  2ESW A;  2L89 A;  1G83 A;  3H0H A;  1K0S A;  3CC4 A;  5GAO p;  5KH6 A;  2YUN A;  2K3Y A;  2RHI A;  3HPW A;  4XTY A;  1GBQ A;  4AI6 A;  3CME A;  1D09 B;  2AKL A;  2OAU A;  1YIT A;  3OYF A;  5I2S A;  3E2U A;  4ZTJ A;  1VQ9 Q;  3JCM P;  4M77 B;  1YJW T;  2GTO A;  2YUP A;  3KXT A;  2DXC A;  2J7I A;  3I55 A;  1S1N A;  4PJO B;  1PSF A;  4OML A;  2K2M A;  4M75 A;  4M77 G;  2BS2 A;  4FM4 B;  2VWF A;  3CC7 A;  2IW9 B;  2KT8 A;  3RES A;  2EYZ A;  1KC8 R;  2RB6 A;  4V2S A;  1GUX A;  1UHF A;  5GMK j;  1LJO A;  1R0B G;  1VQ5 T;  3X28 B;  4E7S A;  1QLB A;  4YC3 B;  3CCM Q;  3G71 A;  3VS4 A;  4A53 A;  3JCM W;  3QDR B;  4QQ6 A;  4C5E A;  4EMK B;  1M1G A;  3S3N A;  3MEA A;  1BK2 A;  5GMK m;  4OGR B;  1W1F A;  1T0J A;  1K9M U;  1SEM A;  2LMJ A;  4JS4 A;  3R6O A;  3S3M A;  4M7D F;  5DY9 A;  1K1Z A;  4NST B;  3O5Z A;  3SWN B;  4M78 C;  2HKQ B;  3JCM d;  1QVG S;  2ZAE A;  2K7A A;  3CCL Q;  1AZG B;  1SSH A;  3I56 T;  4LN2 A;  2RH2 A;  2WSE E;  3FB9 A;  4GLM A;  2E3I A;  2X4J A;  5DLO A;  2M9U A;  5KYN A;  4CFV B;  2O2O A;  4L5G A;  3EFS A;  4C92 B;  2H3E B;  4J8O A;  2DL5 A;  1KFZ A;  3QKJ A;  4FSX A;  2LQK A;  1RAB B;  3J81 E;  2FPF A;  3OBW A;  3QWY A;  1I81 A;  2GQV A;  2CCH B;  2R58 A;  2XHC A;  1JU5 C;  4C92 G;  2JOY A;  1WHG A;  3G1J A;  4JUV A;  5LJ3 g;  1S72 Q;  3X25 B;  4LUD A;  1VQP A;  1N8R U;  1VQ8 A;  1A0N B;  2DKG A;  1TUD A;  3TW6 A;  1M9S A;  2DIG A;  8ATC B;  1AZE A;  1JB0 E;  2I53 A;  4OMQ A;  3C95 A;  2W10 A;  1KQ2 A;  1B7T A;  2PK2 A;  2LVM A;  1H1R B;  1JRI A;  1M3B A;  1OL1 B;  1YIJ Q;  4DBH A;  4QVC A;  2V1R A;  4MZM A;  1YCS B;  4M78 A;  2PUK B;  4A63 B;  5FU7 C;  4LDX A;  2LJ1 A;  2QI2 A;  1BKB A;  2CP7 A;  2X4X A;  4JPB W;  1TWB A;  2HDA A;  5I21 A;  5HK3 A;  1VOL A;  2KQW A;  1KQS S;  4QVZ A;  1MNE A;  1LNX A;  4AFU C;  1Y96 A;  1PCX A;  5HY6 A;  3LWI A;  1Q86 U;  4CXA B;  2BS3 A;  4OB1 B;  3VKH A;  4BBS M;  1WIE A;  4AKH A;  1VQM T;  3E1S A;  4PFZ A;  5DM7 R;  4F16 A;  2SEM A;  4CFN B;  3QXE B;  4M7D B;  2CKK A;  1QVF S;  4CRI A;  5LJ5 e;  5GAO n;  5GAN j;  2MI6 A;  1WXB A;  2F69 A;  3M59 A;  4C8Q D;  3M0Q A;  3HP9 A;  2F5K A;  3CCJ T;  4M7D G;  1VQ9 T;  2QQR A;  4KGV B;  3UF4 A;  1Q82 C;  2YRC A;  2G77 A;  1CSK A;  1WFW A;  2ZPI B;  3CPW A;  2FRY A;  4M77 E;  2XU8 A;  3OYJ A;  3OY9 A;  4CC2 A;  3UA7 A;  4M7A E;  4LE9 A;  2LJ3 A;  1M30 A;  4ZN1 A;  2COY A;  2KRM A;  4IUU A;  1Q7Y R;  1M1K C;  4OR5 B;  4JJB A;  2YLC A;  4NS5 A;  1LPL A;  3HFO A;  1X6G A;  3OMG A;  3PVQ A;  1UE9 A;  1Q81 R;  4J7I A;  3QYG B;  5GAO l;  2UZL B;  2ZZD A;  1M8V A;  2FB7 A;  1M8M A;  2GBQ A;  4FT4 A;  4N4I A;  2PMI B;  1MMA A;  4II1 A;  5CKE A;  1SHG A;  2DJQ A;  2EQJ A;  5GJW B;  4CI0 C;  2DME A;  2FG0 A;  4Z02 A;  4BCM B;  3M57 A;  2UZE B;  1DJ7 B;  1ZA2 B;  2W9F A;  2WIH B;  3JCM Q;  2GFU A;  2JTE A;  3CCR Q;  4F7U F;  4HKE A;  2QA4 T;  2HQX A;  4WCI A;  3EGD A;  3M0P A;  1WHK A;  1X6O A;  4J83 A;  4MMK A;  5IF1 B;  3H9N A;  1M3A A;  2LNH B;  4MDW A;  4Y92 A;  3TN8 B;  1YJN A;  1YI2 T;  1PHT A;  1H8K A;  5FWC A;  2QDJ A;  2W9Z A;  2RO0 A;  1JOW A;  2RNA A;  2DL7 A;  3ASK A;  4YOS A;  5FU6 C;  4BCQ B;  1ZSZ C;  3LQ5 B;  2QAZ A;  2HD0 A;  3ER0 A;  3VYG A;  1NJI U;  3M4Y A;  2ZPB B;  3CCS A;  4EMH A;  4MML A;  1O9K A;  3CC2 T;  3BY7 A;  1N6A A;  2Y4Y A;  3GTM S;  3EFO A;  1H4L D;  4HXJ A;  3VS2 A;  1JO8 A;  3KBG A;  1VQL T;  2QDY B;  3JRZ A;  4LD6 A;  4C8Q C;  3CD6 Q;  4A4F A;  1PSE A;  2P84 A;  4GBQ A;  2AZS A;  4MDX A;  5IN1 A;  2HQH A;  2J05 A;  1JJ2 P;  1OPL A;  3MJX A;  5IDN B;  1F1B B;  3TU4 K;  4BCK B;  1VA7 A;  1UUE A;  4HCC A;  1V76 A;  3QSU A;  4QKU A;  5LJ3 h;  1QVG P;  3L2R A;  2HBW A;  2CZ7 B;  4L6V 5;  3TNI B;  5GJV B;  2G3R A;  3OYN A;  2QEX T;  3VJP A;  4JRI A;  4N4G A;  3GLX A;  2MOX A;  2O01 E;  3BHV B;  4J9E A;  4JLG A;  1KD1 U;  1BIA A;  1ZSZ A;  3P8H A;  1E6H A;  1UGS B;  3LW5 E;  2WSF E;  1M27 C;  3DLM A;  4E7H A;  2YWW A;  3QHR B;  2EGC A;  4OMN A;  3S3O A;  3JCM f;  1U06 A;  2R5M A;  4ZTF A;  4ATO A;  1D3B A;  2DXC B;  2BKD N;  2KVQ G;  4HVV A;  2CCI B;  4M75 B;  4B6M A;  4C8Q A;  2RI5 A;  2R7G A;  3QDF A;  4ZNX A;  4HT8 A;  1AD6 A;  1FMV A;  3PMI A;  3CXC S;  5DQW A;  1ABQ A;  1GUX B;  4NC6 A;  4FL6 A;  2K3X A;  5LL6 S;  4M7D E;  2PTK A;  5FRN A;  4RTT A;  1MMD A;  5CKF A;  4OMF B;  2V22 B;  2JMC A;  4DBQ A;  2C06 A;  4LD9 K;  4KUL A;  4ROE A;  2EBP A;  1YN8 A;  3AT1 B;  4R0K A;  2C5O B;  4FYW B;  2DLP A;  1UB4 A;  1KJW A;  3OSS C;  1M4Z A;  2FL7 A;  3CBM A;  2O31 A;  1KQS P;  2AZV A;  4DQ2 A;  1NBE B;  1UHC A;  2EQK A;  3CME T;  3H6Z A;  1YIT T;  1KIK A;  4RKU E;  1NYG A;  3EG1 A;  3OB9 A;  2PK9 B;  3M03 A;  1Q95 G;  1SRM A;  4KBM B;  1D0Z A;  4CC4 B;  2F5T X;  3AHU A;  2MWO A;  3M0U A;  3I55 T;  3LH5 A;  3FRN A;  1D1C A;  1ARK A;  4XK8 E;  1K9M C;  4KGX B;  3VRY A;  1KSW A;  3CC7 T;  3BW1 A;  5GAN f;  1AIS B;  3CCR T;  3EH2 A;  4EOO B;  2RJE A;  2EYW A;  3CCU Q;  2RF0 A;  2DXB B;  5I5Z B;  1ZUK A;  2FO0 A;  3MY5 B;  5CKB A;  4QSH A;  4A4E A;  3G71 T;  5IHY A;  1VQ9 A;  2KE9 A;  2LQW A;  2GTJ A;  4XU1 A;  4PJN A;  2KAF A;  2L3S A;  3H0I A;  2WSC E;  2X4Y A;  4M78 B;  3HFN A;  2X51 A;  3KFV A;  3TSW A;  4F17 A;  3VS7 A;  2LQN A;  1NYF A;  3M5A A;  2DVJ A;  5KYY A;  1WJS A;  4QVD A;  1N8R C;  2EJ9 A;  2VYT A;  3I5S A;  3TQ7 P;  2DBM A;  3A8H B;  4A4G A;  2CH4 W;  3K7A M;  3NPF A;  4JS5 A;  3LLR A;  3CCM A;  1TSF A;  2JS0 A;  5KCO A;  3OYK A;  3QZ9 B;  1BYM A;  1F5Q B;  2E5Q A;  4GY5 A;  3JB9 H;  2WMA B;  3RUX A;  5LJ3 d;  2A37 A;  2P4T A;  4ELY C;  4F6W B;  2A28 A;  2E6N A;  3M4G A;  1VQP T;  2GF7 A;  4F6U B;  3SEM A;  4LNP A;  4C0Z A;  1VQ8 T;  4BE2 A;  3CCL A;  1D0Y A;  1OU9 A;  3LGL A;  2JNG A;  3CCQ Q;  2QGS A;  3DL1 A;  4CFM B;  2PJQ A;  4QW2 A;  1Y71 A;  2FZC B;  1Q86 C;  1JSU B;  2LC4 A;  1VQ7 Q;  3TSZ A;  5LJ3 j;  2NUP A;  2GCX A;  4BY1 X;  4E7K A;  2QGF B;  1CKA A;  2A0F B;  1G3T A;  3UT1 A;  4UC4 A;  2DD5 A;  2BZY A;  4EON B;  1TS9 A;  2ZGW A;  4BY7 X;  1XTD A;  3F70 A;  1S72 A;  1ZHI A;  4HT9 A;  2EPD A;  1WZO A;  1K73 U;  4J9B A;  3QYH B;  2DYI A;  2JM9 A;  1RAG B;  4PJO F;  2CT3 A;  3TW7 A;  4BI4 A;  4F7U E;  5BNJ B;  2ZZD B;  4RG8 A;  4O6J A;  1KXU A;  3OW2 S;  1YIJ A;  1G3S A;  4EOS B;  2D8J A;  4FX3 B;  3EAE A;  3HSB A;  4YOZ A;  3GOX A;  1HXD A;  3REA B;  1EFN A;  2YRV A;  1M90 R;  4I3Z B;  3DLL A;  2KT1 A;  1ZBJ A;  2LT4 A;  1EIF A;  3PTA A;  3RER A;  2HQE A;  4B9W A;  1TOV A;  1QMC A;  4AKI A;  2K6D A;  2RK2 A;  5IHN A;  1OL2 B;  1R8O B;  2CRE A;  1N4M A;  3RKW A;  4JZ3 A;  1VQO Q;  2OTJ Q;  1T3S A;  1PKS A;  2RK1 A;  3HO8 A;  2K9G A;  4OB2 B;  3OYM A;  4FYX B;  4D8D A;  3PIP A;  3X20 B;  5L23 A;  3G4S Q;  4DOV A;  3MEU A;  3BDL A;  4CFX B;  1O9K B;  4FCY A;  4FT2 A;  2IW6 B;  3CQT A;  3RKX A;  4BCN D;  2ED0 A;  3CPW S;  3EFO B;  1YFN A;  1W2B A;  3CXC P;  1X6B A;  1ZBX A;  2BKZ B;  4QQD A;  2VUB A;  1VIE A;  4HNV A;  4DEY A;  1OZ3 A;  2DA9 A;  1OPK A;  4J6Y A;  1WHM A;  3UWN A;  4A4K A;  5GAO m;  3WVD B;  4P5N A;  2WEV B;  1NJI C;  2CUB A;  2A3L A;  4FSS A;  2NUZ A;  2XD0 A;  3A8M B;  1MV3 A;  3TCJ A;  3PO3 S;  2UUE B;  3FJ5 A;  2RHX A;  3LH0 A;  2YDL A;  3OS1 A;  2DVE A;  3H8Z A;  3CCE Q;  2M16 A;  1BCO A;  1FWZ A;  4LDW A;  2QFZ A;  1J3T A;  4ME7 A;  1SHF A;  1YJN T;  5HBJ B;  1QWE A;  5FU6 B;  1QW1 A;  1ZSZ B;  1KHC A;  2AT1 B;  4Y91 A;  2KMT A;  2L3P A;  4Z8A A;  2DXU A;  4MFD A;  1M1F A;  2GFA A;  3CCS T;  1IGQ A;  3FC3 A;  2YXY A;  1D3B B;  1NEG A;  2RM4 A;  3CCR A;  2CP0 A;  2EYQ A;  4PJO G;  1G3N C;  3VRZ A;  4C8Q B;  5GAM h;  5ICP B;  1SPK A;  2DK3 A;  3BLR B;  1X27 A;  3EID B;  1OQK A;  3X24 B;  4EOR B;  1D0X A;  3P8D A;  1KD1 C;  2BE7 D;  3U23 A;  4C8Q G;  3DDQ B;  2WXV B;  1T0H A;  3M9Q A;  1HSQ A;  4RCB A;  2LP5 A;  4IUQ A;  1BI1 A;  1K8A R;  2EGA A;  2W0Z A;  1VOM A;  2OAW A;  4OB0 B;  3CEY A;  1VQ4 Q;  2YUO A;  2KRN A;  2MWP A;  2E70 A;  2EGE A;  4N4H A;  3HRU A;  1AWJ A;  3O0G D;  4ZGJ B;  2P4R A;  2KR6 A;  5KYU A;  4LDY A;  3G6E Q;  5FWB A;  2JT4 A;  5IHI A;  1NG2 A;  2JS2 A;  3CD6 A;  4C5H A;  3KUF A;  2RD1 A;  2D9T A;  3JB9 D;  4Z89 A;  2ROT A;  2GGR A;  2K3B A;  2E4H A;  1YJ9 Q;  2M1H A;  2DJZ A;  1OU8 A;  4IMY B;  3QII A;  1OV3 A;  1U5S A;  1H1P B;  1Z9Z A;  2QTX A;  3OYG A;  3M53 A;  1H28 B;  1R77 A;  5LMK B;  1H3H A;  5CKH A;  4GLK A;  1RLP C;  1VYV A;  3TRE A;  5CO7 A;  2RMO A;  4MZT A;  4OF1 A;  1NPR A;  1UGP B;  1FMK A;  2EJG A;  2PVG B;  1U8R A;  3M0T A;  2DIL A;  1IHV A;  3OYB A;  4CFW B;  1OI1 A;  1UDL A;  4JJC A;  5LJ3 f;  3GPL A;  4N0A C;  2C6T B;  3SDZ A;  1D1A A;  2QK0 A;  3QWX X;  2KXC A;  2WJ9 A;  5IT9 E;  3MI9 B;  4HA8 A;  3MPU B;  4D8K A;  2CZ1 B;  3EFR A;  2DET A;  1AWO A;  2X35 A;  4KUD K;  1B3Q A;  4C0D B;  4LDU A;  2JJ9 A;  2CZ6 B;  4IIO A;  1V1C A;  4RTU A;  4ROC A;  5D7U A;  5KYY B;  5GAN d;  5A0G A;  2L8D A;  1MMG A;  2D8H A;  1ZA1 B;  2FPE A;  3OW2 P;  3TEE A;  3EHR A;  1H26 B;  2ATC B;  2DZC A;  2WPA B;  4BE0 A;  1JEG A;  1QWF A;  4HL4 A;  2PZ1 A;  2RQR A;  3OSV A;  4JX5 A;  2PU9 B;  1KC8 U;  5I11 A;  3LYI A;  5CR2 A;  1QLY A;  3MP1 A;  2D1X A;  2QXF A;  4N0A A;  2L2P A;  3E9F A;  3PMT A;  4Z88 A;  3OYY A;  6AT1 B;  1MHN A;  3QZ5 B;  1K8A U;  1AT1 B;  1AVZ C;  4BI8 B;  1NM7 A;  2A7Y A;  1N27 A;  3ME9 A;  4M7A D;  1HJD A;  2NUP B;  3CPW P;  4E7L A;  2MAM A;  4PJO E;  3RKY A;  8AT1 B;  2BPM B;  2JTM A;  5GAM d;  3Q1J A;  2DD5 B;  4XTU A;  3CCU A;  2VC8 A;  2EKO A;  2DRK A;  4JJN K;  4R55 A;  1RL2 A;  2C0T A;  2RI3 A;  1ZUU A;  1C1A A;  1BBZ A;  5LJ5 g;  2K57 A;  3CCM T;  4J9D A;  5CK9 A;  1WGS A;  1VIN A;  3VUB A;  1SSF A;  1OKV B;  3M0S A;  4M75 F;  5DQV A;  2QTV A;  3QUI A;  2MYS A;  4J9F A;  4JRK A;  5ECA A;  1RAA B;  3CBP A;  3A5Z B;  4DBF A;  1X43 A;  2KYB A;  1MND A;  2F2W A;  5GMK e;  3JCM X;  3J7A F;  4YOO A;  2CUD A;  5GAM j;  2DPP B;  2D6F A;  4BBR M;  5IDP B;  2P0K A;  1AOJ A;  4FU6 A;  3VS1 A;  2EYX A;  1U1S A;  2HSE B;  3PNW C;  1H64 1;  2KK4 A;  3CCL T;  3BDU A;  4CFU D;  2UZD B;  3WVE B;  2G9X B;  5KE3 A;  4PNO A;  2VB6 A;  4F7J B;  2IPO B;  4IKF A;  4OVA A;  1FIN B;  4AKG A;  2EQI A;  4QQG A;  4TTH A;  1YHQ Q;  1UGV A;  2NUT B;  3EG3 A;  4XTV A;  1X2K A;  4C92 E;  2XI9 A;  2F2X A;  3H0F A;  1E7O A;  5L2W B;  2MK5 A;  4EOI B;  2VXF A;  4II5 B;  1GCQ C;  2RQW A;  2ECZ A;  2OTL Q;  2QG9 B;  4C0G A;  3J80 E;  1S72 T;  4PK4 A;  2HCK A;  3MET A;  3H4C A;  2BIV A;  2QQ9 A;  3VS5 A;  5CVI A;  2OJ2 A;  1PG5 B;  3MCA B;  4BCG B;  1K76 A;  5HCK A;  3CCQ A;  3I35 A;  3C12 A;  5I22 A;  2MMP A;  4X1V A;  3JB9 I;  4M7A C;  3JCM e;  1I07 A;  2KSS A;  2D0Q B;  1TXQ A;  1OYX A;  1YIJ T;  3HKS A;  1VQ7 A;  2VAS A;  3PGG A;  1Y0M A;  5KYX A;  1QKW A;  5CQX A;  3O8V A;  7AT1 B;  4BY6 C;  1RAE B;  4O5V A;  4X9C A;  1JJ2 A;  4RUG A;  2CYZ B;  5FRM A;  3GNG A;  1FKM A;  2K5L A;  1OZ2 A;  2CDT A;  1QVG A;  4RTV A;  2RI2 A;  2LRQ A;  5C6S A;  4M78 F;  1OUL A;  3C4S A;  1I5O B;  2RJD A;  2DIQ A;  4F6S B;  1GCQ A;  3RGF B;  3CCV Q;  2LCC A;  5HNB B;  3M55 A;  2IW8 B;  3VS0 A;  5A0L A;  3JCM g;  2ENM A;  3SFM A;  1G2B A;  4EIK A;  1JST B;  2MF2 A;  4M7D D;  2OI3 A;  1Q82 R;  1Q7Y U;  3QWL A;  4M75 G;  2M0Y A;  2NWM A;  3PE0 A;  4JLI A;  3V7R A;  4M7A A;  2XK0 A;  4KT0 E;  1Q81 U;  3A98 A;  1VQO A;  3MEW A;  4ZN3 A;  2OTJ A;  2A08 A;  2RQU A;  1VIF A;  1GBR A;  2K5I A;  2BTT A;  2HNI A;  2V8K A;  2DEQ A;  2Z0W A;  3G4S A;  1O75 A;  1M1K R;  1IZ6 A;  5GAN e;  1ZUY A;  5GAN 3;  2CJM B;  1BCM A;  5KYU B;  4HLQ A;  2C5V B;  1OGU B;  3CMA Q;  4A4H A;  2CP5 A;  2LW4 A;  3M0R A;  2H8H A;  2F2C A;  1LOJ A;  1RAD B;  2LJ0 A;  1WXT A;  1M2V A;  2B8A A;  2HEQ A;  5CQY A;  2XDB A;  4LOC A;  4PLI A;  1FXX A;  3MKD A;  5GAN 6;  4KH1 B;  1IHW A;  1VQK Q;  1RI9 A;  2DTH A;  2QF7 A;  3E19 A;  1RAF B;  1OX9 A;  5IXB A;  2JVV A;  5A0D A;  1H24 B;  2O9S A;  1YWP A;  2LDM A;  2CP2 A;  1QVF P;  3OS2 A;  4FW2 A;  4MZP A;  3OYD A;  3LX7 A;  1Y7X A;  2BZ8 A;  3THK A;  4E47 A;  4WTO B;  5J26 A;  4ESR A;  2L3R A;  3CCE A;  2XIC A;  5LJ5 h;  2KGT A;  1PRL C;  2CP3 A;  1PM3 A;  2MCN A;  1HD3 A;  1SKU B;  1H1Q B;  4DA4 A;  3M56 A;  4ZGE B;  3OYH A;  5EJC A;  1JXM A;  1X2Q A;  3QJ6 A;  4HNU A;  4IIM A;  4TVR A;  1EX4 A;  1JKW A;  3MHX A;  4BCN B;  1VYU A;  3WXM B;  1NLP C;  1RAC B;  1WJQ A;  2AIR B;  1FVV B;  2CP6 A;  1PKD B;  3CBO A;  3OYE A;  3E9G A;  4E6R A;  4CC7 A;  5HQ0 B;  3N5B B;  4M7D C;  1UNL D;  3RMQ A;  1ZLM A;  4BDY A;  1B34 A;  4EDU A;  3M54 A;  2VXE A;  2O88 A;  4M78 G;  2XDP A;  2EQM A;  3CD6 T;  2A36 A;  2GNC A;  4BCP B;  1Y96 B;  2DMO A;  2RHY A;  2B9R A;  4HVW A;  3CPF A;  2DTO A;  1QCN A;  5GAM f;  2FPD A;  1RAH B;  5EG2 A;  2RJC A;  1VQ4 A;  5I2M A;  1HYO A;  4EOM B;  2JN0 A;  1PNJ A;  3ZFJ A;  1JBM A;  4KGZ B;  1YJW Q;  2JMA A;  3G6E A;  3B57 A;  1TD6 A;  2IIM A;  2DF6 A;  4AT1 B;  1H1S B;  4BDZ A;  3BHU B;  4PFP A;  1YJ9 A;  4C0F A;  5FU7 B;  1TTH B;  1VQN Q;  5GAN 5;  4M7D A;  3CCV T;  2EUF A;  1VQ5 Q;  3A8G B;  2WAC A;  1XOV A;  5IAY A;  1KC8 C;  2QGG A;  2C0I A;  2FEI A;  4M75 E;  2DTI A;  2V1Q A;  1VUB A;  2QQA A;  4M4Z A;  2XKO C;  1UFF A;  1WI7 A;  3P8B B;  1QQJ A;  2DE0 X;  3LWH A;  3EGU A;  3MP8 A;  1WQ7 A;  4XAX B;  4KH0 B;  4EOK B;  4NL2 A;  1QCO A;  2DRM A;  4C8Q F;  2QAS A;  4X9D A;  3I56 Q;  2L3Q A;  2H3J A;  3V8J A;  3HHT B;  5EFQ B;  3VS6 A;  1TH7 A;  4QT7 A;  3RR6 A;  4EOQ B;  2P0P A;  5HVY B;  2QYZ A;  1YBY A;  1YNZ A;  3EGD B;  1HK9 A;  2CSQ A;  4NOY A;  2FHD A;  2J6O A;  3QHS A;  3JB9 G;  1AD5 A;  4RTW A;  1K9M R;  1MMN A;  1AWX A;  4NL3 A;  2RHZ A;  1BB9 A;  3VS3 A;  3VYG B;  2EVR A;  3QG1 A;  4RTZ A;  1VQK T;  1I0C A;  1YWO A;  2JGZ B;  1WA7 A;  2QQS A;  3M58 A;  1I4K 1;  2BZX A;  3OYI A;  5EC7 A;  1PKT A;  1Y07 A;  3I5R A;  2F2V A;  1XQH A;  2PUO B;  3CCU T;  2KY9 A;  2DL3 A;  1G8X A;  2CZ0 B;  1YP5 A;  9ATC B;  4ROD A;  2COZ A;  2XDD A;  1ACM B;  2LCS A;  2DFU A;  4XTX A;  2FRW A;  3RBB B;  2EJF A;  1H92 A;  5GAN 7;  1X69 A;  4EPC A;  5C0M A;  2OX7 A;  2G6F X;  5A2Q E;  5CAI A;  4AFQ C;  2X3W D;  1IB8 A;  3A8L B;  2ZPF B;  1N8R R;  2FVU A;  5KYX B;  1ZQ1 A;  1GFC A;  3QYB A;  1WLP B;  3MY1 B;  2C0O A;  1GFD A;  3FEO A;  2JZ2 A;  3EG2 A;  5LQF B;  5AYF A;  4M78 E;  2KR3 A;  3QJY A;  3UDC A;  5LJ5 j;  3BG3 A;  1W4S A;  2J6F A;  3L2U A;  3V8K A;  5GAN 8;  4OGE A;  1VQM Q;  2HL3 A;  4E2F B;  2JUF A;  3NMZ C;  4XTW A;  3HBL A;  2F1L A;  2DNU A;  3H41 A;  4JRQ A;  2CT4 A;  4F04 B;  1QKX A;  1RI0 A;  2WMB B;  4EOL B;  3OYA A;  3DB3 A;  1TFB A;  3CCJ Q;  3VYH B;  3X26 B;  1Q86 R;  3V8L A;  2L0A A;  4OGC A;  4G6L B;  2IN3 A;  3QBY A;  2X4W A;  4PL6 A;  1KK7 A;  2E12 A;  1ZSG A;  2MPX C;  4M7A B;  3CCQ T;  2VGN A;  5FLX E;  1W70 A;  3MIA B;  3NDQ A;  4AG2 C;  1QVP A;  3L2V A;  2W96 A;  3JCM b;  5IH2 A;  1SRL A;  3SD4 A;  1VQN T;  2UZB B;  2QQB A;  1VQ7 T;  1YHQ A;  4KRT A;  4BY6 B;  2KRS A;  1IGU A;  4F7U A;  4M7A G;  4RTX A;  1UTI A;  2KI7 A;  1BI3 A;  2YLB A;  1R0C B;  1IRE B;  1M90 U;  5HK0 A;  1C9B A;  1U1T A;  2EQU A;  1OKW B;  2OTL A;  1QCF A;  5GAO q;  2P0Q A;  1C6V X;  5KCH A;  1Q7Y C;  2B86 A;  4J9G A;  2WHB B;  2K2V A;  4E7Z A;  3ZBD A;  1BI0 A;  3OYL A;  1JJ2 S;  3S6W A;  2V8I A;  3HRS A;  5LJ3 e;  1Q81 C;  4BCF B;  1ZP2 A;  1M2V B;  1WHL A;  4EC8 B;  2HL5 C;  3BE3 A;  1K4U S;  4J6X A;  2QA4 Q;  3C94 A;  3V7C A;  4ELJ A;  3LGF A;  3VKI A;  1U3O A;  3PFS A;  4CFU B;  2K79 A;  5AT1 B;  4JZ4 A;  2DD4 A;  1YI2 Q;  2PQW A;  4LUE A;  1SF9 A;  2DBK A;  2HBP A;  2HSP A;  3JSC A;  4BXX X;  2RQV A;  1XNI A;  2E64 A;  1N9R A;  2NLU A;  3CC2 Q;  3UAT A;  2EYY A;  1RUW A;  1VQO T;  2OTJ T;  2LCL A;  1UEC A;  2X1N B;  1VQL Q;  2DXB A;  4R56 A;  1BIB A;  2I0N A;  3DTO A;  4BCJ B;  3G4S T;  2RN8 A;  4LXC A;  2M0O A;  3CCV A;  2HAX A;  2RA2 A;  3BLQ B;  4BCO B;  4WF2 A;  1XO2 A;  2W99 A;  1GY3 B;  1NLO C;  3PVL A;  1I5L A;  4B9X A;  4FYY B;  5CYI B;  1B34 B;  2ROL A;  5J39 A;  3OBY A;  3L2Q A;  3JCM V;  1VYT A;  1NJI R;  1UG1 A;  3MP6 A;  1BI2 A;  3MO8 A;  4OB3 B;  2DM1 A;  1M5Q 1;  2DL8 A;  4EMG A;  2MIO A;  2QEX Q;  2ABL A;  4BUG A;  3TNW B;  1PRM C;  1WPY A;  2DX1 A;  3BFM A;  5CKD A;  3OYC A;  1GCP A;  3OW2 A;  1WJR A;  1UJ0 A;  3GNF B;  3VV0 A;  2HMA A;  3DDP B;  2Y90 A;  3CCE T;  4C5G A;  3CMA A;  3G33 B;  4KRD B;  4D6W A;  1SG5 A;  2DER A;  2ZPH B;  1MUZ A;  4FW1 A;  2KXD A;  4M77 D;  2QDL A;  1I1J A;  2KDS A;  1VQ6 Q;  2AHJ B;  1NPP A;  4PJO D;  2WFY B;  3RMS A;  3DB4 A;  1VQK A;  2W2H A;  3ZEH A;  2C4G B;  1KD1 R;  3HL8 A;  1QP2 A;  2IG0 A;  2NYS A;  3VUZ A;  4AFS C;  1WXU A;  3QO3 A;  2RHU A;  4ELZ C;  4C8Q E;  4BD3 A;  3QPH A;  5M9O A;  2LX7 A;  4M6V A;  1JQQ A;  3GBQ A;  4JRP A;  4E7J A;  3GF5 A;  1UJY A;  4IUT A;  2M02 A;  2O4X A;  4J9H A;  3CC4 Q;  2O9V A;  5HBH B;  4XQ3 A;  3TNH B;  3IQL A;  5CEI B;  1GXI E;  1C0M A;  1N9S A;  1RAI B;  1URC B;  1VQ4 T;  1TUG B;  2E41 A;  5FGK B;  3EG9 A;  3CME Q;  5LJ5 f;  1LCK A;  1YIT Q;  2PVD B;  4PLL A;  2KNB B;  4CRL B;  1IO6 A;  3G6E T;  2SRC A;  2X3X D;  1K73 C;  3I55 Q;  3FIF A;  2DL4 A;  1RLQ C;  1CKB A;  1B07 A;  4UN0 A;  1YJ9 T;  4BCI B;  4C92 D;  3CC7 Q;  2K5F A;  3PT9 A;  2QQ8 A;  2JXB A;  2J6K A;  3EGX A;  1AWW A;  1X01 A;  3EG0 A;  4YTL A;  3EHQ A;  3G71 Q;  1YJW A;  3TVT A;  1PC0 A;  3JV3 A;  2V26 A;  1YCY A;  4M77 C;  1P5E B;  2DO3 A;  1OI9 B;  4OMM A;  3REB B;  3I9Q A;  4PJO C;  1K0X A;  3A8O B;  3G7Z A;  4RG2 A;  3HTR A;  1VQN A;  4J5Y A;  1QP3 A;  2VGM A;  1VYW B;  4XU2 A;  1VQ5 A;  4XU0 A;  3DJB A;  2EW3 A;  4ANJ A;  3JCM c;  1UEB A;  1PWT A;  4OMO A;  5KYW A;  5HBE B;  2EAY A;  1ENW A;  2FZG B;  5GMK l;  1M2O A;  4BAC A;  3JCM J;  2BS4 A;  2ED1 A;  2LZ6 B;  4K11 A;  4EC9 B;  4EMK C;  2YT6 A;  3R6N A;  1OIU B;  2YRD A;  1G3W A;  1KQ1 A;  4IUP A;  1VQP Q;  4ZGD B;  3ULR B;  3SWN C;  1VQ8 Q;  3V7S A;  2J06 A;  3I56 A;  4XU3 A;  1NE8 A;  3EOC B;  1PD1 A;  4M77 A;  2KBT A;  2XMF A;  1WQW A;  3RIR A;  3GIB A;  4HVU A;  1I8F A;  3NTK A;  4AFZ C;  2VV5 A;  2CGH A;  4RMO A;  4PJO A;  4XTZ A;  3OA6 A;  4ORZ A;  1FX7 A;  3RDV A;  4C92 C;  2HZY A;  3HB9 A;  4PJM A;  1W2B S;  4J9I A;  2YSQ A;  3QYE A;  3GP8 A;  3L2W A;  2AK5 A;  1AEY A;  4L59 A;  1VQ6 T;  1Y57 A;  2JW4 A;  4JX6 A;  4PJJ A;  3VU3 C;  1KHI A;  2HKN A;  1D3U B;  4F7U B;  3HRT A;  1BU1 A;  4OP0 A;  4HCK A;  3QHW B;  4EMK A;  2LTO A;  2CSI A;  4IUV A;  2EIF A;  4F7U G;  2K4Y A;  4AMC A;  5FW9 A;  2ZCF B;  3T9N A;  1D1B A;  1WHJ A;  2KYM A;  1KQS A;  2X9H A;  2PVO B;  3SWN A;  4BCH B;  3OQ5 A;  3BG5 A;  2COW A;  5GAN 2;  3CC4 T;  4ELL A;  3L2Z A;  1O9S A;  2DEU A;  4BCM D;  2AKK A;  4F7S B;  2E65 A;  1E6G A;  3POM A;  4PFO A;  2BE9 B;  1UNH D;  4J7F A;  1K73 R;  4C0D C;  4HCZ A;  1OEB A;  1M90 C;  3FDR A;  1WNL A;  2DD4 B;  4C92 A;  4LDV A;  4EOJ B;  5GAN g;  3JAM E;  1E9H B;  5ACB A;  1M3C A;  1OIY B;  1X75 C;  1FMW A;  3OS5 A;  4Y28 E;  1K9A A;  1VQM A;  1QVF A;  2EWN A;  4JJD A;  1UGQ B;  4BCQ D;  2JTF A;  5J3B A;  3SB2 A;  5GAM e;  3DOG B;  3A1P A;  1YHQ T;  2CH4 A;  3JB9 F;  4Z6Y A;  2ZPG B;  5GAN 4;  2DZ9 A;  4OMP A;  2KEA A;  2VVK A;  2EFI A;  1NEB A;  2OTL T;  1W98 B;  2R5A A;  2WIP B;  3C0C A;  3CCJ A;  2IVW A;  4IUR A;  5L8R E;  2DYB A;  1JXO A;  3DKM A;  1UNG D;  1H27 B;  2VKN A;  1UGR B;  4AG1 C;  3MEV A;  2JM8 A;  1WX6 A;  4F7N B;  1MGQ A;  1PD0 A;  4RTY A;  1OX8 A;  1V29 B;  2RPN A;  5DLQ E;  5GMK h;  5GAM g;  4A54 A;  5HKC A;  1YJN Q;  2E5K A;  2YUQ A;  4JDS A;  1IXD A;  2RQT A;  2E10 A;  1LVK A;  1Q82 U;  1N5Z A;  3URG A;  2BUD A;  3NHN A;  3CCS Q;  3KHI A;  3FLG A;  5GMK i;  5IHK A;  4DBR A;  2FZK B;  4Y72 B;  1AHJ B;  4FYV B;  4F70 B;  2QA4 A;  2E6Z A;  4HCB A;  3VKG A;  1M1K U;  2CS7 A;  3SHW A;  1E7P A;  4M75 D;  4DOW A;  4X34 A;  1T3L A;  1YI2 A;  1WHH A;  4VUB A;  1BU2 A;  3NFC A;  1FYN A;  3OMC A;  4HNT A;  2ZPE B;  1IRX A;  2E3H A;  2KMG A;  3JB9 J;  3L42 A;  3CC2 A;  1WDX A;  4KRC B;  2DXT A;  1H3Z A;  1Z9Q A;  2I40 B;  3FJP A;  5D6W A;  3INZ A;  1QMZ B;  2XG8 D;  1P92 A;  3BLH B;  1K8A C;  2O4X B;  2XID A;  2EKH A;  3D7S B;  3JCM h;  2E1H A;  3HZJ A;  1VQL A;  3UA6 A;  4F14 A;  4BE1 A;  4M77 F;  1OOT A;  5D6X A;  4JX4 A;  1NZ9 A;  3EG9 B;  1XJW B;  4KUI A;  2LNV A;  5D6Y A;  2PHG A;  2PNI A;  2DAQ A;  4BB7 A;  1TG0 A;  1GL5 A;  3PIO A;  4PJL A;  4M7A F;  3CMA T;  2C5N B;  2LQ8 A;  4CC3 A;  1KG1 A;  2D0N A;  4FIB A;  4C5I A;  4MIM A;  5KE2 A;  2C5X B;  1GH6 B;  4J9C A;  2FYK A;  2L5Q A;  5FRO A;  2IVX A;  2QEX A;  2V8J A;  4MFE A;  2I2L A;  2Y4X A;  5IXF A;  2RJF A;  3ZL7 C;  1EZZ B;  3EGX B;  5GAO r;  1W6X A;  2LT1 A;  4PKC C;  3UPU A;  1MV0 B;  1GRI A;  1ZX6 A;  5LJ5 d;  4RCC A;  4BI3 A;  4EOP B;  2NUT A;  1W2B P;  1TUC A;  3L1A A;  5CIU A;  2KRO A;  3NTI A;  3NGP A;  3RNJ A;  3CXC A;  3F5X B;  1TU0 B;  1ABO A;  1H25 B;  4E7I A;  1VQ6 A;  2M51 A;  4M75 C;  3OS0 A;  2LX9 A;  4M78 D;  5CCA A;  1G3Y A; 
#chains in the Genus database with same CATH homology
 3JCM V;  2MMP A;  4C92 F;  3JB9 I;  4M7A C;  3JCM e;  5GAN h;  2KSS A;  2D0Q B;  1G5V A;  1OYX A;  1YIJ T;  3HKS A;  3MP6 A;  1VQ7 A;  2YHT A;  3M5A A;  3NTH A;  1BI2 A;  4Q5W A;  3MO8 A;  3PGG A;  3BG9 A;  1WJS A;  5CQX A;  3O8V A;  4OB3 B;  4QVD A;  1N8R C;  1M5Q 1;  2EJ9 A;  4BY6 C;  4O5V A;  4X9C A;  2VYT A;  4EMG A;  4J6W A;  4BUG A;  1JJ2 A;  2CYZ B;  4A4G A;  3A8H B;  2R57 A;  2L89 A;  4JS5 A;  3LLR A;  3CCM A;  1WPY A;  5FRM A;  3GNG A;  3BFM A;  5CKD A;  3OYC A;  1FKM A;  2K5L A;  3CC4 A;  5KCO A;  5GAO p;  3OYK A;  5KH6 A;  3OW2 A;  3QZ9 B;  1WJR A;  1OZ2 A;  1QVG A;  1BYM A;  3GNF B;  2E5Q A;  2RI2 A;  3VV0 A;  2LRQ A;  4GY5 A;  3JB9 H;  5C6S A;  3RUX A;  2K3Y A;  2Y90 A;  5LJ3 d;  4C5G A;  3CMA A;  4M78 F;  2RHI A;  3HPW A;  4XTY A;  3CCE T;  2P4T A;  4ELY C;  4AI6 A;  3C4S A;  2RJD A;  2DIQ A;  4D6W A;  3CME A;  2OAU A;  1YIT A;  3OYF A;  2ZPH B;  5I2S A;  2E6N A;  3M4G A;  4ZTJ A;  1VQP T;  2GF7 A;  3JCM P;  2LCC A;  4M77 D;  4M77 B;  3M55 A;  1YJW T;  4C0Z A;  1VQ8 T;  5A0L A;  4BE2 A;  3JCM g;  3CCL A;  3KXT A;  2DXC A;  3SFM A;  2KDS A;  3I55 A;  2AHJ B;  1NPP A;  4PJO B;  4PJO D;  3RMS A;  3DB4 A;  3LGL A;  2JNG A;  1PSF A;  1VQK A;  3DL1 A;  2MF2 A;  4M75 A;  4M77 G;  2BS2 A;  3ZEH A;  4M7D D;  4FM4 B;  4QW2 A;  1Y71 A;  1Q7Y U;  3QWL A;  3HL8 A;  4M75 G;  3CC7 A;  1Q86 C;  1QP2 A;  3RES A;  4JLI A;  2LC4 A;  3V7R A;  4M7A A;  2XK0 A;  4KT0 E;  2IG0 A;  1Q81 U;  2RB6 A;  5LJ3 j;  4V2S A;  3VUZ A;  2GCX A;  1VQO A;  3MEW A;  4ZN3 A;  4E7K A;  5GMK j;  2OTJ A;  1LJO A;  1VIF A;  3QO3 A;  1VQ5 T;  3X28 B;  2K5I A;  2RHU A;  4ELZ C;  1G3T A;  3UT1 A;  2HNI A;  4UC4 A;  2DD5 A;  4C8Q E;  2V8K A;  4BD3 A;  3QPH A;  5M9O A;  2ZGW A;  1QLB A;  1XTD A;  3F70 A;  4M6V A;  1S72 A;  4JRP A;  2DEQ A;  3G71 A;  4E7J A;  1ZHI A;  3GF5 A;  4A53 A;  3G4S A;  1O75 A;  4HT9 A;  3JCM W;  4IUT A;  1IZ6 A;  3QDR B;  2O4X A;  4QQ6 A;  4C5E A;  1K73 U;  4EMK B;  5GAN e;  1M1G A;  4XQ3 A;  3S3N A;  3MEA A;  3QYH B;  5GAN 3;  5GMK m;  4LD9 K;  4PJO F;  1K9M U;  4HLQ A;  1GXI E;  1N9S A;  3TW7 A;  4BI4 A;  1VQ4 T;  2E41 A;  4JS4 A;  4F7U E;  3R6O A;  4A4H A;  3S3M A;  4M7D F;  5LJ5 f;  5DY9 A;  2ZZD B;  4RG8 A;  4O6J A;  1LOJ A;  3SWN B;  2PVD B;  4M78 C;  4PLL A;  3OW2 S;  3JCM d;  1YIJ A;  1QVG S;  1G3S A;  2B8A A;  5CQY A;  2XDB A;  4LOC A;  3EAE A;  3HSB A;  4PLI A;  1FXX A;  3I56 T;  3G6E T;  3GOX A;  1HXD A;  1K73 C;  2RH2 A;  2WSE E;  2YRV A;  3FB9 A;  5GAN 6;  2X4J A;  3FIF A;  3DLL A;  5DLO A;  2DTH A;  2LT4 A;  2QF7 A;  1EIF A;  2M9U A;  3PTA A;  3E19 A;  3RER A;  1YJ9 T;  2HQE A;  4L5G A;  3EFS A;  4B9W A;  4C92 D;  4C92 B;  2K5F A;  4AKI A;  2RK2 A;  4J8O A;  2JVV A;  1R8O B;  3QKJ A;  3PT9 A;  4FSX A;  5A0D A;  2LDM A;  2LQK A;  3RKW A;  2QQ8 A;  3J81 E;  3OBW A;  3OS2 A;  1I81 A;  4MZP A;  3OYD A;  3LX7 A;  1Y7X A;  4E47 A;  2GQV A;  2XHC A;  2R58 A;  2RK1 A;  2L3R A;  5J26 A;  2JOY A;  3HO8 A;  4C92 G;  1X01 A;  3CCE A;  4OB2 B;  2XIC A;  5LJ5 h;  3OYM A;  4JUV A;  5LJ3 g;  3PIP A;  4YTL A;  3X25 B;  3X20 B;  4DA4 A;  1VQP A;  3M56 A;  4ZGE B;  3MEU A;  4DOV A;  1YJW A;  3BDL A;  5EJC A;  3OYH A;  1N8R U;  1VQ8 A;  3QJ6 A;  4HNU A;  4FT2 A;  4TVR A;  1YCY A;  2DKG A;  3RKX A;  3TW6 A;  1M9S A;  2DIG A;  3MHX A;  4M77 C;  3WXM B;  3CPW S;  1WJQ A;  1JB0 E;  2DO3 A;  3CBO A;  3C95 A;  3OYE A;  1W2B A;  1KQ2 A;  1ZBX A;  2LVM A;  3E9G A;  4QQD A;  4PJO C;  2VUB A;  3A8O B;  1JRI A;  3G7Z A;  1VIE A;  5GAN j;  3N5B B;  4RG2 A;  4M7D C;  4QVC A;  4HNV A;  1VQN A;  3RMQ A;  4MZM A;  4J5Y A;  1QP3 A;  1OZ3 A;  4M78 A;  2PUK B;  1B34 A;  4BDY A;  4EDU A;  3M54 A;  2VGM A;  5FU7 C;  2VXE A;  4M78 G;  4LDX A;  4J6Y A;  3UWN A;  2QI2 A;  2EQM A;  2XDP A;  4A4K A;  5GAO m;  3CD6 T;  1BKB A;  2X4X A;  4XU2 A;  4XU0 A;  1VQ5 A;  3WVD B;  4P5N A;  1NJI C;  3JCM c;  1UEB A;  2A3L A;  5I21 A;  5HK3 A;  2XD0 A;  1Y96 B;  3A8M B;  2KQW A;  2RHY A;  2EAY A;  4QVZ A;  1KQS S;  5GMK l;  3TCJ A;  1LNX A;  4BAC A;  3CPF A;  3JCM J;  2BS4 A;  2DTO A;  5GAM f;  2RHX A;  1Y96 A;  3LH0 A;  5EG2 A;  4EMK C;  3OS1 A;  2DVE A;  2RJC A;  5HY6 A;  1VQ4 A;  3H8Z A;  3LWI A;  1Q86 U;  5I2M A;  2M16 A;  2BS3 A;  1FWZ A;  4LDW A;  2QFZ A;  4ME7 A;  4OB1 B;  3VKH A;  4BBS M;  1G3W A;  1KQ1 A;  2JN0 A;  1YJN T;  4IUP A;  4AKH A;  5FU6 B;  1QW1 A;  4ZGD B;  3ZFJ A;  1JBM A;  1VQM T;  3SWN C;  1KHC A;  3V7S A;  3E1S A;  3I56 A;  4Y91 A;  4XU3 A;  5DM7 R;  2KMT A;  3G6E A;  1NE8 A;  2DXU A;  4MFD A;  1M1F A;  2GFA A;  4M77 A;  3CCS T;  3QXE B;  3FC3 A;  4BDZ A;  1WQW A;  4M7D B;  3RIR A;  3GIB A;  1D3B B;  1YJ9 A;  1I8F A;  3NTK A;  2CKK A;  1QVF S;  2VV5 A;  4CRI A;  5LJ5 e;  2CGH A;  5GAO n;  2MI6 A;  4C0F A;  4XTZ A;  4RMO A;  3OA6 A;  5FU7 B;  4PJO A;  2RM4 A;  1FX7 A;  2F69 A;  3CCR A;  5GAN 5;  2EYQ A;  4PJO G;  3M59 A;  4C8Q B;  4C8Q D;  4C92 C;  3HB9 A;  5GAM h;  4M7D A;  1W2B S;  2DK3 A;  3HP9 A;  2F5K A;  3QYE A;  3CCJ T;  3GP8 A;  4M7D G;  1VQ9 T;  3CCV T;  3L2W A;  2QQR A;  3X24 B;  1Q82 C;  3P8D A;  1KD1 C;  3A8G B;  2G77 A;  2WAC A;  1XOV A;  3CPW A;  2ZPI B;  5IAY A;  1KC8 C;  4L59 A;  4C8Q G;  1VQ6 T;  4M77 E;  4JX6 A;  2XU8 A;  3M9Q A;  3OYJ A;  3OY9 A;  4M75 E;  4RCB A;  3VU3 C;  2DTI A;  1KHI A;  4IUQ A;  4F7U B;  1BI1 A;  3HRT A;  1VUB A;  2QQA A;  2XKO C;  1M90 U;  4OP0 A;  4OB0 B;  3P8B B;  4M7A E;  3CEY A;  3LWH A;  3MP8 A;  4EMK A;  2MWP A;  2E70 A;  1WQ7 A;  2LTO A;  3HRU A;  4IUU A;  4N4H A;  4XAX B;  4NL2 A;  4IUV A;  2EIF A;  4ZN1 A;  1M1K C;  4F7U G;  2YLC A;  4NS5 A;  4ZGJ B;  2KR6 A;  3HFO A;  3OMG A;  2K4Y A;  4C8Q F;  2ZCF B;  4J7I A;  3QYG B;  4LDY A;  3T9N A;  2ZZD A;  4X9D A;  5GAO l;  1KQS A;  1M8V A;  2FB7 A;  2H3J A;  2PVO B;  4FT4 A;  3SWN A;  4N4I A;  3OQ5 A;  3CD6 A;  3V8J A;  3BG5 A;  4II1 A;  5CKE A;  3HHT B;  3KUF A;  4C5H A;  2RD1 A;  5GAN 2;  2EQJ A;  3L2Z A;  1O9S A;  4CI0 C;  3CC4 T;  4Z02 A;  2D9T A;  2E65 A;  3M57 A;  3JB9 D;  1TH7 A;  1DJ7 B;  2M1H A;  2P0P A;  3JCM Q;  2C06 A;  1YBY A;  2DJZ A;  2GFU A;  4J7F A;  4C0D C;  1HK9 A;  4HCZ A;  4F7U F;  4NOY A;  2FHD A;  3QII A;  4HKE A;  1M90 C;  3QHS A;  2QA4 T;  2HQX A;  3FDR A;  1WNL A;  3JB9 G;  2DD4 B;  4C92 A;  4LDV A;  4NL3 A;  5GAN g;  3JAM E;  2RHZ A;  1X6O A;  2QTX A;  4J83 A;  4MMK A;  3OYG A;  1X75 C;  3M53 A;  4MDW A;  5CKH A;  4GLK A;  3VYG B;  1YI2 T;  3QG1 A;  1YJN A;  3OS5 A;  5CO7 A;  4Y28 E;  3TRE A;  2QDJ A;  4MZT A;  1VQK T;  4OF1 A;  1VQM A;  2RO0 A;  1QVF A;  1NPR A;  2EWN A;  1UGP B;  1UGQ B;  3ASK A;  2QQS A;  2EJG A;  3M58 A;  2PVG B;  2JTF A;  1I4K 1;  5FU6 C;  2HD0 A;  3ER0 A;  5J3B A;  3VYG A;  3OYI A;  1U8R A;  3SB2 A;  3M4Y A;  1NJI U;  5GAM e;  2ZPB B;  1Y07 A;  4EMH A;  3CCS A;  1YHQ T;  4MML A;  3OYB A;  1XQH A;  3CC2 T;  3JB9 F;  2PUO B;  1OI1 A;  3BY7 A;  1N6A A;  5LJ3 f;  3CCU T;  3GPL A;  2KY9 A;  4Z6Y A;  2Y4Y A;  4N0A C;  2ZPG B;  2CZ0 B;  3SDZ A;  5GAN 4;  2DZ9 A;  2XDD A;  2EFI A;  4XTX A;  2WJ9 A;  3KBG A;  5IT9 E;  1VQL T;  2OTL T;  2QDY B;  2R5A A;  4HA8 A;  2EJF A;  3CCJ A;  5GAN 7;  3JRZ A;  2IVW A;  4LD6 A;  2CZ1 B;  3EFR A;  4A4F A;  4C8Q C;  4IUR A;  4EPC A;  5C0M A;  1PSE A;  1VQ7 T;  5L8R E;  4MDX A;  5IN1 A;  5A2Q E;  2X35 A;  4KUD K;  5CAI A;  3DKM A;  4C0D B;  4LDU A;  2CZ6 B;  3A8L B;  2ZPF B;  2FVU A;  1UGR B;  3MEV A;  1ZQ1 A;  5GAN d;  3QYB A;  5A0G A;  2L8D A;  3FEO A;  1MGQ A;  2JZ2 A;  3TU4 K;  5AYF A;  4M78 E;  4HCC A;  3QJY A;  3QSU A;  3UDC A;  1V29 B;  3BG3 A;  5LJ5 j;  1W4S A;  5LJ3 h;  3TEE A;  3L2R A;  5DLQ E;  2CZ7 B;  2DZC A;  4L6V 5;  5GMK h;  5GAM g;  3V8K A;  3L2U A;  4A54 A;  5HKC A;  4BE0 A;  2G3R A;  3OYN A;  2QEX T;  5GAN 8;  4OGE A;  4JDS A;  3VJP A;  2E10 A;  4JRI A;  4HL4 A;  2JUF A;  1Q82 U;  3OSV A;  4JX5 A;  3GLX A;  2O01 E;  4N4G A;  2PU9 B;  4JLG A;  3URG A;  1KD1 U;  1BIA A;  4XTW A;  1KC8 U;  3HBL A;  2BUD A;  3LYI A;  5CR2 A;  3P8H A;  3KHI A;  3FLG A;  5GMK i;  4JRQ A;  1UGS B;  3LW5 E;  3MP1 A;  2WSF E;  1AHJ B;  3DLM A;  2QXF A;  1RI0 A;  4E7H A;  4N0A A;  3S3O A;  3JCM f;  3OYA A;  2R5M A;  3E9F A;  4ZTF A;  4ATO A;  3DB3 A;  2QA4 A;  2E6Z A;  1D3B A;  2DXC B;  3PMT A;  4HCB A;  3VKG A;  3OYY A;  3VYH B;  1MHN A;  1M1K U;  3X26 B;  2BKD N;  2KVQ G;  2CS7 A;  3V8L A;  1E7P A;  4M75 B;  4M75 D;  4DOW A;  3QZ5 B;  4C8Q A;  4X34 A;  1K8A U;  4BI8 B;  4OGC A;  2RI5 A;  3QBY A;  2A7Y A;  2X4W A;  1N27 A;  4PL6 A;  1YI2 A;  2E12 A;  3ME9 A;  4VUB A;  4HT8 A;  3NFC A;  4M7A B;  3CCQ T;  3PMI A;  4M7A D;  2VGN A;  5FLX E;  3CXC S;  3OMC A;  4E7L A;  4HNT A;  4NC6 A;  3L2V A;  1QVP A;  2MAM A;  4PJO E;  3JCM b;  2ZPE B;  4FL6 A;  3RKY A;  1VQN T;  2K3X A;  3SD4 A;  3JB9 J;  2KMG A;  2QQB A;  5LL6 S;  2JTM A;  5GAM d;  4BY6 B;  3Q1J A;  2DD5 B;  1YHQ A;  3L42 A;  4M7D E;  4XTU A;  3CC2 A;  3CCU A;  4F7U A;  5FRN A;  2DXT A;  4M7A G;  2VC8 A;  5CKF A;  1H3Z A;  3FJP A;  2EKO A;  4OMF B;  5D6W A;  3INZ A;  1BI3 A;  2YLB A;  4R55 A;  1IRE B;  1P92 A;  1RL2 A;  2XG8 D;  4KUL A;  4JJN K;  2RI3 A;  2O4X B;  2XID A;  1K8A C;  3JCM h;  5HK0 A;  2E1H A;  3HZJ A;  1U1T A;  2EQU A;  1VQL A;  2OTL A;  5LJ5 g;  2K57 A;  3CCM T;  5CK9 A;  5GAO q;  1WGS A;  2P0Q A;  4BE1 A;  4M77 F;  3VUB A;  1SSF A;  5D6X A;  5KCH A;  4JX4 A;  1NZ9 A;  1UB4 A;  3OSS C;  2K2V A;  3QUI A;  4M75 F;  4JRK A;  4KUI A;  1M4Z A;  1BI0 A;  2FL7 A;  2LNV A;  3CBM A;  5D6Y A;  3ZBD A;  3OYL A;  1JJ2 S;  2DAQ A;  4BB7 A;  3S6W A;  3CBP A;  2V8I A;  3A5Z B;  3HRS A;  5LJ3 e;  3PIO A;  1Q81 C;  4DQ2 A;  4M7A F;  3CMA T;  5GMK e;  3JCM X;  2LQ8 A;  2EQK A;  3CME T;  3J7A F;  1KG1 A;  5GAM j;  2DPP B;  3H6Z A;  4J6X A;  1YIT T;  4BBR M;  4FIB A;  4C5I A;  4RKU E;  2D6F A;  2P0K A;  3C94 A;  4FU6 A;  3V7C A;  4ELJ A;  3LGF A;  3VKI A;  4MIM A;  3OB9 A;  1U1S A;  3PNW C;  4KBM B;  1H64 1;  2KK4 A;  5KE2 A;  3BDU A;  3PFS A;  3CCL T;  2F5T X;  3AHU A;  3WVE B;  2DD4 A;  2MWO A;  2FYK A;  3I55 T;  2L5Q A;  2PQW A;  5FRO A;  3FRN A;  5KE3 A;  2QEX A;  2V8J A;  4PNO A;  4MFE A;  2I2L A;  4XK8 E;  2HBP A;  1K9M C;  2Y4X A;  3JSC A;  2RJF A;  4IKF A;  3CC7 T;  3BW1 A;  1XNI A;  2E64 A;  4OVA A;  5GAN f;  5GAO r;  4AKG A;  1N9R A;  4QQG A;  3CCR T;  2LT1 A;  2RJE A;  4PKC C;  3UPU A;  2NLU A;  4XTV A;  1VQO T;  2DXB B;  4C92 E;  2XI9 A;  2OTJ T;  2LCL A;  5LJ5 d;  4RCC A;  4BI3 A;  2VXF A;  5CKB A;  3L1A A;  4QSH A;  5CIU A;  2DXB A;  4R56 A;  1BIB A;  4C0G A;  3J80 E;  1S72 T;  4A4E A;  3G71 T;  3G4S T;  3NTI A;  1VQ9 A;  2M0O A;  3CCV A;  3CXC A;  2HAX A;  4XU1 A;  2RA2 A;  3MET A;  2KAF A;  3H4C A;  2BIV A;  2QQ9 A;  4WF2 A;  4E7I A;  1VQ6 A;  5CVI A;  4M75 C;  1I5L A;  2WSC E;  4B9X A;  3MCA B;  3OS0 A;  2X4Y A;  2LX9 A;  3CCQ A;  1Q7Y C;  4M78 D;  4M78 B;  3HFN A;  1B34 B;  5CCA A;  5J39 A;  3C12 A;  3OBY A;  3L2Q A;  1G3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...