2ZPHB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 340min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zphB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zphB02
1V29B 4FM4B 2DPPB 4ZGJB 3A8MB 3QXEB 4OB2B 2ZZDA 2DD4A 2DXBB 4KT0E 3A8LB 1UGRB 2ZPIB 4RKUE 3QZ5B 1AHJB 2ZPGB 2D0QB 1UGPB 3QYGB 2O01E 2PU9B 2CZ6B 3X25B 2CYZB 2ZCFB 1UGSB 1QP2A 2ZPFB 2DXCB 2WSFE 4OB3B 3X26B 2DD4B 2ZPEB 2WSEE 2ZZDB 3A8GB 2PVDB 4ZGDB 2CZ1B 1PSEA 2PVGB 3A8HB 2WSCE 1JB0E 2DXCA 1PSFA 2ZPBB 4Y28E 3HHTB 4XK8E 2PVOB 2ZPHB 1QP3A 2CZ7B 3WVEB 3X20B 3LW5E 3A8OB 2PUOB 2DD5A 2CZ0B 2DD5B 3VYGA 4ZGEB 4L6V5 1GXIE 3X24B 2AHJB 1IREB 4OB0B 3WVDB 1DJ7B 3QZ9B 3VYGB 2PUKB 5L8RE 4OB1B 3QYHB 2QDYB 3VYHB 3X28B 2DXBA 1UGQB
chains in the Genus database with same CATH superfamily
1V29B 4IUUA 1MNDA 1K0SA 3Q1JA 1WNLA 4LUEA 3VS5A 2COWA 1BYMA 1GCQA 4OB2B 4LE9A 1D0YA 3MY1B 3SD4A 2A3LA 2L3QA 1PC0A 1M4ZA 2C5NB 3GTMS 1MUZA 3M0RA 2ZPGB 3DTOA 2FRWA 4FT2A 1K73R 3PTAA 4ELJA 3QYGB 2D1XA 3EJ1B 1CSKA 1RAHB 4IUQA 2J6KA 2PJQA 1FINB 2MAMA 2CZ6B 4YTLA 3POMA 2M51A 2LCSA 3SB2A 1G3SA 4RG8A 2K5IA 1LNXA 4M7AB 3VS6A 1TTHB 2ZAEA 3M53A 1MMDA 2FVUA 1VQ8T 2JMCA 2XK0A 4A4FA 4II5B 4F7UA 2O9SA 1VQMT 1VQNQ 1SRMA 2ZGWA 3BDLA 3QHRB 1RLQC 3M0SA 4BCNB 3VS2A 2C0IA 1N8RC 1Q81C 2KK4A 2IW8B 3C0CA 2MF2A 1PKSA 4F7NB 4WF2A 4K11A 1HJDA 4Y28E 5LJ3g 2QQRA 3JCMf 1VQMQ 1BBZA 1VINA 2ZPHB 4RTUA 4FSSA 1VQPA 1Q86C 1GFCA 3VS4A 1T0JA 2HQEA 3CC4T 5HK0A 1PKTA 3CCVA 3OBYA 4BI8B 3G71A 2BE7D 1T3SA 4FIBA 2JOYA 3CMAA 2HL3A 2GQIA 2VB6A 5FU7C 1RADB 3L2UA 2HAXA 4KUIA 2WPAB 4J9GA 2M02A 4MFEA 1OU8A 2RK2A 1D3BB 1YHQT 3CC2T 1KIKA 4QW2A 1OPLA 2GFUA 2OTLT 1PNJA 4FT4A 3AHUA 1NJIC 4PJOF 1XQHA 4JJNK 1LJOA 1WPYA 5HBEB 3PIPA 1ZA1B 3E9GA 3H6ZA 2L0AA 4PJOC 4M6VA 4JZ4A 4BE0A 1I0CA 4YOSA 4IUTA 1R77A 4KGXB 2X9HA 2GF7A 3CCRA 1M3BA 1RUWA 1BKBA 4AG1C 3SEMA 1K8AC 5ACBA 2DXBA 1GY3B 1UTIA 5I21A 2LT1A 1NM7A 3O5ZA 3CMET 3ER0A 4CFVB 4EOSB 2W96A 1SSHA 1N27A 4OF1A 4AFZC 2EIFA 1NE8A 3H8ZA 4PFPA 5GAOn 3J7AF 5DM7R 4AKHA 4PLLA 7AT1B 4KT0E 5GMKe 1JO8A 2CP5A 3FRNA 2IG0A 5GAN8 4KGVB 2R57A 1HK9A 3CCLQ 3MIAB 2MWOA 3JB9H 2LQ8A 1TUCA 2P0KA 2ED0A 2EJ9A 1MNEA 3CPWA 1C1AA 2CYZB 4OP0A 3EG9B 3H0IA 3HZJA 1TD6A 3EFSA 5FU6C 3HRSA 4A53A 2CREA 4F7UE 4X1VA 2F2CA 3C12A 1GBQA 4F7UF 3EG2A 2EQIA 3M03A 1NEBA 2DA9A 1U1SA 4BY7X 2QASA 4C8QA 1B7TA 2PVGB 4CC2A 4CI0C 3OMGA 4M77G 1X6OA 3CCUA 5J3BA 2RK1A 1M1FA 2HQXA 5ICPB 4IURA 2O4XB 2ZPBB 4M75F 3CC4A 4IMYB 2VGMA 3UA7A 3OW2S 1GRIA 1YJ9Q 4JRIA 3KBGA 2DXUA 3EGDB 2W99A 1JJ2S 3MEWA 3QJ6A 4C92B 1OI9B 3TQ7P 4AFQC 3CBMA 4M7DD 1WJQA 2CP3A 1YWPA 1QWEA 3VS1A 4C8QB 3MPUB 3VS7A 4Y72B 4NSTB 1VQ4A 4EMGA 2EGAA 3RMQA 1ZQ1A 1KXUA 4QVZA 2KAFA 3TCJA 1YJNQ 3BG9A 1WXUA 4M77E 1MHNA 4JDSA 4XTWA 5GANf 3QZ9B 1RLPC 4J5YA 4M78F 4JJDA 2AIRB 2CP6A 1SHGA 1B3QA 2KYMA 4BCMB 1PG5B 3DDQB 5KYUB 3M58A 4ZGJB 3OYMA 3L2QA 2YXYA 1VQLA 1WJRA 1X6BA 4PNOA 1VIFA 3VKIA 2J6OA 3M59A 2RA2A 5GAN3 1UGVA 2YLCA 1WZOA 4EMKB 1YP5A 1ABOA 1ABQA 3DB3A 4UN0A 4BCKB 2EQMA 4LDXA 1KQSA 2MOXA 2GBQA 4F14A 2DETA 2CUBA 4OMPA 4MDWA 1YN8A 3OS2A 3OYYA 2FL7A 4CFNB 5GANh 4JS5A 1M8VA 5A2QE 4J6YA 5IHYA 3META 3CBOA 2DAQA 1E6GA 3H0HA 4MMLA 2DBMA 3URGA 3RKYA 5GAOr 3DL1A 3L1AA 4AT1B 1KHCA 2CDTA 3KUFA 2QTXA 3QJYA 4RTVA 2QI2A 4O5VA 2RI3A 2AT1B 1ZSGA 3JCMJ 1JB0E 1N8RR 3CCET 4BCIB 1WI7A 4M77F 4RTWA 2VVKA 4ELLA 1QMCA 4M77C 4XK8E 3REBB 5D6YA 1M9SA 3G6EQ 3QIIA 2E5QA 3CQTA 1YNZA 3TNHB 4CC7A 1M3CA 2VASA 4M7AG 3HB9A 4AI6A 1M1KU 5FWCA 2AZSA 1K1ZA 2M0OA 3OS5A 3CCVT 1QVGP 4BCPB 4EOPB 2EPDA 1Q7YR 2I53A 3FIFA 2DMOA 1ACMB 5EC7A 3CMAT 1AOJA 1WHKA 2DD5B 4HCCA 1VQ4T 1WHJA 4N4GA 3CCRQ 1Z9QA 4ELZC 2M0YA 1YITQ 2I40B 3JCMg 1D1BA 1AWXA 3CCST 1M1KC 1YWOA 4A4KA 2RF0A 1K9MU 3QDRB 1O9KA 3H4CA 1LOJA 3CCRT 4BI3A 1YCSB 4DEXA 3CD6T 1UGQB 3VU3C 5FLXE 5LJ5j 1G5VA 4BCJB 4M77D 1U3OA 4FW1A 4QQDA 1URCB 2KDSA 3TW7A 1N5ZA 2DPPB 2LDMA 3BW1A 2OTLQ 5I2SA 4M7DA 1YHQQ 3VRYA 2LCCA 2DXBB 2DIGA 3A8LB 2R7GA 4C5IA 3JCMQ 3G4ST 3EFOA 1UHCA 4CXAB 4M75B 4J9EA 4O6JA 5GANj 4YOOA 4F6UB 2OX7A 2BKDN 3GIBA 1AD5A 4KBMB 2QEXT 5GAMd 1BIAA 2EYXA 3VKHA 5KYNA 5KCHA 3E2UA 4J9BA 2UZLB 4XTUA 4JRQA 5GAN2 3WXMB 1KHIA 1Q86U 4LD9K 1JRIA 2IPOB 5IDNB 3DB4A 3CCEA 2C06A 1YBYA 1W6XA 2ENMA 1PCXA 5IF1B 3LH5A 4KRTA 4M77A 1N4MA 3EG9A 2JW4A 5FU7B 1GUXA 1WGSA 3D7SB 1JOWA 2JMAA 2PVOB 1QVGS 1W1FA 1Q82C 3HFNA 4G6LB 5GMKi 1OX9A 5LJ5h 1VQ4Q 1GL5A 4KRCB 4QVDA 1B34A 1BU1A 2FZCB 3MJXA 1VIEA 2HMAA 2QQBA 3BY7A 1OZ3A 2EYWA 4LDWA 2DD5A 1M90U 3OSVA 5GAOq 3QO3A 5I11A 1WXBA 1A0NB 3KFVA 4M7DB 2VYTA 4BBRM 1XJWB 1OPKA 2UZDB 5A0LA 4C8QD 2C4GB 2B9RA 5GANd 3PMTA 2BKZB 4DEYA 1GXIE 3S3NA 2ATCB 3ZEHA 5J26A 1PRLC 3V7SA 2EQUA 3DLLA 1W2BP 1KC8C 3HO8A 4E7KA 4C8QE 2C0TA 3CCMA 4CC3A 3CXCA 3PVLA 1H27B 4OR5B 1IHWA 2GQVA 1ZSZC 4ZTJA 5LJ5f 4ORZA 3PO3S 3HTRA 3HL8A 2O2OA 3BG3A 1H4LD 2YLBA 3CPWS 2F69A 2NUPA 2EQJA 1WLPB 1R8OB 1SSFA 1WHGA 1H1RB 4MZPA 2L5QA 2E1HA 5GMKj 1AHJB 2JM9A 1FMVA 1QCOA 3CCSQ 1QVFS 2XHCA 2D8HA 2DL3A 2DXTA 4MIMA 2O01E 3SWNA 1CKAA 2EGCA 2C0OA 3OW2A 3I5SA 2PTKA 3HSBA 2E70A 2E5KA 1JJ2A 1VQ5A 1K9MR 3M0PA 5GAMf 3G4SQ 2CH4W 1I81A 4FYWB 4X34A 2VXFA 3GNGA 3JCMc 3VUZA 4JPBW 2BS2A 2QDLA 2AZVA 5GANg 3HHTB 3IQLA 4IUPA 1ZHIA 4J9CA 4C0FA 1ZSZB 1OL1B 3G71T 3SWNB 4C92E 1RAFB 1V76A 1XTDA 1WA7A 1JSUB 3ME9A 4GBQA 4E47A 5CR2A 5KYXB 3TVTA 1NYFA 3M57A 1VUBA 3OYIA 1VQ7A 4PK4A 4CRIA 4HT8A 3EG0A 2RJDA 4BCQB 3EFRA 5IAYA 1XOVA 4QSHA 2JT4A 4LD6A 2GCXA 4WCIA 1ZLMA 2K7AA 2GTOA 3DOGB 1YCYA 4DOVA 2DO3A 3RMSA 3F70A 3L2WA 1W4SA 2KSSA 1QVFP 5KYWB 4BCHB 5GANe 4RUGA 4PFOA 5GJVB 1UEBA 2BZYA 3OSSC 4RODA 3QUIA 2PUKB 6AT1B 3CCSA 5C0MA 2KT1A 2QEXQ 2V8JA 3ASKA 4J6WA 2RN8A 2V26A 4QVCA 3CD6A 2X3WD 2LNHB 4RCCA 1WHMA 4II1A 1VQLQ 3FLGA 4Z88A 5LJ5d 2DERA 1TUDA 2KYBA 3J81E 3I5RA 3G4SA 2XI9A 5CAIA 2A0FB 2LJ0A 4KUDK 4V2SA 1NPRA 4HNTA 2LC4A 4BY6C 2Y90A 3EFOB 5KE3A 2RHIA 2BIVA 2P0QA 2WACA 1RAGB 4C5EA 5FU6B 4OB3B 3N5BB 4QQ6A 4MFDA 3T9NA 4J9DA 3A5ZB 4M7DC 5GAMj 2K79A 4A4HA 1KC8U 1PSEA 2DL7A 2XD0A 1TFBA 4M75G 4JS4A 1RAAB 3ZL7C 5BNJB 5J39A 2MPXC 3OYJA 2QGFB 2YRVA 4Z02A 1NJIR 2LZ6B 2PQWA 3OYDA 4F7LB 1ZBJA 5GJWB 2VC8A 4M75A 1ARKA 4M78A 2BUDA 4OMFB 1D3BA 3OA6A 3MEUA 2C6TB 1OL2B 2LX9A 2R5AA 4JLGA 1H8KA 4BCQD 1RAIB 2RHUA 2K5LA 5L23A 2G77A 1Q82R 3INZA 1X43A 4C92D 2LMJA 1S72T 4HLQA 4M78E 2P0PA 4AG2C 2PK9B 3VYGB 4E7LA 2DVEA 5AT1B 3LQ5B 4OB1B 1MMAA 3VYHB 3H0FA 2FEIA 3X28B 3FJ5A 3CCMT 2NUPB 3CCVQ 2UZEB 3JCMP 3TNIB 3TSWA 2QFZA 2D0NA 2RJFA 4CFUD 3EGXA 3FB9A 2OAUA 3L2RA 4BDZA 1YJNA 2O9VA 3QXEB 5IHNA 4M78G 5LJ3e 1Q7YU 1HYOA 1RI0A 1IB8A 1UGRB 2YRCA 1M27C 4D8KA 3M0QA 1UDLA 3DDPB 3JSCA 3M9QA 5GAN7 4DBHA 1U5SA 1W2BS 2XMFA 3NTKA 2FO0A 5GAMh 4BXXX 1H25B 2NYSA 4E7SA 2C5XB 2ZPEB 2X51A 2QA4Q 2B86A 4EMKC 2UUEB 3SWNC 1EIFA 2YSQA 2OTJT 2LJ1A 2RHYA 3RBBB 2YUQA 3BG5A 2BS3A 3A8HB 5LQFB 3CCJT 2KRSA 1IXDA 3UWNA 4CFXB 4CFWB 1GFDA 4HL4A 1KD1U 2C5VB 1ZUKA 2F5KA 5LL6S 1HD3A 1PWTA 4AKIA 5HKCA 1X2KA 4FCYA 5HK3A 2RB6A 1WFWA 3LW5E 1C0MA 2SRCA 3M55A 4PJOA 4XU0A 1WQWA 2LNVA 4MZTA 2DFUA 2RHXA 3I56T 1MMNA 3UT1A 8ATCB 1JU5C 5CQYA 3CC2Q 1QWFA 1S72A 1AZEA 2A28A 2DLPA 4OGEA 1M1KR 1TSFA 2NUZA 2PNIA 4BY6B 4BDYA 3JCMW 4HNUA 3CCUQ 4XU2A 4LUDA 2HSPA 2E64A 2V1RA 1QVFA 5CEIB 5KE2A 1NYGA 2EYZA 1VQKT 4PJOB 2PMIB 2E3IA 3OQ5A 4J7FA 1IGUA 3VRZA 1TS9A 1YI2Q 1GCPA 2KXCA 4OMQA 3DJBA 3CXCP 1ZX6A 1MV3A 1W70A 1S72Q 3O0GD 1D3UB 2CP0A 3QHSA 1YIJQ 5IXFA 1XO2A 2B8AA 1G8XA 2DKGA 2X4WA 3SHWA 2LQWA 4J83A 3JCMe 4OMLA 4EOMB 3DKMA 1WYXA 1G3NC 1Y0MA 4JX4A 4IUVA 3QBYA 1VA7A 1NZ9A 4FX3B 1VQ8A 1AWOA 2FYKA 1VQMA 3RDVA 2K5FA 3CEYA 4CFMB 2OTJA 4C92G 1R0CB 1RABB 3CCJA 2IVXA 2K3YA 3QHWB 1TU0B 2RQVA 4BD3A 1YIJA 2Y4YA 2C5OB 5DQVA 4LDYA 4XTYA 2HBWA 3EHQA 4RTTA 2X35A 1Q86R 5FRNA 1K0XA 3MY5B 2BPMB 1UG1A 1P5EB 1QVGA 5HCKA 1OIUB 1D1AA 4YOZA 2QQAA 2PZ1A 3LH0A 2HQHA 1YI2A 1D09B 2DYIA 1PKDB 2KBTA 1IRXA 3TU4K 2W10A 4BBSM 2KR6A 3K7AM 4AKGA 2JS0A 3I56A 2KI7A 3MEAA 2W9ZA 3CCJQ 2JZ2A 4JUVA 1U8RA 5IH2A 3EG1A 4XTXA 5FROA 2OTJQ 1K9AA 2EKOA 2G3RA 3OYKA 2K3BA 4IKFA 3E1SA 2VKNA 4UC4A 4E7IA 4PFZA 4LOCA 2HEQA 1VQOA 4HVUA 4EOJB 3CCLA 3MHXA 2GTJA 2AKLA 3CMEA 2KR3A 5GAN6 1C6VX 4C0DC 2RJCA 2RMOA 1OIYB 2V8IA 4MMKA 2DNUA 2KXDA 2JS2A 1H3HA 1N6AA 2BE9B 3A1PA 4FYYB 2V22B 2SEMA 1KD1R 5D7UA 2GNCA 4M4ZA 2QK0A 2KMTA 2DMEA 1BIBA 3KXTA 1M90R 3RERA 3TNWB 4HT9A 3J80E 1Y96B 3HRUA 3CCMQ 3JB9D 4BCND 3JCMX 2X4XA 4E6RA 1ZSZA 1WJSA 2F5TX 4PKCC 5L2WB 2CCIB 1UFFA 1KFZA 1QP2A 2WSFE 2K9GA 5CCAA 3G6EA 1RI9A 5FRMA 1FMWA 5CYIB 1WXTA 1VOMA 1YIJT 4JJCA 2QQ8A 2M1HA 4LN2A 1KQ2A 5CKEA 2MYSA 3JCMd 4F16A 2CH4A 2NWMA 1KSWA 5LMKB 4KGZB 1VQ5Q 2DYBA 1VQ9Q 3OBWA 2KMGA 2CGHA 3RIRA 4F6SB 2DL4A 3GBQA 1JSTB 4C92C 4HNVA 1ZUUA 4JX6A 4EDUA 1VYTA 2DTOA 4J7IA 4OMOA 2DEUA 2VUBA 4LXCA 4RMOA 2L8DA 2QGSA 4M78C 2QA4T 5IT9E 2EVRA 1TG0A 5CKHA 1M3AA 1RL2A 2FPFA 3S3MA 3C4SA 5IN1A 1PD0A 4C92A 2G6FX 1QMZB 2QYZA 1ZBXA 3OYFA 4BCOB 1IREB 4F70B 1KJWA 5CQXA 2WXVB 5GAMg 3M4GA 1UHFA 3CD6Q 3R6OA 1GBRA 2ROTA 2KQWA 3R6NA 1QKXA 3M0TA 2PHGA 1GCQC 4EIKA 4EONB 2RQRA 2YUOA 2XICA 2L3RA 1NJIU 1H1PB 3JV3A 1VQ6T 3BHVB 3MP8A 4Z89A 1UB4A 1AD6A 1Y07A 4M7AD 3QWXX 3U23A 5DQWA 2EFIA 4RKUE 3G33B 5DLOA 1OKVB 3OY9A 3QDFA 2D0QB 1R0BG 4BCMD 2YRDA 3FC3A 4Q5WA 1B07A 1EFNA 3LX7A 3FJPA 2A7YA 1Y71A 3PT9A 3UATA 2DXCB 9ATCB 1KD1C 1T0HA 4HA8A 1WHHA 2JTEA 2YDLA 2CS7A 3PFSA 3I55T 1AT1B 2GGRA 1AISB 4KH0B 1HXDA 1I1JA 3F5XB 2CZ1B 2YUPA 1QW1A 2WSCE 2RI5A 4A63B 1QLYA 5HBHB 5I2MA 5CVIA 3OS0A 5D6XA 4FYVB 2K4YA 4EOKB 5A0DA 2M9UA 3UDCA 2CT3A 2JN0A 2RD1A 3HRTA 1MGQA 4ZNXA 2BTTA 1ENWA 3HKSA 4JRKA 1LCKA 2K6DA 4XTZA 2LT4A 1YJWQ 2PUOB 3ZFJA 1X75C 2LQKA 3CPWP 2DVJA 2NLUA 3JAME 4BY1X 2MCNA 3OYGA 3HBLA 3GLXA 4M7DF 5KYXA 5GAOl 4ZGEB 1SEMA 2CSQA 5LJ3d 2JXBA 2G9XB 2JTMA 2COYA 2LW4A 2OTLA 3AT1B 1BCMA 3EAEA 3TN8B 3NTHA 5HY6A 2KVQG 5LJ3f 2RM4A 3LGLA 2FPDA 4HCZA 8AT1B 1UUEA 1VQ7Q 5L8RE 3UPUA 3QYHB 3P8HA 1VQKQ 4FU6A 1OEBA 2DM1A 2DL8A 5AYFA 2RO0A 3OMCA 5CIUA 4M7DG 4ESRA 1YJNT 5CK9A 3EGXB 1FYNA 3QPHA 4FW2A 3VS3A 2JVVA 1EX4A 4LDVA 1UNHD 1B34B 3PE0A 1T3LA 2EBPA 2R5MA 4X9CA 2VV5A 1I4K1 3RKXA 3NFCA 4C0GA 2E41A 1JEGA 5GMKl 4BCFB 1W98B 5IHKA 1X01A 3MKDA 2QEXA 2K2VA 4M77B 1UE9A 2YUNA 3RUXA 3SFMA 1QCFA 3QSUA 4OGRB 1M5Q1 4M75E 2X4JA 2QXFA 1O9KB 1JXOA 1VQ8Q 2W9FA 3RGFB 3EH1A 2E65A 3MEVA 4QQGA 3FEOA 4YC3B 1OU9A 1VOLA 1ZUYA 1QKWA 3G6ET 4OGCA 4F7JB 1X27A 4DA4A 3V8LA 3BLHB 2RQUA 2HDAA 2WIPB 3BDUA 1JKWA 2JNGA 3OYLA 2XIDA 2FHDA 2KRNA 5IDPB 3RR6A 1UJ0A 4DBQA 2P84A 1RAEB 2IW6B 1YJ9A 3RESA 1VYWB 5GAOp 1OQKA 3WVEB 2EYYA 2O88A 2LX7A 3X20B 5D6WA 1Y7XA 3EIDB 1E7PA 4ZN1A 3A8OB 2XKOC 1WDXA 4R0KA 2RNAA 3JB9G 1Q7YC 4JX5A 3TW6A 2EKHA 2HKQB 2QA4A 3PGGA 1FKMA 2HL5C 3PNWC 4M78B 3EGDA 4D6WA 4OMNA 4ELYC 4EOQB 1LPLA 2H8HA 2Z0WA 1E7OA 5HVYB 2W0ZA 3JCMb 1SRLA 2FRYA 4B9XA 4C5GA 3B57A 4OMMA 1GUXB 2BS4A 2E3HA 1QLBA 1VQKA 2LTOA 2ESWA 2FZKB 3NHNA 1K4US 1ZP2A 5CKFA 5HNBB 1P92A 3CBPA 3S6WA 3QG1A 4NL3A 1TWBA 2HD0A 1J3TA 1VQLT 4JZ3A 4FYXB 2WIHB 2X3XD 2JUFA 3LLRA 1SF9A 3QZ5B 3EOCB 2V8KA 3S3OA 3OYCA 4DBRA 2WEVB 2F2XA 2H3JA 2LJ3A 4EPCA 1BU2A 3V8JA 3VS0A 4PJJA 3V8KA 4A4GA 2ZCFB 1N9RA 2NUTB 3MI9B 2HNIA 3VV0A 5FGKB 2E10A 1VQ5T 2DD4B 1O9SA 3M54A 2RH2A 2CSIA 3M4YA 5DLQE 3CCQT 4EOOB 4MDXA 1NBEB 4ZGDB 2MWPA 3I55A 3CC7T 2F2WA 4GY5A 4BCGB 1OULA 2L89A 1Q81R 2F2VA 2BZ8A 2D9TA 4N4HA 1OX8A 4C0DB 1YJ9T 4ZN3A 3CCQQ 1BCOA 2KE9A 1CKBA 1GH6B 3CXCS 3ULRB 1YI2T 2DJQA 4FL6A 2RHZA 2K57A 3KHIA 5CO7A 1X2QA 1VQ7T 2DF6A 4R56A 1QQJA 3PMIA 1KC8R 1PD1A 2LQNA 3DLMA 2I0NA 2H3EB 3JRZA 4WTOB 4EOIB 3JB9J 2K2MA 3I55Q 4EC8B 2D8JA 2J06A 4QKUA 4CC4B 2JM8A 4J9IA 2WMBB 4KRDB 3VYGA 1X69A 3QWLA 1BI0A 1N9SA 2BZXA 3OYHA 4C92F 2HBPA 1YITA 1Q81U 1PHTA 2ABLA 4ROEA 3CCLT 1JJ2P 1G83A 3MP1A 4PL6A 1D0XA 3WVDB 2O31A 5KYYB 3M0UA 4DOWA 2P4RA 1M90C 4KH1B 4FM4B 4Z6YA 1FMKA 2RQTA 3LWHA 3BHUB 3V7RA 5EG2A 2EQKA 1H641 3JB9I 1OOTA 2AKKA 4EOLB 2ZZDA 2OAWA 3RNJA 2QGGA 2QF7A 5LJ5e 4EORB 4J9FA 1K76A 4Y92A 1H26B 1C9BA 2RQWA 2UZBB 4BUGA 5FWBA 3BLQB 3GF5A 4OVAA 3EHRA 1UNLD 2VXEA 3E9FA 1K8AU 2DRMA 1UGSB 4JLIA 1NPPA 1BB9A 4ME7A 4BACA 3CCQA 1BK2A 5KH6A 1SG5A 2E12A 2WSEE 2ZZDB 1VYVA 1M2VA 2PVDB 1M30A 4XU1A 5I22A 4NS5A 4M7AC 4D8DA 1AWJA 4C5HA 1K9MC 2A37A 2QQ9A 3EG3A 4HVVA 1F5QB 2EGEA 2DK3A 4HCKA 5ECAA 1TXQA 3LYIA 4B6MA 3G1JA 3HFOA 4XQ3A 4E7HA 1VQNT 4KULA 1SKUB 4FSXA 2LVMA 4TVRA 1IGQA 1QP3A 2DTIA 2CZ7B 1Y96A 4F7SB 4XAXB 4GLMA 2L2PA 1YJWT 2QDJA 1G2BA 3MO8A 1FWZA 4AFUC 2L3PA 2DJZA 1BI1A 4BB7A 4E2FB 4M75C 1RACB 1YITT 2ECZA 2W2HA 4MZMA 2DL5A 1F1BB 1IO6A 1YHQA 2JTFA 1U06A 3L2VA 4M7DE 4C8QC 2RJEA 2DZ9A 4N0AA 2CP7A 3PVQA 5KYYA 1WX6A 2R58A 2DILA 4J9HA 2QDYB 3BHTB 4JJBA 4Y91A 1NLPC 4RG2A 2HZYA 3OYAA 3FDRA 3GPLA 3UF4A 3E19A 3L2ZA 1VQ6A 4C8QG 3A8MB 3OYBA 4HVWA 3BLRB 1G3WA 2KGTA 2WFYB 1AVZC 3QYBA 3HPWA 3VUBA 2J05A 2ED1A 2KRMA 2RI2A 4M7AF 5C6SA 4ROCA 1IHVA 2ZPIB 1I5OB 1K8AR 2F1LA 4CRLB 2XU8A 1MV0B 5EFQB 3MP6A 1OI1A 4PLIA 3VJPA 3JB9F 4J6XA 4LDUA 5DY9A 3VKGA 3M56A 2EUFA 1I07A 2JGZB 2KEAA 2ZPFB 4ANJA 1VQ9T 3L42A 4J8OA 4BI4A 3QYEA 2XDDA 1H24B 1OGUB 2PK2A 2KROA 1KK7A 3A98A 4BE1A 3NGPA 4Z8AA 1H28B 3CMAQ 4EMKA 4F6WB 2M16A 4F7UG 3REAB 2A36A 1BI2A 1VQOQ 1PM3A 2K3XA 2NUTA 4EC9B 1VQNA 1PSFA 1NLOC 2DX1A 1FX7A 2OI3A 2GFAA 5LJ3h 1TUGB 5IXBA 2WJ9A 1Z9ZA 4L59A 3CC4Q 1Q95G 1N8RU 1E9HB 4I3ZB 2CUDA 1M2VB 3CCEQ 2JJ9A 5FW9A 5M9OA 4XTVA 2CZ0B 2OJ2A 1U1TA 4A4EA 5GAMe 1UNGD 2HCKA 1WHLA 4HCBA 4N0AC 1OZ2A 2EJFA 1NEGA 3O8VA 2ROLA 1WQ7A 4E7JA 1NG2A 3NDQA 2IVWA 2VGNA 4IIMA 4PJLA 3QWYA 1QCNA 3I9QA 1MMGA 4GLKA 1W2BA 3TREA 1SPKA 2LRQA 1KQ1A 5GAN4 2CP2A 4PJMA 2VWFA 1UJYA 4B9WA 3PIOA 4PJNA 2Y4XA 2D6FA 2A08A 2KY9A 2E6NA 1BI3A 4M7AA 1I5LA 2FB7A 4ZTFA 1KQSS 1OV3A 1H1QB 1M8MA 3OB9A 5EJCA 4DQ2A 2MI6A 4F04B 3RKWA 1UGPB 3I56Q 2CT4A 4CFUB 2IN3A 2QAZA 4PJOG 3NMZC 2PU9B 2L3SA 2IIMA 2MMPA 4F17A 2YWWA 3UA6A 3V7CA 3TSZA 1WIEA 3X26B 4BE2A 2CCHB 1ZA2B 2HKNA 3A8GB 4M78D 1Q82U 2KT8A 5KYUA 3BFMA 4NOYA 1K73C 1H3ZA 4RTZA 3P8DA 4AMCA 5LJ3j 4XU3A 2I2LA 2YHTA 4RCBA 1D0ZA 1I8FA 2FPEA 4X9DA 1VQPT 1JXMA 4N4IA 2RPNA 3G71Q 3CPFA 2V1QA 1M2OA 4HXJA 5GMKh 2J7IA 3G7ZA 2DRKA 2EW3A 1H1SB 1M1GA 1Y57A 3JCMh 4PJOE 1PRMC 1YJWA 2X4YA 3H41A 2LP5A 3CMEQ 2COZA 2CKKA 2DTHA 1SHFA 2E4HA 2AK5A 5CKDA 1FVVB 4C0ZA 2MK5A 4C8QF 4RTYA 5HBJB 1VQOT 1LVKA 2P4TA 1D1CA 2QQSA 1TOVA 1KG1A 4JRPA 1VYUA 2EYQA 3EGUA 4OB0B 1DJ7B 2DBKA 4NL2A 5IHIA 1H92A 1V1CA 4QT7A 1X6GA 4M75D 3M5AA 1G3YA 4HKEA 5A0GA 2E6ZA 5CKBA 3TEEA 3OYNA 2DD4A 1OKWB 1UECA 4L5GA 1VQ6Q 3JCMV 1JBMA 3OYEA 1O75A 1E6HA 5HQ0B 4F7UB 1AWWA 4EMHA 3LWIA 4M7AE 1YFNA 3X25B 4IIOA 4A54A 1QVPA 1EZZB 3OS1A 1JQQA 2QG9B 4R55A 2WMAB 3GNFB 4TTHA 4RTXA 3CC7A 3QKJA 1VQ9A 3GOXA 2EJGA 1HSQA 4VUBA 3CC7Q 3GP8A 2XDPA 3CCUT 2KNBB 2DIQA 2YT6A 3I35A 5GAN5 2IW9B 5LJ5g 1TH7A 5GMKm 2DXCA 4E7ZA 3NTIA 4P5NA 2HSEB 4ATOA 2XDBA 3BE3A 1XNIA 1G3TA 2EAYA 3P8BB 1FXXA 2MIOA 3EH2A 1AZGB 3SDZA 5KYWA 1KQSP 4NC6A 3THKA 1S1NA 2DZCA 2X1NB 2O4XA 1IZ6A 3C95A 3NPFA 4DBFA 2QTVA 2WHBB 3H9NA 4PJOD 1AEYA 2DE0X 1VQPQ 4L6V5 3CC2A 4AFSC 3X24B 5GAOm 2FG0A 2CJMB 1OYXA 2DEQA 5I5ZB 2J6FA 2AHJB 3MCAB 5KCOA 2XG8D 2EWNA 3LGFA 3C94A 3OW2P 4LNPA 3HP9A 1K73U 2LCLA 2FZGB 3ZBDA
chains in the Genus database with same CATH topology
5LJ5f 3CMAA 5GAN6 1V29B 4FM4B 4IUUA 4Z6YA 4C0DC 2RJCA 3HL8A 3Q1JA 1WNLA 3BG3A 2YLBA 2V8IA 4MMKA 3LWHA 3CPWS 3V7RA 1BYMA 1N6AA 2F69A 5EG2A 2EQKA 1H641 3JB9I 4OB2B 2ZZDA 2EQJA 3SD4A 1R8OB 2A3LA 1SSFA 2QF7A 1M4ZA 5LJ5e 4MZPA 2L5QA 2E1HA 5GMKj 1AHJB 2ZPGB 2KMTA 4FT2A 1BIBA 3KXTA 3PTAA 4ELJA 3RERA 4BUGA 3QYGB 1QVFS 4HT9A 3J80E 1Y96B 3HRUA 2XHCA 3JB9D 2DXTA 3GF5A 3JCMX 4MIMA 4OVAA 4IUQA 2X4XA 2O01E 3SWNA 2VXEA 3E9FA 1WJSA 2MAMA 2CZ6B 4YTLA 2F5TX 4PKCC 1K8AU 1UGSB 4JLIA 3SB2A 1G3SA 4RG8A 3OW2A 2K5IA 1QP2A 1LNXA 4M7AB 2WSFE 3M53A 1NPPA 2FVUA 4ME7A 4BACA 1VQ8T 3CCQA 5CCAA 3HSBA 3G6EA 2XK0A 2E70A 4A4FA 5KH6A 5FRMA 2E12A 2WSEE 2ZZDB 4F7UA 1JJ2A 1VQMT 2PVDB 4XU1A 1VQ5A 5GAMf 4NS5A 1YIJT 4M7AC 1KQ2A 2QQ8A 2M1HA 2ZGWA 4C5HA 3BDLA 1I81A 4X34A 1K9MC 5CKEA 2QQ9A 3JCMd 2VXFA 2DK3A 1N8RC 3GNGA 3JCMc 3VUZA 2KK4A 1Q81C 2BS2A 2MF2A 3OBWA 2KMGA 2CGHA 3LYIA 4WF2A 5GANg 4Y28E 3RIRA 2QQRA 3JCMf 3HHTB 3HFOA 4XQ3A 5LJ3g 4IUPA 1ZHIA 2ZPHB 4C0FA 4E7HA 1VQNT 3G71T 4KULA 3SWNB 4C92E 3CC4T 4FSXA 2HQEA 1VQPA 1Q86C 2LVMA 4TVRA 1XTDA 1QP3A 2DTIA 5HK0A 2CZ7B 1Y96A 3CCVA 3OBYA 3ME9A 4BI8B 3G71A 4E47A 4XAXB 4C92C 4HNVA 5CR2A 4JX6A 1YJWT 4EDUA 2DTOA 4J7IA 3M57A 2QDJA 1VUBA 2JOYA 1FWZA 3MO8A 4FIBA 3OYIA 2VUBA 2DJZA 1BI1A 5FU7C 4CRIA 4RMOA 3L2UA 2L8DA 2RJDA 4KUIA 4BB7A 4M75C 3EFRA 5IAYA 1XOVA 4M78C 2QA4T 4QSHA 4LD6A 2GCXA 5IT9E 5CKHA 4MFEA 2RK2A 1RL2A 1D3BB 3S3MA 3C4SA 1YHQT 1YITT 3CC2T 5IN1A 4QW2A 2GFUA 4C92A 4MZMA 2OTLT 4FT4A 3AHUA 1YCYA 1NJIC 1YHQA 4DOVA 2DO3A 4PJOF 3RMSA 1XQHA 2JTFA 3F70A 1W4SA 1LJOA 3L2VA 1WPYA 3PIPA 2KSSA 3H6ZA 3E9GA 1M90C 4M7DE 4PJOC 5GANe 4M6VA 1ZBXA 4C8QC 2RJEA 4BE0A 3OYFA 2DZ9A 4N0AA 1IREB 4IUTA 5CQXA 3CCRA 2GF7A 1UEBA 3OSSC 5GAMg 3M4GA 3QUIA 2PUKB 2R58A 3CCSA 1BKBA 3R6OA 1K8AC 2QDYB 4Y91A 5C0MA 2KQWA 2DXBA 2V8JA 3ASKA 4J6WA 4RG2A 5I21A 3OYAA 2LT1A 3FDRA 3CMET 3GPLA 4QVCA 3CD6A 3ER0A 3E19A 1N27A 3L2ZA 4OF1A 4C8QG 1VQ6A 2EIFA 3A8MB 1NE8A 2L3RA 2XICA 4RCCA 3OYBA 3H8ZA 1G3WA 4II1A 1NJIU 3J7AF 5GAOn 5DM7R 4AKHA 3QYBA 1VQ6T 3FLGA 4PLLA 3HPWA 3MP8A 4KT0E 1UB4A 1Y07A 3VUBA 5GMKe 4M7AD 5LJ5d 2RI2A 4M7AF 5C6SA 2EFIA 2ZPIB 4RKUE 5DLOA 3FRNA 3OY9A 2IG0A 2D0QB 3J81E 5GAN8 3G4SA 2XU8A 2XI9A 5CAIA 2R57A 1HK9A 3FC3A 4Q5WA 3MP6A 2MWOA 3JB9H 4KUDK 2LQ8A 1OI1A 4PLIA 3LX7A 2P0KA 1NPRA 3FJPA 4J6XA 4LDUA 2A7YA 5DY9A 3VKGA 3VJPA 3JB9F 2EJ9A 4HNTA 2LC4A 1Y71A 2Y90A 3M56A 2CYZB 3PT9A 4OP0A 4BY6C 3CPWA 3HZJA 5KE3A 2RHIA 3EFSA 5FU6C 3HRSA 2BIVA 2P0QA 4A53A 2WACA 2ZPFB 2DXCB 4C5EA 4F7UE 5FU6B 4OB3B 3L42A 1VQ9T 3C12A 4J8OA 4BI4A 1KD1C 4F7UF 3QYEA 3N5BB 4HA8A 4QQ6A 4MFDA 3T9NA 2CS7A 3A5ZB 3PFSA 2XDDA 3I55T 4M7DC 5GAMj 4BE1A 1U1SA 1HXDA 2CZ1B 4A4HA 1KC8U 1PSEA 4CI0C 4C8QA 1QW1A 2PVGB 2WSCE 4M75G 4EMKA 4JS4A 2XD0A 2M16A 2RI5A 3OMGA 4F7UG 4M77G 1X6OA 3CCUA 5J3BA 2RK1A 1BI2A 1M1FA 2HQXA 5J39A 4IURA 2K3XA 2O4XB 1VQNA 5I2MA 1PSFA 5CVIA 2ZPBB 4M75F 1FX7A 5LJ3h 2GFAA 5D6XA 3OS0A 3OYJA 2K4YA 3CC4A 5A0DA 2M9UA 2VGMA 2YRVA 3OW2S 4Z02A 3UDCA 4JRIA 2JN0A 2PQWA 2WJ9A 3OYDA 2RD1A 3HRTA 4L59A 1MGQA 3KBGA 3HKSA 2DXUA 1JJ2S 1N8RU 3MEWA 4JRKA 2VC8A 3QJ6A 4M75A 4M78A 2BUDA 4C92B 4XTZA 4OMFB 2LT4A 1D3BA 3OA6A 2PUOB 3MEUA 5M9OA 3CBMA 3ZFJA 1X75C 2LX9A 2R5AA 4JLGA 4XTVA 4M7DD 2CZ0B 2LQKA 1WJQA 2NLUA 1U1TA 3JAME 3OYGA 2RHUA 4M7DF 3HBLA 3GLXA 4A4EA 2K5LA 5GAMe 4C8QB 2G77A 5GAOl 1VQ4A 3L2WA 4ZGEB 4EMGA 4HCBA 3INZA 5LJ3d 3RMQA 4N0AC 1OZ2A 1ZQ1A 2EJFA 3O8VA 2JTMA 1WQ7A 4QVZA 4C92D 4E7JA 2KAFA 2OTLA 3TCJA 1S72T 3EAEA 4HLQA 3NTHA 3BG9A 2IVWA 2VGNA 4M77E 5HY6A 2KVQG 1MHNA 2RM4A 3LGLA 4JDSA 2P0PA 4M78E 4XTWA 5LJ3f 5GANf 4HCZA 3QZ9B 3VYGB 4J5YA 4GLKA 4M78F 4E7LA 2DVEA 5L8RE 1W2BA 3TREA 4OB1B 3UPUA 3QYHB 3P8HA 3VYHB 3X28B 2LRQA 4FU6A 3CCMT 1KQ1A 5GAN4 5AYFA 2RO0A 3OMCA 5CIUA 4M7DG 1YJNT 5CK9A 3JCMP 4B9WA 3PIOA 4V2SA 2QFZA 2RJFA 3QPHA 4ZGJB 3M58A 3OYMA 3FB9A 2JVVA 2OAUA 2Y4XA 1B34B 4LDVA 3L2QA 3L2RA 3QXEB 4BDZA 1YJNA 2R5MA 1VQLA 2D6FA 4M78G 4M7AA 5LJ3e 4X9CA 2KY9A 1WJRA 2E6NA 2VV5A 4PNOA 1BI3A 1VIFA 1Q7YU 3VKIA 1I4K1 3M59A 3RKXA 2RA2A 5GAN3 2YLCA 1RI0A 3NFCA 4C0GA 4EMKB 1I5LA 2FB7A 2E41A 1UGRB 3DB3A 5GMKl 4ZTFA 1KQSS 4LDXA 3OB9A 2EQMA 5EJCA 1KQSA 4DQ2A 2MI6A 1X01A 2QEXA 2K2VA 4M77B 1UGPB 3RKWA 3RUXA 3SFMA 3QSUA 3JSCA 3M9QA 5GAN7 1M5Q1 4MDWA 4M75E 3OS2A 1W2BS 4PJOG 3NTKA 2X4JA 3OYYA 2FL7A 2QXFA 2PU9B 2MMPA 5GANh 4JS5A 1M8VA 5GAMh 5A2QE 4J6YA 4IKFA 3META 2E65A 3CBOA 3V7CA 2DAQA 3MEVA 3X26B 4MMLA 4QQGA 2ZPEB 4BE2A 3FEOA 3URGA 3RKYA 5GAOr 3A8GB 3DL1A 3L1AA 4M78D 1KHCA 1Q82U 3BFMA 4EMKC 4NOYA 3KUFA 2QTXA 3QJYA 4OGCA 3SWNC 1EIFA 3G6ET 1K73C 2OTJT 1H3ZA 3P8DA 5LJ3j 4XU3A 2RHYA 2I2LA 2YHTA 3BG5A 2BS3A 3A8HB 2QI2A 4O5VA 4RCBA 3CCJT 2RI3A 3UWNA 4DA4A 3V8LA 1I8FA 4HL4A 3JCMJ 1JB0E 3BDUA 4X9DA 3CCET 2JNGA 3OYLA 2XIDA 4M77F 2FHDA 1KD1U 2F5KA 1VQPT 5LL6S 4N4IA 3CPFA 4M77C 4XK8E 5D6YA 1M9SA 5GMKh 3QIIA 2E5QA 1YJ9A 3RESA 4AKIA 3G7ZA 4M7AG 3HB9A 5HKCA 4AI6A 3WVEB 5GAOp 1M1KU 5HK3A 1M1GA 2RB6A 2M0OA 3X20B 3JCMh 3OS5A 5D6WA 1Y7XA 3LW5E 3CCVT 1E7PA 4ZN1A 4PJOE 3A8OB 1VQ5T 3M55A 4PJOA 1YJWA 2X4YA 2XKOC 3FIFA 4XU0A 1WQWA 2LNVA 4MZTA 3JB9G 3CMAT 2CKKA 2DTHA 2DD5B 1Q7YC 4HCCA 4JX5A 2RHXA 1VQ4T 3TW6A 3I56T 2QA4A 3PGGA 5CKDA 3UT1A 4C0ZA 1FKMA 4N4GA 3PNWC 5CQYA 4C8QF 4ELZC 4M78B 1S72A 4D6WA 4ELYC 3JCMg 4OGEA 1VQOT 3JCMb 2P4TA 2QQSA 3CCST 1KG1A 4BY6B 1M1KC 4BDYA 4A4KA 4JRPA 2EYQA 1K9MU 3JCMW 4HNUA 4OB0B 4B9XA 1DJ7B 3QDRB 4NL2A 4XU2A 4C5GA 2BS4A 1QLBA 3H4CA 1LOJA 2E64A 3CCRT 1VQKA 4BI3A 2LTOA 3CD6T 1UGQB 1QVFA 5KE2A 3VU3C 5FLXE 5LJ5j 1G5VA 4M77D 1VQKT 5CKFA 4PJOB 4QQDA 1P92A 3CBPA 3M5AA 3OQ5A 4M75D 3S6WA 1G3YA 2KDSA 3TW7A 4HKEA 4J7FA 2E6ZA 3BW1A 2DPPB 2LDMA 5A0GA 5CKBA 3QG1A 4NL3A 3TEEA 2HAXA 3OYNA 5I2SA 2HD0A 2DD4A 4M7DA 2LCCA 2DXBB 2DIGA 4L5GA 3A8LB 1VQLT 3JCMV 1JBMA 3OYEA 4C5IA 3QHSA 1O75A 3JCMQ 3G4ST 2JUFA 2B8AA 3QZ5B 3LLRA 3S3OA 2V8KA 1VQ7A 2DKGA 3OYCA 2X4WA 4M75B 4J83A 3JCMe 5GANj 4O6JA 4HT8A 4F7UB 2H3JA 2BKDN 3DKMA 4EPCA 3GIBA 4KBMB 4EMHA 2QEXT 4JX4A 3V8JA 3LWIA 4IUVA 4M7AE 3QBYA 5GAMd 1BIAA 3V8KA 4A4GA 1NZ9A 3X25B 3VKHA 2ZCFB 1N9RA 5KCHA 1VQ8A 4A54A 1QVPA 2HNIA 3VV0A 3OS1A 4R55A 3GNFB 4XTUA 2FYKA 2E10A 5GAN2 3WXMB 4JRQA 1VQMA 2DD4B 1O9SA 3M54A 2RH2A 2K5FA 3CEYA 2OTJA 4C92G 3QKJA 3CC7A 1VQ9A 3M4YA 1KHIA 5DLQE 3GOXA 3CCQT 2EJGA 1Q86U 4MDXA 4VUBA 3CCJA 4LD9K 4ZGDB 2K3YA 3GP8A 1JRIA 2MWPA 2XDPA 3I55A 3CCUT 4GY5A 3CC7T 2L89A 4BD3A 2DIQA 3DB4A 3CCEA 1YBYA 2D9TA 4N4HA 1YIJA 5GAN5 2C06A 2Y4YA 4LDYA 4M77A 1TH7A 5LJ5g 4XTYA 5GMKm 2DXCA 3NTIA 4P5NA 4C0DB 5FU7B 1YJ9T 4ZN3A 4ATOA 1WGSA 2XDBA 2X35A 5FRNA 2PVOB 1QVGS 1Q82C 1XNIA 1G3TA 2EAYA 3HFNA 3CXCS 3P8BB 5GMKi 5LJ5h 1FXXA 1YI2T 1QVGA 4FL6A 2RHZA 2K57A 2QQAA 3SDZA 3KHIA 3LH0A 5CO7A 4QVDA 1YI2A 1B34A 1VQ7T 4NC6A 4R56A 3PMIA 1VIEA 2DZCA 2QQBA 3BY7A 1OZ3A 3TU4K 4JJNK 3DLMA 4BBSM 2KR6A 4AKGA 3JRZA 2O4XA 4LDWA 2DD5A 3I56A 1M90U 1IZ6A 3MEAA 3OSVA 3QO3A 5GAOq 3JB9J 4M7DB 3C95A 2VYTA 2JZ2A 4JUVA 4BBRM 1U8RA 4XTXA 5FROA 5A0LA 4C8QD 3VYGA 4PJOD 5GANd 2EKOA 3PMTA 2G3RA 3QWLA 1BI0A 1N9SA 3OYKA 4L6V5 4C92F 2HBPA 3OYHA 1YITA 3CC2A 3S3NA 3E1SA 1GXIE 3X24B 3ZEHA 5GAOm 4E7IA 4UC4A 5J26A 1Q81U 1OYXA 2DEQA 3V7SA 2EQUA 3DLLA 2AHJB 3MCAB 5KCOA 3CCLT 4LOCA 2XG8D 3MP1A 4PL6A 1VQOA 1KC8C 3HO8A 2EWNA 3WVDB 4E7KA 3LGFA 4C8QE 3CCLA 3C94A 3MHXA 3CCMA 3CXCA 3CMEA 3HP9A 1K73U 2LCLA 4DOWA 2GQVA 4ZTJA 3ZBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V29 B;  4FM4 B;  2DPP B;  4ZGJ B;  3A8M B;  3QXE B;  4OB2 B;  2ZZD A;  2DD4 A;  2DXB B;  4KT0 E;  3A8L B;  1UGR B;  2ZPI B;  4RKU E;  3QZ5 B;  1AHJ B;  2ZPG B;  2D0Q B;  1UGP B;  3QYG B;  2O01 E;  2PU9 B;  2CZ6 B;  3X25 B;  2CYZ B;  2ZCF B;  1UGS B;  1QP2 A;  2ZPF B;  2DXC B;  2WSF E;  4OB3 B;  3X26 B;  2DD4 B;  2ZPE B;  2WSE E;  2ZZD B;  3A8G B;  2PVD B;  4ZGD B;  2CZ1 B;  1PSE A;  2PVG B;  3A8H B;  2WSC E;  1JB0 E;  2DXC A;  1PSF A;  2ZPB B;  4Y28 E;  3HHT B;  4XK8 E;  2PVO B;  2ZPH B;  1QP3 A;  2CZ7 B;  3WVE B;  3X20 B;  3LW5 E;  3A8O B;  2PUO B;  2DD5 A;  2CZ0 B;  2DD5 B;  3VYG A;  4ZGE B;  4L6V 5;  1GXI E;  3X24 B;  2AHJ B;  1IRE B;  4OB0 B;  3WVD B;  1DJ7 B;  3QZ9 B;  3VYG B;  2PUK B;  5L8R E;  4OB1 B;  3QYH B;  2QDY B;  3VYH B;  3X28 B;  2DXB A;  1UGQ B; 
#chains in the Genus database with same CATH topology
 1V29 B;  4IUU A;  1MND A;  1K0S A;  3Q1J A;  1WNL A;  4LUE A;  3VS5 A;  2COW A;  1BYM A;  1GCQ A;  4OB2 B;  4LE9 A;  1D0Y A;  3MY1 B;  3SD4 A;  2A3L A;  2L3Q A;  1PC0 A;  1M4Z A;  2C5N B;  3GTM S;  1MUZ A;  3M0R A;  2ZPG B;  3DTO A;  2FRW A;  4FT2 A;  1K73 R;  3PTA A;  4ELJ A;  3QYG B;  2D1X A;  3EJ1 B;  1CSK A;  1RAH B;  4IUQ A;  2J6K A;  2PJQ A;  1FIN B;  2MAM A;  2CZ6 B;  4YTL A;  3POM A;  2M51 A;  2LCS A;  3SB2 A;  1G3S A;  4RG8 A;  2K5I A;  1LNX A;  4M7A B;  3VS6 A;  1TTH B;  2ZAE A;  3M53 A;  1MMD A;  2FVU A;  1VQ8 T;  2JMC A;  2XK0 A;  4A4F A;  4II5 B;  4F7U A;  2O9S A;  1VQM T;  1VQN Q;  1SRM A;  2ZGW A;  3BDL A;  3QHR B;  1RLQ C;  3M0S A;  4BCN B;  3VS2 A;  2C0I A;  1N8R C;  1Q81 C;  2KK4 A;  2IW8 B;  3C0C A;  2MF2 A;  1PKS A;  4F7N B;  4WF2 A;  4K11 A;  1HJD A;  4Y28 E;  5LJ3 g;  2QQR A;  3JCM f;  1VQM Q;  1BBZ A;  1VIN A;  2ZPH B;  4RTU A;  4FSS A;  1VQP A;  1Q86 C;  1GFC A;  3VS4 A;  1T0J A;  2HQE A;  3CC4 T;  5HK0 A;  1PKT A;  3CCV A;  3OBY A;  4BI8 B;  3G71 A;  2BE7 D;  1T3S A;  4FIB A;  2JOY A;  3CMA A;  2HL3 A;  2GQI A;  2VB6 A;  5FU7 C;  1RAD B;  3L2U A;  2HAX A;  4KUI A;  2WPA B;  4J9G A;  2M02 A;  4MFE A;  1OU8 A;  2RK2 A;  1D3B B;  1YHQ T;  3CC2 T;  1KIK A;  4QW2 A;  1OPL A;  2GFU A;  2OTL T;  1PNJ A;  4FT4 A;  3AHU A;  1NJI C;  4PJO F;  1XQH A;  4JJN K;  1LJO A;  1WPY A;  5HBE B;  3PIP A;  1ZA1 B;  3E9G A;  3H6Z A;  2L0A A;  4PJO C;  4M6V A;  4JZ4 A;  4BE0 A;  1I0C A;  4YOS A;  4IUT A;  1R77 A;  4KGX B;  2X9H A;  2GF7 A;  3CCR A;  1M3B A;  1RUW A;  1BKB A;  4AG1 C;  3SEM A;  1K8A C;  5ACB A;  2DXB A;  1GY3 B;  1UTI A;  5I21 A;  2LT1 A;  1NM7 A;  3O5Z A;  3CME T;  3ER0 A;  4CFV B;  4EOS B;  2W96 A;  1SSH A;  1N27 A;  4OF1 A;  4AFZ C;  2EIF A;  1NE8 A;  3H8Z A;  4PFP A;  5GAO n;  3J7A F;  5DM7 R;  4AKH A;  4PLL A;  7AT1 B;  4KT0 E;  5GMK e;  1JO8 A;  2CP5 A;  3FRN A;  2IG0 A;  5GAN 8;  4KGV B;  2R57 A;  1HK9 A;  3CCL Q;  3MIA B;  2MWO A;  3JB9 H;  2LQ8 A;  1TUC A;  2P0K A;  2ED0 A;  2EJ9 A;  1MNE A;  3CPW A;  1C1A A;  2CYZ B;  4OP0 A;  3EG9 B;  3H0I A;  3HZJ A;  1TD6 A;  3EFS A;  5FU6 C;  3HRS A;  4A53 A;  2CRE A;  4F7U E;  4X1V A;  2F2C A;  3C12 A;  1GBQ A;  4F7U F;  3EG2 A;  2EQI A;  3M03 A;  1NEB A;  2DA9 A;  1U1S A;  4BY7 X;  2QAS A;  4C8Q A;  1B7T A;  2PVG B;  4CC2 A;  4CI0 C;  3OMG A;  4M77 G;  1X6O A;  3CCU A;  5J3B A;  2RK1 A;  1M1F A;  2HQX A;  5ICP B;  4IUR A;  2O4X B;  2ZPB B;  4M75 F;  3CC4 A;  4IMY B;  2VGM A;  3UA7 A;  3OW2 S;  1GRI A;  1YJ9 Q;  4JRI A;  3KBG A;  2DXU A;  3EGD B;  2W99 A;  1JJ2 S;  3MEW A;  3QJ6 A;  4C92 B;  1OI9 B;  3TQ7 P;  4AFQ C;  3CBM A;  4M7D D;  1WJQ A;  2CP3 A;  1YWP A;  1QWE A;  3VS1 A;  4C8Q B;  3MPU B;  3VS7 A;  4Y72 B;  4NST B;  1VQ4 A;  4EMG A;  2EGA A;  3RMQ A;  1ZQ1 A;  1KXU A;  4QVZ A;  2KAF A;  3TCJ A;  1YJN Q;  3BG9 A;  1WXU A;  4M77 E;  1MHN A;  4JDS A;  4XTW A;  5GAN f;  3QZ9 B;  1RLP C;  4J5Y A;  4M78 F;  4JJD A;  2AIR B;  2CP6 A;  1SHG A;  1B3Q A;  2KYM A;  4BCM B;  1PG5 B;  3DDQ B;  5KYU B;  3M58 A;  4ZGJ B;  3OYM A;  3L2Q A;  2YXY A;  1VQL A;  1WJR A;  1X6B A;  4PNO A;  1VIF A;  3VKI A;  2J6O A;  3M59 A;  2RA2 A;  5GAN 3;  1UGV A;  2YLC A;  1WZO A;  4EMK B;  1YP5 A;  1ABO A;  1ABQ A;  3DB3 A;  4UN0 A;  4BCK B;  2EQM A;  4LDX A;  1KQS A;  2MOX A;  2GBQ A;  4F14 A;  2DET A;  2CUB A;  4OMP A;  4MDW A;  1YN8 A;  3OS2 A;  3OYY A;  2FL7 A;  4CFN B;  5GAN h;  4JS5 A;  1M8V A;  5A2Q E;  4J6Y A;  5IHY A;  3MET A;  3CBO A;  2DAQ A;  1E6G A;  3H0H A;  4MML A;  2DBM A;  3URG A;  3RKY A;  5GAO r;  3DL1 A;  3L1A A;  4AT1 B;  1KHC A;  2CDT A;  3KUF A;  2QTX A;  3QJY A;  4RTV A;  2QI2 A;  4O5V A;  2RI3 A;  2AT1 B;  1ZSG A;  3JCM J;  1JB0 E;  1N8R R;  3CCE T;  4BCI B;  1WI7 A;  4M77 F;  4RTW A;  2VVK A;  4ELL A;  1QMC A;  4M77 C;  4XK8 E;  3REB B;  5D6Y A;  1M9S A;  3G6E Q;  3QII A;  2E5Q A;  3CQT A;  1YNZ A;  3TNH B;  4CC7 A;  1M3C A;  2VAS A;  4M7A G;  3HB9 A;  4AI6 A;  1M1K U;  5FWC A;  2AZS A;  1K1Z A;  2M0O A;  3OS5 A;  3CCV T;  1QVG P;  4BCP B;  4EOP B;  2EPD A;  1Q7Y R;  2I53 A;  3FIF A;  2DMO A;  1ACM B;  5EC7 A;  3CMA T;  1AOJ A;  1WHK A;  2DD5 B;  4HCC A;  1VQ4 T;  1WHJ A;  4N4G A;  3CCR Q;  1Z9Q A;  4ELZ C;  2M0Y A;  1YIT Q;  2I40 B;  3JCM g;  1D1B A;  1AWX A;  3CCS T;  1M1K C;  1YWO A;  4A4K A;  2RF0 A;  1K9M U;  3QDR B;  1O9K A;  3H4C A;  1LOJ A;  3CCR T;  4BI3 A;  1YCS B;  4DEX A;  3CD6 T;  1UGQ B;  3VU3 C;  5FLX E;  5LJ5 j;  1G5V A;  4BCJ B;  4M77 D;  1U3O A;  4FW1 A;  4QQD A;  1URC B;  2KDS A;  3TW7 A;  1N5Z A;  2DPP B;  2LDM A;  3BW1 A;  2OTL Q;  5I2S A;  4M7D A;  1YHQ Q;  3VRY A;  2LCC A;  2DXB B;  2DIG A;  3A8L B;  2R7G A;  4C5I A;  3JCM Q;  3G4S T;  3EFO A;  1UHC A;  4CXA B;  4M75 B;  4J9E A;  4O6J A;  5GAN j;  4YOO A;  4F6U B;  2OX7 A;  2BKD N;  3GIB A;  1AD5 A;  4KBM B;  2QEX T;  5GAM d;  1BIA A;  2EYX A;  3VKH A;  5KYN A;  5KCH A;  3E2U A;  4J9B A;  2UZL B;  4XTU A;  4JRQ A;  5GAN 2;  3WXM B;  1KHI A;  1Q86 U;  4LD9 K;  1JRI A;  2IPO B;  5IDN B;  3DB4 A;  3CCE A;  2C06 A;  1YBY A;  1W6X A;  2ENM A;  1PCX A;  5IF1 B;  3LH5 A;  4KRT A;  4M77 A;  1N4M A;  3EG9 A;  2JW4 A;  5FU7 B;  1GUX A;  1WGS A;  3D7S B;  1JOW A;  2JMA A;  2PVO B;  1QVG S;  1W1F A;  1Q82 C;  3HFN A;  4G6L B;  5GMK i;  1OX9 A;  5LJ5 h;  1VQ4 Q;  1GL5 A;  4KRC B;  4QVD A;  1B34 A;  1BU1 A;  2FZC B;  3MJX A;  1VIE A;  2HMA A;  2QQB A;  3BY7 A;  1OZ3 A;  2EYW A;  4LDW A;  2DD5 A;  1M90 U;  3OSV A;  5GAO q;  3QO3 A;  5I11 A;  1WXB A;  1A0N B;  3KFV A;  4M7D B;  2VYT A;  4BBR M;  1XJW B;  1OPK A;  2UZD B;  5A0L A;  4C8Q D;  2C4G B;  2B9R A;  5GAN d;  3PMT A;  2BKZ B;  4DEY A;  1GXI E;  3S3N A;  2ATC B;  3ZEH A;  5J26 A;  1PRL C;  3V7S A;  2EQU A;  3DLL A;  1W2B P;  1KC8 C;  3HO8 A;  4E7K A;  4C8Q E;  2C0T A;  3CCM A;  4CC3 A;  3CXC A;  3PVL A;  1H27 B;  4OR5 B;  1IHW A;  2GQV A;  1ZSZ C;  4ZTJ A;  5LJ5 f;  4ORZ A;  3PO3 S;  3HTR A;  3HL8 A;  2O2O A;  3BG3 A;  1H4L D;  2YLB A;  3CPW S;  2F69 A;  2NUP A;  2EQJ A;  1WLP B;  1R8O B;  1SSF A;  1WHG A;  1H1R B;  4MZP A;  2L5Q A;  2E1H A;  5GMK j;  1AHJ B;  2JM9 A;  1FMV A;  1QCO A;  3CCS Q;  1QVF S;  2XHC A;  2D8H A;  2DL3 A;  2DXT A;  4MIM A;  2O01 E;  3SWN A;  1CKA A;  2EGC A;  2C0O A;  3OW2 A;  3I5S A;  2PTK A;  3HSB A;  2E70 A;  2E5K A;  1JJ2 A;  1VQ5 A;  1K9M R;  3M0P A;  5GAM f;  3G4S Q;  2CH4 W;  1I81 A;  4FYW B;  4X34 A;  2VXF A;  3GNG A;  3JCM c;  3VUZ A;  4JPB W;  2BS2 A;  2QDL A;  2AZV A;  5GAN g;  3HHT B;  3IQL A;  4IUP A;  1ZHI A;  4J9C A;  4C0F A;  1ZSZ B;  1OL1 B;  3G71 T;  3SWN B;  4C92 E;  1RAF B;  1V76 A;  1XTD A;  1WA7 A;  1JSU B;  3ME9 A;  4GBQ A;  4E47 A;  5CR2 A;  5KYX B;  3TVT A;  1NYF A;  3M57 A;  1VUB A;  3OYI A;  1VQ7 A;  4PK4 A;  4CRI A;  4HT8 A;  3EG0 A;  2RJD A;  4BCQ B;  3EFR A;  5IAY A;  1XOV A;  4QSH A;  2JT4 A;  4LD6 A;  2GCX A;  4WCI A;  1ZLM A;  2K7A A;  2GTO A;  3DOG B;  1YCY A;  4DOV A;  2DO3 A;  3RMS A;  3F70 A;  3L2W A;  1W4S A;  2KSS A;  1QVF P;  5KYW B;  4BCH B;  5GAN e;  4RUG A;  4PFO A;  5GJV B;  1UEB A;  2BZY A;  3OSS C;  4ROD A;  3QUI A;  2PUK B;  6AT1 B;  3CCS A;  5C0M A;  2KT1 A;  2QEX Q;  2V8J A;  3ASK A;  4J6W A;  2RN8 A;  2V26 A;  4QVC A;  3CD6 A;  2X3W D;  2LNH B;  4RCC A;  1WHM A;  4II1 A;  1VQL Q;  3FLG A;  4Z88 A;  5LJ5 d;  2DER A;  1TUD A;  2KYB A;  3J81 E;  3I5R A;  3G4S A;  2XI9 A;  5CAI A;  2A0F B;  2LJ0 A;  4KUD K;  4V2S A;  1NPR A;  4HNT A;  2LC4 A;  4BY6 C;  2Y90 A;  3EFO B;  5KE3 A;  2RHI A;  2BIV A;  2P0Q A;  2WAC A;  1RAG B;  4C5E A;  5FU6 B;  4OB3 B;  3N5B B;  4QQ6 A;  4MFD A;  3T9N A;  4J9D A;  3A5Z B;  4M7D C;  5GAM j;  2K79 A;  4A4H A;  1KC8 U;  1PSE A;  2DL7 A;  2XD0 A;  1TFB A;  4M75 G;  4JS4 A;  1RAA B;  3ZL7 C;  5BNJ B;  5J39 A;  2MPX C;  3OYJ A;  2QGF B;  2YRV A;  4Z02 A;  1NJI R;  2LZ6 B;  2PQW A;  3OYD A;  4F7L B;  1ZBJ A;  5GJW B;  2VC8 A;  4M75 A;  1ARK A;  4M78 A;  2BUD A;  4OMF B;  1D3B A;  3OA6 A;  3MEU A;  2C6T B;  1OL2 B;  2LX9 A;  2R5A A;  4JLG A;  1H8K A;  4BCQ D;  1RAI B;  2RHU A;  2K5L A;  5L23 A;  2G77 A;  1Q82 R;  3INZ A;  1X43 A;  4C92 D;  2LMJ A;  1S72 T;  4HLQ A;  4M78 E;  2P0P A;  4AG2 C;  2PK9 B;  3VYG B;  4E7L A;  2DVE A;  5AT1 B;  3LQ5 B;  4OB1 B;  1MMA A;  3VYH B;  3H0F A;  2FEI A;  3X28 B;  3FJ5 A;  3CCM T;  2NUP B;  3CCV Q;  2UZE B;  3JCM P;  3TNI B;  3TSW A;  2QFZ A;  2D0N A;  2RJF A;  4CFU D;  3EGX A;  3FB9 A;  2OAU A;  3L2R A;  4BDZ A;  1YJN A;  2O9V A;  3QXE B;  5IHN A;  4M78 G;  5LJ3 e;  1Q7Y U;  1HYO A;  1RI0 A;  1IB8 A;  1UGR B;  2YRC A;  1M27 C;  4D8K A;  3M0Q A;  1UDL A;  3DDP B;  3JSC A;  3M9Q A;  5GAN 7;  4DBH A;  1U5S A;  1W2B S;  2XMF A;  3NTK A;  2FO0 A;  5GAM h;  4BXX X;  1H25 B;  2NYS A;  4E7S A;  2C5X B;  2ZPE B;  2X51 A;  2QA4 Q;  2B86 A;  4EMK C;  2UUE B;  3SWN C;  1EIF A;  2YSQ A;  2OTJ T;  2LJ1 A;  2RHY A;  3RBB B;  2YUQ A;  3BG5 A;  2BS3 A;  3A8H B;  5LQF B;  3CCJ T;  2KRS A;  1IXD A;  3UWN A;  4CFX B;  4CFW B;  1GFD A;  4HL4 A;  1KD1 U;  2C5V B;  1ZUK A;  2F5K A;  5LL6 S;  1HD3 A;  1PWT A;  4AKI A;  5HKC A;  1X2K A;  4FCY A;  5HK3 A;  2RB6 A;  1WFW A;  3LW5 E;  1C0M A;  2SRC A;  3M55 A;  4PJO A;  4XU0 A;  1WQW A;  2LNV A;  4MZT A;  2DFU A;  2RHX A;  3I56 T;  1MMN A;  3UT1 A;  8ATC B;  1JU5 C;  5CQY A;  3CC2 Q;  1QWF A;  1S72 A;  1AZE A;  2A28 A;  2DLP A;  4OGE A;  1M1K R;  1TSF A;  2NUZ A;  2PNI A;  4BY6 B;  4BDY A;  3JCM W;  4HNU A;  3CCU Q;  4XU2 A;  4LUD A;  2HSP A;  2E64 A;  2V1R A;  1QVF A;  5CEI B;  5KE2 A;  1NYG A;  2EYZ A;  1VQK T;  4PJO B;  2PMI B;  2E3I A;  3OQ5 A;  4J7F A;  1IGU A;  3VRZ A;  1TS9 A;  1YI2 Q;  1GCP A;  2KXC A;  4OMQ A;  3DJB A;  3CXC P;  1ZX6 A;  1MV3 A;  1W70 A;  1S72 Q;  3O0G D;  1D3U B;  2CP0 A;  3QHS A;  1YIJ Q;  5IXF A;  1XO2 A;  2B8A A;  1G8X A;  2DKG A;  2X4W A;  3SHW A;  2LQW A;  4J83 A;  3JCM e;  4OML A;  4EOM B;  3DKM A;  1WYX A;  1G3N C;  1Y0M A;  4JX4 A;  4IUV A;  3QBY A;  1VA7 A;  1NZ9 A;  4FX3 B;  1VQ8 A;  1AWO A;  2FYK A;  1VQM A;  3RDV A;  2K5F A;  3CEY A;  4CFM B;  2OTJ A;  4C92 G;  1R0C B;  1RAB B;  3CCJ A;  2IVX A;  2K3Y A;  3QHW B;  1TU0 B;  2RQV A;  4BD3 A;  1YIJ A;  2Y4Y A;  2C5O B;  5DQV A;  4LDY A;  4XTY A;  2HBW A;  3EHQ A;  4RTT A;  2X35 A;  1Q86 R;  5FRN A;  1K0X A;  3MY5 B;  2BPM B;  1UG1 A;  1P5E B;  1QVG A;  5HCK A;  1OIU B;  1D1A A;  4YOZ A;  2QQA A;  2PZ1 A;  3LH0 A;  2HQH A;  1YI2 A;  1D09 B;  2DYI A;  1PKD B;  2KBT A;  1IRX A;  3TU4 K;  2W10 A;  4BBS M;  2KR6 A;  3K7A M;  4AKG A;  2JS0 A;  3I56 A;  2KI7 A;  3MEA A;  2W9Z A;  3CCJ Q;  2JZ2 A;  4JUV A;  1U8R A;  5IH2 A;  3EG1 A;  4XTX A;  5FRO A;  2OTJ Q;  1K9A A;  2EKO A;  2G3R A;  3OYK A;  2K3B A;  4IKF A;  3E1S A;  2VKN A;  4UC4 A;  4E7I A;  4PFZ A;  4LOC A;  2HEQ A;  1VQO A;  4HVU A;  4EOJ B;  3CCL A;  3MHX A;  2GTJ A;  2AKL A;  3CME A;  2KR3 A;  5GAN 6;  1C6V X;  4C0D C;  2RJC A;  2RMO A;  1OIY B;  2V8I A;  4MMK A;  2DNU A;  2KXD A;  2JS2 A;  1H3H A;  1N6A A;  2BE9 B;  3A1P A;  4FYY B;  2V22 B;  2SEM A;  1KD1 R;  5D7U A;  2GNC A;  4M4Z A;  2QK0 A;  2KMT A;  2DME A;  1BIB A;  3KXT A;  1M90 R;  3RER A;  3TNW B;  4HT9 A;  3J80 E;  1Y96 B;  3HRU A;  3CCM Q;  3JB9 D;  4BCN D;  3JCM X;  2X4X A;  4E6R A;  1ZSZ A;  1WJS A;  2F5T X;  4PKC C;  5L2W B;  2CCI B;  1UFF A;  1KFZ A;  1QP2 A;  2WSF E;  2K9G A;  5CCA A;  3G6E A;  1RI9 A;  5FRM A;  1FMW A;  5CYI B;  1WXT A;  1VOM A;  1YIJ T;  4JJC A;  2QQ8 A;  2M1H A;  4LN2 A;  1KQ2 A;  5CKE A;  2MYS A;  3JCM d;  4F16 A;  2CH4 A;  2NWM A;  1KSW A;  5LMK B;  4KGZ B;  1VQ5 Q;  2DYB A;  1VQ9 Q;  3OBW A;  2KMG A;  2CGH A;  3RIR A;  4F6S B;  2DL4 A;  3GBQ A;  1JST B;  4C92 C;  4HNV A;  1ZUU A;  4JX6 A;  4EDU A;  1VYT A;  2DTO A;  4J7I A;  4OMO A;  2DEU A;  2VUB A;  4LXC A;  4RMO A;  2L8D A;  2QGS A;  4M78 C;  2QA4 T;  5IT9 E;  2EVR A;  1TG0 A;  5CKH A;  1M3A A;  1RL2 A;  2FPF A;  3S3M A;  3C4S A;  5IN1 A;  1PD0 A;  4C92 A;  2G6F X;  1QMZ B;  2QYZ A;  1ZBX A;  3OYF A;  4BCO B;  1IRE B;  4F70 B;  1KJW A;  5CQX A;  2WXV B;  5GAM g;  3M4G A;  1UHF A;  3CD6 Q;  3R6O A;  1GBR A;  2ROT A;  2KQW A;  3R6N A;  1QKX A;  3M0T A;  2PHG A;  1GCQ C;  4EIK A;  4EON B;  2RQR A;  2YUO A;  2XIC A;  2L3R A;  1NJI U;  1H1P B;  3JV3 A;  1VQ6 T;  3BHV B;  3MP8 A;  4Z89 A;  1UB4 A;  1AD6 A;  1Y07 A;  4M7A D;  3QWX X;  3U23 A;  5DQW A;  2EFI A;  4RKU E;  3G33 B;  5DLO A;  1OKV B;  3OY9 A;  3QDF A;  2D0Q B;  1R0B G;  4BCM D;  2YRD A;  3FC3 A;  4Q5W A;  1B07 A;  1EFN A;  3LX7 A;  3FJP A;  2A7Y A;  1Y71 A;  3PT9 A;  3UAT A;  2DXC B;  9ATC B;  1KD1 C;  1T0H A;  4HA8 A;  1WHH A;  2JTE A;  2YDL A;  2CS7 A;  3PFS A;  3I55 T;  1AT1 B;  2GGR A;  1AIS B;  4KH0 B;  1HXD A;  1I1J A;  3F5X B;  2CZ1 B;  2YUP A;  1QW1 A;  2WSC E;  2RI5 A;  4A63 B;  1QLY A;  5HBH B;  5I2M A;  5CVI A;  3OS0 A;  5D6X A;  4FYV B;  2K4Y A;  4EOK B;  5A0D A;  2M9U A;  3UDC A;  2CT3 A;  2JN0 A;  2RD1 A;  3HRT A;  1MGQ A;  4ZNX A;  2BTT A;  1ENW A;  3HKS A;  4JRK A;  1LCK A;  2K6D A;  4XTZ A;  2LT4 A;  1YJW Q;  2PUO B;  3ZFJ A;  1X75 C;  2LQK A;  3CPW P;  2DVJ A;  2NLU A;  3JAM E;  4BY1 X;  2MCN A;  3OYG A;  3HBL A;  3GLX A;  4M7D F;  5KYX A;  5GAO l;  4ZGE B;  1SEM A;  2CSQ A;  5LJ3 d;  2JXB A;  2G9X B;  2JTM A;  2COY A;  2LW4 A;  2OTL A;  3AT1 B;  1BCM A;  3EAE A;  3TN8 B;  3NTH A;  5HY6 A;  2KVQ G;  5LJ3 f;  2RM4 A;  3LGL A;  2FPD A;  4HCZ A;  8AT1 B;  1UUE A;  1VQ7 Q;  5L8R E;  3UPU A;  3QYH B;  3P8H A;  1VQK Q;  4FU6 A;  1OEB A;  2DM1 A;  2DL8 A;  5AYF A;  2RO0 A;  3OMC A;  5CIU A;  4M7D G;  4ESR A;  1YJN T;  5CK9 A;  3EGX B;  1FYN A;  3QPH A;  4FW2 A;  3VS3 A;  2JVV A;  1EX4 A;  4LDV A;  1UNH D;  1B34 B;  3PE0 A;  1T3L A;  2EBP A;  2R5M A;  4X9C A;  2VV5 A;  1I4K 1;  3RKX A;  3NFC A;  4C0G A;  2E41 A;  1JEG A;  5GMK l;  4BCF B;  1W98 B;  5IHK A;  1X01 A;  3MKD A;  2QEX A;  2K2V A;  4M77 B;  1UE9 A;  2YUN A;  3RUX A;  3SFM A;  1QCF A;  3QSU A;  4OGR B;  1M5Q 1;  4M75 E;  2X4J A;  2QXF A;  1O9K B;  1JXO A;  1VQ8 Q;  2W9F A;  3RGF B;  3EH1 A;  2E65 A;  3MEV A;  4QQG A;  3FEO A;  4YC3 B;  1OU9 A;  1VOL A;  1ZUY A;  1QKW A;  3G6E T;  4OGC A;  4F7J B;  1X27 A;  4DA4 A;  3V8L A;  3BLH B;  2RQU A;  2HDA A;  2WIP B;  3BDU A;  1JKW A;  2JNG A;  3OYL A;  2XID A;  2FHD A;  2KRN A;  5IDP B;  3RR6 A;  1UJ0 A;  4DBQ A;  2P84 A;  1RAE B;  2IW6 B;  1YJ9 A;  3RES A;  1VYW B;  5GAO p;  1OQK A;  3WVE B;  2EYY A;  2O88 A;  2LX7 A;  3X20 B;  5D6W A;  1Y7X A;  3EID B;  1E7P A;  4ZN1 A;  3A8O B;  2XKO C;  1WDX A;  4R0K A;  2RNA A;  3JB9 G;  1Q7Y C;  4JX5 A;  3TW6 A;  2EKH A;  2HKQ B;  2QA4 A;  3PGG A;  1FKM A;  2HL5 C;  3PNW C;  4M78 B;  3EGD A;  4D6W A;  4OMN A;  4ELY C;  4EOQ B;  1LPL A;  2H8H A;  2Z0W A;  1E7O A;  5HVY B;  2W0Z A;  3JCM b;  1SRL A;  2FRY A;  4B9X A;  4C5G A;  3B57 A;  4OMM A;  1GUX B;  2BS4 A;  2E3H A;  1QLB A;  1VQK A;  2LTO A;  2ESW A;  2FZK B;  3NHN A;  1K4U S;  1ZP2 A;  5CKF A;  5HNB B;  1P92 A;  3CBP A;  3S6W A;  3QG1 A;  4NL3 A;  1TWB A;  2HD0 A;  1J3T A;  1VQL T;  4JZ3 A;  4FYX B;  2WIH B;  2X3X D;  2JUF A;  3LLR A;  1SF9 A;  3QZ5 B;  3EOC B;  2V8K A;  3S3O A;  3OYC A;  4DBR A;  2WEV B;  2F2X A;  2H3J A;  2LJ3 A;  4EPC A;  1BU2 A;  3V8J A;  3VS0 A;  4PJJ A;  3V8K A;  4A4G A;  2ZCF B;  1N9R A;  2NUT B;  3MI9 B;  2HNI A;  3VV0 A;  5FGK B;  2E10 A;  1VQ5 T;  2DD4 B;  1O9S A;  3M54 A;  2RH2 A;  2CSI A;  3M4Y A;  5DLQ E;  3CCQ T;  4EOO B;  4MDX A;  1NBE B;  4ZGD B;  2MWP A;  3I55 A;  3CC7 T;  2F2W A;  4GY5 A;  4BCG B;  1OUL A;  2L89 A;  1Q81 R;  2F2V A;  2BZ8 A;  2D9T A;  4N4H A;  1OX8 A;  4C0D B;  1YJ9 T;  4ZN3 A;  3CCQ Q;  1BCO A;  2KE9 A;  1CKB A;  1GH6 B;  3CXC S;  3ULR B;  1YI2 T;  2DJQ A;  4FL6 A;  2RHZ A;  2K57 A;  3KHI A;  5CO7 A;  1X2Q A;  1VQ7 T;  2DF6 A;  4R56 A;  1QQJ A;  3PMI A;  1KC8 R;  1PD1 A;  2LQN A;  3DLM A;  2I0N A;  2H3E B;  3JRZ A;  4WTO B;  4EOI B;  3JB9 J;  2K2M A;  3I55 Q;  4EC8 B;  2D8J A;  2J06 A;  4QKU A;  4CC4 B;  2JM8 A;  4J9I A;  2WMB B;  4KRD B;  3VYG A;  1X69 A;  3QWL A;  1BI0 A;  1N9S A;  2BZX A;  3OYH A;  4C92 F;  2HBP A;  1YIT A;  1Q81 U;  1PHT A;  2ABL A;  4ROE A;  3CCL T;  1JJ2 P;  1G83 A;  3MP1 A;  4PL6 A;  1D0X A;  3WVD B;  2O31 A;  5KYY B;  3M0U A;  4DOW A;  2P4R A;  1M90 C;  4KH1 B;  4FM4 B;  4Z6Y A;  1FMK A;  2RQT A;  3LWH A;  3BHU B;  3V7R A;  5EG2 A;  2EQK A;  1H64 1;  3JB9 I;  1OOT A;  2AKK A;  4EOL B;  2ZZD A;  2OAW A;  3RNJ A;  2QGG A;  2QF7 A;  5LJ5 e;  4EOR B;  4J9F A;  1K76 A;  4Y92 A;  1H26 B;  1C9B A;  2RQW A;  2UZB B;  4BUG A;  5FWB A;  3BLQ B;  3GF5 A;  4OVA A;  3EHR A;  1UNL D;  2VXE A;  3E9F A;  1K8A U;  2DRM A;  1UGS B;  4JLI A;  1NPP A;  1BB9 A;  4ME7 A;  4BAC A;  3CCQ A;  1BK2 A;  5KH6 A;  1SG5 A;  2E12 A;  2WSE E;  2ZZD B;  1VYV A;  1M2V A;  2PVD B;  1M30 A;  4XU1 A;  5I22 A;  4NS5 A;  4M7A C;  4D8D A;  1AWJ A;  4C5H A;  1K9M C;  2A37 A;  2QQ9 A;  3EG3 A;  4HVV A;  1F5Q B;  2EGE A;  2DK3 A;  4HCK A;  5ECA A;  1TXQ A;  3LYI A;  4B6M A;  3G1J A;  3HFO A;  4XQ3 A;  4E7H A;  1VQN T;  4KUL A;  1SKU B;  4FSX A;  2LVM A;  4TVR A;  1IGQ A;  1QP3 A;  2DTI A;  2CZ7 B;  1Y96 A;  4F7S B;  4XAX B;  4GLM A;  2L2P A;  1YJW T;  2QDJ A;  1G2B A;  3MO8 A;  1FWZ A;  4AFU C;  2L3P A;  2DJZ A;  1BI1 A;  4BB7 A;  4E2F B;  4M75 C;  1RAC B;  1YIT T;  2ECZ A;  2W2H A;  4MZM A;  2DL5 A;  1F1B B;  1IO6 A;  1YHQ A;  2JTF A;  1U06 A;  3L2V A;  4M7D E;  4C8Q C;  2RJE A;  2DZ9 A;  4N0A A;  2CP7 A;  3PVQ A;  5KYY A;  1WX6 A;  2R58 A;  2DIL A;  4J9H A;  2QDY B;  3BHT B;  4JJB A;  4Y91 A;  1NLP C;  4RG2 A;  2HZY A;  3OYA A;  3FDR A;  3GPL A;  3UF4 A;  3E19 A;  3L2Z A;  1VQ6 A;  4C8Q G;  3A8M B;  3OYB A;  4HVW A;  3BLR B;  1G3W A;  2KGT A;  2WFY B;  1AVZ C;  3QYB A;  3HPW A;  3VUB A;  2J05 A;  2ED1 A;  2KRM A;  2RI2 A;  4M7A F;  5C6S A;  4ROC A;  1IHV A;  2ZPI B;  1I5O B;  1K8A R;  2F1L A;  4CRL B;  2XU8 A;  1MV0 B;  5EFQ B;  3MP6 A;  1OI1 A;  4PLI A;  3VJP A;  3JB9 F;  4J6X A;  4LDU A;  5DY9 A;  3VKG A;  3M56 A;  2EUF A;  1I07 A;  2JGZ B;  2KEA A;  2ZPF B;  4ANJ A;  1VQ9 T;  3L42 A;  4J8O A;  4BI4 A;  3QYE A;  2XDD A;  1H24 B;  1OGU B;  2PK2 A;  2KRO A;  1KK7 A;  3A98 A;  4BE1 A;  3NGP A;  4Z8A A;  1H28 B;  3CMA Q;  4EMK A;  4F6W B;  2M16 A;  4F7U G;  3REA B;  2A36 A;  1BI2 A;  1VQO Q;  1PM3 A;  2K3X A;  2NUT A;  4EC9 B;  1VQN A;  1PSF A;  1NLO C;  2DX1 A;  1FX7 A;  2OI3 A;  2GFA A;  5LJ3 h;  1TUG B;  5IXB A;  2WJ9 A;  1Z9Z A;  4L59 A;  3CC4 Q;  1Q95 G;  1N8R U;  1E9H B;  4I3Z B;  2CUD A;  1M2V B;  3CCE Q;  2JJ9 A;  5FW9 A;  5M9O A;  4XTV A;  2CZ0 B;  2OJ2 A;  1U1T A;  4A4E A;  5GAM e;  1UNG D;  2HCK A;  1WHL A;  4HCB A;  4N0A C;  1OZ2 A;  2EJF A;  1NEG A;  3O8V A;  2ROL A;  1WQ7 A;  4E7J A;  1NG2 A;  3NDQ A;  2IVW A;  2VGN A;  4IIM A;  4PJL A;  3QWY A;  1QCN A;  3I9Q A;  1MMG A;  4GLK A;  1W2B A;  3TRE A;  1SPK A;  2LRQ A;  1KQ1 A;  5GAN 4;  2CP2 A;  4PJM A;  2VWF A;  1UJY A;  4B9W A;  3PIO A;  4PJN A;  2Y4X A;  2D6F A;  2A08 A;  2KY9 A;  2E6N A;  1BI3 A;  4M7A A;  1I5L A;  2FB7 A;  4ZTF A;  1KQS S;  1OV3 A;  1H1Q B;  1M8M A;  3OB9 A;  5EJC A;  4DQ2 A;  2MI6 A;  4F04 B;  3RKW A;  1UGP B;  3I56 Q;  2CT4 A;  4CFU B;  2IN3 A;  2QAZ A;  4PJO G;  3NMZ C;  2PU9 B;  2L3S A;  2IIM A;  2MMP A;  4F17 A;  2YWW A;  3UA6 A;  3V7C A;  3TSZ A;  1WIE A;  3X26 B;  4BE2 A;  2CCH B;  1ZA2 B;  2HKN A;  3A8G B;  4M78 D;  1Q82 U;  2KT8 A;  5KYU A;  3BFM A;  4NOY A;  1K73 C;  1H3Z A;  4RTZ A;  3P8D A;  4AMC A;  5LJ3 j;  4XU3 A;  2I2L A;  2YHT A;  4RCB A;  1D0Z A;  1I8F A;  2FPE A;  4X9D A;  1VQP T;  1JXM A;  4N4I A;  2RPN A;  3G71 Q;  3CPF A;  2V1Q A;  1M2O A;  4HXJ A;  5GMK h;  2J7I A;  3G7Z A;  2DRK A;  2EW3 A;  1H1S B;  1M1G A;  1Y57 A;  3JCM h;  4PJO E;  1PRM C;  1YJW A;  2X4Y A;  3H41 A;  2LP5 A;  3CME Q;  2COZ A;  2CKK A;  2DTH A;  1SHF A;  2E4H A;  2AK5 A;  5CKD A;  1FVV B;  4C0Z A;  2MK5 A;  4C8Q F;  4RTY A;  5HBJ B;  1VQO T;  1LVK A;  2P4T A;  1D1C A;  2QQS A;  1TOV A;  1KG1 A;  4JRP A;  1VYU A;  2EYQ A;  3EGU A;  4OB0 B;  1DJ7 B;  2DBK A;  4NL2 A;  5IHI A;  1H92 A;  1V1C A;  4QT7 A;  1X6G A;  4M75 D;  3M5A A;  1G3Y A;  4HKE A;  5A0G A;  2E6Z A;  5CKB A;  3TEE A;  3OYN A;  2DD4 A;  1OKW B;  1UEC A;  4L5G A;  1VQ6 Q;  3JCM V;  1JBM A;  3OYE A;  1O75 A;  1E6H A;  5HQ0 B;  4F7U B;  1AWW A;  4EMH A;  3LWI A;  4M7A E;  1YFN A;  3X25 B;  4IIO A;  4A54 A;  1QVP A;  1EZZ B;  3OS1 A;  1JQQ A;  2QG9 B;  4R55 A;  2WMA B;  3GNF B;  4TTH A;  4RTX A;  3CC7 A;  3QKJ A;  1VQ9 A;  3GOX A;  2EJG A;  1HSQ A;  4VUB A;  3CC7 Q;  3GP8 A;  2XDP A;  3CCU T;  2KNB B;  2DIQ A;  2YT6 A;  3I35 A;  5GAN 5;  2IW9 B;  5LJ5 g;  1TH7 A;  5GMK m;  2DXC A;  4E7Z A;  3NTI A;  4P5N A;  2HSE B;  4ATO A;  2XDB A;  3BE3 A;  1XNI A;  1G3T A;  2EAY A;  3P8B B;  1FXX A;  2MIO A;  3EH2 A;  1AZG B;  3SDZ A;  5KYW A;  1KQS P;  4NC6 A;  3THK A;  1S1N A;  2DZC A;  2X1N B;  2O4X A;  1IZ6 A;  3C95 A;  3NPF A;  4DBF A;  2QTV A;  2WHB B;  3H9N A;  4PJO D;  1AEY A;  2DE0 X;  1VQP Q;  4L6V 5;  3CC2 A;  4AFS C;  3X24 B;  5GAO m;  2FG0 A;  2CJM B;  1OYX A;  2DEQ A;  5I5Z B;  2J6F A;  2AHJ B;  3MCA B;  5KCO A;  2XG8 D;  2EWN A;  3LGF A;  3C94 A;  3OW2 P;  4LNP A;  3HP9 A;  1K73 U;  2LCL A;  2FZG B;  3ZBD A; 
#chains in the Genus database with same CATH homology
 5LJ5 f;  3CMA A;  5GAN 6;  1V29 B;  4FM4 B;  4IUU A;  4Z6Y A;  4C0D C;  2RJC A;  3HL8 A;  3Q1J A;  1WNL A;  3BG3 A;  2YLB A;  2V8I A;  4MMK A;  3LWH A;  3CPW S;  3V7R A;  1BYM A;  1N6A A;  2F69 A;  5EG2 A;  2EQK A;  1H64 1;  3JB9 I;  4OB2 B;  2ZZD A;  2EQJ A;  3SD4 A;  1R8O B;  2A3L A;  1SSF A;  2QF7 A;  1M4Z A;  5LJ5 e;  4MZP A;  2L5Q A;  2E1H A;  5GMK j;  1AHJ B;  2ZPG B;  2KMT A;  4FT2 A;  1BIB A;  3KXT A;  3PTA A;  4ELJ A;  3RER A;  4BUG A;  3QYG B;  1QVF S;  4HT9 A;  3J80 E;  1Y96 B;  3HRU A;  2XHC A;  3JB9 D;  2DXT A;  3GF5 A;  3JCM X;  4MIM A;  4OVA A;  4IUQ A;  2X4X A;  2O01 E;  3SWN A;  2VXE A;  3E9F A;  1WJS A;  2MAM A;  2CZ6 B;  4YTL A;  2F5T X;  4PKC C;  1K8A U;  1UGS B;  4JLI A;  3SB2 A;  1G3S A;  4RG8 A;  3OW2 A;  2K5I A;  1QP2 A;  1LNX A;  4M7A B;  2WSF E;  3M53 A;  1NPP A;  2FVU A;  4ME7 A;  4BAC A;  1VQ8 T;  3CCQ A;  5CCA A;  3HSB A;  3G6E A;  2XK0 A;  2E70 A;  4A4F A;  5KH6 A;  5FRM A;  2E12 A;  2WSE E;  2ZZD B;  4F7U A;  1JJ2 A;  1VQM T;  2PVD B;  4XU1 A;  1VQ5 A;  5GAM f;  4NS5 A;  1YIJ T;  4M7A C;  1KQ2 A;  2QQ8 A;  2M1H A;  2ZGW A;  4C5H A;  3BDL A;  1I81 A;  4X34 A;  1K9M C;  5CKE A;  2QQ9 A;  3JCM d;  2VXF A;  2DK3 A;  1N8R C;  3GNG A;  3JCM c;  3VUZ A;  2KK4 A;  1Q81 C;  2BS2 A;  2MF2 A;  3OBW A;  2KMG A;  2CGH A;  3LYI A;  4WF2 A;  5GAN g;  4Y28 E;  3RIR A;  2QQR A;  3JCM f;  3HHT B;  3HFO A;  4XQ3 A;  5LJ3 g;  4IUP A;  1ZHI A;  2ZPH B;  4C0F A;  4E7H A;  1VQN T;  3G71 T;  4KUL A;  3SWN B;  4C92 E;  3CC4 T;  4FSX A;  2HQE A;  1VQP A;  1Q86 C;  2LVM A;  4TVR A;  1XTD A;  1QP3 A;  2DTI A;  5HK0 A;  2CZ7 B;  1Y96 A;  3CCV A;  3OBY A;  3ME9 A;  4BI8 B;  3G71 A;  4E47 A;  4XAX B;  4C92 C;  4HNV A;  5CR2 A;  4JX6 A;  1YJW T;  4EDU A;  2DTO A;  4J7I A;  3M57 A;  2QDJ A;  1VUB A;  2JOY A;  1FWZ A;  3MO8 A;  4FIB A;  3OYI A;  2VUB A;  2DJZ A;  1BI1 A;  5FU7 C;  4CRI A;  4RMO A;  3L2U A;  2L8D A;  2RJD A;  4KUI A;  4BB7 A;  4M75 C;  3EFR A;  5IAY A;  1XOV A;  4M78 C;  2QA4 T;  4QSH A;  4LD6 A;  2GCX A;  5IT9 E;  5CKH A;  4MFE A;  2RK2 A;  1RL2 A;  1D3B B;  3S3M A;  3C4S A;  1YHQ T;  1YIT T;  3CC2 T;  5IN1 A;  4QW2 A;  2GFU A;  4C92 A;  4MZM A;  2OTL T;  4FT4 A;  3AHU A;  1YCY A;  1NJI C;  1YHQ A;  4DOV A;  2DO3 A;  4PJO F;  3RMS A;  1XQH A;  2JTF A;  3F70 A;  1W4S A;  1LJO A;  3L2V A;  1WPY A;  3PIP A;  2KSS A;  3H6Z A;  3E9G A;  1M90 C;  4M7D E;  4PJO C;  5GAN e;  4M6V A;  1ZBX A;  4C8Q C;  2RJE A;  4BE0 A;  3OYF A;  2DZ9 A;  4N0A A;  1IRE B;  4IUT A;  5CQX A;  3CCR A;  2GF7 A;  1UEB A;  3OSS C;  5GAM g;  3M4G A;  3QUI A;  2PUK B;  2R58 A;  3CCS A;  1BKB A;  3R6O A;  1K8A C;  2QDY B;  4Y91 A;  5C0M A;  2KQW A;  2DXB A;  2V8J A;  3ASK A;  4J6W A;  4RG2 A;  5I21 A;  3OYA A;  2LT1 A;  3FDR A;  3CME T;  3GPL A;  4QVC A;  3CD6 A;  3ER0 A;  3E19 A;  1N27 A;  3L2Z A;  4OF1 A;  4C8Q G;  1VQ6 A;  2EIF A;  3A8M B;  1NE8 A;  2L3R A;  2XIC A;  4RCC A;  3OYB A;  3H8Z A;  1G3W A;  4II1 A;  1NJI U;  3J7A F;  5GAO n;  5DM7 R;  4AKH A;  3QYB A;  1VQ6 T;  3FLG A;  4PLL A;  3HPW A;  3MP8 A;  4KT0 E;  1UB4 A;  1Y07 A;  3VUB A;  5GMK e;  4M7A D;  5LJ5 d;  2RI2 A;  4M7A F;  5C6S A;  2EFI A;  2ZPI B;  4RKU E;  5DLO A;  3FRN A;  3OY9 A;  2IG0 A;  2D0Q B;  3J81 E;  5GAN 8;  3G4S A;  2XU8 A;  2XI9 A;  5CAI A;  2R57 A;  1HK9 A;  3FC3 A;  4Q5W A;  3MP6 A;  2MWO A;  3JB9 H;  4KUD K;  2LQ8 A;  1OI1 A;  4PLI A;  3LX7 A;  2P0K A;  1NPR A;  3FJP A;  4J6X A;  4LDU A;  2A7Y A;  5DY9 A;  3VKG A;  3VJP A;  3JB9 F;  2EJ9 A;  4HNT A;  2LC4 A;  1Y71 A;  2Y90 A;  3M56 A;  2CYZ B;  3PT9 A;  4OP0 A;  4BY6 C;  3CPW A;  3HZJ A;  5KE3 A;  2RHI A;  3EFS A;  5FU6 C;  3HRS A;  2BIV A;  2P0Q A;  4A53 A;  2WAC A;  2ZPF B;  2DXC B;  4C5E A;  4F7U E;  5FU6 B;  4OB3 B;  3L42 A;  1VQ9 T;  3C12 A;  4J8O A;  4BI4 A;  1KD1 C;  4F7U F;  3QYE A;  3N5B B;  4HA8 A;  4QQ6 A;  4MFD A;  3T9N A;  2CS7 A;  3A5Z B;  3PFS A;  2XDD A;  3I55 T;  4M7D C;  5GAM j;  4BE1 A;  1U1S A;  1HXD A;  2CZ1 B;  4A4H A;  1KC8 U;  1PSE A;  4CI0 C;  4C8Q A;  1QW1 A;  2PVG B;  2WSC E;  4M75 G;  4EMK A;  4JS4 A;  2XD0 A;  2M16 A;  2RI5 A;  3OMG A;  4F7U G;  4M77 G;  1X6O A;  3CCU A;  5J3B A;  2RK1 A;  1BI2 A;  1M1F A;  2HQX A;  5J39 A;  4IUR A;  2K3X A;  2O4X B;  1VQN A;  5I2M A;  1PSF A;  5CVI A;  2ZPB B;  4M75 F;  1FX7 A;  5LJ3 h;  2GFA A;  5D6X A;  3OS0 A;  3OYJ A;  2K4Y A;  3CC4 A;  5A0D A;  2M9U A;  2VGM A;  2YRV A;  3OW2 S;  4Z02 A;  3UDC A;  4JRI A;  2JN0 A;  2PQW A;  2WJ9 A;  3OYD A;  2RD1 A;  3HRT A;  4L59 A;  1MGQ A;  3KBG A;  3HKS A;  2DXU A;  1JJ2 S;  1N8R U;  3MEW A;  4JRK A;  2VC8 A;  3QJ6 A;  4M75 A;  4M78 A;  2BUD A;  4C92 B;  4XTZ A;  4OMF B;  2LT4 A;  1D3B A;  3OA6 A;  2PUO B;  3MEU A;  5M9O A;  3CBM A;  3ZFJ A;  1X75 C;  2LX9 A;  2R5A A;  4JLG A;  4XTV A;  4M7D D;  2CZ0 B;  2LQK A;  1WJQ A;  2NLU A;  1U1T A;  3JAM E;  3OYG A;  2RHU A;  4M7D F;  3HBL A;  3GLX A;  4A4E A;  2K5L A;  5GAM e;  4C8Q B;  2G77 A;  5GAO l;  1VQ4 A;  3L2W A;  4ZGE B;  4EMG A;  4HCB A;  3INZ A;  5LJ3 d;  3RMQ A;  4N0A C;  1OZ2 A;  1ZQ1 A;  2EJF A;  3O8V A;  2JTM A;  1WQ7 A;  4QVZ A;  4C92 D;  4E7J A;  2KAF A;  2OTL A;  3TCJ A;  1S72 T;  3EAE A;  4HLQ A;  3NTH A;  3BG9 A;  2IVW A;  2VGN A;  4M77 E;  5HY6 A;  2KVQ G;  1MHN A;  2RM4 A;  3LGL A;  4JDS A;  2P0P A;  4M78 E;  4XTW A;  5LJ3 f;  5GAN f;  4HCZ A;  3QZ9 B;  3VYG B;  4J5Y A;  4GLK A;  4M78 F;  4E7L A;  2DVE A;  5L8R E;  1W2B A;  3TRE A;  4OB1 B;  3UPU A;  3QYH B;  3P8H A;  3VYH B;  3X28 B;  2LRQ A;  4FU6 A;  3CCM T;  1KQ1 A;  5GAN 4;  5AYF A;  2RO0 A;  3OMC A;  5CIU A;  4M7D G;  1YJN T;  5CK9 A;  3JCM P;  4B9W A;  3PIO A;  4V2S A;  2QFZ A;  2RJF A;  3QPH A;  4ZGJ B;  3M58 A;  3OYM A;  3FB9 A;  2JVV A;  2OAU A;  2Y4X A;  1B34 B;  4LDV A;  3L2Q A;  3L2R A;  3QXE B;  4BDZ A;  1YJN A;  2R5M A;  1VQL A;  2D6F A;  4M78 G;  4M7A A;  5LJ3 e;  4X9C A;  2KY9 A;  1WJR A;  2E6N A;  2VV5 A;  4PNO A;  1BI3 A;  1VIF A;  1Q7Y U;  3VKI A;  1I4K 1;  3M59 A;  3RKX A;  2RA2 A;  5GAN 3;  2YLC A;  1RI0 A;  3NFC A;  4C0G A;  4EMK B;  1I5L A;  2FB7 A;  2E41 A;  1UGR B;  3DB3 A;  5GMK l;  4ZTF A;  1KQS S;  4LDX A;  3OB9 A;  2EQM A;  5EJC A;  1KQS A;  4DQ2 A;  2MI6 A;  1X01 A;  2QEX A;  2K2V A;  4M77 B;  1UGP B;  3RKW A;  3RUX A;  3SFM A;  3QSU A;  3JSC A;  3M9Q A;  5GAN 7;  1M5Q 1;  4MDW A;  4M75 E;  3OS2 A;  1W2B S;  4PJO G;  3NTK A;  2X4J A;  3OYY A;  2FL7 A;  2QXF A;  2PU9 B;  2MMP A;  5GAN h;  4JS5 A;  1M8V A;  5GAM h;  5A2Q E;  4J6Y A;  4IKF A;  3MET A;  2E65 A;  3CBO A;  3V7C A;  2DAQ A;  3MEV A;  3X26 B;  4MML A;  4QQG A;  2ZPE B;  4BE2 A;  3FEO A;  3URG A;  3RKY A;  5GAO r;  3A8G B;  3DL1 A;  3L1A A;  4M78 D;  1KHC A;  1Q82 U;  3BFM A;  4EMK C;  4NOY A;  3KUF A;  2QTX A;  3QJY A;  4OGC A;  3SWN C;  1EIF A;  3G6E T;  1K73 C;  2OTJ T;  1H3Z A;  3P8D A;  5LJ3 j;  4XU3 A;  2RHY A;  2I2L A;  2YHT A;  3BG5 A;  2BS3 A;  3A8H B;  2QI2 A;  4O5V A;  4RCB A;  3CCJ T;  2RI3 A;  3UWN A;  4DA4 A;  3V8L A;  1I8F A;  4HL4 A;  3JCM J;  1JB0 E;  3BDU A;  4X9D A;  3CCE T;  2JNG A;  3OYL A;  2XID A;  4M77 F;  2FHD A;  1KD1 U;  2F5K A;  1VQP T;  5LL6 S;  4N4I A;  3CPF A;  4M77 C;  4XK8 E;  5D6Y A;  1M9S A;  5GMK h;  3QII A;  2E5Q A;  1YJ9 A;  3RES A;  4AKI A;  3G7Z A;  4M7A G;  3HB9 A;  5HKC A;  4AI6 A;  3WVE B;  5GAO p;  1M1K U;  5HK3 A;  1M1G A;  2RB6 A;  2M0O A;  3X20 B;  3JCM h;  3OS5 A;  5D6W A;  1Y7X A;  3LW5 E;  3CCV T;  1E7P A;  4ZN1 A;  4PJO E;  3A8O B;  1VQ5 T;  3M55 A;  4PJO A;  1YJW A;  2X4Y A;  2XKO C;  3FIF A;  4XU0 A;  1WQW A;  2LNV A;  4MZT A;  3JB9 G;  3CMA T;  2CKK A;  2DTH A;  2DD5 B;  1Q7Y C;  4HCC A;  4JX5 A;  2RHX A;  1VQ4 T;  3TW6 A;  3I56 T;  2QA4 A;  3PGG A;  5CKD A;  3UT1 A;  4C0Z A;  1FKM A;  4N4G A;  3PNW C;  5CQY A;  4C8Q F;  4ELZ C;  4M78 B;  1S72 A;  4D6W A;  4ELY C;  3JCM g;  4OGE A;  1VQO T;  3JCM b;  2P4T A;  2QQS A;  3CCS T;  1KG1 A;  4BY6 B;  1M1K C;  4BDY A;  4A4K A;  4JRP A;  2EYQ A;  1K9M U;  3JCM W;  4HNU A;  4OB0 B;  4B9X A;  1DJ7 B;  3QDR B;  4NL2 A;  4XU2 A;  4C5G A;  2BS4 A;  1QLB A;  3H4C A;  1LOJ A;  2E64 A;  3CCR T;  1VQK A;  4BI3 A;  2LTO A;  3CD6 T;  1UGQ B;  1QVF A;  5KE2 A;  3VU3 C;  5FLX E;  5LJ5 j;  1G5V A;  4M77 D;  1VQK T;  5CKF A;  4PJO B;  4QQD A;  1P92 A;  3CBP A;  3M5A A;  3OQ5 A;  4M75 D;  3S6W A;  1G3Y A;  2KDS A;  3TW7 A;  4HKE A;  4J7F A;  2E6Z A;  3BW1 A;  2DPP B;  2LDM A;  5A0G A;  5CKB A;  3QG1 A;  4NL3 A;  3TEE A;  2HAX A;  3OYN A;  5I2S A;  2HD0 A;  2DD4 A;  4M7D A;  2LCC A;  2DXB B;  2DIG A;  4L5G A;  3A8L B;  1VQL T;  3JCM V;  1JBM A;  3OYE A;  4C5I A;  3QHS A;  1O75 A;  3JCM Q;  3G4S T;  2JUF A;  2B8A A;  3QZ5 B;  3LLR A;  3S3O A;  2V8K A;  1VQ7 A;  2DKG A;  3OYC A;  2X4W A;  4M75 B;  4J83 A;  3JCM e;  5GAN j;  4O6J A;  4HT8 A;  4F7U B;  2H3J A;  2BKD N;  3DKM A;  4EPC A;  3GIB A;  4KBM B;  4EMH A;  2QEX T;  4JX4 A;  3V8J A;  3LWI A;  4IUV A;  4M7A E;  3QBY A;  5GAM d;  1BIA A;  3V8K A;  4A4G A;  1NZ9 A;  3X25 B;  3VKH A;  2ZCF B;  1N9R A;  5KCH A;  1VQ8 A;  4A54 A;  1QVP A;  2HNI A;  3VV0 A;  3OS1 A;  4R55 A;  3GNF B;  4XTU A;  2FYK A;  2E10 A;  5GAN 2;  3WXM B;  4JRQ A;  1VQM A;  2DD4 B;  1O9S A;  3M54 A;  2RH2 A;  2K5F A;  3CEY A;  2OTJ A;  4C92 G;  3QKJ A;  3CC7 A;  1VQ9 A;  3M4Y A;  1KHI A;  5DLQ E;  3GOX A;  3CCQ T;  2EJG A;  1Q86 U;  4MDX A;  4VUB A;  3CCJ A;  4LD9 K;  4ZGD B;  2K3Y A;  3GP8 A;  1JRI A;  2MWP A;  2XDP A;  3I55 A;  3CCU T;  4GY5 A;  3CC7 T;  2L89 A;  4BD3 A;  2DIQ A;  3DB4 A;  3CCE A;  1YBY A;  2D9T A;  4N4H A;  1YIJ A;  5GAN 5;  2C06 A;  2Y4Y A;  4LDY A;  4M77 A;  1TH7 A;  5LJ5 g;  4XTY A;  5GMK m;  2DXC A;  3NTI A;  4P5N A;  4C0D B;  5FU7 B;  1YJ9 T;  4ZN3 A;  4ATO A;  1WGS A;  2XDB A;  2X35 A;  5FRN A;  2PVO B;  1QVG S;  1Q82 C;  1XNI A;  1G3T A;  2EAY A;  3HFN A;  3CXC S;  3P8B B;  5GMK i;  5LJ5 h;  1FXX A;  1YI2 T;  1QVG A;  4FL6 A;  2RHZ A;  2K57 A;  2QQA A;  3SDZ A;  3KHI A;  3LH0 A;  5CO7 A;  4QVD A;  1YI2 A;  1B34 A;  1VQ7 T;  4NC6 A;  4R56 A;  3PMI A;  1VIE A;  2DZC A;  2QQB A;  3BY7 A;  1OZ3 A;  3TU4 K;  4JJN K;  3DLM A;  4BBS M;  2KR6 A;  4AKG A;  3JRZ A;  2O4X A;  4LDW A;  2DD5 A;  3I56 A;  1M90 U;  1IZ6 A;  3MEA A;  3OSV A;  3QO3 A;  5GAO q;  3JB9 J;  4M7D B;  3C95 A;  2VYT A;  2JZ2 A;  4JUV A;  4BBR M;  1U8R A;  4XTX A;  5FRO A;  5A0L A;  4C8Q D;  3VYG A;  4PJO D;  5GAN d;  2EKO A;  3PMT A;  2G3R A;  3QWL A;  1BI0 A;  1N9S A;  3OYK A;  4L6V 5;  4C92 F;  2HBP A;  3OYH A;  1YIT A;  3CC2 A;  3S3N A;  3E1S A;  1GXI E;  3X24 B;  3ZEH A;  5GAO m;  4E7I A;  4UC4 A;  5J26 A;  1Q81 U;  1OYX A;  2DEQ A;  3V7S A;  2EQU A;  3DLL A;  2AHJ B;  3MCA B;  5KCO A;  3CCL T;  4LOC A;  2XG8 D;  3MP1 A;  4PL6 A;  1VQO A;  1KC8 C;  3HO8 A;  2EWN A;  3WVD B;  4E7K A;  3LGF A;  4C8Q E;  3CCL A;  3C94 A;  3MHX A;  3CCM A;  3CXC A;  3CME A;  3HP9 A;  1K73 U;  2LCL A;  4DOW A;  2GQV A;  4ZTJ A;  3ZBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...