2ZPHB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 340min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zphB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zphB02
1AHJB 3A8OB 3A8LB 3QZ5B 2PU9B 2PUKB 2CZ6B 1GXIE 2ZPGB 2WSEE 4OB3B 2PVOB 2CZ1B 2AHJB 3WVDB 1PSEA 2PVGB 2DD5A 2DXBB 3VYHB 1PSFA 1UGQB 2ZZDB 1QP3A 5L8RE 2O01E 1UGSB 3X28B 3VYGB 3QYGB 4Y28E 2ZPBB 3LW5E 1UGPB 1DJ7B 2CZ7B 2CYZB 1JB0E 4OB2B 2DXBA 2CZ0B 2ZZDA 3X24B 1IREB 2WSCE 3X20B 2ZPHB 1UGRB 2ZPFB 3A8MB 3VYGA 3WVEB 3QYHB 2D0QB 4FM4B 2DD4B 4RKUE 4OB0B 1QP2A 2DPPB 2QDYB 4ZGJB 3HHTB 2WSFE 2DXCB 2ZPIB 2PVDB 2ZCFB 3A8GB 4L6V5 4ZGEB 3X25B 3QZ9B 2DD4A 4XK8E 3A8HB 4KT0E 2DXCA 2DD5B 3QXEB 3X26B 2PUOB 4ZGDB 2ZPEB 1V29B 4OB1B
chains in the Genus database with same CATH superfamily
1N8RU 2DXTA 4KUDK 1WXTA 2O4XB 4E7IA 1MMDA 1KHCA 3THKA 3VS1A 1JJ2A 3IQLA 4CI0C 3CD6A 1RABB 1K73C 2AHJB 3WVDB 2CT4A 4M75B 5KYUB 1Q86C 2PVGB 2E1HA 5I2SA 2DXBB 3VYHB 1PSFA 4HVVA 2EW3A 2R58A 2V26A 3M0SA 2V8IA 1I0CA 1TG0A 1VYWB 1OV3A 5LJ3j 4PKCC 3M5AA 2G6FX 3MP1A 2RMOA 3RMQA 3OS1A 1M2VB 3LW5E 1U1SA 3VKGA 2QQRA 2CCHB 4VUBA 5GAN6 2CCIB 2DL8A 4PJOC 1W2BS 3OYJA 1NM7A 3L2WA 3PE0A 1N6AA 5HK3A 4EMKC 1M4ZA 1AISB 3OW2A 2IVWA 3EHQA 3X20B 2MCNA 4BY7X 2JT4A 1SEMA 2RHUA 3A98A 2RI3A 3QYHB 3M56A 2QEXA 2Y4XA 5KE3A 2BTTA 5FLXE 1FXXA 3BHTB 3V7SA 5FU6B 2EYQA 2O9VA 5LJ5d 1WHLA 1ACMB 3GLXA 4RG2A 4F6WB 1RAGB 4OP0A 2QFZA 1TUDA 3LLRA 3M4YA 4L5GA 4NC6A 5D6XA 4EOIB 2C0OA 2XMFA 1H28B 1WA7A 4F6SB 4LD6A 4E7SA 2KYBA 2LCLA 2OI3A 2K9GA 4M77A 4PNOA 3CXCP 1K9AA 1YHQA 4CC7A 3BLHB 1WJRA 5GAMh 3Q1JA 5IH2A 3CC7T 3BDLA 3KHIA 5FU7C 5J39A 1Q81R 4KH1B 2X3XD 2EYYA 4QQGA 2E6NA 3CCRT 4KRTA 2JM8A 4C92A 2KSSA 2R57A 2C6TB 2PU9B 2KXCA 5L23A 1JJ2S 1KC8R 2HEQA 2CZ1B 4TVRA 1GY3B 4DBRA 1YCYA 4EOKB 4HCZA 3VJPA 3QKJA 1VQMQ 3LH0A 3K7AM 3VUBA 4ANJA 3A1PA 2QA4Q 4LNPA 4OVAA 1U8RA 2WEVB 1VA7A 1TU0B 2QTXA 2LQWA 2RQUA 4BI4A 1I5LA 2RK2A 1G3WA 2VB6A 4UC4A 2O4XA 2IVXA 1KQSP 3QHRB 4M6VA 4A4HA 1JU5C 3CCQQ 3BW1A 2CP0A 2HNIA 3CC2Q 1Y07A 4M75A 4DOWA 4JS4A 5KYUA 1SSFA 1UTIA 2EQUA 2DIQA 1BBZA 2XI9A 2E70A 2DXBA 3H8ZA 1D0ZA 5GAN5 4EOMB 4O6JA 3HRTA 1Q82C 1OGUB 1BKBA 1F1BB 1TH7A 1ZBJA 1M2VA 2VYTA 5GAOl 1QCNA 2QDLA 4J83A 1EFNA 3I55Q 2M0YA 4BDYA 2B9RA 3TW6A 3HHTB 2K3YA 4B9WA 2I2LA 1M3BA 3CCET 3MJXA 4RTXA 1WNLA 4DBHA 3CCST 4CFUB 1WYXA 3DL1A 5GAN7 5IXFA 5BNJB 4EOSB 3X25B 3MO8A 1M2OA 2DTOA 4Z8AA 1PNJA 1W98B 2H3JA 1XTDA 2P4RA 5ICPB 1YITA 3CCMA 5GAOq 1BK2A 4JDSA 1UE9A 1Q7YU 3EIDB 1BU1A 2C5XB 3UDCA 2XDBA 1ZLMA 2F5KA 2RH2A 2YRCA 1V29B 4JLGA 4M77G 1QVGS 2NWMA 1VYVA 2P4TA 2JJ9A 3FRNA 2PVOB 5A0GA 4ATOA 2GBQA 2W96A 3JAME 4CC4B 4LDXA 2CP2A 1I07A 1IXDA 3L2QA 2RHZA 3CMET 2EQJA 2GTJA 4OMOA 3TSWA 5IHNA 1ZQ1A 2RQVA 4AG1C 4KULA 3G33B 2FL7A 5L8RE 3MIAB 2O01E 3JCMQ 3MP8A 1YI2T 5HVYB 4C92G 5GAN3 1VQNQ 5GAN8 1FWZA 2K7AA 3C95A 1D3BB 3HRSA 3I9QA 3JCMe 2KAFA 5IXBA 2COWA 2HZYA 3EGXB 3J7AF 2DAQA 4HCBA 2YLBA 4L59A 3QIIA 4IKFA 2KK4A 1M90R 2A36A 2KYMA 1Y96B 4JJCA 5GAMg 1GCQC 4PJNA 4F7UF 3CCJQ 2MWPA 1YJNQ 3DKMA 1MMAA 1WIEA 5ACBA 4KBMB 5IDNB 1VQOA 4BY6C 1HXDA 4C8QF 2I53A 4I3ZB 4M75G 3EH1A 4CC3A 3G4SQ 3DTOA 2DL3A 1QVPA 2MK5A 3VS6A 2KI7A 2CUDA 4RTTA 3TW7A 2W9ZA 4F6UB 4TTHA 1FMKA 3BDUA 2RPNA 1VQ4T 4BCOB 2ATCB 3V7RA 3CPWS 3DB3A 3TNWB 2K57A 3QZ9B 2LJ0A 1BI0A 4C92D 1HJDA 1IHWA 2J06A 1S72A 1M1KR 4KT0E 2WACA 1WHMA 1QMZB 1WPYA 1M90U 2CP7A 2GTOA 3JB9G 3L2UA 2QQSA 4GY5A 3DLMA 1LNXA 3EG2A 4JUVA 5LJ3d 5GAMf 4M7AD 2A08A 1NPPA 1R0BG 2O88A 4F16A 2J6FA 4M7DD 3QWXX 2DD5B 1UNLD 3BLQB 2LT1A 2NUPB 3OA6A 5CQYA 3PFSA 5L2WB 5HBJB 3KFVA 4QSHA 1KSWA 1M3CA 5GAOm 1YWPA 4JZ4A 4C92E 3H9NA 4E47A 4OMPA 2D8JA 2DEUA 4EMHA 3G6ET 3HBLA 5GAOr 1ZUUA 1QKXA 4M7AE 4M7DE 1Y0MA 2PHGA 2J6KA 1AOJA 4HCKA 2CKKA 4LDYA 2W10A 4JRPA 2COZA 1QWFA 4ROEA 2K2MA 2DZ9A 1MGQA 2HBWA 3OYCA 4LUDA 1I81A 3VYGB 4F7UE 1LPLA 2MAMA 2QG9B 5LJ3e 2IW9B 2HAXA 4C5HA 3CXCS 5HNBB 3CC4Q 3MY5B 5DY9A 4JLIA 4C0GA 3JB9D 3VS5A 2MWOA 2FZGB 2HCKA 4JJNK 1UDLA 2ZAEA 1YHQQ 5FWBA 1UGRB 4MZPA 2JS2A 4BACA 4FW2A 3CCUA 3GNGA 1D3BA 3JCMP 2YSQA 1K8AU 1VQ9A 3MEVA 1N5ZA 3QJ6A 5D6WA 4JJBA 4MMKA 3EGXA 5CKEA 2LCSA 2RD1A 3V8KA 4ZN1A 1ZUKA 5CYIB 1GCPA 3TVTA 2DXCB 1A0NB 1SRLA 1Y96A 1B3QA 1PKTA 3NMZC 1JRIA 1U5SA 3PGGA 3EGUA 1X6OA 3DB4A 3OSVA 4CFVB 3JCMJ 4BY1X 3TCJA 4JX5A 2VUBA 4BCND 1NPRA 4ZN3A 3VS3A 5EJCA 3GNFB 1JOWA 1E7OA 4JJDA 3JCMh 1TFBA 5FWCA 3QG1A 2M16A 1OZ3A 5KYYB 2H3EB 4II5B 1Q95G 2RI5A 1JO8A 1MNDA 3OBYA 1FMVA 1GXIE 1WZOA 3QUIA 4EONB 5GANj 1BU2A 1KD1R 4KGZB 1OIYB 4BCPB 1ENWA 2DO3A 2RB6A 3P8DA 5HQ0B 3FC3A 2DD5A 3M9QA 4IUTA 1N27A 2NUPA 4AMCA 2EGCA 2LX9A 4IIMA 2CH4W 1QP3A 3VS0A 4R0KA 1VQ8A 3X28B 5DLOA 2CP6A 4DA4A 1UHCA 3L2ZA 1NLPC 1X27A 2C06A 1ZA2B 2QF7A 3O8VA 1QVFP 2RHIA 4AI6A 1VQMT 4FT2A 3BHUB 3OW2P 2CYZB 1QW1A 2PZ1A 2QA4T 4FYVB 5CKDA 4HA8A 4X34A 2C0IA 1YITQ 4C0ZA 3CCMQ 3VYGA 2CDTA 2YUNA 4BDZA 2MOXA 1OI9B 3WVEB 2FRYA 1GFDA 3OYIA 3CCQT 4YOOA 1QKWA 2E41A 3CC2T 4PFOA 2EKHA 1K0XA 4FT4A 1VIFA 1B34B 2VASA 5J26A 2X4JA 4XQ3A 1G3TA 4Y92A 1W2BA 3CBPA 1FVVB 4A4KA 1YBYA 4CFUD 2IPOB 4EDUA 2LJ3A 4XU1A 2KDSA 2JMAA 2HMAA 4QKUA 3TN8B 1YWOA 3I55T 4GBQA 1NJIC 1ZBXA 3OYMA 1VQPA 1WHHA 1GBRA 1LCKA 1LVKA 1FYNA 3VUZA 3HZJA 2QQ8A 4XTZA 1HSQA 4M78G 1U1TA 2V1QA 4OF1A 2L2PA 2DXCA 2DVJA 3OSSC 3OYKA 2E4HA 3RGFB 3VKHA 1D0YA 1NLOC 3UATA 1XJWB 3VS2A 4BUGA 1RI0A 1P5EB 3DOGB 1KXUA 4Z6YA 1U3OA 3MKDA 2X4WA 4CFXB 2EVRA 2DETA 3LYIA 4RCCA 4M7AB 2UZLB 1ZSZB 1S1NA 3OBWA 2KRNA 4M7DB 2BZXA 1C1AA 1AWWA 2LW4A 5KYYA 1OKVB 3HSBA 5LMKB 1VQOQ 1QWEA 3QDFA 3NTIA 1KJWA 2L0AA 1H26B 1OU9A 3M4GA 4C0DB 4N0AA 3REAB 5FROA 4F7UB 2BS2A 2JUFA 1PCXA 5LL6S 4F7LB 3SDZA 1UNHD 4OGRB 2CZ7B 1M30A 1NG2A 1G2BA 4C8QB 9ATCB 1OKWB 4M78D 3URGA 2KRMA 3BG3A 1SHFA 1S72Q 1VQNT 1VOLA 1YP5A 3LGLA 4NS5A 3UF4A 2W99A 1UECA 3JCMg 1GRIA 4UN0A 3H0FA 2R7GA 2DRKA 1YIJA 3L42A 2X3WD 2HL5C 1H1RB 1UNGD 3UT1A 4M78E 4J9HA 2KMGA 3GIBA 4EPCA 2DNUA 4FU6A 1X43A 1AT1B 3A8GB 3CCJT 3PT9A 2AKLA 1YJNT 4F7NB 1AWXA 3CMAA 5DM7R 1AZEA 3OY9A 5IN1A 1QMCA 1PM3A 3CC7A 2AZVA 4LXCA 3E19A 1X6GA 1OX8A 3R6NA 4HNTA 3G4ST 2HD0A 1B34A 3CCRA 1K1ZA 2OTJA 1ZP2A 2DM1A 2KR6A 1Q81C 1K73R 1KG1A 1PG5B 5CCAA 4MZMA 5A0LA 2YDLA 3EG9B 3JCMf 2QAZA 3X26B 2DYBA 1NE8A 1UJYA 3QPHA 1AHJB 3U23A 1ZSGA 1KC8C 1ABOA 1SSHA 4BCNB 2WSEE 1R0CB 2M0OA 1YCSB 2K79A 2W9FA 1OULA 4J6XA 1VQ7A 2FZKB 3CCUQ 1D09B 2CH4A 1VQ9Q 2R5MA 1WQ7A 1G3NC 1NYGA 3V7CA 4NL2A 1UGVA 3C12A 5LJ5e 4XTXA 1K73U 2CSQA 2JM9A 4IURA 4ELJA 2O31A 2YLCA 1Q86U 1QVGA 3ZBDA 2X9HA 1UGPB 4XTWA 1VQ5A 4K11A 4M7AA 1TOVA 1ZSZA 4PJOF 3HP9A 3M0TA 4M7DA 2XIDA 1EIFA 2LDMA 3P8BB 1M27C 3C4SA 2AK5A 1OPLA 4M4ZA 1MMNA 2WSCE 5M9OA 2ZPFB 4RTYA 1GH6B 3GTMS 3RIRA 4BE1A 4B9XA 4F7UA 5GJWB 2DZCA 3E9FA 1PKDB 2EUFA 5CKHA 2J7IA 3CC4T 3CCSA 5GMKh 4KRCB 1UHFA 4RKUE 3OYBA 3PTAA 4N4IA 2KROA 2L3SA 4XU3A 4C8QA 1TS9A 1OOTA 2QQAA 1MUZA 1YHQT 2DLPA 2DKGA 2SRCA 5GANd 2DK3A 3QHSA 1Q7YR 1ZHIA 2EIFA 4M77C 1QLYA 4CFMB 1BCMA 1OU8A 5CQXA 3OYFA 2O2OA 3A8HB 2MI6A 4QQDA 1QVFS 1HYOA 2QGSA 3GBQA 4MDXA 2EGEA 4XTYA 1AD6A 4BE2A 3B57A 3TQ7P 5GAMj 1V76A 2UZBB 1I8FA 4J9CA 1NYFA 4RUGA 3A8LB 3SD4A 1XOVA 3CPWA 2ZGWA 2VC8A 1OI1A 1RUWA 1AD5A 5GANe 2CUBA 4EORB 4AFZC 1LOJA 2JGZB 3EG9A 2RM4A 1IO6A 1IGQA 5FRNA 1OEBA 5HK0A 4A4FA 3F70A 4OMFB 2C5NB 4JX4A 4OGCA 3D7SB 2MF2A 4MIMA 4M75C 2EPDA 1DJ7B 3S6WA 3RESA 4OB2B 2JTMA 5GAOp 3OYHA 2K4YA 2JW4A 3L2RA 1OQKA 2WJ9A 2K2VA 1H3HA 2L3PA 7AT1B 5GAN2 3NPFA 4M77F 4J9GA 4E7HA 3EOCB 2C4GB 3CBMA 3BLRB 2WMAB 4ESRA 4LUEA 4OMNA 2DPPB 1WX6A 1Y7XA 3CXCA 4M7AG 2DIGA 1YJ9A 2LZ6B 4M7DG 4J9IA 4YOZA 4M78B 1YITT 2FZCB 3CCMT 1Q82U 3A5ZB 2BIVA 5A0DA 3O5ZA 3EFRA 1YJWA 3R6OA 3DDPB 4AG2C 4F7UG 1X6BA 3OB9A 5FU6C 1M1KC 3SFMA 1BI2A 2HKQB 3PMTA 4CRIA 1FINB 3RKYA 4WCIA 2EBPA 2K5IA 3CCVA 1D3UB 5LJ5h 8AT1B 4BCMB 4C8QG 4IMYB 2P0QA 2WFYB 2QTVA 4IUPA 2BS3A 5KYNA 1G83A 3ZFJA 1CKAA 1AWJA 2QK0A 2LNVA 3BG5A 4MZTA 4J6YA 1I5OB 3CD6Q 2JTFA 3BFMA 1WJSA 1KQ2A 1VQKA 1KK7A 4M75F 3GPLA 4XTVA 4ELYC 2EAYA 2CP3A 2R5AA 1KQSA 3LH5A 3NDQA 1QCFA 3MY1B 2RK1A 3HFOA 2VKNA 3OS0A 2KT8A 3SWNB 2KE9A 3SHWA 2F5TX 1IHVA 3NTHA 4RTWA 3TU4K 2JZ2A 2X4YA 1TSFA 2EFIA 5IHKA 1YIJQ 2G3RA 5I22A 2DJQA 4JRQA 3CBOA 3NHNA 2LQ8A 3NGPA 1VQLA 1IGUA 3QYGB 2GQVA 4CC2A 3JB9F 1SPKA 1JQQA 3QWYA 4Z89A 5KH6A 3CMAQ 1Y57A 1VINA 3ASKA 1K8AR 3OYEA 3H0HA 4C8QD 1VYTA 1VQOT 4XAXB 2QEXQ 3F5XB 2LP5A 1T3LA 2FVUA 3H6ZA 3I56A 2OTJQ 5EG2A 4GLKA 1T0JA 3L2VA 2HL3A 1KIKA 3OYNA 4IUQA 2ENMA 2M9UA 3HRUA 3TREA 4C8QE 1PRLC 2QQBA 4E7ZA 1W4SA 2LX7A 2H8HA 1S72T 4J7FA 2ZPIB 4E6RA 1OL1B 5CVIA 5CK9A 4AFUC 1JSUB 2DFUA 4BXXX 4DBFA 2CJMB 1OPKA 4FX3B 1VQ7Q 5GMKi 4BCIB 2EJGA 2D8HA 3HPWA 4OMQA 2KXDA 2D0NA 2E64A 3KBGA 2DL7A 3S3NA 3MEUA 4BCQD 4M78A 2OAUA 2FYKA 3OS5A 2UZDB 1URCB 1K9MC 2YWWA 3OQ5A 1VQ5Q 1WQWA 1MV0B 5EC7A 1WDXA 1CKBA 1KD1C 1XQHA 3M03A 2BKZB 2ZPGB 3G71A 2BPMB 1KQSS 1ABQA 1AVZC 2IN3A 3JCMb 2RHXA 1WHGA 5I11A 2NUTB 2LQNA 3ULRB 4EC8B 4R55A 3GP8A 2MMPA 4Y91A 3T9NA 4PJOB 3VV0A 3I5RA 1W70A 2KT1A 4EOJB 3JCMX 2O9SA 2V8JA 3BG9A 4CXAB 3CCLA 2OTLA 4EMKB 1SKUB 4AFQC 1C0MA 2E5QA 1JJ2P 1RAFB 2M1HA 1GBQA 5CO7A 1UB4A 2FG0A 4C5EA 3CCUT 3NFCA 3SWNA 1VQ9T 4FSSA 3MCAB 2RJDA 2OJ2A 3HTRA 4BCKB 1H641 1IRXA 3INZA 2XD0A 5LJ5g 2GQIA 4DEXA 2HSPA 5CEIB 3LGFA 1H27B 4ZNXA 2CT3A 4FM4B 2BE7D 2DJZA 2YT6A 1JEGA 3HKSA 1NEBA 4HNVA 2AT1B 3UA6A 4OB0B 5HCKA 5GAMd 2QDYB 2E3HA 4PJLA 1TXQA 4BI8B 1VQ6A 4X9DA 4RCBA 1P92A 4LN2A 4J5YA 3QYEA 2JNGA 1H25B 5CKBA 5FU7B 4JX6A 3QYBA 1D1CA 2NLUA 2KQWA 2W0ZA 2JTEA 2JOYA 2OAWA 4LDWA 3M53A 3CPFA 4XK8E 4O5VA 1M3AA 2WMBB 3J80E 2EQMA 3ER0A 1N8RC 1H1SB 4MFEA 3PVQA 4J9FA 5GMKl 3PVLA 5LJ5f 3POMA 1KQ1A 2XKOC 2RHYA 1I4K1 1N9RA 2F1LA 5D6YA 1YN8A 1UUEA 4F04B 3MHXA 3JSCA 2EJ9A 1PD1A 2WXVB 2DE0X 1WHKA 4BI3A 4GLMA 2AKKA 4X1VA 3JCMc 3VS7A 2RF0A 2P0KA 4LOCA 5LJ3h 4DBQA 4BBRM 3V8JA 3BHVB 4EMGA 1JXOA 1YJ9Q 1Z9QA 5GANg 2GFAA 1RI9A 4HVWA 3PIOA 2L5QA 2RQTA 1I1JA 2K5FA 1TUGB 2NUTA 1YJWQ 2A7YA 4FW1A 3SEMA 4PJOA 2RA2A 2DTHA 5AT1B 2IW6B 2ZPHB 2GFUA 4EMKA 2F2XA 4C5IA 3CCVQ 1YFNA 4AFSC 1WGSA 2DYIA 2L3RA 1K0SA 1BIBA 2Z0WA 1E9HB 2CS7A 1D1AA 4EOQB 2DA9A 1B07A 4LDUA 4II1A 1G8XA 2K3XA 4FSXA 2E6ZA 5FRMA 1VUBA 2P84A 2LJ1A 4PK4A 3HO8A 4FYYB 4E2FB 1VQKQ 2EYXA 4JPBW 2QASA 5FGKB 2XK0A 4FYXB 2ROTA 4EOLB 2RQWA 2X4XA 4QQ6A 4J6WA 4OMMA 4AKIA 2HQHA 1C6VX 2DXUA 2EYZA 2XU8A 5IAYA 1EX4A 2EJFA 3RUXA 4BCMD 4AKHA 1VQLQ 4ELZC 4PJMA 3C0CA 3QJYA 5D7UA 3QXEB 4RTUA 1TUCA 3CPWP 1NJIU 1X75C 5HBEB 2LT4A 3A8OB 4LE9A 4HLQA 1H1PB 4A4EA 2P0PA 3EFOB 3RDVA 3PIPA 1SG5A 3JB9J 1WLPB 2KMTA 2OX7A 1OZ2A 3I56Q 4KGXB 2F2CA 4BCQB 1QVFA 1PSEA 1ARKA 4CRLB 3HL8A 1VOMA 4OMLA 4A4GA 5I21A 1Q86R 4E7JA 1UGQB 2ZZDB 3M54A 3CD6T 2DEQA 4N0AC 3JV3A 1PWTA 2HSEB 4HVUA 1M5Q1 4LD9K 4Y28E 3OMCA 5GMKm 4WTOB 1UJ0A 4ELLA 2AIRB 3JRZA 2A37A 2KGTA 5A2QE 3ZEHA 2WIPB 4DOVA 1E7PA 4BY6B 4KH0B 2DILA 4FL6A 1YIJT 2RJEA 1X2KA 1BI1A 3CC4A 3RKXA 3TEEA 1SHGA 4OR5B 5CR2A 4BD3A 3P8HA 2WPAB 3I5SA 2BS4A 1B7TA 2L89A 3JCMV 2M51A 1AEYA 3G1JA 2RN8A 2ROLA 1NZ9A 3CMAT 3FIFA 2EQIA 3EG1A 2QEXT 1H3ZA 1H92A 4PJOG 1OYXA 5LQFB 4ZTFA 1Q7YC 2X51A 3FJ5A 2OTJT 2LQKA 3G71Q 6AT1B 2YUPA 1VYUA 2RJCA 2B8AA 4KUIA 3EJ1B 4PFZA 1GFCA 1NEGA 1UG1A 5LJ3g 4HT9A 1G3SA 4F7SB 3CCEA 2E12A 3I35A 2FB7A 1MV3A 2JVVA 8ATCB 1BCOA 2YXYA 4IIOA 5IDPB 3UWNA 3CCLQ 2KEAA 2J6OA 2OTLQ 3GOXA 4F17A 2XHCA 3MEAA 2HKNA 2WIHB 3EGDB 2D6FA 2K6DA 4RODA 2W2HA 4QW2A 1VQ7T 2GCXA 4ZGDB 3FJPA 1G5VA 1O9SA 1N9SA 3MI9B 4BCFB 3QBYA 4FCYA 1H1QB 2V22B 4EOOB 1IZ6A 2PUKB 3FEOA 1Q81U 2DL5A 2I0NA 2L8DA 1TWBA 3META 5HKCA 2J05A 1VQ8Q 3OW2S 1HD3A 2RQRA 1VQ5T 5LJ3f 5C0MA 2ESWA 4FIBA 3TNIB 3RR6A 4PJOD 3AT1B 2A0FB 4FYWB 3VU3C 4PLIA 1KC8U 4C92C 1BYMA 2DL4A 2V8KA 4OGEA 4PFPA 5AYFA 1RAAB 4AT1B 3OYAA 1O75A 5KCHA 3TSZA 1VQ6Q 1MHNA 5HY6A 2BZYA 3EFOA 4N4HA 3CMEA 1K76A 1W6XA 3E9GA 2ZPBB 4M7AC 1T3SA 4YOSA 1ZSZC 4M7DC 1SF9A 2MYSA 2DVEA 1YI2A 3M0RA 3CEYA 2CZ0B 2ZZDA 4PJOE 1XO2A 2ED1A 4E7KA 4QVCA 4C0DC 5J3BA 2DERA 3OMGA 3OYGA 1GCQA 4QT7A 3MPUB 1Q82R 4C0FA 2E5KA 2XDPA 3RMSA 3RBBB 4KGVB 3M0UA 4C8QC 2ECZA 3FLGA 5CIUA 1RACB 3EAEA 4HKEA 4R56A 2JMCA 4A63B 5DLQE 1T0HA 2FEIA 2UZEB 2VVKA 1VIEA 1FMWA 3JCMd 2KR3A 4F7JB 2FPFA 1RL2A 2KRSA 2X35A 5GMKj 1M90C 1WJQA 2LVMA 5CAIA 1AZGB 1LJOA 4CFNB 4B6MA 2YHTA 1VQPQ 2VGNA 4JZ3A 4XU2A 3LWIA 3VRYA 2WHBB 3AHUA 2FPDA 2PNIA 4QVDA 3DLLA 1Y71A 1RAEB 2RO0A 3M0PA 2D9TA 3H4CA 2QDJA 1RLQC 2COYA 4BCHB 1GL5A 2JS0A 5KYWB 3M59A 2NUZA 1VQ4A 1M8VA 2E10A 2YUOA 4A54A 2XG8D 4C92F 1V1CA 2I40B 4BBSM 4ORZA 1D0XA 4JRIA 1H4LD 3FB9A 4AKGA 4M7AF 4OB3B 1X01A 4M7DF 4EC9B 2A3LA 2MPXC 3V8LA 2LMJA 3EGDA 3EHRA 1QQJA 3PNWC 1GUXB 2IG0A 2IIMA 2LRQA 3G6EA 5GJVB 2BZ8A 2B86A 3EG3A 3EG0A 3S3OA 3UA7A 2JN0A 2GF7A 4RG8A 2C5VB 2BE9B 4M77D 1W1FA 2KNBB 3PO3S 4J9DA 4Q5WA 3ZL7C 1K8AC 4EOPB 1WXBA 4PLLA 2KBTA 1U06A 2CREA 2E3IA 3L1AA 2V1RA 2LCCA 3X24B 1PKSA 4CFWB 1YJ9T 4RTVA 3E1SA 1PHTA 1ZX6A 2CSIA 1RAHB 1K4US 4M77E 2DTIA 1EZZB 2DD4B 1IB8A 1KFZA 1CSKA 3UPUA 1YJWT 3VRZA 2UUEB 2GGRA 3JCMW 3QDRB 1JSTB 3REBB 3QSUA 2WSFE 2Y90A 3CC7Q 4P5NA 1E6HA 3CCVT 4KRDB 2EGAA 2HBPA 1FKMA 2QXFA 3CCRQ 1J3TA 4EIKA 1G3YA 5KE2A 2EYWA 1H8KA 1QLBA 2A28A 4N4GA 4D6WA 2CP5A 4A53A 1PC0A 1BIAA 1W2BP 3LX7A 1FX7A 2QGGA 1R8OB 1O9KB 4XTUA 4M75D 4Y72B 4HNUA 1RLPC 1VQKT 2C0TA 5I5ZB 3KUFA 5FW9A 5GANh 3S3MA 1M1KU 1F5QB 5LJ5j 2DX1A 1RADB 2FRWA 3H0IA 2VXFA 1M1FA 2DRMA 2F2VA 4E7LA 2QQ9A 5HBHB 3E2UA 5I2MA 2ED0A 4M75E 2VXEA 1VQLT 3M55A 3HB9A 5IHIA 5KYWA 4YC3B 2E65A 2HQXA 2L3QA 2G9XB 1SRMA 1WI7A 2GNCA 1ZUYA 3VS4A 1YNZA 1M9SA 4JRKA 4V2SA 4ZTJA 1WXUA 4RMOA 4F70B 3I56T 2DMEA 3J81E 5DQVA 1H24B 1M8MA 1JBMA 3VKIA 1OIUB 1JB0E 1BI3A 2EQKA 1GUXA 4F14A 4NL3A 1Z9ZA 2K3BA 3M58A 2VWFA 3CCEQ 1IREB 3CCSQ 3PMIA 4Z88A 2JXBA 4G6LB 2DMOA 1WFWA 1VQMA 2FHDA 1R77A 1JXMA 1PD0A 1MMGA 1D1BA 3EH2A 3RKWA 2QA4A 4DQ2A 2CGHA 2QGFB 2K5LA 1QP2A 2PQWA 4ZGJB 3JB9H 4NOYA 1ZA1B 5C6SA 3KXTA 2F69A 4BE0A 2HQEA 3BE3A 3CCQA 3QHWB 3G7ZA 4D8KA 3CC2A 2BUDA 2ABLA 4L6V5 1K9MR 5IT9E 4ROCA 5KYXB 1AWOA 3DJBA 5ECAA 5GAOn 2HDAA 4J8OA 2X1NB 1XNIA 2DD4A 1UFFA 3GF5A 2AZSA 2PTKA 2FO0A 4M78C 2F2WA 2KVQG 4X9CA 3RNJA 2VGMA 3G71T 3CMEQ 1TTHB 2LNHB 2XDDA 3I55A 3NTKA 1OX9A 2Y4YA 4BCJB 2DF6A 4OB1B 1QCOA 1OL2B 1YI2Q 3QZ5B 1TD6A 2PMIB 2CZ6B 1KHIA 2YUQA 4BCGB 3WXMB 3CCLT 4XU0A 2M02A 2OTLT 3M57A 3QO3A 1N4MA 4HT8A 1O9KA 1WHJA 4MFDA 4JS5A 1K9MU 2IW8B 4DEYA 2RI2A 3OS2A 2FPEA 3OYYA 5GAN4 2LC4A 4MMLA 1KD1U 2RNAA 3BY7A 3DDQB 3FDRA 3MP6A 3O0GD 1UGSB 2YRVA 4YTLA 5GAMe 1C9BA 3RERA 2SEMA 2C5OB 4IUUA 4WF2A 4PL6A 3SWNC 1NBEB 2PK9B 1VQ8T 2QYZA 2EWNA 3OYLA 2DBMA 3M0QA 3LQ5B 1JKWA 5DQWA 3LWHA 1MNEA 2MIOA 2PK2A 4MDWA 5CKFA 3QWLA 1VQ6T 1E6GA 3A8MB 4C5GA 1M1GA 2XICA 4BB7A 1RAIB 4HXJA 1QVGP 2D0QB 3CQTA 4J9BA 3SB2A 3JB9I 1VQ4Q 4M77B 4RTZA 2DBKA 2G77A 5IHYA 4Z02A 4M78F 4HL4A 1PRMC 1VQNA 1N8RR 5KCOA 1X2QA 2RJFA 4LDVA 1X69A 2EKOA 4IUVA 1BB9A 2PVDB 2ZCFB 5GMKe 2NYSA 4QVZA 4HCCA 3EFSA 2KY9A 4ZGEB 5EFQB 5IF1B 4C92B 4ME7A 2D1XA 1NJIR 4J7IA 3G6EQ 2BKDN 3TNHB 3CCJA 3ME9A 3HFNA 1YJNA 2YRDA 2VV5A 1VQPT 3H41A 2LTOA 4PJJA 1HK9A 2QI2A 2PUOB 3OYDA 4J9EA 3G4SA 5KYXA 3MEWA 5GANf 2ZPEB 3N5BB 3C94A 4NSTB 1UEBA 4D8DA 2PJQA
chains in the Genus database with same CATH topology
1N8RU 2JTFA 3BFMA 2DXTA 4KUDK 3QBYA 1WJSA 1IZ6A 1Q81U 2PUKB 3OBYA 1KQ2A 2O4XB 3FEOA 4E7IA 1GXIE 3QUIA 1KHCA 4M75F 5GANj 1VQKA 3GPLA 4XTVA 2L8DA 1JJ2A 4ELYC 2EAYA 4CI0C 1KQSA 2R5AA 3META 3CD6A 5HKCA 1K73C 2AHJB 2RK1A 3HFOA 2DO3A 3WVDB 4M75B 2RB6A 3P8DA 3OS0A 1Q86C 3SWNB 2PVGB 2E1HA 3FC3A 2F5TX 2DD5A 3M9QA 5I2SA 2DXBB 3VYHB 1N27A 1PSFA 3NTHA 4IUTA 3OW2S 2LX9A 3TU4K 2JZ2A 2X4YA 5LJ3f 5C0MA 1QP3A 4FIBA 1VQ5T 2EFIA 4PJOD 2G3RA 3VU3C 2R58A 1KC8U 4PLIA 1BYMA 4C92C 2V8IA 4JRQA 2V8KA 4OGEA 3CBOA 5AYFA 2LQ8A 3OYAA 1O75A 3X28B 5KCHA 1VQ8A 5DLOA 1VQLA 1MHNA 5HY6A 3QYGB 5LJ3j 4PKCC 4N4HA 3CMEA 4DA4A 3M5AA 3L2ZA 2GQVA 3MP1A 3RMQA 3OS1A 2C06A 3JB9F 3E9GA 2QF7A 3O8VA 2ZPBB 3LW5E 4M7AC 1U1SA 2RHIA 3VKGA 2QQRA 4AI6A 1VQMT 4FT2A 4M7DC 4VUBA 5KH6A 5GAN6 2CYZB 1W2BS 1QW1A 3OYJA 3L2WA 4PJOC 3ASKA 2DVEA 2QA4T 1YI2A 3OYEA 3CEYA 2CZ0B 4C8QD 2ZZDA 5CKDA 1VQOT 4PJOE 1N6AA 4XAXB 5HK3A 4HA8A 4X34A 4EMKC 1M4ZA 3OW2A 4E7KA 2IVWA 4QVCA 4C0DC 3X20B 2FVUA 3H6ZA 4C0ZA 3I56A 5J3BA 3VYGA 3OMGA 3OYGA 4BDZA 3WVEB 2RHUA 3M56A 5EG2A 2RI3A 3QYHB 4GLKA 3OYIA 2QEXA 2Y4XA 3CCQT 3L2VA 5KE3A 4C0FA 2E41A 5FLXE 1FXXA 3OYNA 2XDPA 4IUQA 3RMSA 3CC2T 3V7SA 5FU6B 2EYQA 4C8QC 2M9UA 3FLGA 5LJ5d 5CIUA 4FT4A 1VIFA 4R56A 1B34B 3EAEA 3HRUA 4HKEA 3TREA 5DLQE 4C8QE 1VIEA 3JCMd 2QQBA 1W4SA 3GLXA 2X4JA 4RG2A 4XQ3A 1G3TA 4OP0A 5J26A 2QFZA 1RL2A 2X35A 4J7FA 5GMKj 1S72T 1W2BA 2ZPIB 1WJQA 2LVMA 3CBPA 3LLRA 3M4YA 4L5GA 5CVIA 4A4KA 1YBYA 4NC6A 1LJOA 5CAIA 5CK9A 4EDUA 2YHTA 5D6XA 4XU1A 2VGNA 2KDSA 4XU2A 3LWIA 4LD6A 3AHUA 2LCLA 4QVDA 3I55T 4M77A 3DLLA 5GMKi 4PNOA 1NJIC 1Y71A 1ZBXA 3OYMA 1VQPA 2EJGA 2RO0A 3HPWA 1YHQA 3VUZA 2D9TA 3H4CA 3HZJA 2QQ8A 2QDJA 1WJRA 2E64A 4XTZA 3Q1JA 5GAMh 3KBGA 4M78G 1U1TA 4OF1A 3CC7T 3S3NA 3BDLA 3MEUA 4M78A 3KHIA 2OAUA 5FU7C 5J39A 2DXCA 3M59A 2FYKA 1VQ4A 3OS5A 3OSSC 1M8VA 2E10A 4QQGA 3OYKA 4A54A 2XG8D 3VKHA 2E6NA 3CCRT 1K9MC 4C92F 3OQ5A 4BUGA 1RI0A 4BBSM 1WQWA 4C92A 2KSSA 4JRIA 2R57A 1KD1C 1XQHA 4Z6YA 3FB9A 2PU9B 4AKGA 2ZPGB 3G71A 1JJ2S 4M7AF 2X4WA 4OB3B 1KQSS 1X01A 4M7DF 2A3LA 2CZ1B 3JCMb 4TVRA 3V8LA 2RHXA 3LYIA 4RCCA 1YCYA 4HCZA 4M7AB 3VJPA 3QKJA 3LH0A 3OBWA 4R55A 3VUBA 2MMPA 3PNWC 3GP8A 4M7DB 2IG0A 4Y91A 3T9NA 4PJOB 3VV0A 3JCMX 3HSBA 2V8JA 2LRQA 3BG9A 4OVAA 3G6EA 1U8RA 3CCLA 2QTXA 3NTIA 2OTLA 4BI4A 4EMKB 3M4GA 1I5LA 2RK2A 4C0DB 1G3WA 3S3OA 2JN0A 2E5QA 4UC4A 2O4XA 4N0AA 5FROA 2GF7A 4RG8A 4M6VA 2M1HA 4F7UB 2BS2A 4A4HA 2JUFA 5CO7A 1UB4A 4M77D 5LL6S 3BW1A 3SDZA 2HNIA 4C5EA 1Y07A 4Q5WA 4M75A 3CCUT 1K8AC 4DOWA 4JS4A 2CZ7B 3NFCA 1SSFA 4PLLA 3SWNA 2EQUA 1VQ9T 2DIQA 3CPWA 4C8QB 2XI9A 3MCAB 2E70A 2DXBA 2RJDA 3L1AA 2LCCA 3H8ZA 4M78D 3X24B 5GAN5 3URGA 3BG3A 1H641 3INZA 4O6JA 1VQNT 2XD0A 3LGLA 5LJ5g 4NS5A 1YJ9T 3HRTA 1Q82C 3E1SA 3JCMg 1BKBA 3LGFA 1TH7A 2DTIA 4M77E 4FM4B 2DJZA 2VYTA 5GAOl 3HKSA 4J83A 2DD4B 4HNVA 1YIJA 3L42A 3UPUA 4OB0B 1YJWT 4BDYA 5GAMd 2QDYB 3TW6A 3HHTB 2K3YA 4B9WA 4BI8B 3UT1A 1VQ6A 2I2LA 4M78E 3JCMW 4X9DA 2KMGA 3QDRB 3CCET 4RCBA 3GIBA 1WNLA 3CCST 2WSFE 4EPCA 3QSUA 2Y90A 1P92A 4FU6A 4P5NA 4J5YA 3DL1A 3QYEA 2JNGA 5GAN7 3CCVT 5CKBA 5FU7B 3A8GB 3CCJT 4JX6A 3QYBA 2NLUA 3PT9A 2KQWA 2HBPA 1FKMA 2QXFA 1YJNT 3X25B 2JOYA 3MO8A 2DTOA 5DM7R 3CMAA 1G3YA 5KE2A 3OY9A 4LDWA 1QLBA 5IN1A 3CC7A 4N4GA 3M53A 3CPFA 2H3JA 1XTDA 4XK8E 4O5VA 3E19A 4D6WA 3J80E 3G4ST 2EQMA 4HNTA 1YITA 2HD0A 3ER0A 1B34A 4A53A 3CCRA 5GAOq 3CCMA 1N8RC 4JDSA 2OTJA 1BIAA 1Q7YU 3LX7A 2KR6A 4MFEA 1FX7A 1Q81C 1R8OB 5GMKl 4XTUA 4M75D 5LJ5f 1KG1A 4HNUA 1VQKT 1KQ1A 5CCAA 4MZMA 5A0LA 2XKOC 3JCMf 2RHYA 3UDCA 3KUFA 2XDBA 3X26B 5GANh 1I4K1 3S3MA 1M1KU 1N9RA 2F5KA 5LJ5j 2RH2A 1NE8A 5D6YA 3QPHA 1V29B 2VXFA 1M1FA 1AHJB 3MHXA 3JSCA 4JLGA 4M77G 1QVGS 1KC8C 2EJ9A 2P4TA 4E7LA 2QQ9A 4BI3A 2WSEE 3FRNA 2PVOB 5A0GA 5I2MA 4ATOA 3JCMc 4M75E 2VXEA 2M0OA 3JAME 1VQLT 4LDXA 3M55A 3HB9A 2P0KA 3L2QA 2RHZA 3CMET 2EQJA 4J6XA 2E65A 1VQ7A 2HQXA 4LOCA 5LJ3h 2R5MA 1WQ7A 1ZQ1A 4KULA 2FL7A 3V7CA 4NL2A 5L8RE 4BBRM 1M9SA 2O01E 4JRKA 3C12A 3V8JA 3JCMQ 3MP8A 1YI2T 4ZTJA 4C92G 5GAN3 4V2SA 4EMGA 5LJ5e 5GAN8 4XTXA 1FWZA 4RMOA 3C95A 1K73U 1D3BB 4IURA 5GANg 4ELJA 2GFAA 3HRSA 2YLCA 2KAFA 2L5QA 3JCMe 3ZBDA 3J81E 3PIOA 3I56T 1Q86U 1QVGA 2K5FA 1UGPB 4XTWA 1VQ5A 1JBMA 4M7AA 3VKIA 2A7YA 1JB0E 3HP9A 1BI3A 4PJOF 3J7AF 2EQKA 4M7DA 2DAQA 4HCBA 2YLBA 4NL3A 2XIDA 2RA2A 3QIIA 2DTHA 4L59A 1EIFA 4PJOA 4IKFA 3M58A 2LDMA 3P8BB 2KK4A 3C4SA 1IREB 2WSCE 2ZPHB 1Y96B 3PMIA 5M9OA 5GAMg 2GFUA 4EMKA 2ZPFB 4C5IA 4F7UF 1WGSA 3RIRA 1VQMA 2L3RA 2FHDA 4BE1A 2MWPA 4B9XA 4F7UA 2DZCA 3DKMA 3E9FA 5CKHA 3CCSA 1BIBA 4KBMB 3RKWA 5GMKh 3CC4T 2QA4A 4DQ2A 2CGHA 2CS7A 2K5LA 4RKUE 1QP2A 4BY6C 3OYBA 1HXDA 2PQWA 4C8QF 4N4IA 3PTAA 4ZGJB 4M75G 4LDUA 3JB9H 4II1A 2K3XA 4XU3A 4NOYA 4C8QA 5C6SA 3KXTA 2F69A 4FSXA 2QQAA 2E6ZA 5FRMA 1QVPA 1VUBA 4BE0A 1YHQT 2HQEA 1M90C 3HO8A 2DKGA 5GANd 3CCQA 2DK3A 3G7ZA 3QHSA 3TW7A 3CC2A 2BUDA 4L6V5 1ZHIA 2XK0A 2EIFA 5IT9E 3BDUA 4M77C 1VQ4T 3V7RA 3CPWS 3DB3A 5CQXA 5GAOn 2K57A 4J8OA 3OYFA 3QZ9B 1XNIA 2DD4A 1BI0A 2X4XA 4J6WA 4QQ6A 4C92D 4AKIA 3A8HB 1S72A 2MI6A 2DXUA 4KT0E 2WACA 3GF5A 1WPYA 4QQDA 1M90U 2XU8A 4M78C 1QVFS 3JB9G 3L2UA 2QQSA 5IAYA 4GY5A 3DLMA 1LNXA 2KVQG 4X9CA 2EJFA 4JUVA 4AKHA 3RUXA 5LJ3d 4ELZC 2VGMA 5GAMf 4M7AD 3G71T 4MDXA 1NPPA 1VQOA 4XTYA 4M7DD 3QJYA 2XDDA 2DD5B 3I55A 4BE2A 3QXEB 2LT1A 3OA6A 5CQYA 3NTKA 3PFSA 2Y4YA 5GAMj 1NJIU 1X75C 4QSHA 2LT4A 5GAOm 1I8FA 4C92E 4OB1B 4E47A 3A8OB 3A8LB 4HLQA 3SD4A 4A4EA 3QZ5B 1XOVA 2P0PA 4EMHA 2CZ6B 2ZGWA 2VC8A 1KHIA 3PIPA 3G6ET 3JB9J 3WXMB 1OI1A 4XU0A 3CCLT 2KMTA 3HBLA 2OTLT 3M57A 3QO3A 1OZ2A 5GANe 5GAOr 4M7AE 4HT8A 4MFDA 4JS5A 1K9MU 4M7DE 1QVFA 1PSEA 2RI2A 3OS2A 3HL8A 1LOJA 4A4GA 2RM4A 5I21A 2CKKA 4LDYA 3OYYA 4E7JA 1UGQB 2ZZDB 3M54A 5GAN4 4JRPA 2LC4A 4MMLA 1KD1U 5FRNA 3CD6T 3BY7A 5HK0A 2DZ9A 2DEQA 1MGQA 3FDRA 3F70A 3MP6A 4A4FA 3OYCA 1UGSB 4N0AC 4OMFB 1I81A 2YRVA 3VYGB 4YTLA 4F7UE 5GAMe 4JX4A 2MAMA 4OGCA 1M5Q1 3RERA 4LD9K 2MF2A 4MIMA 5LJ3e 4IUUA 4WF2A 2HAXA 4Y28E 4M75C 4C5HA 3OMCA 5GMKm 3CXCS 4PL6A 1DJ7B 3SWNC 3S6WA 3JRZA 1VQ8T 5A2QE 3ZEHA 4DOVA 3RESA 1E7PA 4BY6B 4OB2B 2EWNA 2JTMA 5DY9A 2K4YA 4JLIA 4C0GA 5GAOp 3OYLA 3OYHA 3L2RA 3JB9D 4FL6A 1YIJT 3LWHA 2K2VA 2WJ9A 2MWOA 2RJEA 4JJNK 1BI1A 4MDWA 5CKFA 3CC4A 3RKXA 3TEEA 3QWLA 5CR2A 4BD3A 1UGRB 5GAN2 1VQ6T 3A8MB 3P8HA 4C5GA 4MZPA 4M77F 2BS4A 1M1GA 2XICA 2L89A 3JCMV 4BB7A 4BACA 4E7HA 3CCUA 3GNGA 1D3BA 2D0QB 3JCMP 1K8AU 1VQ9A 3CBMA 3MEVA 3SB2A 3JB9I 4M77B 3QJ6A 1NZ9A 2G77A 3CMAT 4Z02A 2DPPB 4M78F 5D6WA 4HL4A 4MMKA 3FIFA 5CKEA 1VQNA 1Y7XA 3CXCA 4M7AG 2RD1A 5KCOA 2DIGA 2RJFA 3V8KA 4ZN1A 4LDVA 2QEXT 1YJ9A 4M7DG 1H3ZA 2EKOA 4IUVA 4M78B 4PJOG 1OYXA 1YITT 2DXCB 4ZTFA 3CCMT 1Q7YC 1Q82U 2PVDB 2OTJT 2ZCFB 1Y96A 2LQKA 3A5ZB 5GMKe 4QVZA 2BIVA 5A0DA 4HCCA 3EFSA 2RJCA 2KY9A 2B8AA 1JRIA 3EFRA 4ZGEB 3PGGA 4KUIA 1YJWA 3R6OA 1X6OA 3DB4A 5LJ3g 4C92B 3OSVA 4F7UG 3OB9A 5FU6C 1M1KC 3JCMJ 4HT9A 1G3SA 3SFMA 1BI2A 3TCJA 3PMTA 4JX5A 4ME7A 3CCEA 2E12A 2VUBA 4CRIA 1NPRA 2FB7A 2JVVA 4J7IA 3RKYA 4ZN3A 3CCVA 2K5IA 2BKDN 3UWNA 3CCJA 5LJ5h 3ME9A 4C8QG 3HFNA 3GOXA 2P0QA 5EJCA 2XHCA 3GNFB 3MEAA 1YJNA 2VV5A 4IUPA 2BS3A 3JCMh 1VQPT 2LTOA 1HK9A 3QG1A 2QI2A 3ZFJA 2D6FA 2PUOB 2M16A 1OZ3A 3OYDA 2LNVA 3BG5A 4MZTA 4J6YA 4QW2A 3G4SA 1VQ7T 2GCXA 4ZGDB 3FJPA 3MEWA 2ZPEB 1O9SA 1N9SA 3C94A 3N5BB 5GANf 1G5VA 1UEBA 2RI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHJ B;  3A8O B;  3A8L B;  3QZ5 B;  2PU9 B;  2PUK B;  2CZ6 B;  1GXI E;  2ZPG B;  2WSE E;  4OB3 B;  2PVO B;  2CZ1 B;  2AHJ B;  3WVD B;  1PSE A;  2PVG B;  2DD5 A;  2DXB B;  3VYH B;  1PSF A;  1UGQ B;  2ZZD B;  1QP3 A;  5L8R E;  2O01 E;  1UGS B;  3X28 B;  3VYG B;  3QYG B;  4Y28 E;  2ZPB B;  3LW5 E;  1UGP B;  1DJ7 B;  2CZ7 B;  2CYZ B;  1JB0 E;  4OB2 B;  2DXB A;  2CZ0 B;  2ZZD A;  3X24 B;  1IRE B;  2WSC E;  3X20 B;  2ZPH B;  1UGR B;  2ZPF B;  3A8M B;  3VYG A;  3WVE B;  3QYH B;  2D0Q B;  4FM4 B;  2DD4 B;  4RKU E;  4OB0 B;  1QP2 A;  2DPP B;  2QDY B;  4ZGJ B;  3HHT B;  2WSF E;  2DXC B;  2ZPI B;  2PVD B;  2ZCF B;  3A8G B;  4L6V 5;  4ZGE B;  3X25 B;  3QZ9 B;  2DD4 A;  4XK8 E;  3A8H B;  4KT0 E;  2DXC A;  2DD5 B;  3QXE B;  3X26 B;  2PUO B;  4ZGD B;  2ZPE B;  1V29 B;  4OB1 B; 
#chains in the Genus database with same CATH topology
 1N8R U;  2DXT A;  4KUD K;  1WXT A;  2O4X B;  4E7I A;  1MMD A;  1KHC A;  3THK A;  3VS1 A;  1JJ2 A;  3IQL A;  4CI0 C;  3CD6 A;  1RAB B;  1K73 C;  2AHJ B;  3WVD B;  2CT4 A;  4M75 B;  5KYU B;  1Q86 C;  2PVG B;  2E1H A;  5I2S A;  2DXB B;  3VYH B;  1PSF A;  4HVV A;  2EW3 A;  2R58 A;  2V26 A;  3M0S A;  2V8I A;  1I0C A;  1TG0 A;  1VYW B;  1OV3 A;  5LJ3 j;  4PKC C;  3M5A A;  2G6F X;  3MP1 A;  2RMO A;  3RMQ A;  3OS1 A;  1M2V B;  3LW5 E;  1U1S A;  3VKG A;  2QQR A;  2CCH B;  4VUB A;  5GAN 6;  2CCI B;  2DL8 A;  4PJO C;  1W2B S;  3OYJ A;  1NM7 A;  3L2W A;  3PE0 A;  1N6A A;  5HK3 A;  4EMK C;  1M4Z A;  1AIS B;  3OW2 A;  2IVW A;  3EHQ A;  3X20 B;  2MCN A;  4BY7 X;  2JT4 A;  1SEM A;  2RHU A;  3A98 A;  2RI3 A;  3QYH B;  3M56 A;  2QEX A;  2Y4X A;  5KE3 A;  2BTT A;  5FLX E;  1FXX A;  3BHT B;  3V7S A;  5FU6 B;  2EYQ A;  2O9V A;  5LJ5 d;  1WHL A;  1ACM B;  3GLX A;  4RG2 A;  4F6W B;  1RAG B;  4OP0 A;  2QFZ A;  1TUD A;  3LLR A;  3M4Y A;  4L5G A;  4NC6 A;  5D6X A;  4EOI B;  2C0O A;  2XMF A;  1H28 B;  1WA7 A;  4F6S B;  4LD6 A;  4E7S A;  2KYB A;  2LCL A;  2OI3 A;  2K9G A;  4M77 A;  4PNO A;  3CXC P;  1K9A A;  1YHQ A;  4CC7 A;  3BLH B;  1WJR A;  5GAM h;  3Q1J A;  5IH2 A;  3CC7 T;  3BDL A;  3KHI A;  5FU7 C;  5J39 A;  1Q81 R;  4KH1 B;  2X3X D;  2EYY A;  4QQG A;  2E6N A;  3CCR T;  4KRT A;  2JM8 A;  4C92 A;  2KSS A;  2R57 A;  2C6T B;  2PU9 B;  2KXC A;  5L23 A;  1JJ2 S;  1KC8 R;  2HEQ A;  2CZ1 B;  4TVR A;  1GY3 B;  4DBR A;  1YCY A;  4EOK B;  4HCZ A;  3VJP A;  3QKJ A;  1VQM Q;  3LH0 A;  3K7A M;  3VUB A;  4ANJ A;  3A1P A;  2QA4 Q;  4LNP A;  4OVA A;  1U8R A;  2WEV B;  1VA7 A;  1TU0 B;  2QTX A;  2LQW A;  2RQU A;  4BI4 A;  1I5L A;  2RK2 A;  1G3W A;  2VB6 A;  4UC4 A;  2O4X A;  2IVX A;  1KQS P;  3QHR B;  4M6V A;  4A4H A;  1JU5 C;  3CCQ Q;  3BW1 A;  2CP0 A;  2HNI A;  3CC2 Q;  1Y07 A;  4M75 A;  4DOW A;  4JS4 A;  5KYU A;  1SSF A;  1UTI A;  2EQU A;  2DIQ A;  1BBZ A;  2XI9 A;  2E70 A;  2DXB A;  3H8Z A;  1D0Z A;  5GAN 5;  4EOM B;  4O6J A;  3HRT A;  1Q82 C;  1OGU B;  1BKB A;  1F1B B;  1TH7 A;  1ZBJ A;  1M2V A;  2VYT A;  5GAO l;  1QCN A;  2QDL A;  4J83 A;  1EFN A;  3I55 Q;  2M0Y A;  4BDY A;  2B9R A;  3TW6 A;  3HHT B;  2K3Y A;  4B9W A;  2I2L A;  1M3B A;  3CCE T;  3MJX A;  4RTX A;  1WNL A;  4DBH A;  3CCS T;  4CFU B;  1WYX A;  3DL1 A;  5GAN 7;  5IXF A;  5BNJ B;  4EOS B;  3X25 B;  3MO8 A;  1M2O A;  2DTO A;  4Z8A A;  1PNJ A;  1W98 B;  2H3J A;  1XTD A;  2P4R A;  5ICP B;  1YIT A;  3CCM A;  5GAO q;  1BK2 A;  4JDS A;  1UE9 A;  1Q7Y U;  3EID B;  1BU1 A;  2C5X B;  3UDC A;  2XDB A;  1ZLM A;  2F5K A;  2RH2 A;  2YRC A;  1V29 B;  4JLG A;  4M77 G;  1QVG S;  2NWM A;  1VYV A;  2P4T A;  2JJ9 A;  3FRN A;  2PVO B;  5A0G A;  4ATO A;  2GBQ A;  2W96 A;  3JAM E;  4CC4 B;  4LDX A;  2CP2 A;  1I07 A;  1IXD A;  3L2Q A;  2RHZ A;  3CME T;  2EQJ A;  2GTJ A;  4OMO A;  3TSW A;  5IHN A;  1ZQ1 A;  2RQV A;  4AG1 C;  4KUL A;  3G33 B;  2FL7 A;  5L8R E;  3MIA B;  2O01 E;  3JCM Q;  3MP8 A;  1YI2 T;  5HVY B;  4C92 G;  5GAN 3;  1VQN Q;  5GAN 8;  1FWZ A;  2K7A A;  3C95 A;  1D3B B;  3HRS A;  3I9Q A;  3JCM e;  2KAF A;  5IXB A;  2COW A;  2HZY A;  3EGX B;  3J7A F;  2DAQ A;  4HCB A;  2YLB A;  4L59 A;  3QII A;  4IKF A;  2KK4 A;  1M90 R;  2A36 A;  2KYM A;  1Y96 B;  4JJC A;  5GAM g;  1GCQ C;  4PJN A;  4F7U F;  3CCJ Q;  2MWP A;  1YJN Q;  3DKM A;  1MMA A;  1WIE A;  5ACB A;  4KBM B;  5IDN B;  1VQO A;  4BY6 C;  1HXD A;  4C8Q F;  2I53 A;  4I3Z B;  4M75 G;  3EH1 A;  4CC3 A;  3G4S Q;  3DTO A;  2DL3 A;  1QVP A;  2MK5 A;  3VS6 A;  2KI7 A;  2CUD A;  4RTT A;  3TW7 A;  2W9Z A;  4F6U B;  4TTH A;  1FMK A;  3BDU A;  2RPN A;  1VQ4 T;  4BCO B;  2ATC B;  3V7R A;  3CPW S;  3DB3 A;  3TNW B;  2K57 A;  3QZ9 B;  2LJ0 A;  1BI0 A;  4C92 D;  1HJD A;  1IHW A;  2J06 A;  1S72 A;  1M1K R;  4KT0 E;  2WAC A;  1WHM A;  1QMZ B;  1WPY A;  1M90 U;  2CP7 A;  2GTO A;  3JB9 G;  3L2U A;  2QQS A;  4GY5 A;  3DLM A;  1LNX A;  3EG2 A;  4JUV A;  5LJ3 d;  5GAM f;  4M7A D;  2A08 A;  1NPP A;  1R0B G;  2O88 A;  4F16 A;  2J6F A;  4M7D D;  3QWX X;  2DD5 B;  1UNL D;  3BLQ B;  2LT1 A;  2NUP B;  3OA6 A;  5CQY A;  3PFS A;  5L2W B;  5HBJ B;  3KFV A;  4QSH A;  1KSW A;  1M3C A;  5GAO m;  1YWP A;  4JZ4 A;  4C92 E;  3H9N A;  4E47 A;  4OMP A;  2D8J A;  2DEU A;  4EMH A;  3G6E T;  3HBL A;  5GAO r;  1ZUU A;  1QKX A;  4M7A E;  4M7D E;  1Y0M A;  2PHG A;  2J6K A;  1AOJ A;  4HCK A;  2CKK A;  4LDY A;  2W10 A;  4JRP A;  2COZ A;  1QWF A;  4ROE A;  2K2M A;  2DZ9 A;  1MGQ A;  2HBW A;  3OYC A;  4LUD A;  1I81 A;  3VYG B;  4F7U E;  1LPL A;  2MAM A;  2QG9 B;  5LJ3 e;  2IW9 B;  2HAX A;  4C5H A;  3CXC S;  5HNB B;  3CC4 Q;  3MY5 B;  5DY9 A;  4JLI A;  4C0G A;  3JB9 D;  3VS5 A;  2MWO A;  2FZG B;  2HCK A;  4JJN K;  1UDL A;  2ZAE A;  1YHQ Q;  5FWB A;  1UGR B;  4MZP A;  2JS2 A;  4BAC A;  4FW2 A;  3CCU A;  3GNG A;  1D3B A;  3JCM P;  2YSQ A;  1K8A U;  1VQ9 A;  3MEV A;  1N5Z A;  3QJ6 A;  5D6W A;  4JJB A;  4MMK A;  3EGX A;  5CKE A;  2LCS A;  2RD1 A;  3V8K A;  4ZN1 A;  1ZUK A;  5CYI B;  1GCP A;  3TVT A;  2DXC B;  1A0N B;  1SRL A;  1Y96 A;  1B3Q A;  1PKT A;  3NMZ C;  1JRI A;  1U5S A;  3PGG A;  3EGU A;  1X6O A;  3DB4 A;  3OSV A;  4CFV B;  3JCM J;  4BY1 X;  3TCJ A;  4JX5 A;  2VUB A;  4BCN D;  1NPR A;  4ZN3 A;  3VS3 A;  5EJC A;  3GNF B;  1JOW A;  1E7O A;  4JJD A;  3JCM h;  1TFB A;  5FWC A;  3QG1 A;  2M16 A;  1OZ3 A;  5KYY B;  2H3E B;  4II5 B;  1Q95 G;  2RI5 A;  1JO8 A;  1MND A;  3OBY A;  1FMV A;  1GXI E;  1WZO A;  3QUI A;  4EON B;  5GAN j;  1BU2 A;  1KD1 R;  4KGZ B;  1OIY B;  4BCP B;  1ENW A;  2DO3 A;  2RB6 A;  3P8D A;  5HQ0 B;  3FC3 A;  2DD5 A;  3M9Q A;  4IUT A;  1N27 A;  2NUP A;  4AMC A;  2EGC A;  2LX9 A;  4IIM A;  2CH4 W;  1QP3 A;  3VS0 A;  4R0K A;  1VQ8 A;  3X28 B;  5DLO A;  2CP6 A;  4DA4 A;  1UHC A;  3L2Z A;  1NLP C;  1X27 A;  2C06 A;  1ZA2 B;  2QF7 A;  3O8V A;  1QVF P;  2RHI A;  4AI6 A;  1VQM T;  4FT2 A;  3BHU B;  3OW2 P;  2CYZ B;  1QW1 A;  2PZ1 A;  2QA4 T;  4FYV B;  5CKD A;  4HA8 A;  4X34 A;  2C0I A;  1YIT Q;  4C0Z A;  3CCM Q;  3VYG A;  2CDT A;  2YUN A;  4BDZ A;  2MOX A;  1OI9 B;  3WVE B;  2FRY A;  1GFD A;  3OYI A;  3CCQ T;  4YOO A;  1QKW A;  2E41 A;  3CC2 T;  4PFO A;  2EKH A;  1K0X A;  4FT4 A;  1VIF A;  1B34 B;  2VAS A;  5J26 A;  2X4J A;  4XQ3 A;  1G3T A;  4Y92 A;  1W2B A;  3CBP A;  1FVV B;  4A4K A;  1YBY A;  4CFU D;  2IPO B;  4EDU A;  2LJ3 A;  4XU1 A;  2KDS A;  2JMA A;  2HMA A;  4QKU A;  3TN8 B;  1YWO A;  3I55 T;  4GBQ A;  1NJI C;  1ZBX A;  3OYM A;  1VQP A;  1WHH A;  1GBR A;  1LCK A;  1LVK A;  1FYN A;  3VUZ A;  3HZJ A;  2QQ8 A;  4XTZ A;  1HSQ A;  4M78 G;  1U1T A;  2V1Q A;  4OF1 A;  2L2P A;  2DXC A;  2DVJ A;  3OSS C;  3OYK A;  2E4H A;  3RGF B;  3VKH A;  1D0Y A;  1NLO C;  3UAT A;  1XJW B;  3VS2 A;  4BUG A;  1RI0 A;  1P5E B;  3DOG B;  1KXU A;  4Z6Y A;  1U3O A;  3MKD A;  2X4W A;  4CFX B;  2EVR A;  2DET A;  3LYI A;  4RCC A;  4M7A B;  2UZL B;  1ZSZ B;  1S1N A;  3OBW A;  2KRN A;  4M7D B;  2BZX A;  1C1A A;  1AWW A;  2LW4 A;  5KYY A;  1OKV B;  3HSB A;  5LMK B;  1VQO Q;  1QWE A;  3QDF A;  3NTI A;  1KJW A;  2L0A A;  1H26 B;  1OU9 A;  3M4G A;  4C0D B;  4N0A A;  3REA B;  5FRO A;  4F7U B;  2BS2 A;  2JUF A;  1PCX A;  5LL6 S;  4F7L B;  3SDZ A;  1UNH D;  4OGR B;  2CZ7 B;  1M30 A;  1NG2 A;  1G2B A;  4C8Q B;  9ATC B;  1OKW B;  4M78 D;  3URG A;  2KRM A;  3BG3 A;  1SHF A;  1S72 Q;  1VQN T;  1VOL A;  1YP5 A;  3LGL A;  4NS5 A;  3UF4 A;  2W99 A;  1UEC A;  3JCM g;  1GRI A;  4UN0 A;  3H0F A;  2R7G A;  2DRK A;  1YIJ A;  3L42 A;  2X3W D;  2HL5 C;  1H1R B;  1UNG D;  3UT1 A;  4M78 E;  4J9H A;  2KMG A;  3GIB A;  4EPC A;  2DNU A;  4FU6 A;  1X43 A;  1AT1 B;  3A8G B;  3CCJ T;  3PT9 A;  2AKL A;  1YJN T;  4F7N B;  1AWX A;  3CMA A;  5DM7 R;  1AZE A;  3OY9 A;  5IN1 A;  1QMC A;  1PM3 A;  3CC7 A;  2AZV A;  4LXC A;  3E19 A;  1X6G A;  1OX8 A;  3R6N A;  4HNT A;  3G4S T;  2HD0 A;  1B34 A;  3CCR A;  1K1Z A;  2OTJ A;  1ZP2 A;  2DM1 A;  2KR6 A;  1Q81 C;  1K73 R;  1KG1 A;  1PG5 B;  5CCA A;  4MZM A;  5A0L A;  2YDL A;  3EG9 B;  3JCM f;  2QAZ A;  3X26 B;  2DYB A;  1NE8 A;  1UJY A;  3QPH A;  1AHJ B;  3U23 A;  1ZSG A;  1KC8 C;  1ABO A;  1SSH A;  4BCN B;  2WSE E;  1R0C B;  2M0O A;  1YCS B;  2K79 A;  2W9F A;  1OUL A;  4J6X A;  1VQ7 A;  2FZK B;  3CCU Q;  1D09 B;  2CH4 A;  1VQ9 Q;  2R5M A;  1WQ7 A;  1G3N C;  1NYG A;  3V7C A;  4NL2 A;  1UGV A;  3C12 A;  5LJ5 e;  4XTX A;  1K73 U;  2CSQ A;  2JM9 A;  4IUR A;  4ELJ A;  2O31 A;  2YLC A;  1Q86 U;  1QVG A;  3ZBD A;  2X9H A;  1UGP B;  4XTW A;  1VQ5 A;  4K11 A;  4M7A A;  1TOV A;  1ZSZ A;  4PJO F;  3HP9 A;  3M0T A;  4M7D A;  2XID A;  1EIF A;  2LDM A;  3P8B B;  1M27 C;  3C4S A;  2AK5 A;  1OPL A;  4M4Z A;  1MMN A;  2WSC E;  5M9O A;  2ZPF B;  4RTY A;  1GH6 B;  3GTM S;  3RIR A;  4BE1 A;  4B9X A;  4F7U A;  5GJW B;  2DZC A;  3E9F A;  1PKD B;  2EUF A;  5CKH A;  2J7I A;  3CC4 T;  3CCS A;  5GMK h;  4KRC B;  1UHF A;  4RKU E;  3OYB A;  3PTA A;  4N4I A;  2KRO A;  2L3S A;  4XU3 A;  4C8Q A;  1TS9 A;  1OOT A;  2QQA A;  1MUZ A;  1YHQ T;  2DLP A;  2DKG A;  2SRC A;  5GAN d;  2DK3 A;  3QHS A;  1Q7Y R;  1ZHI A;  2EIF A;  4M77 C;  1QLY A;  4CFM B;  1BCM A;  1OU8 A;  5CQX A;  3OYF A;  2O2O A;  3A8H B;  2MI6 A;  4QQD A;  1QVF S;  1HYO A;  2QGS A;  3GBQ A;  4MDX A;  2EGE A;  4XTY A;  1AD6 A;  4BE2 A;  3B57 A;  3TQ7 P;  5GAM j;  1V76 A;  2UZB B;  1I8F A;  4J9C A;  1NYF A;  4RUG A;  3A8L B;  3SD4 A;  1XOV A;  3CPW A;  2ZGW A;  2VC8 A;  1OI1 A;  1RUW A;  1AD5 A;  5GAN e;  2CUB A;  4EOR B;  4AFZ C;  1LOJ A;  2JGZ B;  3EG9 A;  2RM4 A;  1IO6 A;  1IGQ A;  5FRN A;  1OEB A;  5HK0 A;  4A4F A;  3F70 A;  4OMF B;  2C5N B;  4JX4 A;  4OGC A;  3D7S B;  2MF2 A;  4MIM A;  4M75 C;  2EPD A;  1DJ7 B;  3S6W A;  3RES A;  4OB2 B;  2JTM A;  5GAO p;  3OYH A;  2K4Y A;  2JW4 A;  3L2R A;  1OQK A;  2WJ9 A;  2K2V A;  1H3H A;  2L3P A;  7AT1 B;  5GAN 2;  3NPF A;  4M77 F;  4J9G A;  4E7H A;  3EOC B;  2C4G B;  3CBM A;  3BLR B;  2WMA B;  4ESR A;  4LUE A;  4OMN A;  2DPP B;  1WX6 A;  1Y7X A;  3CXC A;  4M7A G;  2DIG A;  1YJ9 A;  2LZ6 B;  4M7D G;  4J9I A;  4YOZ A;  4M78 B;  1YIT T;  2FZC B;  3CCM T;  1Q82 U;  3A5Z B;  2BIV A;  5A0D A;  3O5Z A;  3EFR A;  1YJW A;  3R6O A;  3DDP B;  4AG2 C;  4F7U G;  1X6B A;  3OB9 A;  5FU6 C;  1M1K C;  3SFM A;  1BI2 A;  2HKQ B;  3PMT A;  4CRI A;  1FIN B;  3RKY A;  4WCI A;  2EBP A;  2K5I A;  3CCV A;  1D3U B;  5LJ5 h;  8AT1 B;  4BCM B;  4C8Q G;  4IMY B;  2P0Q A;  2WFY B;  2QTV A;  4IUP A;  2BS3 A;  5KYN A;  1G83 A;  3ZFJ A;  1CKA A;  1AWJ A;  2QK0 A;  2LNV A;  3BG5 A;  4MZT A;  4J6Y A;  1I5O B;  3CD6 Q;  2JTF A;  3BFM A;  1WJS A;  1KQ2 A;  1VQK A;  1KK7 A;  4M75 F;  3GPL A;  4XTV A;  4ELY C;  2EAY A;  2CP3 A;  2R5A A;  1KQS A;  3LH5 A;  3NDQ A;  1QCF A;  3MY1 B;  2RK1 A;  3HFO A;  2VKN A;  3OS0 A;  2KT8 A;  3SWN B;  2KE9 A;  3SHW A;  2F5T X;  1IHV A;  3NTH A;  4RTW A;  3TU4 K;  2JZ2 A;  2X4Y A;  1TSF A;  2EFI A;  5IHK A;  1YIJ Q;  2G3R A;  5I22 A;  2DJQ A;  4JRQ A;  3CBO A;  3NHN A;  2LQ8 A;  3NGP A;  1VQL A;  1IGU A;  3QYG B;  2GQV A;  4CC2 A;  3JB9 F;  1SPK A;  1JQQ A;  3QWY A;  4Z89 A;  5KH6 A;  3CMA Q;  1Y57 A;  1VIN A;  3ASK A;  1K8A R;  3OYE A;  3H0H A;  4C8Q D;  1VYT A;  1VQO T;  4XAX B;  2QEX Q;  3F5X B;  2LP5 A;  1T3L A;  2FVU A;  3H6Z A;  3I56 A;  2OTJ Q;  5EG2 A;  4GLK A;  1T0J A;  3L2V A;  2HL3 A;  1KIK A;  3OYN A;  4IUQ A;  2ENM A;  2M9U A;  3HRU A;  3TRE A;  4C8Q E;  1PRL C;  2QQB A;  4E7Z A;  1W4S A;  2LX7 A;  2H8H A;  1S72 T;  4J7F A;  2ZPI B;  4E6R A;  1OL1 B;  5CVI A;  5CK9 A;  4AFU C;  1JSU B;  2DFU A;  4BXX X;  4DBF A;  2CJM B;  1OPK A;  4FX3 B;  1VQ7 Q;  5GMK i;  4BCI B;  2EJG A;  2D8H A;  3HPW A;  4OMQ A;  2KXD A;  2D0N A;  2E64 A;  3KBG A;  2DL7 A;  3S3N A;  3MEU A;  4BCQ D;  4M78 A;  2OAU A;  2FYK A;  3OS5 A;  2UZD B;  1URC B;  1K9M C;  2YWW A;  3OQ5 A;  1VQ5 Q;  1WQW A;  1MV0 B;  5EC7 A;  1WDX A;  1CKB A;  1KD1 C;  1XQH A;  3M03 A;  2BKZ B;  2ZPG B;  3G71 A;  2BPM B;  1KQS S;  1ABQ A;  1AVZ C;  2IN3 A;  3JCM b;  2RHX A;  1WHG A;  5I11 A;  2NUT B;  2LQN A;  3ULR B;  4EC8 B;  4R55 A;  3GP8 A;  2MMP A;  4Y91 A;  3T9N A;  4PJO B;  3VV0 A;  3I5R A;  1W70 A;  2KT1 A;  4EOJ B;  3JCM X;  2O9S A;  2V8J A;  3BG9 A;  4CXA B;  3CCL A;  2OTL A;  4EMK B;  1SKU B;  4AFQ C;  1C0M A;  2E5Q A;  1JJ2 P;  1RAF B;  2M1H A;  1GBQ A;  5CO7 A;  1UB4 A;  2FG0 A;  4C5E A;  3CCU T;  3NFC A;  3SWN A;  1VQ9 T;  4FSS A;  3MCA B;  2RJD A;  2OJ2 A;  3HTR A;  4BCK B;  1H64 1;  1IRX A;  3INZ A;  2XD0 A;  5LJ5 g;  2GQI A;  4DEX A;  2HSP A;  5CEI B;  3LGF A;  1H27 B;  4ZNX A;  2CT3 A;  4FM4 B;  2BE7 D;  2DJZ A;  2YT6 A;  1JEG A;  3HKS A;  1NEB A;  4HNV A;  2AT1 B;  3UA6 A;  4OB0 B;  5HCK A;  5GAM d;  2QDY B;  2E3H A;  4PJL A;  1TXQ A;  4BI8 B;  1VQ6 A;  4X9D A;  4RCB A;  1P92 A;  4LN2 A;  4J5Y A;  3QYE A;  2JNG A;  1H25 B;  5CKB A;  5FU7 B;  4JX6 A;  3QYB A;  1D1C A;  2NLU A;  2KQW A;  2W0Z A;  2JTE A;  2JOY A;  2OAW A;  4LDW A;  3M53 A;  3CPF A;  4XK8 E;  4O5V A;  1M3A A;  2WMB B;  3J80 E;  2EQM A;  3ER0 A;  1N8R C;  1H1S B;  4MFE A;  3PVQ A;  4J9F A;  5GMK l;  3PVL A;  5LJ5 f;  3POM A;  1KQ1 A;  2XKO C;  2RHY A;  1I4K 1;  1N9R A;  2F1L A;  5D6Y A;  1YN8 A;  1UUE A;  4F04 B;  3MHX A;  3JSC A;  2EJ9 A;  1PD1 A;  2WXV B;  2DE0 X;  1WHK A;  4BI3 A;  4GLM A;  2AKK A;  4X1V A;  3JCM c;  3VS7 A;  2RF0 A;  2P0K A;  4LOC A;  5LJ3 h;  4DBQ A;  4BBR M;  3V8J A;  3BHV B;  4EMG A;  1JXO A;  1YJ9 Q;  1Z9Q A;  5GAN g;  2GFA A;  1RI9 A;  4HVW A;  3PIO A;  2L5Q A;  2RQT A;  1I1J A;  2K5F A;  1TUG B;  2NUT A;  1YJW Q;  2A7Y A;  4FW1 A;  3SEM A;  4PJO A;  2RA2 A;  2DTH A;  5AT1 B;  2IW6 B;  2ZPH B;  2GFU A;  4EMK A;  2F2X A;  4C5I A;  3CCV Q;  1YFN A;  4AFS C;  1WGS A;  2DYI A;  2L3R A;  1K0S A;  1BIB A;  2Z0W A;  1E9H B;  2CS7 A;  1D1A A;  4EOQ B;  2DA9 A;  1B07 A;  4LDU A;  4II1 A;  1G8X A;  2K3X A;  4FSX A;  2E6Z A;  5FRM A;  1VUB A;  2P84 A;  2LJ1 A;  4PK4 A;  3HO8 A;  4FYY B;  4E2F B;  1VQK Q;  2EYX A;  4JPB W;  2QAS A;  5FGK B;  2XK0 A;  4FYX B;  2ROT A;  4EOL B;  2RQW A;  2X4X A;  4QQ6 A;  4J6W A;  4OMM A;  4AKI A;  2HQH A;  1C6V X;  2DXU A;  2EYZ A;  2XU8 A;  5IAY A;  1EX4 A;  2EJF A;  3RUX A;  4BCM D;  4AKH A;  1VQL Q;  4ELZ C;  4PJM A;  3C0C A;  3QJY A;  5D7U A;  3QXE B;  4RTU A;  1TUC A;  3CPW P;  1NJI U;  1X75 C;  5HBE B;  2LT4 A;  3A8O B;  4LE9 A;  4HLQ A;  1H1P B;  4A4E A;  2P0P A;  3EFO B;  3RDV A;  3PIP A;  1SG5 A;  3JB9 J;  1WLP B;  2KMT A;  2OX7 A;  1OZ2 A;  3I56 Q;  4KGX B;  2F2C A;  4BCQ B;  1QVF A;  1PSE A;  1ARK A;  4CRL B;  3HL8 A;  1VOM A;  4OML A;  4A4G A;  5I21 A;  1Q86 R;  4E7J A;  1UGQ B;  2ZZD B;  3M54 A;  3CD6 T;  2DEQ A;  4N0A C;  3JV3 A;  1PWT A;  2HSE B;  4HVU A;  1M5Q 1;  4LD9 K;  4Y28 E;  3OMC A;  5GMK m;  4WTO B;  1UJ0 A;  4ELL A;  2AIR B;  3JRZ A;  2A37 A;  2KGT A;  5A2Q E;  3ZEH A;  2WIP B;  4DOV A;  1E7P A;  4BY6 B;  4KH0 B;  2DIL A;  4FL6 A;  1YIJ T;  2RJE A;  1X2K A;  1BI1 A;  3CC4 A;  3RKX A;  3TEE A;  1SHG A;  4OR5 B;  5CR2 A;  4BD3 A;  3P8H A;  2WPA B;  3I5S A;  2BS4 A;  1B7T A;  2L89 A;  3JCM V;  2M51 A;  1AEY A;  3G1J A;  2RN8 A;  2ROL A;  1NZ9 A;  3CMA T;  3FIF A;  2EQI A;  3EG1 A;  2QEX T;  1H3Z A;  1H92 A;  4PJO G;  1OYX A;  5LQF B;  4ZTF A;  1Q7Y C;  2X51 A;  3FJ5 A;  2OTJ T;  2LQK A;  3G71 Q;  6AT1 B;  2YUP A;  1VYU A;  2RJC A;  2B8A A;  4KUI A;  3EJ1 B;  4PFZ A;  1GFC A;  1NEG A;  1UG1 A;  5LJ3 g;  4HT9 A;  1G3S A;  4F7S B;  3CCE A;  2E12 A;  3I35 A;  2FB7 A;  1MV3 A;  2JVV A;  8ATC B;  1BCO A;  2YXY A;  4IIO A;  5IDP B;  3UWN A;  3CCL Q;  2KEA A;  2J6O A;  2OTL Q;  3GOX A;  4F17 A;  2XHC A;  3MEA A;  2HKN A;  2WIH B;  3EGD B;  2D6F A;  2K6D A;  4ROD A;  2W2H A;  4QW2 A;  1VQ7 T;  2GCX A;  4ZGD B;  3FJP A;  1G5V A;  1O9S A;  1N9S A;  3MI9 B;  4BCF B;  3QBY A;  4FCY A;  1H1Q B;  2V22 B;  4EOO B;  1IZ6 A;  2PUK B;  3FEO A;  1Q81 U;  2DL5 A;  2I0N A;  2L8D A;  1TWB A;  3MET A;  5HKC A;  2J05 A;  1VQ8 Q;  3OW2 S;  1HD3 A;  2RQR A;  1VQ5 T;  5LJ3 f;  5C0M A;  2ESW A;  4FIB A;  3TNI B;  3RR6 A;  4PJO D;  3AT1 B;  2A0F B;  4FYW B;  3VU3 C;  4PLI A;  1KC8 U;  4C92 C;  1BYM A;  2DL4 A;  2V8K A;  4OGE A;  4PFP A;  5AYF A;  1RAA B;  4AT1 B;  3OYA A;  1O75 A;  5KCH A;  3TSZ A;  1VQ6 Q;  1MHN A;  5HY6 A;  2BZY A;  3EFO A;  4N4H A;  3CME A;  1K76 A;  1W6X A;  3E9G A;  2ZPB B;  4M7A C;  1T3S A;  4YOS A;  1ZSZ C;  4M7D C;  1SF9 A;  2MYS A;  2DVE A;  1YI2 A;  3M0R A;  3CEY A;  2CZ0 B;  2ZZD A;  4PJO E;  1XO2 A;  2ED1 A;  4E7K A;  4QVC A;  4C0D C;  5J3B A;  2DER A;  3OMG A;  3OYG A;  1GCQ A;  4QT7 A;  3MPU B;  1Q82 R;  4C0F A;  2E5K A;  2XDP A;  3RMS A;  3RBB B;  4KGV B;  3M0U A;  4C8Q C;  2ECZ A;  3FLG A;  5CIU A;  1RAC B;  3EAE A;  4HKE A;  4R56 A;  2JMC A;  4A63 B;  5DLQ E;  1T0H A;  2FEI A;  2UZE B;  2VVK A;  1VIE A;  1FMW A;  3JCM d;  2KR3 A;  4F7J B;  2FPF A;  1RL2 A;  2KRS A;  2X35 A;  5GMK j;  1M90 C;  1WJQ A;  2LVM A;  5CAI A;  1AZG B;  1LJO A;  4CFN B;  4B6M A;  2YHT A;  1VQP Q;  2VGN A;  4JZ3 A;  4XU2 A;  3LWI A;  3VRY A;  2WHB B;  3AHU A;  2FPD A;  2PNI A;  4QVD A;  3DLL A;  1Y71 A;  1RAE B;  2RO0 A;  3M0P A;  2D9T A;  3H4C A;  2QDJ A;  1RLQ C;  2COY A;  4BCH B;  1GL5 A;  2JS0 A;  5KYW B;  3M59 A;  2NUZ A;  1VQ4 A;  1M8V A;  2E10 A;  2YUO A;  4A54 A;  2XG8 D;  4C92 F;  1V1C A;  2I40 B;  4BBS M;  4ORZ A;  1D0X A;  4JRI A;  1H4L D;  3FB9 A;  4AKG A;  4M7A F;  4OB3 B;  1X01 A;  4M7D F;  4EC9 B;  2A3L A;  2MPX C;  3V8L A;  2LMJ A;  3EGD A;  3EHR A;  1QQJ A;  3PNW C;  1GUX B;  2IG0 A;  2IIM A;  2LRQ A;  3G6E A;  5GJV B;  2BZ8 A;  2B86 A;  3EG3 A;  3EG0 A;  3S3O A;  3UA7 A;  2JN0 A;  2GF7 A;  4RG8 A;  2C5V B;  2BE9 B;  4M77 D;  1W1F A;  2KNB B;  3PO3 S;  4J9D A;  4Q5W A;  3ZL7 C;  1K8A C;  4EOP B;  1WXB A;  4PLL A;  2KBT A;  1U06 A;  2CRE A;  2E3I A;  3L1A A;  2V1R A;  2LCC A;  3X24 B;  1PKS A;  4CFW B;  1YJ9 T;  4RTV A;  3E1S A;  1PHT A;  1ZX6 A;  2CSI A;  1RAH B;  1K4U S;  4M77 E;  2DTI A;  1EZZ B;  2DD4 B;  1IB8 A;  1KFZ A;  1CSK A;  3UPU A;  1YJW T;  3VRZ A;  2UUE B;  2GGR A;  3JCM W;  3QDR B;  1JST B;  3REB B;  3QSU A;  2WSF E;  2Y90 A;  3CC7 Q;  4P5N A;  1E6H A;  3CCV T;  4KRD B;  2EGA A;  2HBP A;  1FKM A;  2QXF A;  3CCR Q;  1J3T A;  4EIK A;  1G3Y A;  5KE2 A;  2EYW A;  1H8K A;  1QLB A;  2A28 A;  4N4G A;  4D6W A;  2CP5 A;  4A53 A;  1PC0 A;  1BIA A;  1W2B P;  3LX7 A;  1FX7 A;  2QGG A;  1R8O B;  1O9K B;  4XTU A;  4M75 D;  4Y72 B;  4HNU A;  1RLP C;  1VQK T;  2C0T A;  5I5Z B;  3KUF A;  5FW9 A;  5GAN h;  3S3M A;  1M1K U;  1F5Q B;  5LJ5 j;  2DX1 A;  1RAD B;  2FRW A;  3H0I A;  2VXF A;  1M1F A;  2DRM A;  2F2V A;  4E7L A;  2QQ9 A;  5HBH B;  3E2U A;  5I2M A;  2ED0 A;  4M75 E;  2VXE A;  1VQL T;  3M55 A;  3HB9 A;  5IHI A;  5KYW A;  4YC3 B;  2E65 A;  2HQX A;  2L3Q A;  2G9X B;  1SRM A;  1WI7 A;  2GNC A;  1ZUY A;  3VS4 A;  1YNZ A;  1M9S A;  4JRK A;  4V2S A;  4ZTJ A;  1WXU A;  4RMO A;  4F70 B;  3I56 T;  2DME A;  3J81 E;  5DQV A;  1H24 B;  1M8M A;  1JBM A;  3VKI A;  1OIU B;  1JB0 E;  1BI3 A;  2EQK A;  1GUX A;  4F14 A;  4NL3 A;  1Z9Z A;  2K3B A;  3M58 A;  2VWF A;  3CCE Q;  1IRE B;  3CCS Q;  3PMI A;  4Z88 A;  2JXB A;  4G6L B;  2DMO A;  1WFW A;  1VQM A;  2FHD A;  1R77 A;  1JXM A;  1PD0 A;  1MMG A;  1D1B A;  3EH2 A;  3RKW A;  2QA4 A;  4DQ2 A;  2CGH A;  2QGF B;  2K5L A;  1QP2 A;  2PQW A;  4ZGJ B;  3JB9 H;  4NOY A;  1ZA1 B;  5C6S A;  3KXT A;  2F69 A;  4BE0 A;  2HQE A;  3BE3 A;  3CCQ A;  3QHW B;  3G7Z A;  4D8K A;  3CC2 A;  2BUD A;  2ABL A;  4L6V 5;  1K9M R;  5IT9 E;  4ROC A;  5KYX B;  1AWO A;  3DJB A;  5ECA A;  5GAO n;  2HDA A;  4J8O A;  2X1N B;  1XNI A;  2DD4 A;  1UFF A;  3GF5 A;  2AZS A;  2PTK A;  2FO0 A;  4M78 C;  2F2W A;  2KVQ G;  4X9C A;  3RNJ A;  2VGM A;  3G71 T;  3CME Q;  1TTH B;  2LNH B;  2XDD A;  3I55 A;  3NTK A;  1OX9 A;  2Y4Y A;  4BCJ B;  2DF6 A;  4OB1 B;  1QCO A;  1OL2 B;  1YI2 Q;  3QZ5 B;  1TD6 A;  2PMI B;  2CZ6 B;  1KHI A;  2YUQ A;  4BCG B;  3WXM B;  3CCL T;  4XU0 A;  2M02 A;  2OTL T;  3M57 A;  3QO3 A;  1N4M A;  4HT8 A;  1O9K A;  1WHJ A;  4MFD A;  4JS5 A;  1K9M U;  2IW8 B;  4DEY A;  2RI2 A;  3OS2 A;  2FPE A;  3OYY A;  5GAN 4;  2LC4 A;  4MML A;  1KD1 U;  2RNA A;  3BY7 A;  3DDQ B;  3FDR A;  3MP6 A;  3O0G D;  1UGS B;  2YRV A;  4YTL A;  5GAM e;  1C9B A;  3RER A;  2SEM A;  2C5O B;  4IUU A;  4WF2 A;  4PL6 A;  3SWN C;  1NBE B;  2PK9 B;  1VQ8 T;  2QYZ A;  2EWN A;  3OYL A;  2DBM A;  3M0Q A;  3LQ5 B;  1JKW A;  5DQW A;  3LWH A;  1MNE A;  2MIO A;  2PK2 A;  4MDW A;  5CKF A;  3QWL A;  1VQ6 T;  1E6G A;  3A8M B;  4C5G A;  1M1G A;  2XIC A;  4BB7 A;  1RAI B;  4HXJ A;  1QVG P;  2D0Q B;  3CQT A;  4J9B A;  3SB2 A;  3JB9 I;  1VQ4 Q;  4M77 B;  4RTZ A;  2DBK A;  2G77 A;  5IHY A;  4Z02 A;  4M78 F;  4HL4 A;  1PRM C;  1VQN A;  1N8R R;  5KCO A;  1X2Q A;  2RJF A;  4LDV A;  1X69 A;  2EKO A;  4IUV A;  1BB9 A;  2PVD B;  2ZCF B;  5GMK e;  2NYS A;  4QVZ A;  4HCC A;  3EFS A;  2KY9 A;  4ZGE B;  5EFQ B;  5IF1 B;  4C92 B;  4ME7 A;  2D1X A;  1NJI R;  4J7I A;  3G6E Q;  2BKD N;  3TNH B;  3CCJ A;  3ME9 A;  3HFN A;  1YJN A;  2YRD A;  2VV5 A;  1VQP T;  3H41 A;  2LTO A;  4PJJ A;  1HK9 A;  2QI2 A;  2PUO B;  3OYD A;  4J9E A;  3G4S A;  5KYX A;  3MEW A;  5GAN f;  2ZPE B;  3N5B B;  3C94 A;  4NST B;  1UEB A;  4D8D A;  2PJQ A; 
#chains in the Genus database with same CATH homology
 1N8R U;  2JTF A;  3BFM A;  2DXT A;  4KUD K;  3QBY A;  1WJS A;  1IZ6 A;  1Q81 U;  2PUK B;  3OBY A;  1KQ2 A;  2O4X B;  3FEO A;  4E7I A;  1GXI E;  3QUI A;  1KHC A;  4M75 F;  5GAN j;  1VQK A;  3GPL A;  4XTV A;  2L8D A;  1JJ2 A;  4ELY C;  2EAY A;  4CI0 C;  1KQS A;  2R5A A;  3MET A;  3CD6 A;  5HKC A;  1K73 C;  2AHJ B;  2RK1 A;  3HFO A;  2DO3 A;  3WVD B;  4M75 B;  2RB6 A;  3P8D A;  3OS0 A;  1Q86 C;  3SWN B;  2PVG B;  2E1H A;  3FC3 A;  2F5T X;  2DD5 A;  3M9Q A;  5I2S A;  2DXB B;  3VYH B;  1N27 A;  1PSF A;  3NTH A;  4IUT A;  3OW2 S;  2LX9 A;  3TU4 K;  2JZ2 A;  2X4Y A;  5LJ3 f;  5C0M A;  1QP3 A;  4FIB A;  1VQ5 T;  2EFI A;  4PJO D;  2G3R A;  3VU3 C;  2R58 A;  1KC8 U;  4PLI A;  1BYM A;  4C92 C;  2V8I A;  4JRQ A;  2V8K A;  4OGE A;  3CBO A;  5AYF A;  2LQ8 A;  3OYA A;  1O75 A;  3X28 B;  5KCH A;  1VQ8 A;  5DLO A;  1VQL A;  1MHN A;  5HY6 A;  3QYG B;  5LJ3 j;  4PKC C;  4N4H A;  3CME A;  4DA4 A;  3M5A A;  3L2Z A;  2GQV A;  3MP1 A;  3RMQ A;  3OS1 A;  2C06 A;  3JB9 F;  3E9G A;  2QF7 A;  3O8V A;  2ZPB B;  3LW5 E;  4M7A C;  1U1S A;  2RHI A;  3VKG A;  2QQR A;  4AI6 A;  1VQM T;  4FT2 A;  4M7D C;  4VUB A;  5KH6 A;  5GAN 6;  2CYZ B;  1W2B S;  1QW1 A;  3OYJ A;  3L2W A;  4PJO C;  3ASK A;  2DVE A;  2QA4 T;  1YI2 A;  3OYE A;  3CEY A;  2CZ0 B;  4C8Q D;  2ZZD A;  5CKD A;  1VQO T;  4PJO E;  1N6A A;  4XAX B;  5HK3 A;  4HA8 A;  4X34 A;  4EMK C;  1M4Z A;  3OW2 A;  4E7K A;  2IVW A;  4QVC A;  4C0D C;  3X20 B;  2FVU A;  3H6Z A;  4C0Z A;  3I56 A;  5J3B A;  3VYG A;  3OMG A;  3OYG A;  4BDZ A;  3WVE B;  2RHU A;  3M56 A;  5EG2 A;  2RI3 A;  3QYH B;  4GLK A;  3OYI A;  2QEX A;  2Y4X A;  3CCQ T;  3L2V A;  5KE3 A;  4C0F A;  2E41 A;  5FLX E;  1FXX A;  3OYN A;  2XDP A;  4IUQ A;  3RMS A;  3CC2 T;  3V7S A;  5FU6 B;  2EYQ A;  4C8Q C;  2M9U A;  3FLG A;  5LJ5 d;  5CIU A;  4FT4 A;  1VIF A;  4R56 A;  1B34 B;  3EAE A;  3HRU A;  4HKE A;  3TRE A;  5DLQ E;  4C8Q E;  1VIE A;  3JCM d;  2QQB A;  1W4S A;  3GLX A;  2X4J A;  4RG2 A;  4XQ3 A;  1G3T A;  4OP0 A;  5J26 A;  2QFZ A;  1RL2 A;  2X35 A;  4J7F A;  5GMK j;  1S72 T;  1W2B A;  2ZPI B;  1WJQ A;  2LVM A;  3CBP A;  3LLR A;  3M4Y A;  4L5G A;  5CVI A;  4A4K A;  1YBY A;  4NC6 A;  1LJO A;  5CAI A;  5CK9 A;  4EDU A;  2YHT A;  5D6X A;  4XU1 A;  2VGN A;  2KDS A;  4XU2 A;  3LWI A;  4LD6 A;  3AHU A;  2LCL A;  4QVD A;  3I55 T;  4M77 A;  3DLL A;  5GMK i;  4PNO A;  1NJI C;  1Y71 A;  1ZBX A;  3OYM A;  1VQP A;  2EJG A;  2RO0 A;  3HPW A;  1YHQ A;  3VUZ A;  2D9T A;  3H4C A;  3HZJ A;  2QQ8 A;  2QDJ A;  1WJR A;  2E64 A;  4XTZ A;  3Q1J A;  5GAM h;  3KBG A;  4M78 G;  1U1T A;  4OF1 A;  3CC7 T;  3S3N A;  3BDL A;  3MEU A;  4M78 A;  3KHI A;  2OAU A;  5FU7 C;  5J39 A;  2DXC A;  3M59 A;  2FYK A;  1VQ4 A;  3OS5 A;  3OSS C;  1M8V A;  2E10 A;  4QQG A;  3OYK A;  4A54 A;  2XG8 D;  3VKH A;  2E6N A;  3CCR T;  1K9M C;  4C92 F;  3OQ5 A;  4BUG A;  1RI0 A;  4BBS M;  1WQW A;  4C92 A;  2KSS A;  4JRI A;  2R57 A;  1KD1 C;  1XQH A;  4Z6Y A;  3FB9 A;  2PU9 B;  4AKG A;  2ZPG B;  3G71 A;  1JJ2 S;  4M7A F;  2X4W A;  4OB3 B;  1KQS S;  1X01 A;  4M7D F;  2A3L A;  2CZ1 B;  3JCM b;  4TVR A;  3V8L A;  2RHX A;  3LYI A;  4RCC A;  1YCY A;  4HCZ A;  4M7A B;  3VJP A;  3QKJ A;  3LH0 A;  3OBW A;  4R55 A;  3VUB A;  2MMP A;  3PNW C;  3GP8 A;  4M7D B;  2IG0 A;  4Y91 A;  3T9N A;  4PJO B;  3VV0 A;  3JCM X;  3HSB A;  2V8J A;  2LRQ A;  3BG9 A;  4OVA A;  3G6E A;  1U8R A;  3CCL A;  2QTX A;  3NTI A;  2OTL A;  4BI4 A;  4EMK B;  3M4G A;  1I5L A;  2RK2 A;  4C0D B;  1G3W A;  3S3O A;  2JN0 A;  2E5Q A;  4UC4 A;  2O4X A;  4N0A A;  5FRO A;  2GF7 A;  4RG8 A;  4M6V A;  2M1H A;  4F7U B;  2BS2 A;  4A4H A;  2JUF A;  5CO7 A;  1UB4 A;  4M77 D;  5LL6 S;  3BW1 A;  3SDZ A;  2HNI A;  4C5E A;  1Y07 A;  4Q5W A;  4M75 A;  3CCU T;  1K8A C;  4DOW A;  4JS4 A;  2CZ7 B;  3NFC A;  1SSF A;  4PLL A;  3SWN A;  2EQU A;  1VQ9 T;  2DIQ A;  3CPW A;  4C8Q B;  2XI9 A;  3MCA B;  2E70 A;  2DXB A;  2RJD A;  3L1A A;  2LCC A;  3H8Z A;  4M78 D;  3X24 B;  5GAN 5;  3URG A;  3BG3 A;  1H64 1;  3INZ A;  4O6J A;  1VQN T;  2XD0 A;  3LGL A;  5LJ5 g;  4NS5 A;  1YJ9 T;  3HRT A;  1Q82 C;  3E1S A;  3JCM g;  1BKB A;  3LGF A;  1TH7 A;  2DTI A;  4M77 E;  4FM4 B;  2DJZ A;  2VYT A;  5GAO l;  3HKS A;  4J83 A;  2DD4 B;  4HNV A;  1YIJ A;  3L42 A;  3UPU A;  4OB0 B;  1YJW T;  4BDY A;  5GAM d;  2QDY B;  3TW6 A;  3HHT B;  2K3Y A;  4B9W A;  4BI8 B;  3UT1 A;  1VQ6 A;  2I2L A;  4M78 E;  3JCM W;  4X9D A;  2KMG A;  3QDR B;  3CCE T;  4RCB A;  3GIB A;  1WNL A;  3CCS T;  2WSF E;  4EPC A;  3QSU A;  2Y90 A;  1P92 A;  4FU6 A;  4P5N A;  4J5Y A;  3DL1 A;  3QYE A;  2JNG A;  5GAN 7;  3CCV T;  5CKB A;  5FU7 B;  3A8G B;  3CCJ T;  4JX6 A;  3QYB A;  2NLU A;  3PT9 A;  2KQW A;  2HBP A;  1FKM A;  2QXF A;  1YJN T;  3X25 B;  2JOY A;  3MO8 A;  2DTO A;  5DM7 R;  3CMA A;  1G3Y A;  5KE2 A;  3OY9 A;  4LDW A;  1QLB A;  5IN1 A;  3CC7 A;  4N4G A;  3M53 A;  3CPF A;  2H3J A;  1XTD A;  4XK8 E;  4O5V A;  3E19 A;  4D6W A;  3J80 E;  3G4S T;  2EQM A;  4HNT A;  1YIT A;  2HD0 A;  3ER0 A;  1B34 A;  4A53 A;  3CCR A;  5GAO q;  3CCM A;  1N8R C;  4JDS A;  2OTJ A;  1BIA A;  1Q7Y U;  3LX7 A;  2KR6 A;  4MFE A;  1FX7 A;  1Q81 C;  1R8O B;  5GMK l;  4XTU A;  4M75 D;  5LJ5 f;  1KG1 A;  4HNU A;  1VQK T;  1KQ1 A;  5CCA A;  4MZM A;  5A0L A;  2XKO C;  3JCM f;  2RHY A;  3UDC A;  3KUF A;  2XDB A;  3X26 B;  5GAN h;  1I4K 1;  3S3M A;  1M1K U;  1N9R A;  2F5K A;  5LJ5 j;  2RH2 A;  1NE8 A;  5D6Y A;  3QPH A;  1V29 B;  2VXF A;  1M1F A;  1AHJ B;  3MHX A;  3JSC A;  4JLG A;  4M77 G;  1QVG S;  1KC8 C;  2EJ9 A;  2P4T A;  4E7L A;  2QQ9 A;  4BI3 A;  2WSE E;  3FRN A;  2PVO B;  5A0G A;  5I2M A;  4ATO A;  3JCM c;  4M75 E;  2VXE A;  2M0O A;  3JAM E;  1VQL T;  4LDX A;  3M55 A;  3HB9 A;  2P0K A;  3L2Q A;  2RHZ A;  3CME T;  2EQJ A;  4J6X A;  2E65 A;  1VQ7 A;  2HQX A;  4LOC A;  5LJ3 h;  2R5M A;  1WQ7 A;  1ZQ1 A;  4KUL A;  2FL7 A;  3V7C A;  4NL2 A;  5L8R E;  4BBR M;  1M9S A;  2O01 E;  4JRK A;  3C12 A;  3V8J A;  3JCM Q;  3MP8 A;  1YI2 T;  4ZTJ A;  4C92 G;  5GAN 3;  4V2S A;  4EMG A;  5LJ5 e;  5GAN 8;  4XTX A;  1FWZ A;  4RMO A;  3C95 A;  1K73 U;  1D3B B;  4IUR A;  5GAN g;  4ELJ A;  2GFA A;  3HRS A;  2YLC A;  2KAF A;  2L5Q A;  3JCM e;  3ZBD A;  3J81 E;  3PIO A;  3I56 T;  1Q86 U;  1QVG A;  2K5F A;  1UGP B;  4XTW A;  1VQ5 A;  1JBM A;  4M7A A;  3VKI A;  2A7Y A;  1JB0 E;  3HP9 A;  1BI3 A;  4PJO F;  3J7A F;  2EQK A;  4M7D A;  2DAQ A;  4HCB A;  2YLB A;  4NL3 A;  2XID A;  2RA2 A;  3QII A;  2DTH A;  4L59 A;  1EIF A;  4PJO A;  4IKF A;  3M58 A;  2LDM A;  3P8B B;  2KK4 A;  3C4S A;  1IRE B;  2WSC E;  2ZPH B;  1Y96 B;  3PMI A;  5M9O A;  5GAM g;  2GFU A;  4EMK A;  2ZPF B;  4C5I A;  4F7U F;  1WGS A;  3RIR A;  1VQM A;  2L3R A;  2FHD A;  4BE1 A;  2MWP A;  4B9X A;  4F7U A;  2DZC A;  3DKM A;  3E9F A;  5CKH A;  3CCS A;  1BIB A;  4KBM B;  3RKW A;  5GMK h;  3CC4 T;  2QA4 A;  4DQ2 A;  2CGH A;  2CS7 A;  2K5L A;  4RKU E;  1QP2 A;  4BY6 C;  3OYB A;  1HXD A;  2PQW A;  4C8Q F;  4N4I A;  3PTA A;  4ZGJ B;  4M75 G;  4LDU A;  3JB9 H;  4II1 A;  2K3X A;  4XU3 A;  4NOY A;  4C8Q A;  5C6S A;  3KXT A;  2F69 A;  4FSX A;  2QQA A;  2E6Z A;  5FRM A;  1QVP A;  1VUB A;  4BE0 A;  1YHQ T;  2HQE A;  1M90 C;  3HO8 A;  2DKG A;  5GAN d;  3CCQ A;  2DK3 A;  3G7Z A;  3QHS A;  3TW7 A;  3CC2 A;  2BUD A;  4L6V 5;  1ZHI A;  2XK0 A;  2EIF A;  5IT9 E;  3BDU A;  4M77 C;  1VQ4 T;  3V7R A;  3CPW S;  3DB3 A;  5CQX A;  5GAO n;  2K57 A;  4J8O A;  3OYF A;  3QZ9 B;  1XNI A;  2DD4 A;  1BI0 A;  2X4X A;  4J6W A;  4QQ6 A;  4C92 D;  4AKI A;  3A8H B;  1S72 A;  2MI6 A;  2DXU A;  4KT0 E;  2WAC A;  3GF5 A;  1WPY A;  4QQD A;  1M90 U;  2XU8 A;  4M78 C;  1QVF S;  3JB9 G;  3L2U A;  2QQS A;  5IAY A;  4GY5 A;  3DLM A;  1LNX A;  2KVQ G;  4X9C A;  2EJF A;  4JUV A;  4AKH A;  3RUX A;  5LJ3 d;  4ELZ C;  2VGM A;  5GAM f;  4M7A D;  3G71 T;  4MDX A;  1NPP A;  1VQO A;  4XTY A;  4M7D D;  3QJY A;  2XDD A;  2DD5 B;  3I55 A;  4BE2 A;  3QXE B;  2LT1 A;  3OA6 A;  5CQY A;  3NTK A;  3PFS A;  2Y4Y A;  5GAM j;  1NJI U;  1X75 C;  4QSH A;  2LT4 A;  5GAO m;  1I8F A;  4C92 E;  4OB1 B;  4E47 A;  3A8O B;  3A8L B;  4HLQ A;  3SD4 A;  4A4E A;  3QZ5 B;  1XOV A;  2P0P A;  4EMH A;  2CZ6 B;  2ZGW A;  2VC8 A;  1KHI A;  3PIP A;  3G6E T;  3JB9 J;  3WXM B;  1OI1 A;  4XU0 A;  3CCL T;  2KMT A;  3HBL A;  2OTL T;  3M57 A;  3QO3 A;  1OZ2 A;  5GAN e;  5GAO r;  4M7A E;  4HT8 A;  4MFD A;  4JS5 A;  1K9M U;  4M7D E;  1QVF A;  1PSE A;  2RI2 A;  3OS2 A;  3HL8 A;  1LOJ A;  4A4G A;  2RM4 A;  5I21 A;  2CKK A;  4LDY A;  3OYY A;  4E7J A;  1UGQ B;  2ZZD B;  3M54 A;  5GAN 4;  4JRP A;  2LC4 A;  4MML A;  1KD1 U;  5FRN A;  3CD6 T;  3BY7 A;  5HK0 A;  2DZ9 A;  2DEQ A;  1MGQ A;  3FDR A;  3F70 A;  3MP6 A;  4A4F A;  3OYC A;  1UGS B;  4N0A C;  4OMF B;  1I81 A;  2YRV A;  3VYG B;  4YTL A;  4F7U E;  5GAM e;  4JX4 A;  2MAM A;  4OGC A;  1M5Q 1;  3RER A;  4LD9 K;  2MF2 A;  4MIM A;  5LJ3 e;  4IUU A;  4WF2 A;  2HAX A;  4Y28 E;  4M75 C;  4C5H A;  3OMC A;  5GMK m;  3CXC S;  4PL6 A;  1DJ7 B;  3SWN C;  3S6W A;  3JRZ A;  1VQ8 T;  5A2Q E;  3ZEH A;  4DOV A;  3RES A;  1E7P A;  4BY6 B;  4OB2 B;  2EWN A;  2JTM A;  5DY9 A;  2K4Y A;  4JLI A;  4C0G A;  5GAO p;  3OYL A;  3OYH A;  3L2R A;  3JB9 D;  4FL6 A;  1YIJ T;  3LWH A;  2K2V A;  2WJ9 A;  2MWO A;  2RJE A;  4JJN K;  1BI1 A;  4MDW A;  5CKF A;  3CC4 A;  3RKX A;  3TEE A;  3QWL A;  5CR2 A;  4BD3 A;  1UGR B;  5GAN 2;  1VQ6 T;  3A8M B;  3P8H A;  4C5G A;  4MZP A;  4M77 F;  2BS4 A;  1M1G A;  2XIC A;  2L89 A;  3JCM V;  4BB7 A;  4BAC A;  4E7H A;  3CCU A;  3GNG A;  1D3B A;  2D0Q B;  3JCM P;  1K8A U;  1VQ9 A;  3CBM A;  3MEV A;  3SB2 A;  3JB9 I;  4M77 B;  3QJ6 A;  1NZ9 A;  2G77 A;  3CMA T;  4Z02 A;  2DPP B;  4M78 F;  5D6W A;  4HL4 A;  4MMK A;  3FIF A;  5CKE A;  1VQN A;  1Y7X A;  3CXC A;  4M7A G;  2RD1 A;  5KCO A;  2DIG A;  2RJF A;  3V8K A;  4ZN1 A;  4LDV A;  2QEX T;  1YJ9 A;  4M7D G;  1H3Z A;  2EKO A;  4IUV A;  4M78 B;  4PJO G;  1OYX A;  1YIT T;  2DXC B;  4ZTF A;  3CCM T;  1Q7Y C;  1Q82 U;  2PVD B;  2OTJ T;  2ZCF B;  1Y96 A;  2LQK A;  3A5Z B;  5GMK e;  4QVZ A;  2BIV A;  5A0D A;  4HCC A;  3EFS A;  2RJC A;  2KY9 A;  2B8A A;  1JRI A;  3EFR A;  4ZGE B;  3PGG A;  4KUI A;  1YJW A;  3R6O A;  1X6O A;  3DB4 A;  5LJ3 g;  4C92 B;  3OSV A;  4F7U G;  3OB9 A;  5FU6 C;  1M1K C;  3JCM J;  4HT9 A;  1G3S A;  3SFM A;  1BI2 A;  3TCJ A;  3PMT A;  4JX5 A;  4ME7 A;  3CCE A;  2E12 A;  2VUB A;  4CRI A;  1NPR A;  2FB7 A;  2JVV A;  4J7I A;  3RKY A;  4ZN3 A;  3CCV A;  2K5I A;  2BKD N;  3UWN A;  3CCJ A;  5LJ5 h;  3ME9 A;  4C8Q G;  3HFN A;  3GOX A;  2P0Q A;  5EJC A;  2XHC A;  3GNF B;  3MEA A;  1YJN A;  2VV5 A;  4IUP A;  2BS3 A;  3JCM h;  1VQP T;  2LTO A;  1HK9 A;  3QG1 A;  2QI2 A;  3ZFJ A;  2D6F A;  2PUO B;  2M16 A;  1OZ3 A;  3OYD A;  2LNV A;  3BG5 A;  4MZT A;  4J6Y A;  4QW2 A;  3G4S A;  1VQ7 T;  2GCX A;  4ZGD B;  3FJP A;  3MEW A;  2ZPE B;  1O9S A;  1N9S A;  3C94 A;  3N5B B;  5GAN f;  1G5V A;  1UEB A;  2RI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...