2ZPHB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 340min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zphB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zphB02
4ZGDB 1UGSB 2PVGB 2DD5A 4FM4B 1DJ7B 2WSEE 4XK8E 2AHJB 2CZ6B 3A8LB 5L8RE 2ZZDB 2ZPIB 4OB3B 2WSCE 2PVOB 1UGRB 3X26B 1UGPB 1PSEA 3QZ9B 3QXEB 3WVEB 2CZ0B 2ZZDA 4L6V5 2CZ1B 1UGQB 3X28B 3VYHB 3A8OB 2QDYB 2ZPFB 1AHJB 2DPPB 2DD5B 2ZPGB 1IREB 4OB1B 2PU9B 3X20B 2ZCFB 3QYHB 4RKUE 2CYZB 2WSFE 2DXBA 2PVDB 2DXCB 2DD4A 3VYGB 4OB0B 4ZGEB 2PUOB 1V29B 3A8MB 3LW5E 1JB0E 3QZ5B 2CZ7B 3X25B 1PSFA 4OB2B 2ZPEB 2PUKB 2D0QB 4KT0E 1QP2A 3A8GB 3VYGA 2DD4B 2DXCA 4Y28E 1QP3A 2ZPHB 2ZPBB 3X24B 2DXBB 2O01E 4ZGJB 3A8HB 3WVDB 3QYGB 1GXIE 3HHTB
chains in the Genus database with same CATH superfamily
1QMCA 3E19A 4J9BA 3EGDB 1YIJQ 3GLXA 1D3BA 4C5IA 2DVJA 4F17A 4EMGA 1HSQA 2HKNA 2XG8D 2FO0A 1YIJA 1OKVB 4JRQA 1VQ4A 5DQVA 1WI7A 3MKDA 1YFNA 5EG2A 4FL6A 1YJNA 3ULRB 4M78F 4EMKB 1RACB 2JM9A 2JS0A 4F7UG 1OV3A 3OYLA 1QWEA 2DXTA 3M0PA 5HBHB 5EJCA 1YIJT 2QI2A 8ATCB 5ACBA 3FJ5A 2KDSA 3MO8A 4BDZA 2RHUA 2C06A 1B07A 2VC8A 4D8DA 4OGEA 3R6OA 1Y07A 3UF4A 4GLMA 1KQ1A 5GANh 4A4GA 4E47A 2LT4A 4CC3A 4M7DC 1KQSA 3JSCA 1K8AC 1H1RB 3MCAB 4AMCA 1OGUB 3LH0A 2ZAEA 5IHYA 1OQKA 5AT1B 1ABQA 3RDVA 1E6HA 5CKEA 1K4US 5KCOA 1WDXA 3E9FA 4HCCA 2YLBA 3VYGB 1Y0MA 2ENMA 2IVXA 3EJ1B 2GFAA 5LL6S 3R6NA 1V29B 4KULA 3H4CA 3QHRB 3G1JA 4Y92A 3MY1B 3LX7A 4NC6A 3JCMf 1ZLMA 3KUFA 2KNBB 2NUPA 2RPNA 1C9BA 3MJXA 4KRCB 4PJNA 5M9OA 1MUZA 5GAOm 2DO3A 2KXDA 4J9GA 4Y91A 5GAMe 1JJ2P 1ZBXA 4D8KA 2K79A 4Y28E 1IHWA 4V2SA 1QP3A 1AWOA 1BI3A 2CT4A 3CBMA 1NZ9A 4XU2A 4PJMA 4ESRA 2LC4A 1VQ8Q 5I2SA 4M7DE 1URCB 2BE7D 1M2VA 1VQKA 4JX4A 1TUCA 2DMOA 2IG0A 1WLPB 3E9GA 4JLGA 1WYXA 2QGGA 2D8HA 1WHHA 2RQWA 4EOKB 4IKFA 4M4ZA 2B9RA 2NLUA 4QQDA 2DL5A 3QXEB 1M1GA 3CC2Q 5GAMf 5IN1A 3SWNB 1CKAA 4ZTFA 1VQ8A 3I5RA 4II5B 2B8AA 1D0YA 2A36A 3MIAB 2RQTA 1W98B 1P5EB 2KRSA 2ZPGB 4OB1B 1W1FA 2KVQG 4IUUA 4NL3A 1UHFA 1YJWA 1YN8A 3SWNA 3EGXB 1M90C 5GAN5 3BW1A 1H26B 2XMFA 1OIUB 4F6UB 4A53A 1M2VB 1ZQ1A 5HNBB 1NEGA 1YCYA 1QMZB 5LJ5f 1WXUA 2AZVA 1PKTA 5I11A 3FRNA 3CCEA 2HSPA 4HLQA 1SG5A 2KMTA 5GAOp 4E2FB 1UJ0A 2O88A 1YHQA 4Z6YA 1V76A 5KYUA 3I55Q 3CCMA 4XTYA 4KRTA 3CCSA 3CCJT 4LDWA 4LDXA 3QJ6A 3M03A 4J83A 2W9ZA 2RM4A 3GNGA 1YITT 4OMOA 1QCFA 2K9GA 4ZGJB 3M0SA 2H3EB 3OSSC 4E7HA 4F7UE 4MFEA 1VQ9T 1H27B 3EFRA 4RTWA 1BI0A 1Y96B 3BFMA 2W99A 2L0AA 2OAUA 3HHTB 1TG0A 1D0ZA 1B34B 3TNIB 1M9SA 1WQWA 1AWXA 2NUPB 3KFVA 2F2CA 2DZCA 2J6OA 1VQMQ 2BKDN 4BCHB 4AT1B 4WF2A 2XDDA 3OYGA 4HCZA 3M53A 2BKZB 2R7GA 1WX6A 2JXBA 4RODA 2DL8A 3JV3A 3FDRA 4GBQA 2E5KA 1O9SA 3VS2A 4CFUB 1IHVA 1W2BS 2A7YA 3CPWP 3QZ9B 3RMSA 3CD6A 2M02A 1WA7A 1M3BA 2DL7A 4M7DG 3WVEB 3RBBB 5L23A 1G8XA 1Q86U 4F7JB 1TD6A 4A4HA 1MMAA 2ZPFB 2DAQA 4KRDB 4Z02A 4JDSA 2K57A 4ZNXA 2V1QA 3QJYA 2QEXA 1WQ7A 3JCMb 4EMKA 1W70A 4QVCA 4XQ3A 3X20B 1VQ7T 1VQ6Q 4RKUE 4PFOA 3LQ5B 1BI2A 2LVMA 3JCMe 2DXCB 3BG5A 4B9WA 4C0DB 1EIFA 5IHNA 2EYXA 1H1QB 1U8RA 5D7UA 5IH2A 2K2MA 2EJGA 2HSEB 3OS1A 3TQ7P 5GAOq 4HXJA 5GAN2 1QVGS 1XTDA 2FYKA 3HRSA 2HD0A 2VGMA 4EOOB 3GIBA 3UA6A 1VQLT 2CJMB 2DEQA 5GJVB 4XTZA 5DY9A 4MMLA 3C12A 4C92C 3JB9G 1YI2A 1LVKA 4KUIA 1O75A 2F2VA 4F16A 1QLYA 4BE2A 5IAYA 4X1VA 3QYGB 3CCQQ 3URGA 4C8QF 6AT1B 2C5XB 1NPRA 1CKBA 2CP3A 2L5QA 1M1KU 1WJRA 3UWNA 3G71T 4OGRB 4I3ZB 1X69A 3H6ZA 3CC4T 1J3TA 3CMAQ 4PFZA 2K5IA 2R5MA 1W6XA 2DEUA 2ROTA 3VS4A 3E1SA 3CCJA 4M78A 3PIPA 1KQ2A 2DE0X 3CCMT 1GUXA 2VB6A 2KXCA 2YT6A 1UGRB 3VS5A 2KY9A 1FWZA 3DKMA 3M54A 2P84A 1BU1A 3L2RA 2JS2A 2BPMB 2A0FB 2EYZA 2W10A 2RI5A 4G6LB 3BHUB 4N4GA 1MMNA 4BI3A 2XICA 3CCVA 3V7RA 1UE9A 2WEVB 1UJYA 3GOXA 1WIEA 2M9UA 4FIBA 2X9HA 1Z9QA 4JJNK 2MWPA 2J7IA 2QQAA 1X6OA 2QTXA 1YHQQ 2OAWA 2QASA 2KEAA 4QKUA 4X9CA 1FMWA 3PE0A 5CO7A 2EGAA 1O9KA 5LMKB 2BUDA 2X4JA 3HSBA 2AKKA 2W96A 2E3IA 1ZX6A 4CFMB 4HNVA 4IIMA 1Q82U 4M7DD 3CCST 3S3MA 2GTOA 5LJ5e 5KYNA 3UA7A 2E70A 1QVGA 2CREA 2LW4A 1GFCA 4JJDA 2VXEA 1NEBA 4CC2A 1UG1A 2L3RA 1Q86C 1VQPQ 3G33B 2MMPA 3SFMA 1TH7A 2OJ2A 4KT0E 5KYWB 4MMKA 4FYXB 4CFVB 1BCMA 5J3BA 5BNJB 1V1CA 2RK1A 2XHCA 2LNVA 2DXCA 4DOWA 4IUQA 1PD0A 1YP5A 2RJEA 4PJOG 3OYEA 3H0IA 4M75G 1VA7A 2HQEA 4GY5A 1Y71A 2D6FA 1YJNT 3CD6Q 1PNJA 2MWOA 5GMKh 1KD1C 4EMHA 2DD5A 3FB9A 2J05A 3OYIA 3JCMc 1Q81C 1I5OB 1ZA2B 1VQPT 3OMGA 2C0TA 4R55A 3CCLQ 2RHIA 3F70A 4DBRA 5L8RE 4OMMA 4E7LA 1AD5A 3HP9A 4F7UA 2RHYA 4PJLA 1VQKQ 4JS5A 2HMAA 3NTKA 3ZFJA 1VQ6A 2ZZDA 3SDZA 3X28B 2YRDA 3ER0A 2KQWA 3B57A 4BI4A 4RCCA 4J9DA 1QW1A 1RLQC 3EHRA 3L2UA 3EFOA 4C5GA 1VQ5Q 5AYFA 3H0HA 1OI9B 4HL4A 2HEQA 3ZBDA 2L8DA 3MEAA 3M4YA 3CCJQ 4C0ZA 2FEIA 1OI1A 1HXDA 4E6RA 2DA9A 3I55T 1VQOT 3GP8A 3JCMh 3LLRA 1VQ9A 4JS4A 2CT3A 1VQ9Q 1EZZB 5GAMj 2P0KA 2X4XA 4JRKA 5LJ3d 1GBRA 4C92G 2DVEA 3OS0A 3JB9D 3FIFA 3HFNA 3X25B 1OX8A 3DLMA 2E6NA 1IGQA 4EONB 3V8LA 1LNXA 1H25B 5GJWB 2KR6A 3FJPA 2QGSA 4BCMB 5CCAA 5GMKj 2PK2A 4J9FA 4ANJA 2DD4B 3OYDA 4AKHA 3CCRQ 4M7AD 4F14A 1F1BB 1X6BA 4HVUA 1Q86R 4QQGA 5HVYB 5DQWA 1M90R 4II1A 3EHQA 3HFOA 3I5SA 5FW9A 4EOIB 3QKJA 5HK0A 3U23A 4L5GA 2DRMA 2F2XA 4JZ4A 4AFQC 1F5QB 1YJNQ 2QG9B 3VKIA 5C0MA 2I0NA 4M75D 1AZGB 2GQVA 2PHGA 1N8RC 3V7CA 2CCHB 4PL6A 2E12A 3X26B 3SEMA 2WFYB 1GCQC 2GNCA 4HNUA 1ZP2A 3PMTA 4C8QA 1WFWA 4N4HA 1RL2A 1K8AU 1BIAA 2YRVA 1AHJB 1UNHD 1UDLA 1LOJA 4D6WA 1JO8A 3MI9B 3POMA 2MI6A 1VQPA 1G3SA 2E1HA 4HT8A 1B3QA 5A0GA 1YWPA 4GLKA 2E41A 4IURA 1VQ5A 1PRMC 3LWIA 1W4SA 3BE3A 4KGXB 1JEGA 1AOJA 2HBPA 2X35A 2G6FX 2DLPA 5KH6A 1YHQT 3OBYA 3EOCB 3M0QA 2JMAA 1PKDB 4C92A 1AT1B 2QA4Q 3VKGA 2NUZA 4OMPA 5GANe 3EG9B 4XU3A 3NDQA 2CZ7B 4F6SB 1U3OA 2K3BA 2DL4A 3MEVA 1WHKA 2O9VA 4BY1X 3O0GD 1N8RR 2RO0A 1K9AA 4Z88A 4X34A 3CQTA 3CMEQ 1E7OA 2DBMA 1XJWB 1YI2Q 4M78B 3I55A 4VUBA 3VYGA 3OYNA 3CCMQ 1H3ZA 2IW6B 1FMKA 4Z89A 1G3TA 3BG9A 2RB6A 2K3YA 3TW6A 1H92A 2CDTA 1UHCA 1VINA 1C0MA 1U5SA 4MZMA 3TCJA 3NTHA 1I81A 3INZA 3M0UA 2FPDA 3CC7A 2R57A 4ZGDB 1VQOQ 2PK9B 2VV5A 3C4SA 2FZCB 1AWJA 2I2LA 4RG2A 1PKSA 1GH6B 2CP0A 3LWHA 3PIOA 2CZ6B 2JMCA 3V8KA 3M0RA 2K5LA 4N0AA 4BY6C 4L59A 2ZPIB 2PMIB 2EWNA 4OB3B 2KYMA 3PMIA 3OYMA 4DBHA 4PJOF 2HZYA 2KSSA 2BZ8A 1JJ2S 3NPFA 4M75F 1NM7A 1UNGD 1IRXA 1EFNA 1E6GA 3NGPA 4HVWA 2WIPB 5FU6B 3QHSA 3ZEHA 4XU1A 2EYQA 5L2WB 3GTMS 4N4IA 2YRCA 3JB9I 3TN8B 4J9EA 3JRZA 3C0CA 2NUTA 1I8FA 1JBMA 2GGRA 3NMZC 3UATA 1VQ5T 4FT4A 1TSFA 2LDMA 2LQ8A 2RMOA 2L3SA 1SRMA 3IQLA 1KQSP 2O4XA 3M4GA 1K73U 2MYSA 2RHXA 4EOLB 2J6FA 4PJOC 5GAMg 2GQIA 2E64A 2DNUA 2RD1A 2JNGA 3TNHB 2C5VB 2RI2A 3QZ5B 5LQFB 1FYNA 3RUXA 4CXAB 2X1NB 1XO2A 4M77A 1PD1A 1ZA1B 3LYIA 4JX5A 4C0GA 3RMQA 2MCNA 1YNZA 3L2WA 1VOLA 2HCKA 4KH0B 5ECAA 4BY7X 2WJ9A 1G3NC 4FT2A 4F7LB 2YXYA 4WTOB 3CCQA 2ZPHB 2RNAA 5GANj 1GCQA 1YITA 1KQSS 3EAEA 1PCXA 2HQXA 3MY5B 1FVVB 2FL7A 3EG9A 5LJ5g 2FG0A 5CAIA 2DM1A 2RJCA 4PJOA 1K76A 2DMEA 1B34A 4BD3A 1PC0A 1KHIA 2IIMA 2J6KA 4FM4B 1WPYA 2AT1B 3HRTA 4BCJB 4C0DC 2V8JA 1C6VX 4M78G 4EOQB 3PVLA 3VJPA 3QO3A 2F5KA 1MNDA 3OS2A 2KYBA 1N9RA 5KYXA 1K0SA 3ZL7C 5FU7C 4DBQA 1AD6A 1PSEA 4IUPA 4F7NB 1FMVA 3VS1A 1AZEA 2CZ0B 2CZ1B 1OL1B 3P8DA 2QDYB 3UPUA 4NS5A 3JB9H 4BCIB 2MOXA 4C8QB 2LZ6B 3JCMQ 4K11A 2L3PA 3O8VA 4C92D 5IT9E 2VKNA 3L2VA 3G4SA 5LJ5j 3CC2A 1KD1R 2SRCA 1X2QA 1XQHA 2BZXA 3H8ZA 1RAFB 1M1KC 2M16A 1Y57A 2GF7A 3A1PA 5D6WA 2EW3A 3TEEA 2KBTA 1GBQA 5FWCA 3VS6A 1TUGB 3LH5A 2K2VA 1QVFP 2DD4A 2KE9A 4LE9A 1KD1U 1Q7YU 3NHNA 3MEWA 2V1RA 4F04B 5CKHA 2W9FA 2XU8A 2G77A 1QLBA 3A8MB 1N4MA 2I53A 1I0CA 1NYGA 1NYFA 2FZGB 1MV3A 1W2BP 4FYWB 1H4LD 2HKQB 2K7AA 1YITQ 3CMAT 3CC7Q 5FRNA 1H641 2X4WA 2YUNA 2QEXT 5LJ3e 1QCNA 4XTUA 3RR6A 2EKHA 3VRYA 1NJIR 1VQ7A 2GFUA 2I40B 2ZPBB 1BKBA 1Y7XA 1HYOA 3CCRA 2QQSA 1TTHB 3CMEA 3HZJA 4FX3B 4AFZC 3HB9A 1NBEB 5FWBA 2IVWA 2JJ9A 2OI3A 2RJFA 2OTJQ 2KGTA 2QA4T 1UGSB 3CCVT 4CC7A 4AI6A 3EFSA 1VOMA 3EFOB 5IXBA 1NJIU 4HNTA 1KFZA 2L2PA 3G71A 4PJJA 5CKFA 2QTVA 2QQ9A 3E2UA 3T9NA 3G71Q 2UUEB 2ZZDB 3EH2A 2K5FA 2JOYA 3BLQB 4EC9B 2CGHA 2D8JA 2ECZA 4AFUC 4OMLA 3JCMd 2DTHA 2MIOA 3S6WA 1VYVA 1X43A 3DJBA 4RTZA 3CXCA 3VS3A 5DM7R 2NYSA 4F7UB 1R77A 3M0TA 3SB2A 1UGQB 1MGQA 5LJ3f 3CPWA 4ZTJA 3BHVB 4EPCA 1CSKA 1VIEA 3OW2A 4FW2A 3EH1A 4M77E 3REAB 4QVZA 3CC2T 2DD5B 5EFQB 1G2BA 1X75C 2EQJA 1ACMB 2PU9B 2O4XB 4EMKC 4JUVA 1OL2B 4CFXB 2ZCFB 4OR5B 1R0BG 2JGZB 1GRIA 1T0HA 3DTOA 2PJQA 1UEBA 4PFPA 4FW1A 2DXBA 5I2MA 4JPBW 2ATCB 4HCBA 2XI9A 1S72T 3HBLA 2M1HA 4TVRA 4C92E 3L42A 3I9QA 2RN8A 4E7ZA 2DZ9A 1G83A 1WJQA 1TU0B 4QT7A 2BE9B 1VQ8T 1PSFA 1UGVA 2BS2A 1QP2A 1NLOC 4BCGB 2KAFA 3G4SQ 1T3SA 2FHDA 1QQJA 2JTFA 2BS3A 2AK5A 4RTYA 4HA8A 2EYWA 3MP1A 2FB7A 2LCCA 2LT1A 2CP2A 2EBPA 1VQKT 3BHTB 3CC4A 2LJ1A 3QDFA 4DEYA 3EGDA 1K9MR 5KE3A 4ROCA 1I4K1 1MMGA 4HKEA 1UB4A 2PVGB 2IW8B 3RKYA 1TOVA 2QGFB 1OEBA 1YI2T 1H1PB 4XK8E 5I5ZB 4ELYC 2JTMA 1AEYA 3I56T 4WCIA 5IF1B 3RGFB 2AZSA 5CIUA 1U1SA 5FROA 4M75C 4J6XA 1SSFA 1GL5A 2LQNA 4FU6A 1VQMA 3ASKA 2H3JA 3FLGA 3QPHA 4P5NA 2D1XA 4LOCA 4IUTA 3G6EQ 3CCUQ 1GUXB 3QHWB 4M7DB 5KE2A 1N6AA 2FZKB 3OB9A 4PK4A 2LQWA 2C5OB 2WIHB 2L3QA 5HBEB 3MPUB 3G7ZA 1K0XA 3CMET 5CVIA 3OY9A 1KK7A 3QWYA 3Q1JA 3OYAA 1JSTB 1OU8A 2H8HA 3D7SB 1IREB 3CCSQ 5ICPB 2VGNA 2J06A 1JU5C 5A2QE 2YSQA 1ZBJA 2QYZA 2GCXA 3H41A 3OMCA 3OQ5A 4JZ3A 3RKXA 3BDUA 2KMGA 2PZ1A 2CSIA 2AIRB 2A37A 4YC3B 5CQXA 1I5LA 2M0YA 2BIVA 2XIDA 5HQ0B 4YOZA 1SHFA 1RAEB 1FXXA 2FVUA 2Y4YA 1JB0E 2XK0A 2YUOA 3I56A 3CD6T 5CKBA 3CCRT 2C4GB 1KC8C 3M56A 1BYMA 2V22B 4M7AA 2ED1A 3GNFB 2IN3A 2COYA 1ZSGA 5I21A 5HY6A 2DL3A 1ZUYA 2FRYA 2EYYA 1UTIA 1FKMA 5DLOA 1SSHA 2DERA 3M57A 1N9SA 3A8HB 1X01A 1VQ4Q 1D1CA 3DB4A 3JCMX 2V8KA 4IIOA 1D0XA 1JQQA 1SRLA 4ZN3A 1QCOA 3QUIA 5EC7A 4RUGA 2WACA 2JUFA 5CK9A 4J5YA 3CXCS 3NFCA 2NWMA 3OYBA 2K6DA 3M59A 9ATCB 1K73C 1D1AA 2E4HA 3M9QA 4ELZC 2YDLA 1LCKA 4KGZB 1TWBA 2DX1A 3ME9A 4CFWB 2LQKA 3EG0A 1KHCA 4DEXA 2CH4W 3NTIA 2P4RA 2QK0A 2EQMA 1OZ3A 2RH2A 1WGSA 1JXOA 3QWLA 3VV0A 2JT4A 4BCMD 3CCLT 2F2WA 1BK2A 5FU7B 4FYVB 1QVFS 3VS7A 1QWFA 2EFIA 3OS5A 4BBSM 2OTJT 2QQRA 3GF5A 1UECA 3G6ET 3FC3A 4J9HA 4BUGA 4R0KA 2D9TA 1U06A 3SHWA 1TUDA 1JKWA 3LW5E 7AT1B 2QAZA 2QF7A 3QWXX 3L2QA 4RTVA 5GMKl 4IMYB 4EOSB 5CKDA 1T3LA 1K73R 2QFZA 1R0CB 4XU0A 2Y4XA 2HQHA 4AKGA 1UFFA 2ED0A 2OTLT 3META 4EOMB 1Z9ZA 4M78C 1RABB 5LJ3h 2YLCA 3L2ZA 1EX4A 4RTXA 5LJ5d 3WXMB 5KYUB 1QKWA 2EKOA 4N0AC 2KROA 4BDYA 2QDLA 4J8OA 3CBOA 3X24B 2O01E 3EGXA 1C1AA 3JAME 3PO3S 3WVDB 3PNWC 4C0FA 1E7PA 4MZTA 1VQMT 2OTLA 4BBRM 3DB3A 1AVZC 2LX7A 4BCQD 2KK4A 3OW2P 3OYFA 4A4KA 1M30A 5CEIB 5GAMh 2EVRA 2WSEE 2LJ0A 1IZ6A 4ATOA 2OTJA 4LUEA 4F6WB 2C6TB 5IDPB 1H3HA 3REBB 4LUDA 3S3OA 3S3NA 2PNIA 3OYYA 3THKA 2LRQA 5FGKB 1VQNT 5KYWA 1TFBA 4AG1C 5GMKi 5A0DA 1YJWQ 2DETA 1M4ZA 3MHXA 5KYYB 4A4FA 1Q81U 5J26A 2QEXQ 3UDCA 4M77F 4MDWA 1WHGA 1KSWA 2JVVA 5FU6C 2EGEA 2L89A 1NG2A 3TW7A 1A0NB 2RQRA 3JCMg 5KYXB 4M78D 2MPXC 2YWWA 2DJQA 4XTXA 5CQYA 5IXFA 1Q81R 3SWNC 3C95A 1XNIA 4KBMB 4LNPA 5GAN4 1U1TA 2E6ZA 2HL5C 1OKWB 4EOPB 4KGVB 3G4ST 1M1FA 4Y72B 4A4EA 3DLLA 5LJ3j 2LX9A 2PUOB 4BACA 2VYTA 4BCOB 1ZSZA 3DDPB 4TTHA 1WXTA 4LD6A 1WNLA 1YJ9A 3JCMJ 2FRWA 2DRKA 2D0QB 2Y90A 4BCPB 1Q7YR 2KRMA 4JRIA 1Q82C 4J9IA 4B6MA 5FRMA 4E7KA 3QYEA 4JJCA 3RIRA 2DYBA 2DTOA 2UZDB 3CCUT 2C0OA 4PJOB 2EUFA 1SEMA 1WJSA 1VYWB 1PG5B 1X27A 1H24B 4JLIA 4LDYA 2LCSA 3JCMV 1T0JA 1OX9A 3J80E 2HNIA 3CCQT 4C5HA 5FLXE 1K8AR 3JCMP 4BCKB 1HK9A 4A63B 5GAN3 3TNWB 3JB9F 1MV0B 4M7AE 2AKLA 5HK3A 1GFDA 4ELJA 4YOSA 3A5ZB 2M51A 3MEUA 2P4TA 1ZUKA 3TREA 2QDJA 3VUZA 4XTVA 2DFUA 3OBWA 5GAOn 4C8QG 4EDUA 2CS7A 2RF0A 3VUBA 4C8QE 1IO6A 2WMBB 3HTRA 2G9XB 3P8BB 2CUDA 4M78E 3VU3C 1KXUA 2NUTB 3EG3A 4M7AG 5A0LA 2K4YA 4OVAA 5C6SA 2ESWA 2PQWA 2BS4A 3OYJA 2DBKA 2GTJA 2YUQA 3QSUA 4DOVA 4CFNB 4L6V5 4BY6B 1KJWA 3VYHB 1OZ2A 5HKCA 2O2OA 3G6EA 1RAAB 2JN0A 1K9MC 3L1AA 4C8QC 2IW9B 1FX7A 2SEMA 1M8VA 3JCMW 2F1LA 1R8OB 5HBJB 3BDLA 4PKCC 2WMAB 1IGUA 3AT1B 2P0PA 3KXTA 4OP0A 4MFDA 4BCFB 1S72Q 1H28B 1SHGA 4M7AC 2CYZB 1XOVA 2A28A 2EAYA 1WZOA 1VIFA 1I07A 1D3BB 3I56Q 2RA2A 2PVDB 4JRPA 1ARKA 2OX7A 3QYBA 3DOGB 2VVKA 4OGCA 1ZUUA 4CFUD 4OB0B 2FPFA 2DF6A 3HKSA 1UNLD 1N27A 4PLLA 4BCQB 2WXVB 2QA4A 1NPPA 2DTIA 2LJ3A 1KG1A 2JW4A 3I35A 1WXBA 2W0ZA 3EGUA 4MIMA 3M55A 4OB2B 1SPKA 2UZEB 4OMFB 1D3UB 1PHTA 2EJ9A 2CP6A 2HDAA 4FSSA 4LDUA 1JSUB 4ROEA 2C5NB 5GANg 5I22A 1SKUB 2QQBA 3VKHA 3FEOA 4J7IA 5CYIB 3RNJA 4OMNA 1M2OA 3RERA 3PVQA 4J7FA 1OIYB 3BLHB 1QVFA 2O9SA 3SD4A 3KBGA 4BCNB 3KHIA 1VQLQ 2C0IA 4JX6A 3K7AM 2V8IA 2EQIA 3LGFA 1Q7YC 1Q82R 4ELLA 4C8QD 1YJ9Q 1KIKA 1RUWA 2COWA 3EG2A 2VUBA 4C92B 1Y96A 1RI9A 1MNEA 4LN2A 1W2BA 5GMKm 2DJZA 2B86A 1VQOA 2RQUA 5GAOr 4M77C 1OOTA 4RG8A 1AWWA 4M75A 4X9DA 1KC8R 3HL8A 2DYIA 1ZSZB 1PWTA 1M5Q1 2KRNA 2EQKA 2BZYA 4M7DA 2VXFA 3M58A 2DXUA 2MAMA 1ZSZC 1VQ6T 3OA6A 4JJBA 2V26A 4BI8B 1ABOA 2KR3A 3CPFA 2LMJA 2R5AA 1MMDA 3V7SA 1JOWA 2R58A 3UT1A 3OYCA 1NLPC 2EJFA 3GPLA 3QYHB 2DILA 4PJOD 1VUBA 4PNOA 5KYYA 4RCBA 4E7IA 3EIDB 2F69A 8AT1B 1G3WA 2EGCA 4EOJB 1D1BA 1LPLA 2RJDA 2EPDA 4FYYB 2EIFA 3HO8A 4F7SB 2HL3A 4B9XA 2K3XA 2CH4A 5J39A 4J6YA 4ZGEB 5GAMd 5LJ3g 1IXDA 1OU9A 2COZA 4XAXB 1BIBA 2VWFA 1OPKA 4MZPA 4KH1B 4RTUA 2IPOB 3TSZA 4C92F 2P0QA 2E65A 4KUDK 4CRLB 1RI0A 1HJDA 3CPWS 2M0OA 3PT9A 5LJ5h 2DIQA 3F5XB 4O6JA 5D6YA 1PRLC 2ROLA 4E7JA 1YJ9T 4J9CA 3TU4K 2DXBB 4YOOA 3MP6A 4F7UF 1JRIA 2DKGA 2KI7A 4Z8AA 3OW2S 4DA4A 1FINB 1K1ZA 1OYXA 4R56A 2HAXA 2RK2A 4LD9K 1WHJA 1DJ7B 1QKXA 1Q95G 4M77D 1GCPA 2ZGWA 2AHJB 4NSTB 1D09B 1WHLA 1M3AA 3A98A 2EQUA 1NE8A 2JZ2A 1JJ2A 1VYUA 2LTOA 1JXMA 4ME7A 2CSQA 4UC4A 4E7SA 3OSVA 3J7AF 2JM8A 1H8KA 2WSCE 1N5ZA 4EORB 4CRIA 1OULA 1YCSB 2UZLB 4AKIA 2XDPA 4QVDA 3DL1A 2A3LA 5DLQE 1BBZA 2E3HA 5GAN6 2X3XD 1QVGP 1RAGB 1M90U 4RMOA 1UUEA 3OYKA 1BB9A 3CCET 2DPPB 3EG1A 3LGLA 3C94A 4PLIA 2UZBB 2WPAB 3CCUA 2W2HA 3GBQA 4M7AF 4BE0A 4QSHA 3PFSA 4HVVA 2ABLA 4AG2C 4BCND 4BB7A 2CP5A 3AHUA 2RHZA 4RTTA 4OMQA 4LDVA 3H0FA 3PGGA 3QG1A 1VQNA 4NL2A 4FCYA 4IUVA 4EIKA 1X2KA 1RADB 2ZPEB 3O5ZA 4Q5WA 3A8GB 3P8HA 1S72A 3BG3A 1RAIB 2VASA 3N5BB 4ZN1A 1GY3B 1S1NA 5GAOl 1P92A 2D0NA 1TXQA 3PTAA 2MF2A 4M6VA 1M1KR 2KT8A 2OTLQ 2YUPA 2A08A 1SF9A 2LNHB 4F70B 2BTTA 4ORZA 1VYTA 2G3RA 5KCHA 4HCKA 2DIGA 1MHNA 3RESA 2GBQA 3CCLA 2XDBA 1VQNQ 1ZHIA 4CC4B 2FPEA 2PTKA 4OF1A 1BCOA 4C5EA 5IDNB 2E5QA 1VQ4T 5GANf 5IHKA 2CKKA 3A8LB 2E10A 2LP5A 3CEYA 2F5TX 1IB8A 3TVTA 1N8RU 4LXCA 3J81E 2YHTA 2PVOB 3CMAA 4M7AB 1UGPB 3DDQB 5GMKe 2KT1A 3M5AA 1QVPA 3MP8A 1YJWT 5CR2A 1NJIC 1O9KB 3BY7A 4MDXA 3A8OB 4M75E 3CC7T 3TSWA 1G3YA 4BE1A 2WHBB 4PJOE 1BU2A 5IHIA 4CI0C 5GANd 1M8MA 2CP7A 2JTEA 4AFSC 1H1SB 2HBWA 2X4YA 2MK5A 4NOYA 4XTWA 4UN0A 3BLRB 5GAN7 1I1JA 4EC8B 1RAHB 4M75B 1OPLA 1AISB 3CBPA 4QQ6A 3QIIA 2WSFE 3OYHA 2X3WD 3CXCP 2X51A 1YBYA 2RI3A 4YTLA 1K9MU 3VS0A 4DBFA 3HPWA 4O5VA 4QW2A 5D6XA 3RKWA 1X6GA 4J6WA 2CUBA 3QBYA 3VRZA 1HD3A 1BI1A 2LCLA 1PM3A 1LJOA 2XKOC 1WHMA 4M77B 4HT9A 3HRUA 1YWOA 3QDRB 1G5VA 4DQ2A 1KC8U 2PUKB 2XD0A 2QQ8A 3CCVQ 3V8JA 1B7TA 1E9HB 4A54A 4M77G 1VQLA 3CC4Q 5GAN8 1VQ7Q 1TS9A 3JB9J 2O31A 1ENWA 1M27C 2CCIB 1M3CA 2RQVA 3CCEQ 1RLPC 2Z0WA 4FSXA 4BXXX 2QXFA 4M7DF 2DK3A 3H9NA 1GXIE 5HCKA
chains in the Genus database with same CATH topology
2QA4T 1UGSB 5GMKh 3CCVT 1KD1C 3MEUA 4EMHA 4AI6A 2P4TA 3EFSA 2QDJA 3TREA 4XTVA 2DD5A 4HNTA 3E19A 3FB9A 3VUZA 3JCMc 3OYIA 1Q81C 3G71A 5CKFA 3GLXA 1D3BA 3OBWA 3OMGA 4C8QG 5GAOn 4R55A 4C5IA 4EDUA 1VQPT 2CS7A 3VUBA 4C8QE 4EMGA 2QQ9A 2RHIA 3F70A 2XG8D 3T9NA 1YIJA 1VQ4A 4JRQA 5L8RE 4E7LA 3P8BB 2ZZDB 3HP9A 4M78E 3VU3C 5EG2A 4F7UA 2RHYA 4FL6A 2K5FA 1YJNA 2JOYA 4M78F 4EMKB 2CGHA 5A0LA 4M7AG 2K4YA 4OVAA 5C6SA 4F7UG 2DTHA 3S6WA 2PQWA 3JCMd 2BS4A 3OYJA 3CXCA 4JS5A 3OYLA 2DXTA 5DM7R 3NTKA 4F7UB 3ZFJA 1VQ6A 2ZZDA 3SB2A 3QSUA 3SDZA 4BY6B 4L6V5 4DOVA 5EJCA 1UGQB 3X28B 1MGQA 5LJ3f 3CPWA 3VYHB 3ER0A 4ZTJA 2KQWA 1YIJT 1OZ2A 2QI2A 4BI4A 4RCCA 1VIEA 1QW1A 4EPCA 5HKCA 3OW2A 2KDSA 3MO8A 3G6EA 4BDZA 4M77E 2JN0A 2RHUA 3L1AA 4C8QC 1K9MC 1FX7A 4QVZA 3L2UA 2C06A 3CC2T 2DD5B 2VC8A 4C5GA 3JCMW 1R8OB 4OGEA 5AYFA 3BDLA 3R6OA 1X75C 4HL4A 1Y07A 4PKCC 3ZBDA 2P0PA 2EQJA 2L8DA 1KQ1A 2O4XB 2PU9B 3M4YA 3MEAA 4JUVA 4OP0A 4EMKC 4MFDA 4A4GA 4C0ZA 4E47A 2LT4A 5GANh 2ZCFB 4M7DC 1KQSA 1OI1A 1HXDA 3I55T 4M7AC 2CYZB 1VQOT 1XOVA 1UEBA 2EAYA 3JSCA 3GP8A 3JCMh 1VIFA 2DXBA 3LLRA 3MCAB 5I2MA 1K8AC 1VQ9A 1M8VA 3LH0A 4JS4A 1D3BB 2RA2A 4HCBA 2XI9A 5CKEA 2PVDB 5KCOA 4JRPA 3HBLA 2M1HA 3E9FA 4TVRA 3QYBA 4OGCA 1S72T 4HCCA 2YLBA 3VYGB 4OB0B 4C92E 3L42A 3HKSA 5GAMj 2P0KA 2GFAA 2X4XA 1N27A 2DZ9A 4JRKA 4PLLA 5LJ3d 5LL6S 1V29B 1WJQA 4C92G 4KULA 2QA4A 2DVEA 1NPPA 3H4CA 3OS0A 2DTIA 3FIFA 3HFNA 3LX7A 3X25B 4NC6A 1PSFA 3JB9D 1VQ8T 1KG1A 3M55A 4MIMA 3DLMA 4OB2B 2E6NA 3JCMf 4OMFB 3V8LA 3KUFA 2BS2A 1QP2A 1LNXA 2EJ9A 2KAFA 4LDUA 2FHDA 2JTFA 2BS3A 2KR6A 5M9OA 5GANg 5GAOm 3FJPA 4HA8A 2DO3A 3VKHA 2QQBA 3FEOA 3MP1A 2FB7A 4J7IA 2LCCA 2LT1A 4Y91A 5GAMe 5CCAA 5GMKj 1VQKT 1ZBXA 2DD4B 3OYDA 4AKHA 4Y28E 4M7AD 3RERA 3CC4A 1QP3A 4V2SA 4J7FA 1QVFA 1BI3A 4QQGA 3CBMA 3SD4A 3KBGA 3KHIA 4II1A 1NZ9A 3HFOA 4XU2A 4JX6A 2LC4A 2V8IA 3LGFA 5KE3A 3QKJA 5I2SA 1Q7YC 4C8QD 5HK0A 4M7DE 1I4K1 4HKEA 2VUBA 4C92B 1UB4A 1Y96A 4L5GA 2PVGB 3RKYA 1VQKA 1W2BA 5GMKm 4JX4A 2DJZA 1YI2T 4XK8E 1VQOA 4ELYC 2JTMA 5GAOr 4M77C 2IG0A 3VKIA 3I56T 5C0MA 4RG8A 4M75A 4X9DA 5CIUA 1VQMT 4M75D 1U1SA 3HL8A 3E9GA 4JLGA 4M75C 5FROA 4J6XA 1SSFA 2GQVA 1M5Q1 4FU6A 1VQMA 3ASKA 2H3JA 2EQKA 3FLGA 3QPHA 4P5NA 3V7CA 1N8RC 4IKFA 4LOCA 4IUTA 4M7DA 4PL6A 4M7DB 2VXFA 2E12A 3X26B 3M58A 5KE2A 1N6AA 2NLUA 4HNUA 2DXUA 3OB9A 3QXEB 1M1GA 2MAMA 3PMTA 4QQDA 4C8QA 4N4HA 1RL2A 5GAMf 5IN1A 3OA6A 1K8AU 1VQ6T 1BIAA 2YRVA 3SWNB 3G7ZA 1AHJB 4ZTFA 1VQ8A 4BI8B 1LOJA 5CVIA 3CMET 2B8AA 3OY9A 3CPFA 3Q1JA 4D6WA 3OYAA 2MI6A 2R5AA 2ZPGB 1VQPA 1G3SA 2E1HA 4HT8A 3V7SA 5A0GA 1IREB 2R58A 4OB1B 2KVQG 4IUUA 3UT1A 3OYCA 4NL3A 4GLKA 2E41A 2EJFA 4IURA 1VQ5A 2VGNA 3GPLA 1YJWA 3QYHB 4PJOD 1VUBA 4PNOA 3SWNA 5A2QE 2GCXA 3LWIA 3KXTA 1W4SA 3OMCA 4RCBA 4E7IA 3OQ5A 3RKXA 2F69A 2HBPA 5GAN5 1M90C 3BDUA 2KMGA 1G3WA 2X35A 5KH6A 2RJDA 3BW1A 4A53A 1YHQT 2EIFA 3OBYA 3HO8A 4B9XA 1ZQ1A 2K3XA 5CQXA 1I5LA 2BIVA 2XIDA 4C92A 5J39A 1YCYA 4J6YA 4ZGEB 5GAMd 5LJ3g 5LJ5f 3VKGA 1FXXA 2FVUA 2Y4YA 4XAXB 1JB0E 5GANe 2XK0A 1BIBA 4XU3A 3I56A 3CD6T 5CKBA 2CZ7B 3CCRT 3FRNA 4MZPA 3CCEA 1KC8C 4HLQA 2KMTA 3M56A 3MEVA 5GAOp 4C92F 1BYMA 2P0QA 4M7AA 1YHQA 4Z6YA 3GNFB 3CCMA 2E65A 4XTYA 2RO0A 4KUDK 4X34A 1RI0A 3CCSA 3CPWS 5I21A 3CCJT 4M78B 2M0OA 3PT9A 4LDWA 5HY6A 3I55A 4VUBA 3VYGA 5LJ5h 3OYNA 1H3ZA 4LDXA 3QJ6A 2DIQA 4J83A 3GNGA 2RM4A 4O6JA 5D6YA 1YITT 1G3TA 1FKMA 3BG9A 2RB6A 5DLOA 2K3YA 4E7JA 1YJ9T 3TW6A 3TU4K 2DXBB 3MP6A 4F7UF 1JRIA 4ZGJB 3M57A 2DKGA 1N9SA 3A8HB 1X01A 3OSSC 4E7HA 4F7UE 3DB4A 3JCMX 4MFEA 4MZMA 3OW2S 4DA4A 1VQ9T 3EFRA 2V8KA 3TCJA 3NTHA 1BI0A 1I81A 1Y96B 3BFMA 4ZN3A 2OAUA 3QUIA 1OYXA 3HHTB 4R56A 3INZA 3CC7A 2WACA 2R57A 4ZGDB 1B34B 2JUFA 5CK9A 4J5YA 1M9SA 2HAXA 2RK2A 4LD9K 1WQWA 2VV5A 3CXCS 3C4SA 3NFCA 1DJ7B 2DZCA 2I2LA 4M77D 4RG2A 2ZGWA 2BKDN 3OYBA 2AHJB 3M59A 4WF2A 2XDDA 3LWHA 3OYGA 3PIOA 2CZ6B 4HCZA 3V8KA 4ELZC 3M9QA 2K5LA 3M53A 2EQUA 4N0AA 1K73C 1NE8A 2JZ2A 4BY6C 4L59A 2ZPIB 1JJ2A 2EWNA 2LTOA 4ME7A 4OB3B 4UC4A 3FDRA 3PMIA 3OYMA 3OSVA 4PJOF 3J7AF 1O9SA 2KSSA 1JJ2S 2WSCE 3ME9A 4M75F 4CRIA 2LQKA 1W2BS 2A7YA 1KHCA 3QZ9B 3RMSA 3CD6A 4M7DG 4AKIA 2XDPA 3WVEB 4QVDA 3DL1A 2A3LA 3NTIA 5DLQE 1Q86U 5FU6B 3QHSA 3ZEHA 4XU1A 2EQMA 1OZ3A 2EYQA 2RH2A 4A4HA 5GAN6 1M90U 2ZPFB 4RMOA 2DAQA 4N4IA 3JB9I 3OYKA 4Z02A 4JDSA 2DPPB 2K57A 3CCET 1WGSA 3QJYA 2QEXA 3QWLA 3LGLA 1WQ7A 3JRZA 3C94A 3VV0A 4EMKA 4QVCA 3JCMb 4PLIA 4XQ3A 3X20B 1VQ7T 3CCLT 1I8FA 1JBMA 4RKUE 5FU7B 1VQ5T 4FT4A 3CCUA 1QVFS 2LDMA 4M7AF 3OS5A 2EFIA 2LQ8A 4BE0A 4QSHA 3PFSA 4BBSM 1BI2A 2OTJT 2QQRA 3GF5A 2LVMA 3JCMe 2O4XA 3M4GA 4BB7A 3G6ET 1K73U 3FC3A 2DXCB 4BUGA 2RHXA 3AHUA 3BG5A 4B9WA 2RHZA 4PJOC 2D9TA 4C0DB 5GAMg 1EIFA 4LDVA 3PGGA 2E64A 2RD1A 3QG1A 1U8RA 2JNGA 3LW5E 1VQNA 2EJGA 2QF7A 2RI2A 3QZ5B 4NL2A 3L2QA 3OS1A 5GMKl 4IUVA 3RUXA 5CKDA 2ZPEB 5GAOq 5GAN2 4M77A 2QFZA 4XU0A 3LYIA 4C0GA 4JX5A 1QVGS 1XTDA 2FYKA 3HRSA 3A8GB 2Y4XA 3P8HA 4Q5WA 3BG3A 4AKGA 2HD0A 2VGMA 3RMQA 1S72A 2OTLT 3L2WA 3META 3N5BB 4ZN1A 4M78C 3GIBA 5LJ3h 2YLCA 3L2ZA 2WJ9A 5GAOl 1VQLT 1P92A 4FT2A 3WXMB 5LJ5d 2DEQA 2EKOA 3PTAA 4XTZA 2MF2A 4M6VA 4MMLA 5DY9A 3C12A 4C92C 3JB9G 4N0AC 4BDYA 3CCQA 2ZPHB 1YI2A 4KUIA 4J8OA 5GANj 3CBOA 1YITA 3X24B 2O01E 1O75A 1KQSS 3EAEA 2HQXA 2G3RA 5KCHA 4BE2A 5IAYA 3JAME 2FL7A 5LJ5g 3WVDB 3PNWC 5CAIA 2RJCA 4PJOA 4C0FA 1E7PA 3QYGB 1B34A 4MZTA 3URGA 4BD3A 2DIGA 1MHNA 1KHIA 3RESA 4BBRM 2OTLA 4C8QF 3DB3A 2L5QA 1NPRA 2KK4A 1M1KU 1WJRA 3CCLA 3OYFA 2XDBA 3UWNA 4A4KA 3G71T 4FM4B 1WPYA 1ZHIA 4OF1A 5GAMh 3H6ZA 2WSEE 3HRTA 4C5EA 3CC4T 1IZ6A 4C0DC 2K5IA 2R5MA 2E5QA 2V8JA 1VQ4T 4M78G 4ATOA 2OTJA 5GANf 2CKKA 3A8LB 2E10A 3VJPA 3CEYA 3QO3A 2F5KA 2F5TX 3E1SA 3OS2A 3CCJA 4M78A 3PIPA 1N9RA 1N8RU 3S3OA 1KQ2A 3J81E 3OYYA 3CCMT 3S3NA 2LRQA 2YHTA 5FU7C 2PVOB 1UGRB 3CMAA 4M7AB 1VQNT 1UGPB 1FWZA 2KY9A 5GMKe 3DKMA 1PSEA 3M5AA 1QVPA 4IUPA 3M54A 3MP8A 5GMKi 5CR2A 1YJWT 5A0DA 3L2RA 1NJIC 2CZ0B 1M4ZA 3MHXA 4A4FA 1Q81U 3BY7A 2CZ1B 5J26A 2RI5A 4MDXA 3A8OB 3P8DA 3UDCA 4M75E 2QDYB 4M77F 3UPUA 4N4GA 4NS5A 3CC7T 3JB9H 4BI3A 2XICA 1G3YA 4C8QB 4MDWA 4BE1A 4PJOE 3JCMQ 3CCVA 3V7RA 4CI0C 2JVVA 5GANd 3O8VA 4C92D 3GOXA 5IT9E 5FU6C 2L89A 3L2VA 3G4SA 2M9UA 4FIBA 5LJ5j 3TW7A 3CC2A 3JCMg 4JJNK 2MWPA 1XQHA 2X4YA 4NOYA 4M78D 3H8ZA 4XTWA 4XTXA 1M1KC 5CQYA 2M16A 2QQAA 3SWNC 1X6OA 3C95A 2QTXA 2GF7A 5GAN7 1XNIA 4KBMB 4X9CA 4M75B 5D6WA 3CBPA 5CO7A 4QQ6A 3QIIA 5GAN4 2WSFE 1U1TA 2BUDA 3TEEA 2X4JA 3OYHA 3HSBA 2E6ZA 2K2VA 1YBYA 2RI3A 4YTLA 2DD4A 4HNVA 1KD1U 1K9MU 1Q82U 3HPWA 4O5VA 4QW2A 5D6XA 1Q7YU 3G4ST 4M7DD 3CCST 1M1FA 3MEWA 3RKWA 3S3MA 4A4EA 4J6WA 5CKHA 5LJ5e 3DLLA 2E70A 2XU8A 2G77A 2LX9A 2PUOB 3QBYA 5LJ3j 2VYTA 1QLBA 4BACA 3A8MB 1QVGA 2LCLA 1BI1A 2VXEA 1LJOA 2XKOC 2L3RA 1Q86C 4M77B 4LD6A 1WNLA 1YJ9A 3HRUA 3JCMJ 4HT9A 3QDRB 2MMPA 1G5VA 3SFMA 4DQ2A 1KC8U 2PUKB 2XD0A 2QQ8A 2D0QB 1TH7A 2Y90A 4KT0E 4JRIA 3V8JA 1Q82C 5FRMA 4E7KA 3QYEA 4MMKA 4A54A 4M77G 3CMAT 1VQLA 5FRNA 1H641 5GAN8 3RIRA 5J3BA 2X4WA 2DTOA 2RK1A 2XHCA 2QEXT 3CCUT 3JB9J 2LNVA 4PJOB 2DXCA 5LJ3e 4DOWA 4IUQA 4XTUA 1WJSA 2RJEA 1NJIU 1VQ7A 2GFUA 1BKBA 2ZPBB 1Y7XA 4JLIA 4LDYA 4PJOG 3CCRA 3JCMV 3J80E 3CCQT 2HNIA 4C5HA 2QQSA 5FLXE 3OYEA 3JCMP 4M75G 3CMEA 1HK9A 4FSXA 5GAN3 3HZJA 2HQEA 2QXFA 1Y71A 3HB9A 4GY5A 2D6FA 3JB9F 4M7DF 2IVWA 1YJNT 4M7AE 5HK3A 2DK3A 1GXIE 4ELJA 2RJFA 2MWOA 3A5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGD B;  1UGS B;  2PVG B;  2DD5 A;  4FM4 B;  1DJ7 B;  2WSE E;  4XK8 E;  2AHJ B;  2CZ6 B;  3A8L B;  5L8R E;  2ZZD B;  2ZPI B;  4OB3 B;  2WSC E;  2PVO B;  1UGR B;  3X26 B;  1UGP B;  1PSE A;  3QZ9 B;  3QXE B;  3WVE B;  2CZ0 B;  2ZZD A;  4L6V 5;  2CZ1 B;  1UGQ B;  3X28 B;  3VYH B;  3A8O B;  2QDY B;  2ZPF B;  1AHJ B;  2DPP B;  2DD5 B;  2ZPG B;  1IRE B;  4OB1 B;  2PU9 B;  3X20 B;  2ZCF B;  3QYH B;  4RKU E;  2CYZ B;  2WSF E;  2DXB A;  2PVD B;  2DXC B;  2DD4 A;  3VYG B;  4OB0 B;  4ZGE B;  2PUO B;  1V29 B;  3A8M B;  3LW5 E;  1JB0 E;  3QZ5 B;  2CZ7 B;  3X25 B;  1PSF A;  4OB2 B;  2ZPE B;  2PUK B;  2D0Q B;  4KT0 E;  1QP2 A;  3A8G B;  3VYG A;  2DD4 B;  2DXC A;  4Y28 E;  1QP3 A;  2ZPH B;  2ZPB B;  3X24 B;  2DXB B;  2O01 E;  4ZGJ B;  3A8H B;  3WVD B;  3QYG B;  1GXI E;  3HHT B; 
#chains in the Genus database with same CATH topology
 1QMC A;  3E19 A;  4J9B A;  3EGD B;  1YIJ Q;  3GLX A;  1D3B A;  4C5I A;  2DVJ A;  4F17 A;  4EMG A;  1HSQ A;  2HKN A;  2XG8 D;  2FO0 A;  1YIJ A;  1OKV B;  4JRQ A;  1VQ4 A;  5DQV A;  1WI7 A;  3MKD A;  1YFN A;  5EG2 A;  4FL6 A;  1YJN A;  3ULR B;  4M78 F;  4EMK B;  1RAC B;  2JM9 A;  2JS0 A;  4F7U G;  1OV3 A;  3OYL A;  1QWE A;  2DXT A;  3M0P A;  5HBH B;  5EJC A;  1YIJ T;  2QI2 A;  8ATC B;  5ACB A;  3FJ5 A;  2KDS A;  3MO8 A;  4BDZ A;  2RHU A;  2C06 A;  1B07 A;  2VC8 A;  4D8D A;  4OGE A;  3R6O A;  1Y07 A;  3UF4 A;  4GLM A;  1KQ1 A;  5GAN h;  4A4G A;  4E47 A;  2LT4 A;  4CC3 A;  4M7D C;  1KQS A;  3JSC A;  1K8A C;  1H1R B;  3MCA B;  4AMC A;  1OGU B;  3LH0 A;  2ZAE A;  5IHY A;  1OQK A;  5AT1 B;  1ABQ A;  3RDV A;  1E6H A;  5CKE A;  1K4U S;  5KCO A;  1WDX A;  3E9F A;  4HCC A;  2YLB A;  3VYG B;  1Y0M A;  2ENM A;  2IVX A;  3EJ1 B;  2GFA A;  5LL6 S;  3R6N A;  1V29 B;  4KUL A;  3H4C A;  3QHR B;  3G1J A;  4Y92 A;  3MY1 B;  3LX7 A;  4NC6 A;  3JCM f;  1ZLM A;  3KUF A;  2KNB B;  2NUP A;  2RPN A;  1C9B A;  3MJX A;  4KRC B;  4PJN A;  5M9O A;  1MUZ A;  5GAO m;  2DO3 A;  2KXD A;  4J9G A;  4Y91 A;  5GAM e;  1JJ2 P;  1ZBX A;  4D8K A;  2K79 A;  4Y28 E;  1IHW A;  4V2S A;  1QP3 A;  1AWO A;  1BI3 A;  2CT4 A;  3CBM A;  1NZ9 A;  4XU2 A;  4PJM A;  4ESR A;  2LC4 A;  1VQ8 Q;  5I2S A;  4M7D E;  1URC B;  2BE7 D;  1M2V A;  1VQK A;  4JX4 A;  1TUC A;  2DMO A;  2IG0 A;  1WLP B;  3E9G A;  4JLG A;  1WYX A;  2QGG A;  2D8H A;  1WHH A;  2RQW A;  4EOK B;  4IKF A;  4M4Z A;  2B9R A;  2NLU A;  4QQD A;  2DL5 A;  3QXE B;  1M1G A;  3CC2 Q;  5GAM f;  5IN1 A;  3SWN B;  1CKA A;  4ZTF A;  1VQ8 A;  3I5R A;  4II5 B;  2B8A A;  1D0Y A;  2A36 A;  3MIA B;  2RQT A;  1W98 B;  1P5E B;  2KRS A;  2ZPG B;  4OB1 B;  1W1F A;  2KVQ G;  4IUU A;  4NL3 A;  1UHF A;  1YJW A;  1YN8 A;  3SWN A;  3EGX B;  1M90 C;  5GAN 5;  3BW1 A;  1H26 B;  2XMF A;  1OIU B;  4F6U B;  4A53 A;  1M2V B;  1ZQ1 A;  5HNB B;  1NEG A;  1YCY A;  1QMZ B;  5LJ5 f;  1WXU A;  2AZV A;  1PKT A;  5I11 A;  3FRN A;  3CCE A;  2HSP A;  4HLQ A;  1SG5 A;  2KMT A;  5GAO p;  4E2F B;  1UJ0 A;  2O88 A;  1YHQ A;  4Z6Y A;  1V76 A;  5KYU A;  3I55 Q;  3CCM A;  4XTY A;  4KRT A;  3CCS A;  3CCJ T;  4LDW A;  4LDX A;  3QJ6 A;  3M03 A;  4J83 A;  2W9Z A;  2RM4 A;  3GNG A;  1YIT T;  4OMO A;  1QCF A;  2K9G A;  4ZGJ B;  3M0S A;  2H3E B;  3OSS C;  4E7H A;  4F7U E;  4MFE A;  1VQ9 T;  1H27 B;  3EFR A;  4RTW A;  1BI0 A;  1Y96 B;  3BFM A;  2W99 A;  2L0A A;  2OAU A;  3HHT B;  1TG0 A;  1D0Z A;  1B34 B;  3TNI B;  1M9S A;  1WQW A;  1AWX A;  2NUP B;  3KFV A;  2F2C A;  2DZC A;  2J6O A;  1VQM Q;  2BKD N;  4BCH B;  4AT1 B;  4WF2 A;  2XDD A;  3OYG A;  4HCZ A;  3M53 A;  2BKZ B;  2R7G A;  1WX6 A;  2JXB A;  4ROD A;  2DL8 A;  3JV3 A;  3FDR A;  4GBQ A;  2E5K A;  1O9S A;  3VS2 A;  4CFU B;  1IHV A;  1W2B S;  2A7Y A;  3CPW P;  3QZ9 B;  3RMS A;  3CD6 A;  2M02 A;  1WA7 A;  1M3B A;  2DL7 A;  4M7D G;  3WVE B;  3RBB B;  5L23 A;  1G8X A;  1Q86 U;  4F7J B;  1TD6 A;  4A4H A;  1MMA A;  2ZPF B;  2DAQ A;  4KRD B;  4Z02 A;  4JDS A;  2K57 A;  4ZNX A;  2V1Q A;  3QJY A;  2QEX A;  1WQ7 A;  3JCM b;  4EMK A;  1W70 A;  4QVC A;  4XQ3 A;  3X20 B;  1VQ7 T;  1VQ6 Q;  4RKU E;  4PFO A;  3LQ5 B;  1BI2 A;  2LVM A;  3JCM e;  2DXC B;  3BG5 A;  4B9W A;  4C0D B;  1EIF A;  5IHN A;  2EYX A;  1H1Q B;  1U8R A;  5D7U A;  5IH2 A;  2K2M A;  2EJG A;  2HSE B;  3OS1 A;  3TQ7 P;  5GAO q;  4HXJ A;  5GAN 2;  1QVG S;  1XTD A;  2FYK A;  3HRS A;  2HD0 A;  2VGM A;  4EOO B;  3GIB A;  3UA6 A;  1VQL T;  2CJM B;  2DEQ A;  5GJV B;  4XTZ A;  5DY9 A;  4MML A;  3C12 A;  4C92 C;  3JB9 G;  1YI2 A;  1LVK A;  4KUI A;  1O75 A;  2F2V A;  4F16 A;  1QLY A;  4BE2 A;  5IAY A;  4X1V A;  3QYG B;  3CCQ Q;  3URG A;  4C8Q F;  6AT1 B;  2C5X B;  1NPR A;  1CKB A;  2CP3 A;  2L5Q A;  1M1K U;  1WJR A;  3UWN A;  3G71 T;  4OGR B;  4I3Z B;  1X69 A;  3H6Z A;  3CC4 T;  1J3T A;  3CMA Q;  4PFZ A;  2K5I A;  2R5M A;  1W6X A;  2DEU A;  2ROT A;  3VS4 A;  3E1S A;  3CCJ A;  4M78 A;  3PIP A;  1KQ2 A;  2DE0 X;  3CCM T;  1GUX A;  2VB6 A;  2KXC A;  2YT6 A;  1UGR B;  3VS5 A;  2KY9 A;  1FWZ A;  3DKM A;  3M54 A;  2P84 A;  1BU1 A;  3L2R A;  2JS2 A;  2BPM B;  2A0F B;  2EYZ A;  2W10 A;  2RI5 A;  4G6L B;  3BHU B;  4N4G A;  1MMN A;  4BI3 A;  2XIC A;  3CCV A;  3V7R A;  1UE9 A;  2WEV B;  1UJY A;  3GOX A;  1WIE A;  2M9U A;  4FIB A;  2X9H A;  1Z9Q A;  4JJN K;  2MWP A;  2J7I A;  2QQA A;  1X6O A;  2QTX A;  1YHQ Q;  2OAW A;  2QAS A;  2KEA A;  4QKU A;  4X9C A;  1FMW A;  3PE0 A;  5CO7 A;  2EGA A;  1O9K A;  5LMK B;  2BUD A;  2X4J A;  3HSB A;  2AKK A;  2W96 A;  2E3I A;  1ZX6 A;  4CFM B;  4HNV A;  4IIM A;  1Q82 U;  4M7D D;  3CCS T;  3S3M A;  2GTO A;  5LJ5 e;  5KYN A;  3UA7 A;  2E70 A;  1QVG A;  2CRE A;  2LW4 A;  1GFC A;  4JJD A;  2VXE A;  1NEB A;  4CC2 A;  1UG1 A;  2L3R A;  1Q86 C;  1VQP Q;  3G33 B;  2MMP A;  3SFM A;  1TH7 A;  2OJ2 A;  4KT0 E;  5KYW B;  4MMK A;  4FYX B;  4CFV B;  1BCM A;  5J3B A;  5BNJ B;  1V1C A;  2RK1 A;  2XHC A;  2LNV A;  2DXC A;  4DOW A;  4IUQ A;  1PD0 A;  1YP5 A;  2RJE A;  4PJO G;  3OYE A;  3H0I A;  4M75 G;  1VA7 A;  2HQE A;  4GY5 A;  1Y71 A;  2D6F A;  1YJN T;  3CD6 Q;  1PNJ A;  2MWO A;  5GMK h;  1KD1 C;  4EMH A;  2DD5 A;  3FB9 A;  2J05 A;  3OYI A;  3JCM c;  1Q81 C;  1I5O B;  1ZA2 B;  1VQP T;  3OMG A;  2C0T A;  4R55 A;  3CCL Q;  2RHI A;  3F70 A;  4DBR A;  5L8R E;  4OMM A;  4E7L A;  1AD5 A;  3HP9 A;  4F7U A;  2RHY A;  4PJL A;  1VQK Q;  4JS5 A;  2HMA A;  3NTK A;  3ZFJ A;  1VQ6 A;  2ZZD A;  3SDZ A;  3X28 B;  2YRD A;  3ER0 A;  2KQW A;  3B57 A;  4BI4 A;  4RCC A;  4J9D A;  1QW1 A;  1RLQ C;  3EHR A;  3L2U A;  3EFO A;  4C5G A;  1VQ5 Q;  5AYF A;  3H0H A;  1OI9 B;  4HL4 A;  2HEQ A;  3ZBD A;  2L8D A;  3MEA A;  3M4Y A;  3CCJ Q;  4C0Z A;  2FEI A;  1OI1 A;  1HXD A;  4E6R A;  2DA9 A;  3I55 T;  1VQO T;  3GP8 A;  3JCM h;  3LLR A;  1VQ9 A;  4JS4 A;  2CT3 A;  1VQ9 Q;  1EZZ B;  5GAM j;  2P0K A;  2X4X A;  4JRK A;  5LJ3 d;  1GBR A;  4C92 G;  2DVE A;  3OS0 A;  3JB9 D;  3FIF A;  3HFN A;  3X25 B;  1OX8 A;  3DLM A;  2E6N A;  1IGQ A;  4EON B;  3V8L A;  1LNX A;  1H25 B;  5GJW B;  2KR6 A;  3FJP A;  2QGS A;  4BCM B;  5CCA A;  5GMK j;  2PK2 A;  4J9F A;  4ANJ A;  2DD4 B;  3OYD A;  4AKH A;  3CCR Q;  4M7A D;  4F14 A;  1F1B B;  1X6B A;  4HVU A;  1Q86 R;  4QQG A;  5HVY B;  5DQW A;  1M90 R;  4II1 A;  3EHQ A;  3HFO A;  3I5S A;  5FW9 A;  4EOI B;  3QKJ A;  5HK0 A;  3U23 A;  4L5G A;  2DRM A;  2F2X A;  4JZ4 A;  4AFQ C;  1F5Q B;  1YJN Q;  2QG9 B;  3VKI A;  5C0M A;  2I0N A;  4M75 D;  1AZG B;  2GQV A;  2PHG A;  1N8R C;  3V7C A;  2CCH B;  4PL6 A;  2E12 A;  3X26 B;  3SEM A;  2WFY B;  1GCQ C;  2GNC A;  4HNU A;  1ZP2 A;  3PMT A;  4C8Q A;  1WFW A;  4N4H A;  1RL2 A;  1K8A U;  1BIA A;  2YRV A;  1AHJ B;  1UNH D;  1UDL A;  1LOJ A;  4D6W A;  1JO8 A;  3MI9 B;  3POM A;  2MI6 A;  1VQP A;  1G3S A;  2E1H A;  4HT8 A;  1B3Q A;  5A0G A;  1YWP A;  4GLK A;  2E41 A;  4IUR A;  1VQ5 A;  1PRM C;  3LWI A;  1W4S A;  3BE3 A;  4KGX B;  1JEG A;  1AOJ A;  2HBP A;  2X35 A;  2G6F X;  2DLP A;  5KH6 A;  1YHQ T;  3OBY A;  3EOC B;  3M0Q A;  2JMA A;  1PKD B;  4C92 A;  1AT1 B;  2QA4 Q;  3VKG A;  2NUZ A;  4OMP A;  5GAN e;  3EG9 B;  4XU3 A;  3NDQ A;  2CZ7 B;  4F6S B;  1U3O A;  2K3B A;  2DL4 A;  3MEV A;  1WHK A;  2O9V A;  4BY1 X;  3O0G D;  1N8R R;  2RO0 A;  1K9A A;  4Z88 A;  4X34 A;  3CQT A;  3CME Q;  1E7O A;  2DBM A;  1XJW B;  1YI2 Q;  4M78 B;  3I55 A;  4VUB A;  3VYG A;  3OYN A;  3CCM Q;  1H3Z A;  2IW6 B;  1FMK A;  4Z89 A;  1G3T A;  3BG9 A;  2RB6 A;  2K3Y A;  3TW6 A;  1H92 A;  2CDT A;  1UHC A;  1VIN A;  1C0M A;  1U5S A;  4MZM A;  3TCJ A;  3NTH A;  1I81 A;  3INZ A;  3M0U A;  2FPD A;  3CC7 A;  2R57 A;  4ZGD B;  1VQO Q;  2PK9 B;  2VV5 A;  3C4S A;  2FZC B;  1AWJ A;  2I2L A;  4RG2 A;  1PKS A;  1GH6 B;  2CP0 A;  3LWH A;  3PIO A;  2CZ6 B;  2JMC A;  3V8K A;  3M0R A;  2K5L A;  4N0A A;  4BY6 C;  4L59 A;  2ZPI B;  2PMI B;  2EWN A;  4OB3 B;  2KYM A;  3PMI A;  3OYM A;  4DBH A;  4PJO F;  2HZY A;  2KSS A;  2BZ8 A;  1JJ2 S;  3NPF A;  4M75 F;  1NM7 A;  1UNG D;  1IRX A;  1EFN A;  1E6G A;  3NGP A;  4HVW A;  2WIP B;  5FU6 B;  3QHS A;  3ZEH A;  4XU1 A;  2EYQ A;  5L2W B;  3GTM S;  4N4I A;  2YRC A;  3JB9 I;  3TN8 B;  4J9E A;  3JRZ A;  3C0C A;  2NUT A;  1I8F A;  1JBM A;  2GGR A;  3NMZ C;  3UAT A;  1VQ5 T;  4FT4 A;  1TSF A;  2LDM A;  2LQ8 A;  2RMO A;  2L3S A;  1SRM A;  3IQL A;  1KQS P;  2O4X A;  3M4G A;  1K73 U;  2MYS A;  2RHX A;  4EOL B;  2J6F A;  4PJO C;  5GAM g;  2GQI A;  2E64 A;  2DNU A;  2RD1 A;  2JNG A;  3TNH B;  2C5V B;  2RI2 A;  3QZ5 B;  5LQF B;  1FYN A;  3RUX A;  4CXA B;  2X1N B;  1XO2 A;  4M77 A;  1PD1 A;  1ZA1 B;  3LYI A;  4JX5 A;  4C0G A;  3RMQ A;  2MCN A;  1YNZ A;  3L2W A;  1VOL A;  2HCK A;  4KH0 B;  5ECA A;  4BY7 X;  2WJ9 A;  1G3N C;  4FT2 A;  4F7L B;  2YXY A;  4WTO B;  3CCQ A;  2ZPH B;  2RNA A;  5GAN j;  1GCQ A;  1YIT A;  1KQS S;  3EAE A;  1PCX A;  2HQX A;  3MY5 B;  1FVV B;  2FL7 A;  3EG9 A;  5LJ5 g;  2FG0 A;  5CAI A;  2DM1 A;  2RJC A;  4PJO A;  1K76 A;  2DME A;  1B34 A;  4BD3 A;  1PC0 A;  1KHI A;  2IIM A;  2J6K A;  4FM4 B;  1WPY A;  2AT1 B;  3HRT A;  4BCJ B;  4C0D C;  2V8J A;  1C6V X;  4M78 G;  4EOQ B;  3PVL A;  3VJP A;  3QO3 A;  2F5K A;  1MND A;  3OS2 A;  2KYB A;  1N9R A;  5KYX A;  1K0S A;  3ZL7 C;  5FU7 C;  4DBQ A;  1AD6 A;  1PSE A;  4IUP A;  4F7N B;  1FMV A;  3VS1 A;  1AZE A;  2CZ0 B;  2CZ1 B;  1OL1 B;  3P8D A;  2QDY B;  3UPU A;  4NS5 A;  3JB9 H;  4BCI B;  2MOX A;  4C8Q B;  2LZ6 B;  3JCM Q;  4K11 A;  2L3P A;  3O8V A;  4C92 D;  5IT9 E;  2VKN A;  3L2V A;  3G4S A;  5LJ5 j;  3CC2 A;  1KD1 R;  2SRC A;  1X2Q A;  1XQH A;  2BZX A;  3H8Z A;  1RAF B;  1M1K C;  2M16 A;  1Y57 A;  2GF7 A;  3A1P A;  5D6W A;  2EW3 A;  3TEE A;  2KBT A;  1GBQ A;  5FWC A;  3VS6 A;  1TUG B;  3LH5 A;  2K2V A;  1QVF P;  2DD4 A;  2KE9 A;  4LE9 A;  1KD1 U;  1Q7Y U;  3NHN A;  3MEW A;  2V1R A;  4F04 B;  5CKH A;  2W9F A;  2XU8 A;  2G77 A;  1QLB A;  3A8M B;  1N4M A;  2I53 A;  1I0C A;  1NYG A;  1NYF A;  2FZG B;  1MV3 A;  1W2B P;  4FYW B;  1H4L D;  2HKQ B;  2K7A A;  1YIT Q;  3CMA T;  3CC7 Q;  5FRN A;  1H64 1;  2X4W A;  2YUN A;  2QEX T;  5LJ3 e;  1QCN A;  4XTU A;  3RR6 A;  2EKH A;  3VRY A;  1NJI R;  1VQ7 A;  2GFU A;  2I40 B;  2ZPB B;  1BKB A;  1Y7X A;  1HYO A;  3CCR A;  2QQS A;  1TTH B;  3CME A;  3HZJ A;  4FX3 B;  4AFZ C;  3HB9 A;  1NBE B;  5FWB A;  2IVW A;  2JJ9 A;  2OI3 A;  2RJF A;  2OTJ Q;  2KGT A;  2QA4 T;  1UGS B;  3CCV T;  4CC7 A;  4AI6 A;  3EFS A;  1VOM A;  3EFO B;  5IXB A;  1NJI U;  4HNT A;  1KFZ A;  2L2P A;  3G71 A;  4PJJ A;  5CKF A;  2QTV A;  2QQ9 A;  3E2U A;  3T9N A;  3G71 Q;  2UUE B;  2ZZD B;  3EH2 A;  2K5F A;  2JOY A;  3BLQ B;  4EC9 B;  2CGH A;  2D8J A;  2ECZ A;  4AFU C;  4OML A;  3JCM d;  2DTH A;  2MIO A;  3S6W A;  1VYV A;  1X43 A;  3DJB A;  4RTZ A;  3CXC A;  3VS3 A;  5DM7 R;  2NYS A;  4F7U B;  1R77 A;  3M0T A;  3SB2 A;  1UGQ B;  1MGQ A;  5LJ3 f;  3CPW A;  4ZTJ A;  3BHV B;  4EPC A;  1CSK A;  1VIE A;  3OW2 A;  4FW2 A;  3EH1 A;  4M77 E;  3REA B;  4QVZ A;  3CC2 T;  2DD5 B;  5EFQ B;  1G2B A;  1X75 C;  2EQJ A;  1ACM B;  2PU9 B;  2O4X B;  4EMK C;  4JUV A;  1OL2 B;  4CFX B;  2ZCF B;  4OR5 B;  1R0B G;  2JGZ B;  1GRI A;  1T0H A;  3DTO A;  2PJQ A;  1UEB A;  4PFP A;  4FW1 A;  2DXB A;  5I2M A;  4JPB W;  2ATC B;  4HCB A;  2XI9 A;  1S72 T;  3HBL A;  2M1H A;  4TVR A;  4C92 E;  3L42 A;  3I9Q A;  2RN8 A;  4E7Z A;  2DZ9 A;  1G83 A;  1WJQ A;  1TU0 B;  4QT7 A;  2BE9 B;  1VQ8 T;  1PSF A;  1UGV A;  2BS2 A;  1QP2 A;  1NLO C;  4BCG B;  2KAF A;  3G4S Q;  1T3S A;  2FHD A;  1QQJ A;  2JTF A;  2BS3 A;  2AK5 A;  4RTY A;  4HA8 A;  2EYW A;  3MP1 A;  2FB7 A;  2LCC A;  2LT1 A;  2CP2 A;  2EBP A;  1VQK T;  3BHT B;  3CC4 A;  2LJ1 A;  3QDF A;  4DEY A;  3EGD A;  1K9M R;  5KE3 A;  4ROC A;  1I4K 1;  1MMG A;  4HKE A;  1UB4 A;  2PVG B;  2IW8 B;  3RKY A;  1TOV A;  2QGF B;  1OEB A;  1YI2 T;  1H1P B;  4XK8 E;  5I5Z B;  4ELY C;  2JTM A;  1AEY A;  3I56 T;  4WCI A;  5IF1 B;  3RGF B;  2AZS A;  5CIU A;  1U1S A;  5FRO A;  4M75 C;  4J6X A;  1SSF A;  1GL5 A;  2LQN A;  4FU6 A;  1VQM A;  3ASK A;  2H3J A;  3FLG A;  3QPH A;  4P5N A;  2D1X A;  4LOC A;  4IUT A;  3G6E Q;  3CCU Q;  1GUX B;  3QHW B;  4M7D B;  5KE2 A;  1N6A A;  2FZK B;  3OB9 A;  4PK4 A;  2LQW A;  2C5O B;  2WIH B;  2L3Q A;  5HBE B;  3MPU B;  3G7Z A;  1K0X A;  3CME T;  5CVI A;  3OY9 A;  1KK7 A;  3QWY A;  3Q1J A;  3OYA A;  1JST B;  1OU8 A;  2H8H A;  3D7S B;  1IRE B;  3CCS Q;  5ICP B;  2VGN A;  2J06 A;  1JU5 C;  5A2Q E;  2YSQ A;  1ZBJ A;  2QYZ A;  2GCX A;  3H41 A;  3OMC A;  3OQ5 A;  4JZ3 A;  3RKX A;  3BDU A;  2KMG A;  2PZ1 A;  2CSI A;  2AIR B;  2A37 A;  4YC3 B;  5CQX A;  1I5L A;  2M0Y A;  2BIV A;  2XID A;  5HQ0 B;  4YOZ A;  1SHF A;  1RAE B;  1FXX A;  2FVU A;  2Y4Y A;  1JB0 E;  2XK0 A;  2YUO A;  3I56 A;  3CD6 T;  5CKB A;  3CCR T;  2C4G B;  1KC8 C;  3M56 A;  1BYM A;  2V22 B;  4M7A A;  2ED1 A;  3GNF B;  2IN3 A;  2COY A;  1ZSG A;  5I21 A;  5HY6 A;  2DL3 A;  1ZUY A;  2FRY A;  2EYY A;  1UTI A;  1FKM A;  5DLO A;  1SSH A;  2DER A;  3M57 A;  1N9S A;  3A8H B;  1X01 A;  1VQ4 Q;  1D1C A;  3DB4 A;  3JCM X;  2V8K A;  4IIO A;  1D0X A;  1JQQ A;  1SRL A;  4ZN3 A;  1QCO A;  3QUI A;  5EC7 A;  4RUG A;  2WAC A;  2JUF A;  5CK9 A;  4J5Y A;  3CXC S;  3NFC A;  2NWM A;  3OYB A;  2K6D A;  3M59 A;  9ATC B;  1K73 C;  1D1A A;  2E4H A;  3M9Q A;  4ELZ C;  2YDL A;  1LCK A;  4KGZ B;  1TWB A;  2DX1 A;  3ME9 A;  4CFW B;  2LQK A;  3EG0 A;  1KHC A;  4DEX A;  2CH4 W;  3NTI A;  2P4R A;  2QK0 A;  2EQM A;  1OZ3 A;  2RH2 A;  1WGS A;  1JXO A;  3QWL A;  3VV0 A;  2JT4 A;  4BCM D;  3CCL T;  2F2W A;  1BK2 A;  5FU7 B;  4FYV B;  1QVF S;  3VS7 A;  1QWF A;  2EFI A;  3OS5 A;  4BBS M;  2OTJ T;  2QQR A;  3GF5 A;  1UEC A;  3G6E T;  3FC3 A;  4J9H A;  4BUG A;  4R0K A;  2D9T A;  1U06 A;  3SHW A;  1TUD A;  1JKW A;  3LW5 E;  7AT1 B;  2QAZ A;  2QF7 A;  3QWX X;  3L2Q A;  4RTV A;  5GMK l;  4IMY B;  4EOS B;  5CKD A;  1T3L A;  1K73 R;  2QFZ A;  1R0C B;  4XU0 A;  2Y4X A;  2HQH A;  4AKG A;  1UFF A;  2ED0 A;  2OTL T;  3MET A;  4EOM B;  1Z9Z A;  4M78 C;  1RAB B;  5LJ3 h;  2YLC A;  3L2Z A;  1EX4 A;  4RTX A;  5LJ5 d;  3WXM B;  5KYU B;  1QKW A;  2EKO A;  4N0A C;  2KRO A;  4BDY A;  2QDL A;  4J8O A;  3CBO A;  3X24 B;  2O01 E;  3EGX A;  1C1A A;  3JAM E;  3PO3 S;  3WVD B;  3PNW C;  4C0F A;  1E7P A;  4MZT A;  1VQM T;  2OTL A;  4BBR M;  3DB3 A;  1AVZ C;  2LX7 A;  4BCQ D;  2KK4 A;  3OW2 P;  3OYF A;  4A4K A;  1M30 A;  5CEI B;  5GAM h;  2EVR A;  2WSE E;  2LJ0 A;  1IZ6 A;  4ATO A;  2OTJ A;  4LUE A;  4F6W B;  2C6T B;  5IDP B;  1H3H A;  3REB B;  4LUD A;  3S3O A;  3S3N A;  2PNI A;  3OYY A;  3THK A;  2LRQ A;  5FGK B;  1VQN T;  5KYW A;  1TFB A;  4AG1 C;  5GMK i;  5A0D A;  1YJW Q;  2DET A;  1M4Z A;  3MHX A;  5KYY B;  4A4F A;  1Q81 U;  5J26 A;  2QEX Q;  3UDC A;  4M77 F;  4MDW A;  1WHG A;  1KSW A;  2JVV A;  5FU6 C;  2EGE A;  2L89 A;  1NG2 A;  3TW7 A;  1A0N B;  2RQR A;  3JCM g;  5KYX B;  4M78 D;  2MPX C;  2YWW A;  2DJQ A;  4XTX A;  5CQY A;  5IXF A;  1Q81 R;  3SWN C;  3C95 A;  1XNI A;  4KBM B;  4LNP A;  5GAN 4;  1U1T A;  2E6Z A;  2HL5 C;  1OKW B;  4EOP B;  4KGV B;  3G4S T;  1M1F A;  4Y72 B;  4A4E A;  3DLL A;  5LJ3 j;  2LX9 A;  2PUO B;  4BAC A;  2VYT A;  4BCO B;  1ZSZ A;  3DDP B;  4TTH A;  1WXT A;  4LD6 A;  1WNL A;  1YJ9 A;  3JCM J;  2FRW A;  2DRK A;  2D0Q B;  2Y90 A;  4BCP B;  1Q7Y R;  2KRM A;  4JRI A;  1Q82 C;  4J9I A;  4B6M A;  5FRM A;  4E7K A;  3QYE A;  4JJC A;  3RIR A;  2DYB A;  2DTO A;  2UZD B;  3CCU T;  2C0O A;  4PJO B;  2EUF A;  1SEM A;  1WJS A;  1VYW B;  1PG5 B;  1X27 A;  1H24 B;  4JLI A;  4LDY A;  2LCS A;  3JCM V;  1T0J A;  1OX9 A;  3J80 E;  2HNI A;  3CCQ T;  4C5H A;  5FLX E;  1K8A R;  3JCM P;  4BCK B;  1HK9 A;  4A63 B;  5GAN 3;  3TNW B;  3JB9 F;  1MV0 B;  4M7A E;  2AKL A;  5HK3 A;  1GFD A;  4ELJ A;  4YOS A;  3A5Z B;  2M51 A;  3MEU A;  2P4T A;  1ZUK A;  3TRE A;  2QDJ A;  3VUZ A;  4XTV A;  2DFU A;  3OBW A;  5GAO n;  4C8Q G;  4EDU A;  2CS7 A;  2RF0 A;  3VUB A;  4C8Q E;  1IO6 A;  2WMB B;  3HTR A;  2G9X B;  3P8B B;  2CUD A;  4M78 E;  3VU3 C;  1KXU A;  2NUT B;  3EG3 A;  4M7A G;  5A0L A;  2K4Y A;  4OVA A;  5C6S A;  2ESW A;  2PQW A;  2BS4 A;  3OYJ A;  2DBK A;  2GTJ A;  2YUQ A;  3QSU A;  4DOV A;  4CFN B;  4L6V 5;  4BY6 B;  1KJW A;  3VYH B;  1OZ2 A;  5HKC A;  2O2O A;  3G6E A;  1RAA B;  2JN0 A;  1K9M C;  3L1A A;  4C8Q C;  2IW9 B;  1FX7 A;  2SEM A;  1M8V A;  3JCM W;  2F1L A;  1R8O B;  5HBJ B;  3BDL A;  4PKC C;  2WMA B;  1IGU A;  3AT1 B;  2P0P A;  3KXT A;  4OP0 A;  4MFD A;  4BCF B;  1S72 Q;  1H28 B;  1SHG A;  4M7A C;  2CYZ B;  1XOV A;  2A28 A;  2EAY A;  1WZO A;  1VIF A;  1I07 A;  1D3B B;  3I56 Q;  2RA2 A;  2PVD B;  4JRP A;  1ARK A;  2OX7 A;  3QYB A;  3DOG B;  2VVK A;  4OGC A;  1ZUU A;  4CFU D;  4OB0 B;  2FPF A;  2DF6 A;  3HKS A;  1UNL D;  1N27 A;  4PLL A;  4BCQ B;  2WXV B;  2QA4 A;  1NPP A;  2DTI A;  2LJ3 A;  1KG1 A;  2JW4 A;  3I35 A;  1WXB A;  2W0Z A;  3EGU A;  4MIM A;  3M55 A;  4OB2 B;  1SPK A;  2UZE B;  4OMF B;  1D3U B;  1PHT A;  2EJ9 A;  2CP6 A;  2HDA A;  4FSS A;  4LDU A;  1JSU B;  4ROE A;  2C5N B;  5GAN g;  5I22 A;  1SKU B;  2QQB A;  3VKH A;  3FEO A;  4J7I A;  5CYI B;  3RNJ A;  4OMN A;  1M2O A;  3RER A;  3PVQ A;  4J7F A;  1OIY B;  3BLH B;  1QVF A;  2O9S A;  3SD4 A;  3KBG A;  4BCN B;  3KHI A;  1VQL Q;  2C0I A;  4JX6 A;  3K7A M;  2V8I A;  2EQI A;  3LGF A;  1Q7Y C;  1Q82 R;  4ELL A;  4C8Q D;  1YJ9 Q;  1KIK A;  1RUW A;  2COW A;  3EG2 A;  2VUB A;  4C92 B;  1Y96 A;  1RI9 A;  1MNE A;  4LN2 A;  1W2B A;  5GMK m;  2DJZ A;  2B86 A;  1VQO A;  2RQU A;  5GAO r;  4M77 C;  1OOT A;  4RG8 A;  1AWW A;  4M75 A;  4X9D A;  1KC8 R;  3HL8 A;  2DYI A;  1ZSZ B;  1PWT A;  1M5Q 1;  2KRN A;  2EQK A;  2BZY A;  4M7D A;  2VXF A;  3M58 A;  2DXU A;  2MAM A;  1ZSZ C;  1VQ6 T;  3OA6 A;  4JJB A;  2V26 A;  4BI8 B;  1ABO A;  2KR3 A;  3CPF A;  2LMJ A;  2R5A A;  1MMD A;  3V7S A;  1JOW A;  2R58 A;  3UT1 A;  3OYC A;  1NLP C;  2EJF A;  3GPL A;  3QYH B;  2DIL A;  4PJO D;  1VUB A;  4PNO A;  5KYY A;  4RCB A;  4E7I A;  3EID B;  2F69 A;  8AT1 B;  1G3W A;  2EGC A;  4EOJ B;  1D1B A;  1LPL A;  2RJD A;  2EPD A;  4FYY B;  2EIF A;  3HO8 A;  4F7S B;  2HL3 A;  4B9X A;  2K3X A;  2CH4 A;  5J39 A;  4J6Y A;  4ZGE B;  5GAM d;  5LJ3 g;  1IXD A;  1OU9 A;  2COZ A;  4XAX B;  1BIB A;  2VWF A;  1OPK A;  4MZP A;  4KH1 B;  4RTU A;  2IPO B;  3TSZ A;  4C92 F;  2P0Q A;  2E65 A;  4KUD K;  4CRL B;  1RI0 A;  1HJD A;  3CPW S;  2M0O A;  3PT9 A;  5LJ5 h;  2DIQ A;  3F5X B;  4O6J A;  5D6Y A;  1PRL C;  2ROL A;  4E7J A;  1YJ9 T;  4J9C A;  3TU4 K;  2DXB B;  4YOO A;  3MP6 A;  4F7U F;  1JRI A;  2DKG A;  2KI7 A;  4Z8A A;  3OW2 S;  4DA4 A;  1FIN B;  1K1Z A;  1OYX A;  4R56 A;  2HAX A;  2RK2 A;  4LD9 K;  1WHJ A;  1DJ7 B;  1QKX A;  1Q95 G;  4M77 D;  1GCP A;  2ZGW A;  2AHJ B;  4NST B;  1D09 B;  1WHL A;  1M3A A;  3A98 A;  2EQU A;  1NE8 A;  2JZ2 A;  1JJ2 A;  1VYU A;  2LTO A;  1JXM A;  4ME7 A;  2CSQ A;  4UC4 A;  4E7S A;  3OSV A;  3J7A F;  2JM8 A;  1H8K A;  2WSC E;  1N5Z A;  4EOR B;  4CRI A;  1OUL A;  1YCS B;  2UZL B;  4AKI A;  2XDP A;  4QVD A;  3DL1 A;  2A3L A;  5DLQ E;  1BBZ A;  2E3H A;  5GAN 6;  2X3X D;  1QVG P;  1RAG B;  1M90 U;  4RMO A;  1UUE A;  3OYK A;  1BB9 A;  3CCE T;  2DPP B;  3EG1 A;  3LGL A;  3C94 A;  4PLI A;  2UZB B;  2WPA B;  3CCU A;  2W2H A;  3GBQ A;  4M7A F;  4BE0 A;  4QSH A;  3PFS A;  4HVV A;  2ABL A;  4AG2 C;  4BCN D;  4BB7 A;  2CP5 A;  3AHU A;  2RHZ A;  4RTT A;  4OMQ A;  4LDV A;  3H0F A;  3PGG A;  3QG1 A;  1VQN A;  4NL2 A;  4FCY A;  4IUV A;  4EIK A;  1X2K A;  1RAD B;  2ZPE B;  3O5Z A;  4Q5W A;  3A8G B;  3P8H A;  1S72 A;  3BG3 A;  1RAI B;  2VAS A;  3N5B B;  4ZN1 A;  1GY3 B;  1S1N A;  5GAO l;  1P92 A;  2D0N A;  1TXQ A;  3PTA A;  2MF2 A;  4M6V A;  1M1K R;  2KT8 A;  2OTL Q;  2YUP A;  2A08 A;  1SF9 A;  2LNH B;  4F70 B;  2BTT A;  4ORZ A;  1VYT A;  2G3R A;  5KCH A;  4HCK A;  2DIG A;  1MHN A;  3RES A;  2GBQ A;  3CCL A;  2XDB A;  1VQN Q;  1ZHI A;  4CC4 B;  2FPE A;  2PTK A;  4OF1 A;  1BCO A;  4C5E A;  5IDN B;  2E5Q A;  1VQ4 T;  5GAN f;  5IHK A;  2CKK A;  3A8L B;  2E10 A;  2LP5 A;  3CEY A;  2F5T X;  1IB8 A;  3TVT A;  1N8R U;  4LXC A;  3J81 E;  2YHT A;  2PVO B;  3CMA A;  4M7A B;  1UGP B;  3DDQ B;  5GMK e;  2KT1 A;  3M5A A;  1QVP A;  3MP8 A;  1YJW T;  5CR2 A;  1NJI C;  1O9K B;  3BY7 A;  4MDX A;  3A8O B;  4M75 E;  3CC7 T;  3TSW A;  1G3Y A;  4BE1 A;  2WHB B;  4PJO E;  1BU2 A;  5IHI A;  4CI0 C;  5GAN d;  1M8M A;  2CP7 A;  2JTE A;  4AFS C;  1H1S B;  2HBW A;  2X4Y A;  2MK5 A;  4NOY A;  4XTW A;  4UN0 A;  3BLR B;  5GAN 7;  1I1J A;  4EC8 B;  1RAH B;  4M75 B;  1OPL A;  1AIS B;  3CBP A;  4QQ6 A;  3QII A;  2WSF E;  3OYH A;  2X3W D;  3CXC P;  2X51 A;  1YBY A;  2RI3 A;  4YTL A;  1K9M U;  3VS0 A;  4DBF A;  3HPW A;  4O5V A;  4QW2 A;  5D6X A;  3RKW A;  1X6G A;  4J6W A;  2CUB A;  3QBY A;  3VRZ A;  1HD3 A;  1BI1 A;  2LCL A;  1PM3 A;  1LJO A;  2XKO C;  1WHM A;  4M77 B;  4HT9 A;  3HRU A;  1YWO A;  3QDR B;  1G5V A;  4DQ2 A;  1KC8 U;  2PUK B;  2XD0 A;  2QQ8 A;  3CCV Q;  3V8J A;  1B7T A;  1E9H B;  4A54 A;  4M77 G;  1VQL A;  3CC4 Q;  5GAN 8;  1VQ7 Q;  1TS9 A;  3JB9 J;  2O31 A;  1ENW A;  1M27 C;  2CCI B;  1M3C A;  2RQV A;  3CCE Q;  1RLP C;  2Z0W A;  4FSX A;  4BXX X;  2QXF A;  4M7D F;  2DK3 A;  3H9N A;  1GXI E;  5HCK A; 
#chains in the Genus database with same CATH homology
 2QA4 T;  1UGS B;  5GMK h;  3CCV T;  1KD1 C;  3MEU A;  4EMH A;  4AI6 A;  2P4T A;  3EFS A;  2QDJ A;  3TRE A;  4XTV A;  2DD5 A;  4HNT A;  3E19 A;  3FB9 A;  3VUZ A;  3JCM c;  3OYI A;  1Q81 C;  3G71 A;  5CKF A;  3GLX A;  1D3B A;  3OBW A;  3OMG A;  4C8Q G;  5GAO n;  4R55 A;  4C5I A;  4EDU A;  1VQP T;  2CS7 A;  3VUB A;  4C8Q E;  4EMG A;  2QQ9 A;  2RHI A;  3F70 A;  2XG8 D;  3T9N A;  1YIJ A;  1VQ4 A;  4JRQ A;  5L8R E;  4E7L A;  3P8B B;  2ZZD B;  3HP9 A;  4M78 E;  3VU3 C;  5EG2 A;  4F7U A;  2RHY A;  4FL6 A;  2K5F A;  1YJN A;  2JOY A;  4M78 F;  4EMK B;  2CGH A;  5A0L A;  4M7A G;  2K4Y A;  4OVA A;  5C6S A;  4F7U G;  2DTH A;  3S6W A;  2PQW A;  3JCM d;  2BS4 A;  3OYJ A;  3CXC A;  4JS5 A;  3OYL A;  2DXT A;  5DM7 R;  3NTK A;  4F7U B;  3ZFJ A;  1VQ6 A;  2ZZD A;  3SB2 A;  3QSU A;  3SDZ A;  4BY6 B;  4L6V 5;  4DOV A;  5EJC A;  1UGQ B;  3X28 B;  1MGQ A;  5LJ3 f;  3CPW A;  3VYH B;  3ER0 A;  4ZTJ A;  2KQW A;  1YIJ T;  1OZ2 A;  2QI2 A;  4BI4 A;  4RCC A;  1VIE A;  1QW1 A;  4EPC A;  5HKC A;  3OW2 A;  2KDS A;  3MO8 A;  3G6E A;  4BDZ A;  4M77 E;  2JN0 A;  2RHU A;  3L1A A;  4C8Q C;  1K9M C;  1FX7 A;  4QVZ A;  3L2U A;  2C06 A;  3CC2 T;  2DD5 B;  2VC8 A;  4C5G A;  3JCM W;  1R8O B;  4OGE A;  5AYF A;  3BDL A;  3R6O A;  1X75 C;  4HL4 A;  1Y07 A;  4PKC C;  3ZBD A;  2P0P A;  2EQJ A;  2L8D A;  1KQ1 A;  2O4X B;  2PU9 B;  3M4Y A;  3MEA A;  4JUV A;  4OP0 A;  4EMK C;  4MFD A;  4A4G A;  4C0Z A;  4E47 A;  2LT4 A;  5GAN h;  2ZCF B;  4M7D C;  1KQS A;  1OI1 A;  1HXD A;  3I55 T;  4M7A C;  2CYZ B;  1VQO T;  1XOV A;  1UEB A;  2EAY A;  3JSC A;  3GP8 A;  3JCM h;  1VIF A;  2DXB A;  3LLR A;  3MCA B;  5I2M A;  1K8A C;  1VQ9 A;  1M8V A;  3LH0 A;  4JS4 A;  1D3B B;  2RA2 A;  4HCB A;  2XI9 A;  5CKE A;  2PVD B;  5KCO A;  4JRP A;  3HBL A;  2M1H A;  3E9F A;  4TVR A;  3QYB A;  4OGC A;  1S72 T;  4HCC A;  2YLB A;  3VYG B;  4OB0 B;  4C92 E;  3L42 A;  3HKS A;  5GAM j;  2P0K A;  2GFA A;  2X4X A;  1N27 A;  2DZ9 A;  4JRK A;  4PLL A;  5LJ3 d;  5LL6 S;  1V29 B;  1WJQ A;  4C92 G;  4KUL A;  2QA4 A;  2DVE A;  1NPP A;  3H4C A;  3OS0 A;  2DTI A;  3FIF A;  3HFN A;  3LX7 A;  3X25 B;  4NC6 A;  1PSF A;  3JB9 D;  1VQ8 T;  1KG1 A;  3M55 A;  4MIM A;  3DLM A;  4OB2 B;  2E6N A;  3JCM f;  4OMF B;  3V8L A;  3KUF A;  2BS2 A;  1QP2 A;  1LNX A;  2EJ9 A;  2KAF A;  4LDU A;  2FHD A;  2JTF A;  2BS3 A;  2KR6 A;  5M9O A;  5GAN g;  5GAO m;  3FJP A;  4HA8 A;  2DO3 A;  3VKH A;  2QQB A;  3FEO A;  3MP1 A;  2FB7 A;  4J7I A;  2LCC A;  2LT1 A;  4Y91 A;  5GAM e;  5CCA A;  5GMK j;  1VQK T;  1ZBX A;  2DD4 B;  3OYD A;  4AKH A;  4Y28 E;  4M7A D;  3RER A;  3CC4 A;  1QP3 A;  4V2S A;  4J7F A;  1QVF A;  1BI3 A;  4QQG A;  3CBM A;  3SD4 A;  3KBG A;  3KHI A;  4II1 A;  1NZ9 A;  3HFO A;  4XU2 A;  4JX6 A;  2LC4 A;  2V8I A;  3LGF A;  5KE3 A;  3QKJ A;  5I2S A;  1Q7Y C;  4C8Q D;  5HK0 A;  4M7D E;  1I4K 1;  4HKE A;  2VUB A;  4C92 B;  1UB4 A;  1Y96 A;  4L5G A;  2PVG B;  3RKY A;  1VQK A;  1W2B A;  5GMK m;  4JX4 A;  2DJZ A;  1YI2 T;  4XK8 E;  1VQO A;  4ELY C;  2JTM A;  5GAO r;  4M77 C;  2IG0 A;  3VKI A;  3I56 T;  5C0M A;  4RG8 A;  4M75 A;  4X9D A;  5CIU A;  1VQM T;  4M75 D;  1U1S A;  3HL8 A;  3E9G A;  4JLG A;  4M75 C;  5FRO A;  4J6X A;  1SSF A;  2GQV A;  1M5Q 1;  4FU6 A;  1VQM A;  3ASK A;  2H3J A;  2EQK A;  3FLG A;  3QPH A;  4P5N A;  3V7C A;  1N8R C;  4IKF A;  4LOC A;  4IUT A;  4M7D A;  4PL6 A;  4M7D B;  2VXF A;  2E12 A;  3X26 B;  3M58 A;  5KE2 A;  1N6A A;  2NLU A;  4HNU A;  2DXU A;  3OB9 A;  3QXE B;  1M1G A;  2MAM A;  3PMT A;  4QQD A;  4C8Q A;  4N4H A;  1RL2 A;  5GAM f;  5IN1 A;  3OA6 A;  1K8A U;  1VQ6 T;  1BIA A;  2YRV A;  3SWN B;  3G7Z A;  1AHJ B;  4ZTF A;  1VQ8 A;  4BI8 B;  1LOJ A;  5CVI A;  3CME T;  2B8A A;  3OY9 A;  3CPF A;  3Q1J A;  4D6W A;  3OYA A;  2MI6 A;  2R5A A;  2ZPG B;  1VQP A;  1G3S A;  2E1H A;  4HT8 A;  3V7S A;  5A0G A;  1IRE B;  2R58 A;  4OB1 B;  2KVQ G;  4IUU A;  3UT1 A;  3OYC A;  4NL3 A;  4GLK A;  2E41 A;  2EJF A;  4IUR A;  1VQ5 A;  2VGN A;  3GPL A;  1YJW A;  3QYH B;  4PJO D;  1VUB A;  4PNO A;  3SWN A;  5A2Q E;  2GCX A;  3LWI A;  3KXT A;  1W4S A;  3OMC A;  4RCB A;  4E7I A;  3OQ5 A;  3RKX A;  2F69 A;  2HBP A;  5GAN 5;  1M90 C;  3BDU A;  2KMG A;  1G3W A;  2X35 A;  5KH6 A;  2RJD A;  3BW1 A;  4A53 A;  1YHQ T;  2EIF A;  3OBY A;  3HO8 A;  4B9X A;  1ZQ1 A;  2K3X A;  5CQX A;  1I5L A;  2BIV A;  2XID A;  4C92 A;  5J39 A;  1YCY A;  4J6Y A;  4ZGE B;  5GAM d;  5LJ3 g;  5LJ5 f;  3VKG A;  1FXX A;  2FVU A;  2Y4Y A;  4XAX B;  1JB0 E;  5GAN e;  2XK0 A;  1BIB A;  4XU3 A;  3I56 A;  3CD6 T;  5CKB A;  2CZ7 B;  3CCR T;  3FRN A;  4MZP A;  3CCE A;  1KC8 C;  4HLQ A;  2KMT A;  3M56 A;  3MEV A;  5GAO p;  4C92 F;  1BYM A;  2P0Q A;  4M7A A;  1YHQ A;  4Z6Y A;  3GNF B;  3CCM A;  2E65 A;  4XTY A;  2RO0 A;  4KUD K;  4X34 A;  1RI0 A;  3CCS A;  3CPW S;  5I21 A;  3CCJ T;  4M78 B;  2M0O A;  3PT9 A;  4LDW A;  5HY6 A;  3I55 A;  4VUB A;  3VYG A;  5LJ5 h;  3OYN A;  1H3Z A;  4LDX A;  3QJ6 A;  2DIQ A;  4J83 A;  3GNG A;  2RM4 A;  4O6J A;  5D6Y A;  1YIT T;  1G3T A;  1FKM A;  3BG9 A;  2RB6 A;  5DLO A;  2K3Y A;  4E7J A;  1YJ9 T;  3TW6 A;  3TU4 K;  2DXB B;  3MP6 A;  4F7U F;  1JRI A;  4ZGJ B;  3M57 A;  2DKG A;  1N9S A;  3A8H B;  1X01 A;  3OSS C;  4E7H A;  4F7U E;  3DB4 A;  3JCM X;  4MFE A;  4MZM A;  3OW2 S;  4DA4 A;  1VQ9 T;  3EFR A;  2V8K A;  3TCJ A;  3NTH A;  1BI0 A;  1I81 A;  1Y96 B;  3BFM A;  4ZN3 A;  2OAU A;  3QUI A;  1OYX A;  3HHT B;  4R56 A;  3INZ A;  3CC7 A;  2WAC A;  2R57 A;  4ZGD B;  1B34 B;  2JUF A;  5CK9 A;  4J5Y A;  1M9S A;  2HAX A;  2RK2 A;  4LD9 K;  1WQW A;  2VV5 A;  3CXC S;  3C4S A;  3NFC A;  1DJ7 B;  2DZC A;  2I2L A;  4M77 D;  4RG2 A;  2ZGW A;  2BKD N;  3OYB A;  2AHJ B;  3M59 A;  4WF2 A;  2XDD A;  3LWH A;  3OYG A;  3PIO A;  2CZ6 B;  4HCZ A;  3V8K A;  4ELZ C;  3M9Q A;  2K5L A;  3M53 A;  2EQU A;  4N0A A;  1K73 C;  1NE8 A;  2JZ2 A;  4BY6 C;  4L59 A;  2ZPI B;  1JJ2 A;  2EWN A;  2LTO A;  4ME7 A;  4OB3 B;  4UC4 A;  3FDR A;  3PMI A;  3OYM A;  3OSV A;  4PJO F;  3J7A F;  1O9S A;  2KSS A;  1JJ2 S;  2WSC E;  3ME9 A;  4M75 F;  4CRI A;  2LQK A;  1W2B S;  2A7Y A;  1KHC A;  3QZ9 B;  3RMS A;  3CD6 A;  4M7D G;  4AKI A;  2XDP A;  3WVE B;  4QVD A;  3DL1 A;  2A3L A;  3NTI A;  5DLQ E;  1Q86 U;  5FU6 B;  3QHS A;  3ZEH A;  4XU1 A;  2EQM A;  1OZ3 A;  2EYQ A;  2RH2 A;  4A4H A;  5GAN 6;  1M90 U;  2ZPF B;  4RMO A;  2DAQ A;  4N4I A;  3JB9 I;  3OYK A;  4Z02 A;  4JDS A;  2DPP B;  2K57 A;  3CCE T;  1WGS A;  3QJY A;  2QEX A;  3QWL A;  3LGL A;  1WQ7 A;  3JRZ A;  3C94 A;  3VV0 A;  4EMK A;  4QVC A;  3JCM b;  4PLI A;  4XQ3 A;  3X20 B;  1VQ7 T;  3CCL T;  1I8F A;  1JBM A;  4RKU E;  5FU7 B;  1VQ5 T;  4FT4 A;  3CCU A;  1QVF S;  2LDM A;  4M7A F;  3OS5 A;  2EFI A;  2LQ8 A;  4BE0 A;  4QSH A;  3PFS A;  4BBS M;  1BI2 A;  2OTJ T;  2QQR A;  3GF5 A;  2LVM A;  3JCM e;  2O4X A;  3M4G A;  4BB7 A;  3G6E T;  1K73 U;  3FC3 A;  2DXC B;  4BUG A;  2RHX A;  3AHU A;  3BG5 A;  4B9W A;  2RHZ A;  4PJO C;  2D9T A;  4C0D B;  5GAM g;  1EIF A;  4LDV A;  3PGG A;  2E64 A;  2RD1 A;  3QG1 A;  1U8R A;  2JNG A;  3LW5 E;  1VQN A;  2EJG A;  2QF7 A;  2RI2 A;  3QZ5 B;  4NL2 A;  3L2Q A;  3OS1 A;  5GMK l;  4IUV A;  3RUX A;  5CKD A;  2ZPE B;  5GAO q;  5GAN 2;  4M77 A;  2QFZ A;  4XU0 A;  3LYI A;  4C0G A;  4JX5 A;  1QVG S;  1XTD A;  2FYK A;  3HRS A;  3A8G B;  2Y4X A;  3P8H A;  4Q5W A;  3BG3 A;  4AKG A;  2HD0 A;  2VGM A;  3RMQ A;  1S72 A;  2OTL T;  3L2W A;  3MET A;  3N5B B;  4ZN1 A;  4M78 C;  3GIB A;  5LJ3 h;  2YLC A;  3L2Z A;  2WJ9 A;  5GAO l;  1VQL T;  1P92 A;  4FT2 A;  3WXM B;  5LJ5 d;  2DEQ A;  2EKO A;  3PTA A;  4XTZ A;  2MF2 A;  4M6V A;  4MML A;  5DY9 A;  3C12 A;  4C92 C;  3JB9 G;  4N0A C;  4BDY A;  3CCQ A;  2ZPH B;  1YI2 A;  4KUI A;  4J8O A;  5GAN j;  3CBO A;  1YIT A;  3X24 B;  2O01 E;  1O75 A;  1KQS S;  3EAE A;  2HQX A;  2G3R A;  5KCH A;  4BE2 A;  5IAY A;  3JAM E;  2FL7 A;  5LJ5 g;  3WVD B;  3PNW C;  5CAI A;  2RJC A;  4PJO A;  4C0F A;  1E7P A;  3QYG B;  1B34 A;  4MZT A;  3URG A;  4BD3 A;  2DIG A;  1MHN A;  1KHI A;  3RES A;  4BBR M;  2OTL A;  4C8Q F;  3DB3 A;  2L5Q A;  1NPR A;  2KK4 A;  1M1K U;  1WJR A;  3CCL A;  3OYF A;  2XDB A;  3UWN A;  4A4K A;  3G71 T;  4FM4 B;  1WPY A;  1ZHI A;  4OF1 A;  5GAM h;  3H6Z A;  2WSE E;  3HRT A;  4C5E A;  3CC4 T;  1IZ6 A;  4C0D C;  2K5I A;  2R5M A;  2E5Q A;  2V8J A;  1VQ4 T;  4M78 G;  4ATO A;  2OTJ A;  5GAN f;  2CKK A;  3A8L B;  2E10 A;  3VJP A;  3CEY A;  3QO3 A;  2F5K A;  2F5T X;  3E1S A;  3OS2 A;  3CCJ A;  4M78 A;  3PIP A;  1N9R A;  1N8R U;  3S3O A;  1KQ2 A;  3J81 E;  3OYY A;  3CCM T;  3S3N A;  2LRQ A;  2YHT A;  5FU7 C;  2PVO B;  1UGR B;  3CMA A;  4M7A B;  1VQN T;  1UGP B;  1FWZ A;  2KY9 A;  5GMK e;  3DKM A;  1PSE A;  3M5A A;  1QVP A;  4IUP A;  3M54 A;  3MP8 A;  5GMK i;  5CR2 A;  1YJW T;  5A0D A;  3L2R A;  1NJI C;  2CZ0 B;  1M4Z A;  3MHX A;  4A4F A;  1Q81 U;  3BY7 A;  2CZ1 B;  5J26 A;  2RI5 A;  4MDX A;  3A8O B;  3P8D A;  3UDC A;  4M75 E;  2QDY B;  4M77 F;  3UPU A;  4N4G A;  4NS5 A;  3CC7 T;  3JB9 H;  4BI3 A;  2XIC A;  1G3Y A;  4C8Q B;  4MDW A;  4BE1 A;  4PJO E;  3JCM Q;  3CCV A;  3V7R A;  4CI0 C;  2JVV A;  5GAN d;  3O8V A;  4C92 D;  3GOX A;  5IT9 E;  5FU6 C;  2L89 A;  3L2V A;  3G4S A;  2M9U A;  4FIB A;  5LJ5 j;  3TW7 A;  3CC2 A;  3JCM g;  4JJN K;  2MWP A;  1XQH A;  2X4Y A;  4NOY A;  4M78 D;  3H8Z A;  4XTW A;  4XTX A;  1M1K C;  5CQY A;  2M16 A;  2QQA A;  3SWN C;  1X6O A;  3C95 A;  2QTX A;  2GF7 A;  5GAN 7;  1XNI A;  4KBM B;  4X9C A;  4M75 B;  5D6W A;  3CBP A;  5CO7 A;  4QQ6 A;  3QII A;  5GAN 4;  2WSF E;  1U1T A;  2BUD A;  3TEE A;  2X4J A;  3OYH A;  3HSB A;  2E6Z A;  2K2V A;  1YBY A;  2RI3 A;  4YTL A;  2DD4 A;  4HNV A;  1KD1 U;  1K9M U;  1Q82 U;  3HPW A;  4O5V A;  4QW2 A;  5D6X A;  1Q7Y U;  3G4S T;  4M7D D;  3CCS T;  1M1F A;  3MEW A;  3RKW A;  3S3M A;  4A4E A;  4J6W A;  5CKH A;  5LJ5 e;  3DLL A;  2E70 A;  2XU8 A;  2G77 A;  2LX9 A;  2PUO B;  3QBY A;  5LJ3 j;  2VYT A;  1QLB A;  4BAC A;  3A8M B;  1QVG A;  2LCL A;  1BI1 A;  2VXE A;  1LJO A;  2XKO C;  2L3R A;  1Q86 C;  4M77 B;  4LD6 A;  1WNL A;  1YJ9 A;  3HRU A;  3JCM J;  4HT9 A;  3QDR B;  2MMP A;  1G5V A;  3SFM A;  4DQ2 A;  1KC8 U;  2PUK B;  2XD0 A;  2QQ8 A;  2D0Q B;  1TH7 A;  2Y90 A;  4KT0 E;  4JRI A;  3V8J A;  1Q82 C;  5FRM A;  4E7K A;  3QYE A;  4MMK A;  4A54 A;  4M77 G;  3CMA T;  1VQL A;  5FRN A;  1H64 1;  5GAN 8;  3RIR A;  5J3B A;  2X4W A;  2DTO A;  2RK1 A;  2XHC A;  2QEX T;  3CCU T;  3JB9 J;  2LNV A;  4PJO B;  2DXC A;  5LJ3 e;  4DOW A;  4IUQ A;  4XTU A;  1WJS A;  2RJE A;  1NJI U;  1VQ7 A;  2GFU A;  1BKB A;  2ZPB B;  1Y7X A;  4JLI A;  4LDY A;  4PJO G;  3CCR A;  3JCM V;  3J80 E;  3CCQ T;  2HNI A;  4C5H A;  2QQS A;  5FLX E;  3OYE A;  3JCM P;  4M75 G;  3CME A;  1HK9 A;  4FSX A;  5GAN 3;  3HZJ A;  2HQE A;  2QXF A;  1Y71 A;  3HB9 A;  4GY5 A;  2D6F A;  3JB9 F;  4M7D F;  2IVW A;  1YJN T;  4M7A E;  5HK3 A;  2DK3 A;  1GXI E;  4ELJ A;  2RJF A;  2MWO A;  3A5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...