2ZPHB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 340min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zphB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zphB02
2WSCE 1QP2A 2DD4B 2ZZDB 2DD5B 2PVOB 2PU9B 3A8OB 2WSFE 3X28B 2DXBB 2O01E 4L6V5 2AHJB 3VYGB 4OB2B 2DD4A 4Y28E 2ZZDA 3A8MB 4KT0E 2ZPGB 2ZPIB 2PVGB 2CYZB 2D0QB 3VYHB 3QZ9B 2DXBA 2PUOB 3VYGA 3A8LB 2ZPFB 2WSEE 3QYHB 4OB3B 3X24B 3X26B 4OB0B 1IREB 2DD5A 1DJ7B 1PSEA 3QZ5B 4OB1B 3A8HB 4ZGDB 3LW5E 4ZGJB 3QXEB 3HHTB 2CZ6B 1UGQB 2ZPEB 2DXCB 2PUKB 2CZ0B 4FM4B 4ZGEB 1GXIE 2ZPHB 3WVEB 1PSFA 1UGPB 2QDYB 1AHJB 5L8RE 2ZPBB 3A8GB 2DPPB 2DXCA 3X25B 1QP3A 2PVDB 4XK8E 2ZCFB 1UGRB 1UGSB 2CZ1B 2CZ7B 1JB0E 1V29B 3X20B 3WVDB 4RKUE 3QYGB
chains in the Genus database with same CATH superfamily
3QO3A 2G9XB 2K57A 3C94A 3OYYA 4AKHA 1I0CA 1TXQA 2PVOB 2PTKA 1X69A 1H3ZA 2E3HA 2P84A 2KEAA 4F7NB 2XU8A 4E7HA 3VUZA 4KGZB 2QQ9A 5GAN8 3TN8B 5FWBA 1FXXA 4FX3B 4GBQA 2DL8A 2K3XA 4KGXB 1SRMA 1MNDA 4EORB 2EJ9A 2YWWA 2A37A 4BCQD 2DXBA 2DILA 2OTJQ 4AFSC 4J7IA 2DYBA 1NJIU 2C5VB 1OX9A 5GAOr 5AT1B 3I56A 3P8DA 4EOPB 3CCQT 4GLKA 4BCPB 1VUBA 4Z6YA 1UDLA 1O9KA 2IVWA 4ZGDB 4M77D 1QCFA 1SRLA 3NGPA 3OBYA 3PGGA 5IHKA 4MZTA 1WXBA 2ZPEB 3MEVA 5GANj 4C5HA 2M02A 3VRYA 3OW2S 3MP1A 2RHZA 3TU4K 1E7OA 4HVWA 5D6XA 5FLXE 4LDXA 3N5BB 3S3NA 3ZEHA 1NM7A 4IUVA 1PKDB 2K7AA 1MHNA 2CJMB 4BCJB 1I5OB 1H24B 2RM4A 1D3BA 3GF5A 2PZ1A 4HL4A 5D7UA 1VQPQ 2JJ9A 4M7DF 4RMOA 1M3BA 1V29B 4JX5A 4ESRA 4C5EA 7AT1B 1ZSZC 4ZN1A 2R57A 1U5SA 1D0ZA 2YUNA 4JJDA 4XU2A 1OKVB 2F69A 3PIOA 1UHCA 2MYSA 4C92A 1S72Q 4IUQA 2FB7A 4MZMA 3BG3A 2QDLA 1WX6A 1IZ6A 2PK9B 3GNFB 1K8AR 1ZUKA 3LX7A 5IDNB 1VQ8Q 3SWNA 1UTIA 2XDDA 1OI9B 1XTDA 2O4XB 4O6JA 1IXDA 1P5EB 1WHKA 2ZPGB 4PFOA 2QTVA 2OTLT 1RADB 4XTZA 1FYNA 5DLOA 2KROA 4E6RA 4FT2A 3EFSA 2WSEE 3HL8A 4C92G 1F5QB 1G3NC 2O9VA 4PLIA 5GAMf 3CCQA 4C5GA 4M7AE 2M16A 2ROTA 2LQWA 2QDJA 4EOJB 4C0FA 4Z88A 4RG2A 2E5KA 5LJ3f 1BB9A 1VYTA 2J05A 1VQLQ 2QTXA 4M7DD 1WA7A 3LW5E 2KRMA 3RMSA 3QJYA 4YC3B 4M78C 1UJ0A 2K2MA 3JCMb 2K5IA 5CKFA 3J81E 1QVFA 2DVJA 2EQUA 3NHNA 1K9MC 1H1PB 3VUBA 4YOSA 2MOXA 1ZA1B 3Q1JA 2K9GA 3FDRA 2UZLB 2LQNA 2DL3A 3JCMJ 5LJ5h 2QQSA 4EMHA 2MWOA 1WZOA 2ZPHB 2LJ1A 3VU3C 3CMAA 1B7TA 1NPRA 4M78E 1N8RR 3AHUA 1MMNA 1ZP2A 1M8MA 1K0SA 1I81A 4XK8E 3CCET 1UGSB 2CZ1B 2CZ7B 4LUDA 4PK4A 1X6OA 4D8DA 4EMKC 3RDVA 3CXCA 2G3RA 4M75F 3X20B 2CP2A 4RTUA 4E47A 3FC3A 2EYXA 4Y72B 4RTXA 2B9RA 2DD5B 4J9EA 5J39A 2CP6A 2K2VA 2RB6A 3JCMP 3P8BB 2YT6A 3PT9A 4CFWB 1PD0A 4FSSA 2QA4T 3VS0A 4BE2A 1M8VA 2MCNA 1F1BB 1ZA2B 2CDTA 2BS3A 4L6V5 3EJ1B 2KYMA 2BE9B 3L2RA 4AFUC 2DE0X 2RF0A 3FJPA 3EG9B 2COZA 2QYZA 1M1KU 2PNIA 1UUEA 1G3YA 1I8FA 1GCPA 1X43A 3JB9I 2GQIA 4MIMA 1ZSZB 4EDUA 3NMZC 4F6WB 1VQ9Q 3EG0A 2DJZA 1M1KR 3E1SA 1BCMA 2RQVA 3A8LB 2ZPFB 4RTZA 1M90C 1Q82C 2F2WA 2BS4A 1YBYA 1SSFA 1Q81R 4LD6A 4ANJA 4M75D 3CC2A 1PRLC 1U06A 3QXEB 1K9AA 3HPWA 1M2OA 2W96A 2RMOA 3HHTB 2EQIA 2RHYA 2C6TB 3A5ZB 4BD3A 1AT1B 1Q86C 4XTXA 3VS1A 3OS1A 3SEMA 3M57A 2L3SA 4BCOB 4PNOA 4M4ZA 1VQMT 4L59A 4JX6A 1QVGA 2C0OA 1BU1A 2UUEB 2GFAA 5LJ3g 1OIUB 4LD9K 2XD0A 1E6GA 4PJOG 3RIRA 3QWXX 2LMJA 3PE0A 2LVMA 2CREA 2X51A 3X25B 2P4RA 2W99A 2VGNA 4JRPA 1XJWB 2DJQA 4DBFA 3EGUA 3CCEA 3RNJA 3NPFA 3GIBA 2RI5A 2RK2A 4JRQA 3HSBA 1YJNT 4QVZA 4M78B 1G5VA 4BDYA 1BIBA 1VQKQ 5GAMe 4EOLB 1VYWB 5LJ3e 1IO6A 5KCHA 1IHWA 4B9WA 1YJWQ 2UZDB 5C0MA 4BDZA 2A36A 2LW4A 2JW4A 2DM1A 4XAXB 2D8JA 3HP9A 2NUZA 4C0GA 1ZUUA 5CKBA 1AWWA 5A0GA 4PJOD 2RPNA 4FL6A 1RL2A 1SSHA 3PO3S 2H3JA 4HNVA 1PM3A 1GRIA 2RQUA 4HCZA 2JVVA 2J6KA 5KCOA 5A2QE 2CH4A 1UNGD 4ME7A 2HD0A 2ED1A 1H92A 1W4SA 2HKQB 4EMKB 3CCUA 1OQKA 4J6YA 2W2HA 5GMKj 1K76A 1QVFP 4QKUA 3L2WA 3VYGA 4KULA 5LJ5f 2AKLA 2FYKA 3REBB 1KHCA 2RI2A 1VQ6A 1GL5A 2I0NA 2LRQA 2FL7A 2ZAEA 5GMKi 1V76A 3JRZA 1OZ3A 2HQHA 3DDQB 5KYNA 1CSKA 1X6BA 1FMWA 1OL2B 4BCKB 3G4SA 3CMET 1JO8A 4HKEA 3I9QA 1VQOT 2CP5A 1MMAA 3CXCP 1VQMA 1UE9A 1JKWA 1KC8U 3TNWB 1TSFA 1WNLA 2VXEA 1UJYA 1M2VA 4IUTA 1KC8R 2PJQA 1Y96B 5CR2A 3H9NA 1VQ5Q 1SKUB 4FSXA 3BW1A 1QWEA 3PFSA 3CD6T 2R7GA 1VQ4A 2FZKB 3E2UA 1E6HA 1AD6A 1YJNA 3CCSQ 3OW2A 2HL5C 1W98B 3THKA 1JB0E 2G6FX 1VIEA 3NDQA 1IGQA 1KD1C 1TOVA 2DNUA 1AD5A 3CXCS 1I07A 2HBPA 2M0OA 3QYGB 4BY7X 3BE3A 5CKEA 2E65A 2EQJA 5GANg 4QW2A 2NUTA 2WPAB 1UECA 2V26A 1NG2A 3EGXA 3MY1B 2YXYA 1AVZC 4BXXX 2OX7A 1C6VX 2EFIA 2GNCA 1NBEB 1OX8A 5KYWA 2GTOA 4QT7A 3TSZA 3BFMA 4D6WA 3ULRB 4KH1B 2JXBA 3PVLA 2DD4A 4IURA 3J80E 1CKBA 5ACBA 1LOJA 3H8ZA 1JOWA 1G3SA 3VS6A 3KXTA 3KBGA 4DEYA 2FRWA 3NTKA 1PD1A 2QQ8A 1WLPB 5GANe 1WFWA 2YRDA 2DKGA 2EQKA 1GUXA 2F1LA 5HK3A 4YOZA 2EYZA 4AKIA 1N9RA 1BYMA 2F2CA 3LWIA 1R0BG 1TUDA 5FU6C 3VS7A 2PMIB 2C4GB 2OTJT 1RAIB 3JCMh 3JCMV 1X6GA 2LTOA 4XQ3A 3BDUA 2RHXA 1M4ZA 3QBYA 3EOCB 1GFCA 3JCMc 5GAOq 1YHQQ 3EG3A 1WGSA 2XICA 2MF2A 1W2BS 2RNAA 6AT1B 3QJ6A 1Q7YU 4PKCC 1K1ZA 5GMKl 4ZNXA 1VQOA 4QSHA 4F7UA 4ZGEB 1WJQA 4YTLA 4MFEA 4C8QC 3SDZA 4E2FB 2L5QA 1Q7YR 4PJMA 4A4FA 2EGEA 3KFVA 2CT4A 2WMAB 4V2SA 2GGRA 2VC8A 3SWNB 3DTOA 2QGFB 2JM8A 3NTIA 1NJIC 4A4GA 5KYXA 5ECAA 2NWMA 4HT9A 3S3MA 3CD6A 5FU7C 2R5MA 2HNIA 2FG0A 2CT3A 1M3AA 2IIMA 4CFVB 4LDUA 2FPEA 4XTWA 4M78F 2HAXA 3G7ZA 2XI9A 2RK1A 4UC4A 2VVKA 2P0QA 4Y92A 3HBLA 4ELJA 1X2KA 4MDXA 1VQ7Q 2ENMA 3QDRB 2ZGWA 2M1HA 3EFOA 3X28B 4M77A 1OU8A 4ZTJA 5GANd 2PQWA 2O01E 4PFZA 4CC7A 1TG0A 2EYYA 1MGQA 4A4EA 4RTVA 2L2PA 2QQAA 1H26B 4C0DB 3VKIA 5KYUA 2PVGB 3O0GD 2D0QB 3VYHB 3UF4A 2M0YA 1VQNQ 5C6SA 1VQ8T 2AT1B 3E9FA 3LH0A 4OMQA 1LVKA 5DM7R 3CC7Q 3HZJA 3CCMT 4M77G 2OTJA 1K73R 5I21A 3I55Q 4N0AA 1IREB 2X35A 5M9OA 3M0SA 4Z02A 4M78D 3CEYA 1OV3A 4NL2A 4M6VA 5GAN5 5HQ0B 5CQYA 2A28A 4ZTFA 3URGA 3EGDA 2B86A 1KQ2A 3MP8A 2RJEA 3BG9A 4PJLA 2DTOA 2I2LA 2R5AA 2X1NB 2KY9A 1RUWA 1E7PA 3OW2P 4Y91A 4J9IA 5L2WB 2D0NA 2DL4A 4KUIA 3CC4T 4K11A 4ROCA 2OI3A 2L8DA 1GH6B 1M3CA 2HSPA 5KYYA 1UGVA 5EJCA 4JS5A 1OKWB 2WFYB 2ZPBB 3HTRA 2JS0A 5FU6B 1NPPA 1W1FA 1WDXA 2RQTA 2NYSA 1HXDA 3ME9A 3OS2A 2KXDA 3M4YA 1WHMA 2QEXT 4EOSB 2BZXA 3DLMA 3PMTA 3CPWA 1U1SA 4DBQA 1OPLA 1B07A 3KUFA 4BCNB 2WSCE 1WIEA 1VQPA 3CMAT 5GAOl 3UT1A 3QUIA 3BHVB 4C8QB 2NUPA 1QCOA 2UZBB 3A8OB 3QIIA 1O75A 4RCBA 3BHUB 4CC3A 1M1FA 2V8IA 4M7DA 2KE9A 4CRIA 2WACA 3JCMf 3P8HA 3DKMA 2P0PA 4LN2A 2DLPA 1S72A 5FU7B 5GJVB 1OULA 2OJ2A 4QQGA 1C9BA 1CKAA 4R55A 1MNEA 1X2QA 3JAME 3H6ZA 3RUXA 3V8JA 2RJCA 4VUBA 5D6YA 1VQ8A 2KNBB 2AK5A 4FYWB 3MO8A 2QQRA 2XIDA 1K8AU 2RJFA 1U8RA 1RAEB 1J3TA 1D3UB 2HL3A 4G6LB 5GAN6 1RAAB 3BDLA 3QYHB 2Z0WA 3CCMA 2CKKA 1FWZA 3L2UA 5CVIA 3CCRQ 4M7DG 3JV3A 4FYYB 2EBPA 3M0UA 1GBRA 2V1RA 4IIOA 4KRDB 4OGEA 1VQ9T 4AI6A 3EAEA 4HCCA 4QVDA 1ZX6A 4WF2A 3REAB 4M7AC 1M27C 3TVTA 2KYBA 5LJ5j 1RI9A 2DXUA 5HBEB 4HCKA 4JS4A 1VQLA 2X4YA 2DK3A 3QHRB 2PUKB 3OYNA 1D0XA 4ATOA 2CZ0B 1JSUB 3DDPB 3CC4A 3FEOA 2UZEB 4PLLA 2EKHA 4LUEA 1VA7A 2CS7A 3M0QA 2KR3A 1NLOC 3TW7A 4NC6A 1WYXA 3M0TA 1B34A 2H8HA 2F2XA 2VASA 3CC2T 1QLYA 5IHYA 3AT1B 3LH5A 4XU3A 2QEXA 2DO3A 4HLQA 4JRKA 1AEYA 3O5ZA 1N8RU 2JT4A 4FIBA 3UDCA 4BI3A 5DQVA 2JZ2A 4A54A 5GMKe 1H3HA 3GP8A 1VIFA 4RKUE 1HK9A 5EG2A 2ZZDB 2KBTA 3M4GA 4R0KA 4EONB 4F7UE 3CCQQ 1D1BA 4J6XA 2PU9B 2VWFA 4JJCA 5FRNA 5IT9E 1KQ1A 3EH2A 4JLGA 4M75A 4PJNA 1KIKA 2LNHB 2AHJB 4CRLB 1YJWT 1NLPC 3JB9F 4JX4A 4DBHA 3OMGA 2HEQA 4O5VA 2G77A 3INZA 2D8HA 2BIVA 3SFMA 4GY5A 1O9SA 5KE2A 1P92A 1Q95G 2JUFA 3NTHA 3L42A 4FYXB 4F7JB 3JB9G 1V1CA 1IRXA 3RGFB 4EMGA 2XMFA 3LYIA 3QWLA 3QSUA 4M75G 1VQ9A 1VOMA 3MP6A 4RTYA 4NSTB 1UHFA 2MIOA 4LDWA 3VS3A 4CXAB 4BBSM 2RD1A 3DLLA 1OEBA 1YI2T 2ESWA 2YUPA 5CO7A 1OZ2A 3CCUT 4II1A 2K79A 4AKGA 1M5Q1 2HZYA 4IKFA 1XNIA 4BI8B 2GBQA 1TD6A 2EJFA 4RTWA 2DL5A 2E41A 3CPWP 1WJSA 2HDAA 4OGCA 3G6EQ 1Q81U 2K3YA 1ARKA 1NEBA 1VQ6T 2J06A 4PJOA 1N9SA 2QGGA 4OGRB 3VKHA 3JB9D 4X9DA 1RLQC 2DBKA 5IHIA 1W2BA 1WQWA 3I5SA 4KBMB 2NLUA 3M58A 1GCQA 2H3EB 4OVAA 2SEMA 4M7AB 4Q5WA 3G4ST 2OTLQ 2DIQA 4N4HA 1ZBJA 2DTHA 1K9MU 2O31A 3MY5B 3CPWS 3RKXA 5GAMg 4OMOA 2P4TA 4P5NA 5LQFB 3F5XB 1RABB 2AZSA 2SRCA 2VGMA 1K9MR 1RLPC 4C8QF 4DOVA 2DF6A 1VQKA 1RI0A 4EOIB 2WSFE 4A4KA 1TFBA 5I11A 2E6ZA 1KC8C 2ATCB 2KK4A 4PJJA 1YJWA 1VQ4T 2DETA 4HT8A 2DEQA 2QXFA 2QK0A 3POMA 1YCYA 3GBQA 4KGVB 2MPXC 1YIJQ 1X75C 1I1JA 2ED0A 4L5GA 5CYIB 2LZ6B 2DL7A 4BUGA 2HQXA 3BLHB 2CP0A 3H0IA 2C5NB 3C95A 4C8QG 4LNPA 5IF1B 2QQBA 3OB9A 2IPOB 2DRKA 4J83A 1ZHIA 2F5KA 2O4XA 1N5ZA 4F04B 1BI3A 2RA2A 4AT1B 3KHIA 1TH7A 2BKDN 4JLIA 3TW6A 2V22B 3EIDB 5BNJB 2AZVA 2W0ZA 4AFQC 1DJ7B 3MEAA 2FEIA 2KVQG 1YI2A 4JRIA 4C92C 3VKGA 3CBPA 4J7FA 1SEMA 3C4SA 5HCKA 4BCND 1ZQ1A 2DXCB 2XK0A 1YITT 4C8QD 2BE7D 4I3ZB 3SWNC 2EQMA 2XKOC 2BTTA 1GXIE 1KHIA 2E6NA 2QA4Q 4C92E 3MI9B 2J6FA 2QDYB 3G33B 4BCHB 2J6OA 4OF1A 1BK2A 2E64A 5GAOn 5KYUB 2X3WD 1M90R 1YJ9Q 2DYIA 3IQLA 1Q82R 3CCJQ 1W70A 3M0RA 1GY3B 1WHJA 1ABOA 3FRNA 4DOWA 3V7SA 1Z9QA 2FO0A 1FX7A 1VQ5A 4HNUA 2EPDA 2K5LA 1QLBA 3CBMA 2LJ0A 1H1RB 4F70B 3A1PA 1U1TA 3FB9A 2FVUA 3CCSA 1TWBA 1WJRA 1QP2A 4JZ4A 4EOMB 2IN3A 1Q7YC 2QI2A 1T0HA 1Q86R 5HBJB 1GBQA 1SPKA 5GAMd 3OYLA 5AYFA 4CFUB 5HY6A 3HKSA 5LJ3d 1SG5A 2VUBA 3PTAA 2DXBB 1U3OA 5IHNA 4OMMA 4X34A 4C0DC 2CSIA 4IMYB 2YSQA 2E4HA 2BKZB 4OB2B 1FVVB 3DL1A 1H641 3G71Q 2VYTA 1VQ7T 2EGAA 3H0FA 4J9HA 3QYEA 1A0NB 2IG0A 1RAGB 4OP0A 3SHWA 3FLGA 1O9KB 2JN0A 1H1SB 2KDSA 2LT1A 4A4HA 3DB4A 3E9GA 3C12A 2IW9B 2HBWA 2DMOA 5DY9A 1PNJA 3EG9A 4KRCB 4QQ6A 2A08A 2COYA 1PSEA 3UA6A 3UA7A 1ZSZA 2KQWA 3M03A 3JCMW 3HO8A 1YJNQ 3V7CA 3CC7T 1W2BP 4ZGJB 3V8LA 1UEBA 3TSWA 1KJWA 4XU1A 2IW6B 2NUPB 4HNTA 3EHRA 3HRUA 1YITA 1UGQB 2LQ8A 1YHQA 5J3BA 3EG2A 4TVRA 4KH0B 1AWOA 1D3BB 2EYQA 2FPFA 1QCNA 5FW9A 2WHBB 2XDBA 2BUDA 2CCIB 2W10A 2Y90A 1OOTA 1VOLA 3L2QA 2CSQA 4MMLA 2QASA 2C0TA 2JS2A 2LDMA 4F17A 2M51A 1UGRB 3HFOA 4M7AF 1BI1A 4C92B 1PCXA 9ATCB 2A3LA 5DLQE 2QF7A 1VYUA 2LT4A 5LJ5g 1JJ2A 3OYDA 4AMCA 1VINA 2D6FA 4JPBW 2WJ9A 5I2SA 2EW3A 1YP5A 4PFPA 3M53A 1BI0A 1FMVA 3K7AM 2DZ9A 5HBHB 4N4IA 1PC0A 2LX9A 4KRTA 4M78A 4M7AG 4PJOE 2KR6A 3RR6A 4J9FA 4R56A 2X9HA 4CFXB 1VYVA 1VQ7A 2F5TX 5LJ5e 4JUVA 3CMEQ 5LMKB 2WXVB 1ACMB 2LNVA 2EKOA 3QHWB 1N27A 2JTFA 3HRSA 2CYZB 4E7IA 3GLXA 1R77A 2OAWA 1VQPT 1EZZB 4CFNB 2BS2A 3CCVQ 2X3XD 4JJNK 2WMBB 3QKJA 3CCLQ 4Z8AA 2FZCB 5CQXA 1KG1A 4Z89A 1H25B 2A0FB 1VQNA 1RACB 2E3IA 2EJGA 2JGZB 4M78G 3OYAA 2L0AA 1M1GA 4EMKA 1BBZA 5EC7A 4MFDA 4M7AD 3J7AF 2EYWA 1S72T 3ER0A 5GAMh 4E7ZA 3QZ5B 3CC7A 3A8HB 5LJ3h 3TEEA 1LJOA 1IGUA 1PKSA 3I55A 1WHHA 2HCKA 3GNGA 3D7SB 3QWYA 1KQSA 4NL3A 1K73U 2DFUA 1Z9ZA 4RUGA 3MIAB 3I5RA 3TNIB 2R58A 2X4WA 3LGLA 2RHIA 1RAHB 3ZFJA 1KSWA 1I5LA 2DERA 2K5FA 5KE3A 1MMGA 3TQ7P 1K8AC 2W9FA 1OI1A 2LCCA 4J9CA 5L8RE 3EHQA 2DPPB 1UG1A 4UN0A 3HRTA 4JDSA 2C5XB 1MUZA 2JTEA 5IN1A 4RG8A 3PIPA 1QW1A 2RQWA 5IXBA 1VQLT 2COWA 2J7IA 3QYBA 2JOYA 1H8KA 4WTOB 4HA8A 2QFZA 2DIGA 1Y96A 3OBWA 1SHGA 5LJ5d 4BCMB 1X27A 1WPYA 5IAYA 4IUUA 4J6WA 4IIMA 1ZUYA 1UB4A 1T3LA 1YCSB 1FINB 4QVCA 2YRCA 3JB9H 4ELZC 3ASKA 3OYFA 5HKCA 1NJIR 4Y28E 5HVYB 3JCMQ 1UNHD 2MAMA 4EC8B 5DQWA 3T9NA 2V1QA 4CC2A 4PJOB 1HD3A 3OA6A 1H4LD 1JSTB 4FU6A 3I56Q 1QMZB 3R6OA 4CI0C 3OYCA 1YFNA 2GFUA 1N8RC 3L1AA 1AISB 3I35A 2CCHB 1G8XA 3MEWA 4RODA 2A7YA 4HVVA 1FKMA 1S1NA 1AZEA 3UPUA 1IHVA 5GAN4 2DTIA 4ELYC 1AWXA 2E5QA 4EIKA 5FROA 1B3QA 3CCRA 2KRNA 2CUDA 3VS2A 2QG9B 1PWTA 5CK9A 1WQ7A 3M59A 1JJ2P 2FZGB 4CFUD 3RMQA 2K3BA 2VXFA 2QGSA 3OYEA 3LWHA 1YNZA 1QKWA 2KSSA 4RCCA 2BZ8A 3GPLA 2WIHB 5GANh 2KT8A 3G6ET 4J8OA 2MI6A 3OSSC 4N4GA 1BU2A 1TUCA 4C92F 4BY1X 3DJBA 1LCKA 2LC4A 2K4YA 2YUQA 3OS0A 1M1KC 1JJ2S 4TTHA 3TREA 5HNBB 3S6WA 2Y4XA 1BIAA 4J9BA 3CCMQ 3M54A 3H0HA 3HFNA 8AT1B 3EG1A 1FMKA 3OYHA 4F14A 1RAFB 1Q81C 1ZLMA 1NYFA 1YN8A 2YDLA 1I4K1 3VYGB 4MZPA 2DVEA 1D1AA 2XHCA 4PL6A 4BBRM 5CEIB 4KT0E 1TS9A 2ZPIB 5CAIA 1HSQA 2X4XA 2EWNA 4EPCA 3CC4Q 1MV0B 1T0JA 3LQ5B 2DA9A 1KQSP 1KXUA 1JQQA 1T3SA 1BCOA 3CBOA 5HK0A 3BLRB 1YIJT 3OSVA 4E7LA 1VQKT 2CH4W 3QHSA 4XTYA 3X24B 3S3OA 4OMNA 3GTMS 4EOQB 4BY6C 4C92D 2QEXQ 2EIFA 3DB3A 3M56A 4FT4A 2DBMA 4ZN3A 2YLBA 4M77C 1PHTA 3OYKA 1TTHB 1EIFA 1JRIA 1QMCA 1M2VB 3CMAQ 3OY9A 2GTJA 5CKDA 1KQSS 1IB8A 1YWPA 3H4CA 5J26A 4AG2C 2DEUA 1TUGB 1BI2A 4FW1A 5I5ZB 3JCMg 1PSFA 3BLQB 2L3QA 4M77E 1AZGB 5A0LA 4KUDK 2DRMA 3G6EA 1QP3A 1PKTA 2NUTB 1WXTA 2JMCA 4EOOB 2RHUA 2O9SA 3EGXB 5CIUA 1WXUA 3VS4A 3PVQA 4LDVA 4N0AC 2JTMA 3C0CA 1D1CA 4J5YA 5KYWB 1M30A 1YJ9T 4MMKA 3CCJT 3JCMe 1ABQA 2I53A 1LPLA 2C06A 2OTLA 2DD4B 2E70A 2CP3A 1JEGA 4F7SB 3BY7A 2RQRA 2ECZA 3HB9A 4ROEA 1EFNA 4XTVA 3PNWC 1D09B 1GUXB 2AIRB 2QAZA 1OPKA 5FWCA 1NYGA 2E12A 1KFZA 1N6AA 1VQ5T 4J9GA 4C8QA 3B57A 5IH2A 2V8JA 3M0PA 4PJOF 3CCST 2RN8A 4A63B 1Y07A 4BE0A 2DX1A 3VS5A 2PUOB 3G71T 2FHDA 1YIJA 3MHXA 5FGKB 1TU0B 4NS5A 2W9ZA 3E19A 3DOGB 4BCFB 1H28B 1AWJA 1ZSGA 2VB6A 1SF9A 1YWOA 3CC2Q 3ZL7C 1R8OB 2DAQA 2VV5A 5GANf 4F7UB 2LJ3A 2C5OB 2HQEA 3R6NA 1OIYB 3O8VA 4BACA 3FIFA 2CUBA 1G2BA 1OYXA 2L89A 3RKYA 2MMPA 4M7DC 2B8AA 1K0XA 2KXCA 2CZ6B 4X9CA 3L2VA 5KYXB 2BPMB 4BCGB 2KRSA 4FM4B 4BCMD 1MMDA 3G1JA 2ROLA 4AFZC 4BCQB 3JB9J 1H1QB 3QDFA 3WVEB 5IXFA 1GFDA 1UNLD 3UWNA 3WXMB 2JM9A 3CCEQ 4M7DE 4DA4A 3SB2A 3QPHA 2LCSA 2MK5A 4QQDA 1JXMA 3A8GB 3JCMd 1UFFA 1WHGA 2EUFA 2E1HA 2PVDB 5LL6S 4JJBA 3BHTB 2QA4A 5CCAA 4BY6B 2GCXA 1QKXA 1X01A 1R0CB 3EH1A 3M9QA 2HKNA 2JNGA 3EFOB 2L3RA 4M77B 4D8KA 5L23A 4YOOA 1YJ9A 1YHQT 3CCJA 3V8KA 3BG5A 4ORZA 3VJPA 1Y0MA 3V7RA 1MV3A 1WI7A 3WVDB 1ZBXA 2DXTA 3UATA 4BI4A 1M90U 1Q82U 4BE1A 5GMKm 1NEGA 1NZ9A 1OGUB 2V8KA 3JCMX 2DMEA 3M5AA 1ENWA 2RH2A 5KH6A 2HMAA 3META 2C0IA 5GAOp 4FW2A 1QVPA 3OYMA 1YI2Q 3OYIA 2MWPA 3CCUQ 3LGFA 1C1AA 3RKWA 4F6SB 5GJWB 2ZZDA 2WIPB 1Q86U 1OL1B 3A8MB 4DBRA 1K4US 2WEVB 3EFRA 1URCB 3QG1A 4WCIA 2M9UA 8ATCB 3JSCA 2GF7A 3G71A 1VQ6Q 1JU5C 1XQHA 3MCAB 4F6UB 1QVFS 3OMCA 3CQTA 2IW8B 3M55A 4OMPA 4RTTA 3EGDB 4FYVB 1XO2A 2E10A 1WHLA 4HVUA 2DD5A 3CCVT 5GMKh 3G4SQ 5CKHA 1Y7XA 5I2MA 2I40B 2HSEB 3PMIA 3CCLT 4C5IA 1LNXA 5KYYB 4IUPA 1VQMQ 3SD4A 1D0YA 4DQ2A 1Y57A 4M75C 2F2VA 5EFQB 2CP7A 3RBBB 4E7JA 4F16A 5GAN7 2FPDA 1H27B 5FRMA 1OU9A 2L3PA 1G3WA 2OAUA 1VQNT 2KT1A 1UGPB 1HYOA 4X1VA 1N4MA 1VQ4Q 3VRZA 3RERA 3NFCA 4M75E 4CFMB 3VV0A 2RO0A 4LOCA 2KMGA 5GAN2 3I55T 2ZCFB 3A98A 4OR5B 2EGCA 3RESA 5I22A 4M7DB 4JZ3A 5IDPB 2GQVA 2D9TA 2LP5A 2KI7A 4LXCA 1JXOA 1G3TA 1QWFA 3OQ5A 2ABLA 3MEUA 2CGHA 4C0ZA 3OS5A 1K73C 2AKKA 4M7AA 2RJDA 2KAFA 2XG8D 2EVRA 4F7LB 4HXJA 1NE8A 4EC9B 1XOVA 4FCYA 2YHTA 4EOKB 1C0MA 5ICPB 1W6XA 3LLRA 4CC4B 3MJXA 2YLCA 4II5B 1AOJA 4PJOC 1QVGP 4B6MA 4XTUA 4E7SA 4HCBA 1HJDA 1PG5B 3F70A 1YITQ 2BZYA 4LE9A 4A53A 4GLMA 3U23A 2EAYA 5A0DA 2RI3A 4ELLA 3QZ9B 2LCLA 3OYJA 3CMEA 1GCQC 1SHFA 5D6WA 3TNHB 5GAMj 1BKBA 5LJ3j 3MKDA 4OB3B 5GAOm 1QQJA 4BCIB 2O2OA 4MDWA 2FRYA 2LX7A 3ZBDA 5GAN3 4NOYA 3I56T 3CCVA 1E9HB 3X26B 4OB0B 1KK7A 1QVGS 2PHGA 3TCJA 4F7UF 3OYGA 2XDPA 3CCLA 4OB1B 2O88A 1VQOQ 1KD1U 1Y71A 4AG1C 1B34B 1PRMC 4C8QE 1KD1R 2IVXA 2PK2A 3CD6Q 4F7UG 1M9SA 1G83A 3MPUB 4B9XA 1AHJB 4E7KA 2DXCA 3FJ5A 3H41A 2JMAA 3CCRT 3L2ZA 4OMLA 1EX4A 2X4JA 3OYBA 3CPFA 2YUOA 2KGTA 4XU0A 4OMFB 2KMTA 2VKNA 4BB7A 2DZCA 2P0KA 1JBMA 2YRVA 4M75B 4M77F 4LDYA 2LQKA 4DEXA 3GOXA 2Y4YA 4J9DA 2D1XA 2K6DA
chains in the Genus database with same CATH topology
4P5NA 3QO3A 2Y4XA 1BIAA 2K57A 3C94A 3OYYA 4AKHA 2E65A 2EQJA 3M54A 4QW2A 2VGMA 5CKEA 5GANg 2PVOB 3HFNA 4C8QF 4DOVA 1H3ZA 1VQKA 1RI0A 3OYHA 2WSFE 2EFIA 1Q81C 4A4KA 1KC8C 2E6ZA 2XU8A 2KK4A 4E7HA 3VUZA 3BFMA 1YJWA 1I4K1 1VQ4T 4HT8A 4D6WA 2QQ9A 2DEQA 3VYGB 4MZPA 2DVEA 5GAN8 2QXFA 2XHCA 4PL6A 2DD4A 1YCYA 1FXXA 4IURA 3J80E 4BBRM 1LOJA 3H8ZA 2K3XA 1G3SA 1X75C 4KT0E 4L5GA 3KXTA 2ZPIB 3KBGA 5CAIA 2EJ9A 2HQXA 2X4XA 4BUGA 2EWNA 4EPCA 3NTKA 2QQ8A 3C95A 4C8QG 5GANe 2DXBA 2QQBA 3OB9A 2DKGA 2EQKA 3CBOA 5HK0A 1YIJT 3OSVA 4E7LA 4J7IA 1NJIU 5HK3A 1VQKT 3QHSA 4XTYA 4J83A 5GAOr 1ZHIA 2F5KA 2O4XA 3X24B 1BI3A 4AKIA 2RA2A 3I56A 1N9RA 3P8DA 3KHIA 1BYMA 1TH7A 2BKDN 3LWIA 4JLIA 3TW6A 5FU6C 3S3OA 3CCQT 4GLKA 2OTJT 1VUBA 3JCMh 3CCET 4Z6YA 1DJ7B 3MEAA 3JCMV 4BY6C 4C92D 2KVQG 2LTOA 4XQ3A 3BDUA 2IVWA 2RHXA 1M4ZA 4ZGDB 2EIFA 3QBYA 3DB3A 1YI2A 4M77D 4JRIA 4C92C 5GAOq 3VKGA 3CBPA 3M56A 4FT4A 3OBYA 4J7FA 3JCMc 4HCCA 3PGGA 1WGSA 4MZTA 2XICA 2MF2A 2YLBA 4M77C 4ZN3A 1W2BS 3C4SA 3OYKA 1ZQ1A 1EIFA 3QJ6A 1JRIA 1Q7YU 4PKCC 2ZPEB 2DXCB 2XK0A 5GMKl 3OY9A 5CKDA 1KQSS 1VQOA 1YITT 4QSHA 3MEVA 4C8QD 3H4CA 5J26A 4C5HA 4F7UA 3SWNC 2EQMA 5GANj 3OW2S 4ZGEB 1WJQA 4YTLA 2XKOC 1BI2A 3MP1A 4MFEA 4C8QC 3SDZA 1GXIE 2RHZA 1KHIA 3JCMg 3TU4K 2L5QA 5D6XA 5FLXE 2E6NA 1PSFA 4A4FA 4C92E 2P4TA 4LDXA 4V2SA 2VC8A 3N5BB 3SWNB 3S3NA 2QDYB 4M77E 3NTIA 5A0LA 1NJIC 4KUDK 3ZEHA 4OF1A 4A4GA 2E64A 3G6EA 4IUVA 5GAOn 4HT9A 3S3MA 1QP3A 1MHNA 3CD6A 5FU7C 2R5MA 2HNIA 2RM4A 1D3BA 3GF5A 4LDUA 2RHUA 3FRNA 4DOWA 3V7SA 4HL4A 5CIUA 4XTWA 1FX7A 4M78F 4M7DF 1VQ5A 4HNUA 2K5LA 2JTMA 1QLBA 3CBMA 1V29B 4J5YA 4JX5A 4LDVA 4N0AC 4C5EA 1JJ2A 2HAXA 1YJ9T 3G7ZA 4MMKA 4ZN1A 3CCJT 1U1TA 2R57A 2XI9A 3JCMe 2RK1A 3FB9A 2FVUA 4UC4A 3CCSA 2P0QA 1WJRA 4XU2A 3HBLA 1QP2A 2F69A 2C06A 3PIOA 2DD4B 2OTLA 4ELJA 1Q7YC 2E70A 4MDXA 2QI2A 3BY7A 4C92A 3OYLA 5GAMd 3QDRB 2ZGWA 3HB9A 4IUQA 5AYFA 5HY6A 2FB7A 3HKSA 4MZMA 2M1HA 3X28B 3BG3A 4M77A 5LJ3d 4ZTJA 2VUBA 5GANd 3PTAA 2DXBB 2PQWA 2O01E 1IZ6A 4XTVA 3PNWC 4X34A 4C0DC 1MGQA 3GNFB 3LX7A 4OB2B 3DL1A 1H641 3SWNA 4A4EA 2E12A 4RMOA 2VYTA 2XDDA 1N6AA 1VQ7T 1XTDA 1VQ5T 2O4XB 4O6JA 4C8QA 2QQAA 3QYEA 2ZPGB 2IG0A 4C0DB 3VKIA 2PVGB 2V8JA 4PJOF 2D0QB 3VYHB 4OP0A 3CCST 3FLGA 2OTLT 1Y07A 4XTZA 4BE0A 2JN0A 5C6SA 1VQ8T 2KDSA 3G71T 2PUOB 5DLOA 2FHDA 1YIJA 3E9FA 3MHXA 4FT2A 4NS5A 2LT1A 4A4HA 3DB4A 3E9GA 3C12A 3E19A 3EFSA 3LH0A 5DM7R 2WSEE 3HL8A 4C92G 5DY9A 3HZJA 3CCMT 4PLIA 5GAMf 3CCQA 4C5GA 4M7AE 4M77G 2M16A 4QQ6A 2OTJA 2QDJA 5I21A 1R8OB 4C0FA 1VQ9A 5LJ3f 4RG2A 2DAQA 2VV5A 4N0AA 1IREB 4F7UB 5GANf 2X35A 1PSEA 2HQEA 5M9OA 3O8VA 2KQWA 4Z02A 3HO8A 4BACA 3FIFA 3JCMW 2QTXA 4M78D 3CEYA 4M7DD 3LW5E 3V7CA 3CC7T 1OYXA 4M6VA 4ZGJB 2L89A 4NL2A 3QJYA 2MMPA 3RKYA 3RMSA 3V8LA 1UEBA 4M78C 4M7DC 5CQYA 3JCMb 4XU1A 3URGA 2B8AA 2K5IA 5CKFA 3J81E 4ZTFA 1KQ2A 1QVFA 3MP8A 2CZ6B 4HNTA 4X9CA 3HRUA 3L2VA 2EQUA 2RJEA 3BG9A 1YITA 1UGQB 1K9MC 2DTOA 2LQ8A 2I2LA 2R5AA 2KY9A 3VUBA 1E7PA 3Q1JA 4FM4B 4Y91A 1YHQA 5J3BA 3FDRA 4KUIA 4TVRA 3CC4T 3JCMJ 1D3BB 2L8DA 5LJ5h 2EYQA 2QQSA 4EMHA 2MWOA 3JB9J 2ZPHB 3VU3C 2XDBA 3WVEB 2BUDA 3CMAA 1NPRA 3UWNA 3WXMB 4M78E 5EJCA 2Y90A 4JS5A 3AHUA 4M7DE 4DA4A 3SB2A 3QPHA 3L2QA 4QQDA 2ZPBB 3A8GB 5FU6B 3JCMd 1NPPA 4MMLA 2LDMA 2PVDB 2E1HA 5LL6S 2QA4A 5CCAA 1I81A 4XK8E 4BY6B 1UGRB 3HFOA 4M7AF 2GCXA 1BI1A 3ME9A 1HXDA 1UGSB 2CZ1B 2CZ7B 1X01A 3M4YA 4C92B 3OS2A 2QEXT 2A3LA 3M9QA 5DLQE 2QF7A 1X6OA 2JNGA 2LT4A 2L3RA 3DLMA 3PMTA 4M77B 4EMKC 5LJ5g 3OYDA 3CPWA 1U1SA 3CXCA 2G3RA 3CCJA 3V8KA 4M75F 3X20B 1YHQT 1YJ9A 3BG5A 2D6FA 3VJPA 2WJ9A 3V7RA 4BI4A 5I2SA 2DXTA 3WVDB 1ZBXA 3KUFA 4E47A 1M90U 3FC3A 1Q82U 4BE1A 3M53A 2WSCE 1BI0A 5GMKm 1VQPA 1NZ9A 3CMAT 2DZ9A 5GAOl 3UT1A 2DD5B 3QUIA 2V8KA 4C8QB 3JCMX 5J39A 4N4IA 3M5AA 2K2VA 2RB6A 2RH2A 3JCMP 3A8OB 3P8BB 1O75A 2LX9A 3QIIA 4RCBA 5KH6A 1M1FA 2V8IA 4M78A 4M7DA 4M7AG 3PT9A 4PJOE 3META 2QA4T 4CRIA 2KR6A 2WACA 5GAOp 4BE2A 1M8VA 1QVPA 3GP8A 4L6V5 3JCMf 3OYMA 2BS3A 3P8HA 3OYIA 3DKMA 4R56A 2MWPA 2P0PA 1VQ7A 3LGFA 3RKWA 5FU7B 1S72A 2F5TX 5LJ5e 4JUVA 4QQGA 3L2RA 2ZZDA 1Q86U 3A8MB 2LNVA 2EKOA 3FJPA 1N27A 3EFRA 4R55A 2JTFA 3HRSA 1M1KU 3QG1A 2CYZB 2M9UA 4E7IA 3GLXA 3JAME 3H6ZA 3RUXA 3V8JA 1G3YA 1I8FA 3JSCA 2GF7A 2RJCA 4VUBA 5D6YA 3JB9I 3G71A 1VQPT 4MIMA 1VQ8A 4EDUA 3MO8A 2BS2A 1XQHA 2QQRA 2XIDA 1K8AU 2RJFA 1U8RA 3MCAB 2DJZA 4JJNK 3E1SA 3A8LB 2ZPFB 1QVFS 3QKJA 3OMCA 3M55A 5GAN6 3BDLA 3QYHB 3CCMA 5CQXA 2CKKA 1KG1A 1FWZA 1M90C 3L2UA 1VQNA 1Q82C 2EJGA 4M78G 5CVIA 4M7DG 3OYAA 2E10A 1M1GA 4EMKA 2BS4A 4MFDA 4M7AD 3J7AF 4OGEA 1YBYA 1VQ9T 4AI6A 2DD5A 3EAEA 4QVDA 3ER0A 5GMKh 5CKHA 3CCVT 5GAMh 1S72T 4WF2A 3QZ5B 4M7AC 1SSFA 3CC7A 3A8HB 1Y7XA 5I2MA 5LJ3h 3PMIA 3TEEA 1LJOA 4LD6A 4C5IA 3CCLT 4M75D 1LNXA 5LJ5j 3CC2A 3I55A 3QXEB 4IUPA 2DXUA 3HPWA 3GNGA 3SD4A 4DQ2A 3HHTB 4M75C 4JS4A 1KQSA 4NL3A 1K73U 2RHYA 4E7JA 1VQLA 2X4YA 3A5ZB 2DK3A 4BD3A 5GAN7 2PUKB 1Q86C 4XTXA 3OYNA 3OS1A 2CZ0B 4ATOA 3M57A 3CC4A 3FEOA 5FRMA 4PNOA 2R58A 1G3WA 4PLLA 2X4WA 2OAUA 3LGLA 1VQNT 2CS7A 2RHIA 1VQMT 4L59A 4JX6A 1QVGA 3ZFJA 1UGPB 1I5LA 2K5FA 5KE3A 2GFAA 3TW7A 5LJ3g 1K8AC 4NC6A 1OI1A 4LD9K 2LCCA 3NFCA 4PJOG 2XD0A 5L8RE 3RERA 4M75E 3RIRA 2LVMA 1B34A 2DPPB 3VV0A 3HRTA 2RO0A 3X25B 4JDSA 4LOCA 2KMGA 2VGNA 5GAN2 4JRPA 3CC2T 3I55T 5IN1A 2ZCFB 5GAN5 4RG8A 3CCEA 3PIPA 3GIBA 3RESA 4XU3A 2RI5A 1QW1A 2RK2A 2DO3A 2QEXA 4JRQA 3HSBA 1YJNT 4HLQA 4JRKA 4QVZA 4M78B 1VQLT 4M7DB 1N8RU 2GQVA 1G5VA 2D9TA 4FIBA 3UDCA 3QYBA 2JOYA 3OQ5A 1G3TA 4BDYA 4BI3A 1BIBA 4HA8A 2JZ2A 4A54A 2QFZA 5GMKe 2DIGA 3MEUA 2CGHA 1Y96A 1VIFA 3OBWA 1HK9A 4RKUE 5EG2A 3OS5A 4C0ZA 5GAMe 5LJ5d 5LJ3e 1K73C 2ZZDB 3M4GA 5KCHA 4B9WA 4M7AA 2RJDA 5C0MA 4BDZA 4F7UE 2KAFA 2XG8D 1WPYA 4J6XA 2PU9B 5IAYA 4XAXB 3HP9A 4C0GA 5IT9E 5FRNA 1NE8A 4IUUA 4J6WA 1KQ1A 1XOVA 5CKBA 5A0GA 4JLGA 4M75A 2YHTA 4PJOD 4FL6A 1RL2A 1UB4A 3LLRA 2AHJB 2H3JA 4HNVA 2YLCA 4QVCA 1YJWT 3JB9H 3JB9F 4PJOC 4ELZC 3ASKA 3OYFA 4JX4A 2JVVA 4HCZA 4XTUA 5KCOA 4Y28E 5HKCA 5A2QE 3JCMQ 4HCBA 3OMGA 2MAMA 3F70A 4O5VA 4ME7A 3T9NA 2HD0A 4A53A 2G77A 3INZA 4PJOB 2EAYA 5A0DA 2RI3A 3OA6A 1W4SA 2BIVA 3SFMA 4EMKB 3CCUA 4FU6A 4GY5A 3QZ9B 1O9SA 2LCLA 3R6OA 4J6YA 3OYJA 3CMEA 4CI0C 3OYCA 5KE2A 5D6WA 5GMKj 2GFUA 5GAMj 3L2WA 1BKBA 3VYGA 1N8RC 1P92A 3L1AA 4KULA 2JUFA 5LJ5f 5LJ3j 3NTHA 2FYKA 1KHCA 3MEWA 4OB3B 2RI2A 3L42A 5GAOm 3JB9G 1VQ6A 2A7YA 4EMGA 1FKMA 3QWLA 3LYIA 2LRQA 4M75G 4MDWA 3ZBDA 2FL7A 4NOYA 5GAN3 5GMKi 3I56T 3X26B 3CCVA 3UPUA 4OB0B 3MP6A 3JRZA 1OZ3A 2DTIA 5GAN4 3TCJA 3OYGA 4F7UF 1QVGS 2XDPA 4ELYC 2E5QA 4LDWA 3CCLA 5FROA 4OB1B 4BBSM 3CCRA 1KD1U 2RD1A 3DLLA 1Y71A 1YI2T 5CO7A 1OZ2A 3CCUT 4II1A 3G4SA 4AKGA 1M5Q1 3CMET 1B34B 4C8QE 1WQ7A 5CK9A 4IKFA 1XNIA 4HKEA 4BI8B 3M59A 2EJFA 2E41A 1VQOT 1WJSA 1VQMA 4OGCA 1Q81U 2K3YA 1KC8U 3RMQA 1VQ6T 4PJOA 4F7UG 2VXFA 1M9SA 1N9SA 1WNLA 2VXEA 3OYEA 4B9XA 3LWHA 3VKHA 1AHJB 3JB9D 2KSSA 4X9DA 4E7KA 4RCCA 3GPLA 4IUTA 5GANh 1W2BA 2DXCA 1Y96B 5CR2A 1WQWA 3CCRT 3G6ET 4KBMB 3L2ZA 2NLUA 3BW1A 2X4JA 3M58A 4FSXA 3OYBA 3CPFA 3PFSA 4OVAA 4M7AB 3CD6T 4J8OA 1VQ4A 2MI6A 4XU0A 3OSSC 4OMFB 4Q5WA 4N4GA 3G4ST 2KMTA 4BB7A 1YJNA 2DZCA 2P0KA 1JBMA 3OW2A 4C92F 2DIQA 2LC4A 4N4HA 2K4YA 3QSUA 1JB0E 3OS0A 2YRVA 4M75B 2DTHA 4M77F 1VIEA 4LDYA 1M1KC 1K9MU 1KD1C 2LQKA 3GOXA 3CPWS 1JJ2S 2Y4YA 3RKXA 3CXCS 3TREA 5GAMg 3S6WA 2HBPA 2M0OA 3QYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSC E;  1QP2 A;  2DD4 B;  2ZZD B;  2DD5 B;  2PVO B;  2PU9 B;  3A8O B;  2WSF E;  3X28 B;  2DXB B;  2O01 E;  4L6V 5;  2AHJ B;  3VYG B;  4OB2 B;  2DD4 A;  4Y28 E;  2ZZD A;  3A8M B;  4KT0 E;  2ZPG B;  2ZPI B;  2PVG B;  2CYZ B;  2D0Q B;  3VYH B;  3QZ9 B;  2DXB A;  2PUO B;  3VYG A;  3A8L B;  2ZPF B;  2WSE E;  3QYH B;  4OB3 B;  3X24 B;  3X26 B;  4OB0 B;  1IRE B;  2DD5 A;  1DJ7 B;  1PSE A;  3QZ5 B;  4OB1 B;  3A8H B;  4ZGD B;  3LW5 E;  4ZGJ B;  3QXE B;  3HHT B;  2CZ6 B;  1UGQ B;  2ZPE B;  2DXC B;  2PUK B;  2CZ0 B;  4FM4 B;  4ZGE B;  1GXI E;  2ZPH B;  3WVE B;  1PSF A;  1UGP B;  2QDY B;  1AHJ B;  5L8R E;  2ZPB B;  3A8G B;  2DPP B;  2DXC A;  3X25 B;  1QP3 A;  2PVD B;  4XK8 E;  2ZCF B;  1UGR B;  1UGS B;  2CZ1 B;  2CZ7 B;  1JB0 E;  1V29 B;  3X20 B;  3WVD B;  4RKU E;  3QYG B; 
#chains in the Genus database with same CATH topology
 3QO3 A;  2G9X B;  2K57 A;  3C94 A;  3OYY A;  4AKH A;  1I0C A;  1TXQ A;  2PVO B;  2PTK A;  1X69 A;  1H3Z A;  2E3H A;  2P84 A;  2KEA A;  4F7N B;  2XU8 A;  4E7H A;  3VUZ A;  4KGZ B;  2QQ9 A;  5GAN 8;  3TN8 B;  5FWB A;  1FXX A;  4FX3 B;  4GBQ A;  2DL8 A;  2K3X A;  4KGX B;  1SRM A;  1MND A;  4EOR B;  2EJ9 A;  2YWW A;  2A37 A;  4BCQ D;  2DXB A;  2DIL A;  2OTJ Q;  4AFS C;  4J7I A;  2DYB A;  1NJI U;  2C5V B;  1OX9 A;  5GAO r;  5AT1 B;  3I56 A;  3P8D A;  4EOP B;  3CCQ T;  4GLK A;  4BCP B;  1VUB A;  4Z6Y A;  1UDL A;  1O9K A;  2IVW A;  4ZGD B;  4M77 D;  1QCF A;  1SRL A;  3NGP A;  3OBY A;  3PGG A;  5IHK A;  4MZT A;  1WXB A;  2ZPE B;  3MEV A;  5GAN j;  4C5H A;  2M02 A;  3VRY A;  3OW2 S;  3MP1 A;  2RHZ A;  3TU4 K;  1E7O A;  4HVW A;  5D6X A;  5FLX E;  4LDX A;  3N5B B;  3S3N A;  3ZEH A;  1NM7 A;  4IUV A;  1PKD B;  2K7A A;  1MHN A;  2CJM B;  4BCJ B;  1I5O B;  1H24 B;  2RM4 A;  1D3B A;  3GF5 A;  2PZ1 A;  4HL4 A;  5D7U A;  1VQP Q;  2JJ9 A;  4M7D F;  4RMO A;  1M3B A;  1V29 B;  4JX5 A;  4ESR A;  4C5E A;  7AT1 B;  1ZSZ C;  4ZN1 A;  2R57 A;  1U5S A;  1D0Z A;  2YUN A;  4JJD A;  4XU2 A;  1OKV B;  2F69 A;  3PIO A;  1UHC A;  2MYS A;  4C92 A;  1S72 Q;  4IUQ A;  2FB7 A;  4MZM A;  3BG3 A;  2QDL A;  1WX6 A;  1IZ6 A;  2PK9 B;  3GNF B;  1K8A R;  1ZUK A;  3LX7 A;  5IDN B;  1VQ8 Q;  3SWN A;  1UTI A;  2XDD A;  1OI9 B;  1XTD A;  2O4X B;  4O6J A;  1IXD A;  1P5E B;  1WHK A;  2ZPG B;  4PFO A;  2QTV A;  2OTL T;  1RAD B;  4XTZ A;  1FYN A;  5DLO A;  2KRO A;  4E6R A;  4FT2 A;  3EFS A;  2WSE E;  3HL8 A;  4C92 G;  1F5Q B;  1G3N C;  2O9V A;  4PLI A;  5GAM f;  3CCQ A;  4C5G A;  4M7A E;  2M16 A;  2ROT A;  2LQW A;  2QDJ A;  4EOJ B;  4C0F A;  4Z88 A;  4RG2 A;  2E5K A;  5LJ3 f;  1BB9 A;  1VYT A;  2J05 A;  1VQL Q;  2QTX A;  4M7D D;  1WA7 A;  3LW5 E;  2KRM A;  3RMS A;  3QJY A;  4YC3 B;  4M78 C;  1UJ0 A;  2K2M A;  3JCM b;  2K5I A;  5CKF A;  3J81 E;  1QVF A;  2DVJ A;  2EQU A;  3NHN A;  1K9M C;  1H1P B;  3VUB A;  4YOS A;  2MOX A;  1ZA1 B;  3Q1J A;  2K9G A;  3FDR A;  2UZL B;  2LQN A;  2DL3 A;  3JCM J;  5LJ5 h;  2QQS A;  4EMH A;  2MWO A;  1WZO A;  2ZPH B;  2LJ1 A;  3VU3 C;  3CMA A;  1B7T A;  1NPR A;  4M78 E;  1N8R R;  3AHU A;  1MMN A;  1ZP2 A;  1M8M A;  1K0S A;  1I81 A;  4XK8 E;  3CCE T;  1UGS B;  2CZ1 B;  2CZ7 B;  4LUD A;  4PK4 A;  1X6O A;  4D8D A;  4EMK C;  3RDV A;  3CXC A;  2G3R A;  4M75 F;  3X20 B;  2CP2 A;  4RTU A;  4E47 A;  3FC3 A;  2EYX A;  4Y72 B;  4RTX A;  2B9R A;  2DD5 B;  4J9E A;  5J39 A;  2CP6 A;  2K2V A;  2RB6 A;  3JCM P;  3P8B B;  2YT6 A;  3PT9 A;  4CFW B;  1PD0 A;  4FSS A;  2QA4 T;  3VS0 A;  4BE2 A;  1M8V A;  2MCN A;  1F1B B;  1ZA2 B;  2CDT A;  2BS3 A;  4L6V 5;  3EJ1 B;  2KYM A;  2BE9 B;  3L2R A;  4AFU C;  2DE0 X;  2RF0 A;  3FJP A;  3EG9 B;  2COZ A;  2QYZ A;  1M1K U;  2PNI A;  1UUE A;  1G3Y A;  1I8F A;  1GCP A;  1X43 A;  3JB9 I;  2GQI A;  4MIM A;  1ZSZ B;  4EDU A;  3NMZ C;  4F6W B;  1VQ9 Q;  3EG0 A;  2DJZ A;  1M1K R;  3E1S A;  1BCM A;  2RQV A;  3A8L B;  2ZPF B;  4RTZ A;  1M90 C;  1Q82 C;  2F2W A;  2BS4 A;  1YBY A;  1SSF A;  1Q81 R;  4LD6 A;  4ANJ A;  4M75 D;  3CC2 A;  1PRL C;  1U06 A;  3QXE B;  1K9A A;  3HPW A;  1M2O A;  2W96 A;  2RMO A;  3HHT B;  2EQI A;  2RHY A;  2C6T B;  3A5Z B;  4BD3 A;  1AT1 B;  1Q86 C;  4XTX A;  3VS1 A;  3OS1 A;  3SEM A;  3M57 A;  2L3S A;  4BCO B;  4PNO A;  4M4Z A;  1VQM T;  4L59 A;  4JX6 A;  1QVG A;  2C0O A;  1BU1 A;  2UUE B;  2GFA A;  5LJ3 g;  1OIU B;  4LD9 K;  2XD0 A;  1E6G A;  4PJO G;  3RIR A;  3QWX X;  2LMJ A;  3PE0 A;  2LVM A;  2CRE A;  2X51 A;  3X25 B;  2P4R A;  2W99 A;  2VGN A;  4JRP A;  1XJW B;  2DJQ A;  4DBF A;  3EGU A;  3CCE A;  3RNJ A;  3NPF A;  3GIB A;  2RI5 A;  2RK2 A;  4JRQ A;  3HSB A;  1YJN T;  4QVZ A;  4M78 B;  1G5V A;  4BDY A;  1BIB A;  1VQK Q;  5GAM e;  4EOL B;  1VYW B;  5LJ3 e;  1IO6 A;  5KCH A;  1IHW A;  4B9W A;  1YJW Q;  2UZD B;  5C0M A;  4BDZ A;  2A36 A;  2LW4 A;  2JW4 A;  2DM1 A;  4XAX B;  2D8J A;  3HP9 A;  2NUZ A;  4C0G A;  1ZUU A;  5CKB A;  1AWW A;  5A0G A;  4PJO D;  2RPN A;  4FL6 A;  1RL2 A;  1SSH A;  3PO3 S;  2H3J A;  4HNV A;  1PM3 A;  1GRI A;  2RQU A;  4HCZ A;  2JVV A;  2J6K A;  5KCO A;  5A2Q E;  2CH4 A;  1UNG D;  4ME7 A;  2HD0 A;  2ED1 A;  1H92 A;  1W4S A;  2HKQ B;  4EMK B;  3CCU A;  1OQK A;  4J6Y A;  2W2H A;  5GMK j;  1K76 A;  1QVF P;  4QKU A;  3L2W A;  3VYG A;  4KUL A;  5LJ5 f;  2AKL A;  2FYK A;  3REB B;  1KHC A;  2RI2 A;  1VQ6 A;  1GL5 A;  2I0N A;  2LRQ A;  2FL7 A;  2ZAE A;  5GMK i;  1V76 A;  3JRZ A;  1OZ3 A;  2HQH A;  3DDQ B;  5KYN A;  1CSK A;  1X6B A;  1FMW A;  1OL2 B;  4BCK B;  3G4S A;  3CME T;  1JO8 A;  4HKE A;  3I9Q A;  1VQO T;  2CP5 A;  1MMA A;  3CXC P;  1VQM A;  1UE9 A;  1JKW A;  1KC8 U;  3TNW B;  1TSF A;  1WNL A;  2VXE A;  1UJY A;  1M2V A;  4IUT A;  1KC8 R;  2PJQ A;  1Y96 B;  5CR2 A;  3H9N A;  1VQ5 Q;  1SKU B;  4FSX A;  3BW1 A;  1QWE A;  3PFS A;  3CD6 T;  2R7G A;  1VQ4 A;  2FZK B;  3E2U A;  1E6H A;  1AD6 A;  1YJN A;  3CCS Q;  3OW2 A;  2HL5 C;  1W98 B;  3THK A;  1JB0 E;  2G6F X;  1VIE A;  3NDQ A;  1IGQ A;  1KD1 C;  1TOV A;  2DNU A;  1AD5 A;  3CXC S;  1I07 A;  2HBP A;  2M0O A;  3QYG B;  4BY7 X;  3BE3 A;  5CKE A;  2E65 A;  2EQJ A;  5GAN g;  4QW2 A;  2NUT A;  2WPA B;  1UEC A;  2V26 A;  1NG2 A;  3EGX A;  3MY1 B;  2YXY A;  1AVZ C;  4BXX X;  2OX7 A;  1C6V X;  2EFI A;  2GNC A;  1NBE B;  1OX8 A;  5KYW A;  2GTO A;  4QT7 A;  3TSZ A;  3BFM A;  4D6W A;  3ULR B;  4KH1 B;  2JXB A;  3PVL A;  2DD4 A;  4IUR A;  3J80 E;  1CKB A;  5ACB A;  1LOJ A;  3H8Z A;  1JOW A;  1G3S A;  3VS6 A;  3KXT A;  3KBG A;  4DEY A;  2FRW A;  3NTK A;  1PD1 A;  2QQ8 A;  1WLP B;  5GAN e;  1WFW A;  2YRD A;  2DKG A;  2EQK A;  1GUX A;  2F1L A;  5HK3 A;  4YOZ A;  2EYZ A;  4AKI A;  1N9R A;  1BYM A;  2F2C A;  3LWI A;  1R0B G;  1TUD A;  5FU6 C;  3VS7 A;  2PMI B;  2C4G B;  2OTJ T;  1RAI B;  3JCM h;  3JCM V;  1X6G A;  2LTO A;  4XQ3 A;  3BDU A;  2RHX A;  1M4Z A;  3QBY A;  3EOC B;  1GFC A;  3JCM c;  5GAO q;  1YHQ Q;  3EG3 A;  1WGS A;  2XIC A;  2MF2 A;  1W2B S;  2RNA A;  6AT1 B;  3QJ6 A;  1Q7Y U;  4PKC C;  1K1Z A;  5GMK l;  4ZNX A;  1VQO A;  4QSH A;  4F7U A;  4ZGE B;  1WJQ A;  4YTL A;  4MFE A;  4C8Q C;  3SDZ A;  4E2F B;  2L5Q A;  1Q7Y R;  4PJM A;  4A4F A;  2EGE A;  3KFV A;  2CT4 A;  2WMA B;  4V2S A;  2GGR A;  2VC8 A;  3SWN B;  3DTO A;  2QGF B;  2JM8 A;  3NTI A;  1NJI C;  4A4G A;  5KYX A;  5ECA A;  2NWM A;  4HT9 A;  3S3M A;  3CD6 A;  5FU7 C;  2R5M A;  2HNI A;  2FG0 A;  2CT3 A;  1M3A A;  2IIM A;  4CFV B;  4LDU A;  2FPE A;  4XTW A;  4M78 F;  2HAX A;  3G7Z A;  2XI9 A;  2RK1 A;  4UC4 A;  2VVK A;  2P0Q A;  4Y92 A;  3HBL A;  4ELJ A;  1X2K A;  4MDX A;  1VQ7 Q;  2ENM A;  3QDR B;  2ZGW A;  2M1H A;  3EFO A;  3X28 B;  4M77 A;  1OU8 A;  4ZTJ A;  5GAN d;  2PQW A;  2O01 E;  4PFZ A;  4CC7 A;  1TG0 A;  2EYY A;  1MGQ A;  4A4E A;  4RTV A;  2L2P A;  2QQA A;  1H26 B;  4C0D B;  3VKI A;  5KYU A;  2PVG B;  3O0G D;  2D0Q B;  3VYH B;  3UF4 A;  2M0Y A;  1VQN Q;  5C6S A;  1VQ8 T;  2AT1 B;  3E9F A;  3LH0 A;  4OMQ A;  1LVK A;  5DM7 R;  3CC7 Q;  3HZJ A;  3CCM T;  4M77 G;  2OTJ A;  1K73 R;  5I21 A;  3I55 Q;  4N0A A;  1IRE B;  2X35 A;  5M9O A;  3M0S A;  4Z02 A;  4M78 D;  3CEY A;  1OV3 A;  4NL2 A;  4M6V A;  5GAN 5;  5HQ0 B;  5CQY A;  2A28 A;  4ZTF A;  3URG A;  3EGD A;  2B86 A;  1KQ2 A;  3MP8 A;  2RJE A;  3BG9 A;  4PJL A;  2DTO A;  2I2L A;  2R5A A;  2X1N B;  2KY9 A;  1RUW A;  1E7P A;  3OW2 P;  4Y91 A;  4J9I A;  5L2W B;  2D0N A;  2DL4 A;  4KUI A;  3CC4 T;  4K11 A;  4ROC A;  2OI3 A;  2L8D A;  1GH6 B;  1M3C A;  2HSP A;  5KYY A;  1UGV A;  5EJC A;  4JS5 A;  1OKW B;  2WFY B;  2ZPB B;  3HTR A;  2JS0 A;  5FU6 B;  1NPP A;  1W1F A;  1WDX A;  2RQT A;  2NYS A;  1HXD A;  3ME9 A;  3OS2 A;  2KXD A;  3M4Y A;  1WHM A;  2QEX T;  4EOS B;  2BZX A;  3DLM A;  3PMT A;  3CPW A;  1U1S A;  4DBQ A;  1OPL A;  1B07 A;  3KUF A;  4BCN B;  2WSC E;  1WIE A;  1VQP A;  3CMA T;  5GAO l;  3UT1 A;  3QUI A;  3BHV B;  4C8Q B;  2NUP A;  1QCO A;  2UZB B;  3A8O B;  3QII A;  1O75 A;  4RCB A;  3BHU B;  4CC3 A;  1M1F A;  2V8I A;  4M7D A;  2KE9 A;  4CRI A;  2WAC A;  3JCM f;  3P8H A;  3DKM A;  2P0P A;  4LN2 A;  2DLP A;  1S72 A;  5FU7 B;  5GJV B;  1OUL A;  2OJ2 A;  4QQG A;  1C9B A;  1CKA A;  4R55 A;  1MNE A;  1X2Q A;  3JAM E;  3H6Z A;  3RUX A;  3V8J A;  2RJC A;  4VUB A;  5D6Y A;  1VQ8 A;  2KNB B;  2AK5 A;  4FYW B;  3MO8 A;  2QQR A;  2XID A;  1K8A U;  2RJF A;  1U8R A;  1RAE B;  1J3T A;  1D3U B;  2HL3 A;  4G6L B;  5GAN 6;  1RAA B;  3BDL A;  3QYH B;  2Z0W A;  3CCM A;  2CKK A;  1FWZ A;  3L2U A;  5CVI A;  3CCR Q;  4M7D G;  3JV3 A;  4FYY B;  2EBP A;  3M0U A;  1GBR A;  2V1R A;  4IIO A;  4KRD B;  4OGE A;  1VQ9 T;  4AI6 A;  3EAE A;  4HCC A;  4QVD A;  1ZX6 A;  4WF2 A;  3REA B;  4M7A C;  1M27 C;  3TVT A;  2KYB A;  5LJ5 j;  1RI9 A;  2DXU A;  5HBE B;  4HCK A;  4JS4 A;  1VQL A;  2X4Y A;  2DK3 A;  3QHR B;  2PUK B;  3OYN A;  1D0X A;  4ATO A;  2CZ0 B;  1JSU B;  3DDP B;  3CC4 A;  3FEO A;  2UZE B;  4PLL A;  2EKH A;  4LUE A;  1VA7 A;  2CS7 A;  3M0Q A;  2KR3 A;  1NLO C;  3TW7 A;  4NC6 A;  1WYX A;  3M0T A;  1B34 A;  2H8H A;  2F2X A;  2VAS A;  3CC2 T;  1QLY A;  5IHY A;  3AT1 B;  3LH5 A;  4XU3 A;  2QEX A;  2DO3 A;  4HLQ A;  4JRK A;  1AEY A;  3O5Z A;  1N8R U;  2JT4 A;  4FIB A;  3UDC A;  4BI3 A;  5DQV A;  2JZ2 A;  4A54 A;  5GMK e;  1H3H A;  3GP8 A;  1VIF A;  4RKU E;  1HK9 A;  5EG2 A;  2ZZD B;  2KBT A;  3M4G A;  4R0K A;  4EON B;  4F7U E;  3CCQ Q;  1D1B A;  4J6X A;  2PU9 B;  2VWF A;  4JJC A;  5FRN A;  5IT9 E;  1KQ1 A;  3EH2 A;  4JLG A;  4M75 A;  4PJN A;  1KIK A;  2LNH B;  2AHJ B;  4CRL B;  1YJW T;  1NLP C;  3JB9 F;  4JX4 A;  4DBH A;  3OMG A;  2HEQ A;  4O5V A;  2G77 A;  3INZ A;  2D8H A;  2BIV A;  3SFM A;  4GY5 A;  1O9S A;  5KE2 A;  1P92 A;  1Q95 G;  2JUF A;  3NTH A;  3L42 A;  4FYX B;  4F7J B;  3JB9 G;  1V1C A;  1IRX A;  3RGF B;  4EMG A;  2XMF A;  3LYI A;  3QWL A;  3QSU A;  4M75 G;  1VQ9 A;  1VOM A;  3MP6 A;  4RTY A;  4NST B;  1UHF A;  2MIO A;  4LDW A;  3VS3 A;  4CXA B;  4BBS M;  2RD1 A;  3DLL A;  1OEB A;  1YI2 T;  2ESW A;  2YUP A;  5CO7 A;  1OZ2 A;  3CCU T;  4II1 A;  2K79 A;  4AKG A;  1M5Q 1;  2HZY A;  4IKF A;  1XNI A;  4BI8 B;  2GBQ A;  1TD6 A;  2EJF A;  4RTW A;  2DL5 A;  2E41 A;  3CPW P;  1WJS A;  2HDA A;  4OGC A;  3G6E Q;  1Q81 U;  2K3Y A;  1ARK A;  1NEB A;  1VQ6 T;  2J06 A;  4PJO A;  1N9S A;  2QGG A;  4OGR B;  3VKH A;  3JB9 D;  4X9D A;  1RLQ C;  2DBK A;  5IHI A;  1W2B A;  1WQW A;  3I5S A;  4KBM B;  2NLU A;  3M58 A;  1GCQ A;  2H3E B;  4OVA A;  2SEM A;  4M7A B;  4Q5W A;  3G4S T;  2OTL Q;  2DIQ A;  4N4H A;  1ZBJ A;  2DTH A;  1K9M U;  2O31 A;  3MY5 B;  3CPW S;  3RKX A;  5GAM g;  4OMO A;  2P4T A;  4P5N A;  5LQF B;  3F5X B;  1RAB B;  2AZS A;  2SRC A;  2VGM A;  1K9M R;  1RLP C;  4C8Q F;  4DOV A;  2DF6 A;  1VQK A;  1RI0 A;  4EOI B;  2WSF E;  4A4K A;  1TFB A;  5I11 A;  2E6Z A;  1KC8 C;  2ATC B;  2KK4 A;  4PJJ A;  1YJW A;  1VQ4 T;  2DET A;  4HT8 A;  2DEQ A;  2QXF A;  2QK0 A;  3POM A;  1YCY A;  3GBQ A;  4KGV B;  2MPX C;  1YIJ Q;  1X75 C;  1I1J A;  2ED0 A;  4L5G A;  5CYI B;  2LZ6 B;  2DL7 A;  4BUG A;  2HQX A;  3BLH B;  2CP0 A;  3H0I A;  2C5N B;  3C95 A;  4C8Q G;  4LNP A;  5IF1 B;  2QQB A;  3OB9 A;  2IPO B;  2DRK A;  4J83 A;  1ZHI A;  2F5K A;  2O4X A;  1N5Z A;  4F04 B;  1BI3 A;  2RA2 A;  4AT1 B;  3KHI A;  1TH7 A;  2BKD N;  4JLI A;  3TW6 A;  2V22 B;  3EID B;  5BNJ B;  2AZV A;  2W0Z A;  4AFQ C;  1DJ7 B;  3MEA A;  2FEI A;  2KVQ G;  1YI2 A;  4JRI A;  4C92 C;  3VKG A;  3CBP A;  4J7F A;  1SEM A;  3C4S A;  5HCK A;  4BCN D;  1ZQ1 A;  2DXC B;  2XK0 A;  1YIT T;  4C8Q D;  2BE7 D;  4I3Z B;  3SWN C;  2EQM A;  2XKO C;  2BTT A;  1GXI E;  1KHI A;  2E6N A;  2QA4 Q;  4C92 E;  3MI9 B;  2J6F A;  2QDY B;  3G33 B;  4BCH B;  2J6O A;  4OF1 A;  1BK2 A;  2E64 A;  5GAO n;  5KYU B;  2X3W D;  1M90 R;  1YJ9 Q;  2DYI A;  3IQL A;  1Q82 R;  3CCJ Q;  1W70 A;  3M0R A;  1GY3 B;  1WHJ A;  1ABO A;  3FRN A;  4DOW A;  3V7S A;  1Z9Q A;  2FO0 A;  1FX7 A;  1VQ5 A;  4HNU A;  2EPD A;  2K5L A;  1QLB A;  3CBM A;  2LJ0 A;  1H1R B;  4F70 B;  3A1P A;  1U1T A;  3FB9 A;  2FVU A;  3CCS A;  1TWB A;  1WJR A;  1QP2 A;  4JZ4 A;  4EOM B;  2IN3 A;  1Q7Y C;  2QI2 A;  1T0H A;  1Q86 R;  5HBJ B;  1GBQ A;  1SPK A;  5GAM d;  3OYL A;  5AYF A;  4CFU B;  5HY6 A;  3HKS A;  5LJ3 d;  1SG5 A;  2VUB A;  3PTA A;  2DXB B;  1U3O A;  5IHN A;  4OMM A;  4X34 A;  4C0D C;  2CSI A;  4IMY B;  2YSQ A;  2E4H A;  2BKZ B;  4OB2 B;  1FVV B;  3DL1 A;  1H64 1;  3G71 Q;  2VYT A;  1VQ7 T;  2EGA A;  3H0F A;  4J9H A;  3QYE A;  1A0N B;  2IG0 A;  1RAG B;  4OP0 A;  3SHW A;  3FLG A;  1O9K B;  2JN0 A;  1H1S B;  2KDS A;  2LT1 A;  4A4H A;  3DB4 A;  3E9G A;  3C12 A;  2IW9 B;  2HBW A;  2DMO A;  5DY9 A;  1PNJ A;  3EG9 A;  4KRC B;  4QQ6 A;  2A08 A;  2COY A;  1PSE A;  3UA6 A;  3UA7 A;  1ZSZ A;  2KQW A;  3M03 A;  3JCM W;  3HO8 A;  1YJN Q;  3V7C A;  3CC7 T;  1W2B P;  4ZGJ B;  3V8L A;  1UEB A;  3TSW A;  1KJW A;  4XU1 A;  2IW6 B;  2NUP B;  4HNT A;  3EHR A;  3HRU A;  1YIT A;  1UGQ B;  2LQ8 A;  1YHQ A;  5J3B A;  3EG2 A;  4TVR A;  4KH0 B;  1AWO A;  1D3B B;  2EYQ A;  2FPF A;  1QCN A;  5FW9 A;  2WHB B;  2XDB A;  2BUD A;  2CCI B;  2W10 A;  2Y90 A;  1OOT A;  1VOL A;  3L2Q A;  2CSQ A;  4MML A;  2QAS A;  2C0T A;  2JS2 A;  2LDM A;  4F17 A;  2M51 A;  1UGR B;  3HFO A;  4M7A F;  1BI1 A;  4C92 B;  1PCX A;  9ATC B;  2A3L A;  5DLQ E;  2QF7 A;  1VYU A;  2LT4 A;  5LJ5 g;  1JJ2 A;  3OYD A;  4AMC A;  1VIN A;  2D6F A;  4JPB W;  2WJ9 A;  5I2S A;  2EW3 A;  1YP5 A;  4PFP A;  3M53 A;  1BI0 A;  1FMV A;  3K7A M;  2DZ9 A;  5HBH B;  4N4I A;  1PC0 A;  2LX9 A;  4KRT A;  4M78 A;  4M7A G;  4PJO E;  2KR6 A;  3RR6 A;  4J9F A;  4R56 A;  2X9H A;  4CFX B;  1VYV A;  1VQ7 A;  2F5T X;  5LJ5 e;  4JUV A;  3CME Q;  5LMK B;  2WXV B;  1ACM B;  2LNV A;  2EKO A;  3QHW B;  1N27 A;  2JTF A;  3HRS A;  2CYZ B;  4E7I A;  3GLX A;  1R77 A;  2OAW A;  1VQP T;  1EZZ B;  4CFN B;  2BS2 A;  3CCV Q;  2X3X D;  4JJN K;  2WMB B;  3QKJ A;  3CCL Q;  4Z8A A;  2FZC B;  5CQX A;  1KG1 A;  4Z89 A;  1H25 B;  2A0F B;  1VQN A;  1RAC B;  2E3I A;  2EJG A;  2JGZ B;  4M78 G;  3OYA A;  2L0A A;  1M1G A;  4EMK A;  1BBZ A;  5EC7 A;  4MFD A;  4M7A D;  3J7A F;  2EYW A;  1S72 T;  3ER0 A;  5GAM h;  4E7Z A;  3QZ5 B;  3CC7 A;  3A8H B;  5LJ3 h;  3TEE A;  1LJO A;  1IGU A;  1PKS A;  3I55 A;  1WHH A;  2HCK A;  3GNG A;  3D7S B;  3QWY A;  1KQS A;  4NL3 A;  1K73 U;  2DFU A;  1Z9Z A;  4RUG A;  3MIA B;  3I5R A;  3TNI B;  2R58 A;  2X4W A;  3LGL A;  2RHI A;  1RAH B;  3ZFJ A;  1KSW A;  1I5L A;  2DER A;  2K5F A;  5KE3 A;  1MMG A;  3TQ7 P;  1K8A C;  2W9F A;  1OI1 A;  2LCC A;  4J9C A;  5L8R E;  3EHQ A;  2DPP B;  1UG1 A;  4UN0 A;  3HRT A;  4JDS A;  2C5X B;  1MUZ A;  2JTE A;  5IN1 A;  4RG8 A;  3PIP A;  1QW1 A;  2RQW A;  5IXB A;  1VQL T;  2COW A;  2J7I A;  3QYB A;  2JOY A;  1H8K A;  4WTO B;  4HA8 A;  2QFZ A;  2DIG A;  1Y96 A;  3OBW A;  1SHG A;  5LJ5 d;  4BCM B;  1X27 A;  1WPY A;  5IAY A;  4IUU A;  4J6W A;  4IIM A;  1ZUY A;  1UB4 A;  1T3L A;  1YCS B;  1FIN B;  4QVC A;  2YRC A;  3JB9 H;  4ELZ C;  3ASK A;  3OYF A;  5HKC A;  1NJI R;  4Y28 E;  5HVY B;  3JCM Q;  1UNH D;  2MAM A;  4EC8 B;  5DQW A;  3T9N A;  2V1Q A;  4CC2 A;  4PJO B;  1HD3 A;  3OA6 A;  1H4L D;  1JST B;  4FU6 A;  3I56 Q;  1QMZ B;  3R6O A;  4CI0 C;  3OYC A;  1YFN A;  2GFU A;  1N8R C;  3L1A A;  1AIS B;  3I35 A;  2CCH B;  1G8X A;  3MEW A;  4ROD A;  2A7Y A;  4HVV A;  1FKM A;  1S1N A;  1AZE A;  3UPU A;  1IHV A;  5GAN 4;  2DTI A;  4ELY C;  1AWX A;  2E5Q A;  4EIK A;  5FRO A;  1B3Q A;  3CCR A;  2KRN A;  2CUD A;  3VS2 A;  2QG9 B;  1PWT A;  5CK9 A;  1WQ7 A;  3M59 A;  1JJ2 P;  2FZG B;  4CFU D;  3RMQ A;  2K3B A;  2VXF A;  2QGS A;  3OYE A;  3LWH A;  1YNZ A;  1QKW A;  2KSS A;  4RCC A;  2BZ8 A;  3GPL A;  2WIH B;  5GAN h;  2KT8 A;  3G6E T;  4J8O A;  2MI6 A;  3OSS C;  4N4G A;  1BU2 A;  1TUC A;  4C92 F;  4BY1 X;  3DJB A;  1LCK A;  2LC4 A;  2K4Y A;  2YUQ A;  3OS0 A;  1M1K C;  1JJ2 S;  4TTH A;  3TRE A;  5HNB B;  3S6W A;  2Y4X A;  1BIA A;  4J9B A;  3CCM Q;  3M54 A;  3H0H A;  3HFN A;  8AT1 B;  3EG1 A;  1FMK A;  3OYH A;  4F14 A;  1RAF B;  1Q81 C;  1ZLM A;  1NYF A;  1YN8 A;  2YDL A;  1I4K 1;  3VYG B;  4MZP A;  2DVE A;  1D1A A;  2XHC A;  4PL6 A;  4BBR M;  5CEI B;  4KT0 E;  1TS9 A;  2ZPI B;  5CAI A;  1HSQ A;  2X4X A;  2EWN A;  4EPC A;  3CC4 Q;  1MV0 B;  1T0J A;  3LQ5 B;  2DA9 A;  1KQS P;  1KXU A;  1JQQ A;  1T3S A;  1BCO A;  3CBO A;  5HK0 A;  3BLR B;  1YIJ T;  3OSV A;  4E7L A;  1VQK T;  2CH4 W;  3QHS A;  4XTY A;  3X24 B;  3S3O A;  4OMN A;  3GTM S;  4EOQ B;  4BY6 C;  4C92 D;  2QEX Q;  2EIF A;  3DB3 A;  3M56 A;  4FT4 A;  2DBM A;  4ZN3 A;  2YLB A;  4M77 C;  1PHT A;  3OYK A;  1TTH B;  1EIF A;  1JRI A;  1QMC A;  1M2V B;  3CMA Q;  3OY9 A;  2GTJ A;  5CKD A;  1KQS S;  1IB8 A;  1YWP A;  3H4C A;  5J26 A;  4AG2 C;  2DEU A;  1TUG B;  1BI2 A;  4FW1 A;  5I5Z B;  3JCM g;  1PSF A;  3BLQ B;  2L3Q A;  4M77 E;  1AZG B;  5A0L A;  4KUD K;  2DRM A;  3G6E A;  1QP3 A;  1PKT A;  2NUT B;  1WXT A;  2JMC A;  4EOO B;  2RHU A;  2O9S A;  3EGX B;  5CIU A;  1WXU A;  3VS4 A;  3PVQ A;  4LDV A;  4N0A C;  2JTM A;  3C0C A;  1D1C A;  4J5Y A;  5KYW B;  1M30 A;  1YJ9 T;  4MMK A;  3CCJ T;  3JCM e;  1ABQ A;  2I53 A;  1LPL A;  2C06 A;  2OTL A;  2DD4 B;  2E70 A;  2CP3 A;  1JEG A;  4F7S B;  3BY7 A;  2RQR A;  2ECZ A;  3HB9 A;  4ROE A;  1EFN A;  4XTV A;  3PNW C;  1D09 B;  1GUX B;  2AIR B;  2QAZ A;  1OPK A;  5FWC A;  1NYG A;  2E12 A;  1KFZ A;  1N6A A;  1VQ5 T;  4J9G A;  4C8Q A;  3B57 A;  5IH2 A;  2V8J A;  3M0P A;  4PJO F;  3CCS T;  2RN8 A;  4A63 B;  1Y07 A;  4BE0 A;  2DX1 A;  3VS5 A;  2PUO B;  3G71 T;  2FHD A;  1YIJ A;  3MHX A;  5FGK B;  1TU0 B;  4NS5 A;  2W9Z A;  3E19 A;  3DOG B;  4BCF B;  1H28 B;  1AWJ A;  1ZSG A;  2VB6 A;  1SF9 A;  1YWO A;  3CC2 Q;  3ZL7 C;  1R8O B;  2DAQ A;  2VV5 A;  5GAN f;  4F7U B;  2LJ3 A;  2C5O B;  2HQE A;  3R6N A;  1OIY B;  3O8V A;  4BAC A;  3FIF A;  2CUB A;  1G2B A;  1OYX A;  2L89 A;  3RKY A;  2MMP A;  4M7D C;  2B8A A;  1K0X A;  2KXC A;  2CZ6 B;  4X9C A;  3L2V A;  5KYX B;  2BPM B;  4BCG B;  2KRS A;  4FM4 B;  4BCM D;  1MMD A;  3G1J A;  2ROL A;  4AFZ C;  4BCQ B;  3JB9 J;  1H1Q B;  3QDF A;  3WVE B;  5IXF A;  1GFD A;  1UNL D;  3UWN A;  3WXM B;  2JM9 A;  3CCE Q;  4M7D E;  4DA4 A;  3SB2 A;  3QPH A;  2LCS A;  2MK5 A;  4QQD A;  1JXM A;  3A8G B;  3JCM d;  1UFF A;  1WHG A;  2EUF A;  2E1H A;  2PVD B;  5LL6 S;  4JJB A;  3BHT B;  2QA4 A;  5CCA A;  4BY6 B;  2GCX A;  1QKX A;  1X01 A;  1R0C B;  3EH1 A;  3M9Q A;  2HKN A;  2JNG A;  3EFO B;  2L3R A;  4M77 B;  4D8K A;  5L23 A;  4YOO A;  1YJ9 A;  1YHQ T;  3CCJ A;  3V8K A;  3BG5 A;  4ORZ A;  3VJP A;  1Y0M A;  3V7R A;  1MV3 A;  1WI7 A;  3WVD B;  1ZBX A;  2DXT A;  3UAT A;  4BI4 A;  1M90 U;  1Q82 U;  4BE1 A;  5GMK m;  1NEG A;  1NZ9 A;  1OGU B;  2V8K A;  3JCM X;  2DME A;  3M5A A;  1ENW A;  2RH2 A;  5KH6 A;  2HMA A;  3MET A;  2C0I A;  5GAO p;  4FW2 A;  1QVP A;  3OYM A;  1YI2 Q;  3OYI A;  2MWP A;  3CCU Q;  3LGF A;  1C1A A;  3RKW A;  4F6S B;  5GJW B;  2ZZD A;  2WIP B;  1Q86 U;  1OL1 B;  3A8M B;  4DBR A;  1K4U S;  2WEV B;  3EFR A;  1URC B;  3QG1 A;  4WCI A;  2M9U A;  8ATC B;  3JSC A;  2GF7 A;  3G71 A;  1VQ6 Q;  1JU5 C;  1XQH A;  3MCA B;  4F6U B;  1QVF S;  3OMC A;  3CQT A;  2IW8 B;  3M55 A;  4OMP A;  4RTT A;  3EGD B;  4FYV B;  1XO2 A;  2E10 A;  1WHL A;  4HVU A;  2DD5 A;  3CCV T;  5GMK h;  3G4S Q;  5CKH A;  1Y7X A;  5I2M A;  2I40 B;  2HSE B;  3PMI A;  3CCL T;  4C5I A;  1LNX A;  5KYY B;  4IUP A;  1VQM Q;  3SD4 A;  1D0Y A;  4DQ2 A;  1Y57 A;  4M75 C;  2F2V A;  5EFQ B;  2CP7 A;  3RBB B;  4E7J A;  4F16 A;  5GAN 7;  2FPD A;  1H27 B;  5FRM A;  1OU9 A;  2L3P A;  1G3W A;  2OAU A;  1VQN T;  2KT1 A;  1UGP B;  1HYO A;  4X1V A;  1N4M A;  1VQ4 Q;  3VRZ A;  3RER A;  3NFC A;  4M75 E;  4CFM B;  3VV0 A;  2RO0 A;  4LOC A;  2KMG A;  5GAN 2;  3I55 T;  2ZCF B;  3A98 A;  4OR5 B;  2EGC A;  3RES A;  5I22 A;  4M7D B;  4JZ3 A;  5IDP B;  2GQV A;  2D9T A;  2LP5 A;  2KI7 A;  4LXC A;  1JXO A;  1G3T A;  1QWF A;  3OQ5 A;  2ABL A;  3MEU A;  2CGH A;  4C0Z A;  3OS5 A;  1K73 C;  2AKK A;  4M7A A;  2RJD A;  2KAF A;  2XG8 D;  2EVR A;  4F7L B;  4HXJ A;  1NE8 A;  4EC9 B;  1XOV A;  4FCY A;  2YHT A;  4EOK B;  1C0M A;  5ICP B;  1W6X A;  3LLR A;  4CC4 B;  3MJX A;  2YLC A;  4II5 B;  1AOJ A;  4PJO C;  1QVG P;  4B6M A;  4XTU A;  4E7S A;  4HCB A;  1HJD A;  1PG5 B;  3F70 A;  1YIT Q;  2BZY A;  4LE9 A;  4A53 A;  4GLM A;  3U23 A;  2EAY A;  5A0D A;  2RI3 A;  4ELL A;  3QZ9 B;  2LCL A;  3OYJ A;  3CME A;  1GCQ C;  1SHF A;  5D6W A;  3TNH B;  5GAM j;  1BKB A;  5LJ3 j;  3MKD A;  4OB3 B;  5GAO m;  1QQJ A;  4BCI B;  2O2O A;  4MDW A;  2FRY A;  2LX7 A;  3ZBD A;  5GAN 3;  4NOY A;  3I56 T;  3CCV A;  1E9H B;  3X26 B;  4OB0 B;  1KK7 A;  1QVG S;  2PHG A;  3TCJ A;  4F7U F;  3OYG A;  2XDP A;  3CCL A;  4OB1 B;  2O88 A;  1VQO Q;  1KD1 U;  1Y71 A;  4AG1 C;  1B34 B;  1PRM C;  4C8Q E;  1KD1 R;  2IVX A;  2PK2 A;  3CD6 Q;  4F7U G;  1M9S A;  1G83 A;  3MPU B;  4B9X A;  1AHJ B;  4E7K A;  2DXC A;  3FJ5 A;  3H41 A;  2JMA A;  3CCR T;  3L2Z A;  4OML A;  1EX4 A;  2X4J A;  3OYB A;  3CPF A;  2YUO A;  2KGT A;  4XU0 A;  4OMF B;  2KMT A;  2VKN A;  4BB7 A;  2DZC A;  2P0K A;  1JBM A;  2YRV A;  4M75 B;  4M77 F;  4LDY A;  2LQK A;  4DEX A;  3GOX A;  2Y4Y A;  4J9D A;  2D1X A;  2K6D A; 
#chains in the Genus database with same CATH homology
 4P5N A;  3QO3 A;  2Y4X A;  1BIA A;  2K57 A;  3C94 A;  3OYY A;  4AKH A;  2E65 A;  2EQJ A;  3M54 A;  4QW2 A;  2VGM A;  5CKE A;  5GAN g;  2PVO B;  3HFN A;  4C8Q F;  4DOV A;  1H3Z A;  1VQK A;  1RI0 A;  3OYH A;  2WSF E;  2EFI A;  1Q81 C;  4A4K A;  1KC8 C;  2E6Z A;  2XU8 A;  2KK4 A;  4E7H A;  3VUZ A;  3BFM A;  1YJW A;  1I4K 1;  1VQ4 T;  4HT8 A;  4D6W A;  2QQ9 A;  2DEQ A;  3VYG B;  4MZP A;  2DVE A;  5GAN 8;  2QXF A;  2XHC A;  4PL6 A;  2DD4 A;  1YCY A;  1FXX A;  4IUR A;  3J80 E;  4BBR M;  1LOJ A;  3H8Z A;  2K3X A;  1G3S A;  1X75 C;  4KT0 E;  4L5G A;  3KXT A;  2ZPI B;  3KBG A;  5CAI A;  2EJ9 A;  2HQX A;  2X4X A;  4BUG A;  2EWN A;  4EPC A;  3NTK A;  2QQ8 A;  3C95 A;  4C8Q G;  5GAN e;  2DXB A;  2QQB A;  3OB9 A;  2DKG A;  2EQK A;  3CBO A;  5HK0 A;  1YIJ T;  3OSV A;  4E7L A;  4J7I A;  1NJI U;  5HK3 A;  1VQK T;  3QHS A;  4XTY A;  4J83 A;  5GAO r;  1ZHI A;  2F5K A;  2O4X A;  3X24 B;  1BI3 A;  4AKI A;  2RA2 A;  3I56 A;  1N9R A;  3P8D A;  3KHI A;  1BYM A;  1TH7 A;  2BKD N;  3LWI A;  4JLI A;  3TW6 A;  5FU6 C;  3S3O A;  3CCQ T;  4GLK A;  2OTJ T;  1VUB A;  3JCM h;  3CCE T;  4Z6Y A;  1DJ7 B;  3MEA A;  3JCM V;  4BY6 C;  4C92 D;  2KVQ G;  2LTO A;  4XQ3 A;  3BDU A;  2IVW A;  2RHX A;  1M4Z A;  4ZGD B;  2EIF A;  3QBY A;  3DB3 A;  1YI2 A;  4M77 D;  4JRI A;  4C92 C;  5GAO q;  3VKG A;  3CBP A;  3M56 A;  4FT4 A;  3OBY A;  4J7F A;  3JCM c;  4HCC A;  3PGG A;  1WGS A;  4MZT A;  2XIC A;  2MF2 A;  2YLB A;  4M77 C;  4ZN3 A;  1W2B S;  3C4S A;  3OYK A;  1ZQ1 A;  1EIF A;  3QJ6 A;  1JRI A;  1Q7Y U;  4PKC C;  2ZPE B;  2DXC B;  2XK0 A;  5GMK l;  3OY9 A;  5CKD A;  1KQS S;  1VQO A;  1YIT T;  4QSH A;  3MEV A;  4C8Q D;  3H4C A;  5J26 A;  4C5H A;  4F7U A;  3SWN C;  2EQM A;  5GAN j;  3OW2 S;  4ZGE B;  1WJQ A;  4YTL A;  2XKO C;  1BI2 A;  3MP1 A;  4MFE A;  4C8Q C;  3SDZ A;  1GXI E;  2RHZ A;  1KHI A;  3JCM g;  3TU4 K;  2L5Q A;  5D6X A;  5FLX E;  2E6N A;  1PSF A;  4A4F A;  4C92 E;  2P4T A;  4LDX A;  4V2S A;  2VC8 A;  3N5B B;  3SWN B;  3S3N A;  2QDY B;  4M77 E;  3NTI A;  5A0L A;  1NJI C;  4KUD K;  3ZEH A;  4OF1 A;  4A4G A;  2E64 A;  3G6E A;  4IUV A;  5GAO n;  4HT9 A;  3S3M A;  1QP3 A;  1MHN A;  3CD6 A;  5FU7 C;  2R5M A;  2HNI A;  2RM4 A;  1D3B A;  3GF5 A;  4LDU A;  2RHU A;  3FRN A;  4DOW A;  3V7S A;  4HL4 A;  5CIU A;  4XTW A;  1FX7 A;  4M78 F;  4M7D F;  1VQ5 A;  4HNU A;  2K5L A;  2JTM A;  1QLB A;  3CBM A;  1V29 B;  4J5Y A;  4JX5 A;  4LDV A;  4N0A C;  4C5E A;  1JJ2 A;  2HAX A;  1YJ9 T;  3G7Z A;  4MMK A;  4ZN1 A;  3CCJ T;  1U1T A;  2R57 A;  2XI9 A;  3JCM e;  2RK1 A;  3FB9 A;  2FVU A;  4UC4 A;  3CCS A;  2P0Q A;  1WJR A;  4XU2 A;  3HBL A;  1QP2 A;  2F69 A;  2C06 A;  3PIO A;  2DD4 B;  2OTL A;  4ELJ A;  1Q7Y C;  2E70 A;  4MDX A;  2QI2 A;  3BY7 A;  4C92 A;  3OYL A;  5GAM d;  3QDR B;  2ZGW A;  3HB9 A;  4IUQ A;  5AYF A;  5HY6 A;  2FB7 A;  3HKS A;  4MZM A;  2M1H A;  3X28 B;  3BG3 A;  4M77 A;  5LJ3 d;  4ZTJ A;  2VUB A;  5GAN d;  3PTA A;  2DXB B;  2PQW A;  2O01 E;  1IZ6 A;  4XTV A;  3PNW C;  4X34 A;  4C0D C;  1MGQ A;  3GNF B;  3LX7 A;  4OB2 B;  3DL1 A;  1H64 1;  3SWN A;  4A4E A;  2E12 A;  4RMO A;  2VYT A;  2XDD A;  1N6A A;  1VQ7 T;  1XTD A;  1VQ5 T;  2O4X B;  4O6J A;  4C8Q A;  2QQA A;  3QYE A;  2ZPG B;  2IG0 A;  4C0D B;  3VKI A;  2PVG B;  2V8J A;  4PJO F;  2D0Q B;  3VYH B;  4OP0 A;  3CCS T;  3FLG A;  2OTL T;  1Y07 A;  4XTZ A;  4BE0 A;  2JN0 A;  5C6S A;  1VQ8 T;  2KDS A;  3G71 T;  2PUO B;  5DLO A;  2FHD A;  1YIJ A;  3E9F A;  3MHX A;  4FT2 A;  4NS5 A;  2LT1 A;  4A4H A;  3DB4 A;  3E9G A;  3C12 A;  3E19 A;  3EFS A;  3LH0 A;  5DM7 R;  2WSE E;  3HL8 A;  4C92 G;  5DY9 A;  3HZJ A;  3CCM T;  4PLI A;  5GAM f;  3CCQ A;  4C5G A;  4M7A E;  4M77 G;  2M16 A;  4QQ6 A;  2OTJ A;  2QDJ A;  5I21 A;  1R8O B;  4C0F A;  1VQ9 A;  5LJ3 f;  4RG2 A;  2DAQ A;  2VV5 A;  4N0A A;  1IRE B;  4F7U B;  5GAN f;  2X35 A;  1PSE A;  2HQE A;  5M9O A;  3O8V A;  2KQW A;  4Z02 A;  3HO8 A;  4BAC A;  3FIF A;  3JCM W;  2QTX A;  4M78 D;  3CEY A;  4M7D D;  3LW5 E;  3V7C A;  3CC7 T;  1OYX A;  4M6V A;  4ZGJ B;  2L89 A;  4NL2 A;  3QJY A;  2MMP A;  3RKY A;  3RMS A;  3V8L A;  1UEB A;  4M78 C;  4M7D C;  5CQY A;  3JCM b;  4XU1 A;  3URG A;  2B8A A;  2K5I A;  5CKF A;  3J81 E;  4ZTF A;  1KQ2 A;  1QVF A;  3MP8 A;  2CZ6 B;  4HNT A;  4X9C A;  3HRU A;  3L2V A;  2EQU A;  2RJE A;  3BG9 A;  1YIT A;  1UGQ B;  1K9M C;  2DTO A;  2LQ8 A;  2I2L A;  2R5A A;  2KY9 A;  3VUB A;  1E7P A;  3Q1J A;  4FM4 B;  4Y91 A;  1YHQ A;  5J3B A;  3FDR A;  4KUI A;  4TVR A;  3CC4 T;  3JCM J;  1D3B B;  2L8D A;  5LJ5 h;  2EYQ A;  2QQS A;  4EMH A;  2MWO A;  3JB9 J;  2ZPH B;  3VU3 C;  2XDB A;  3WVE B;  2BUD A;  3CMA A;  1NPR A;  3UWN A;  3WXM B;  4M78 E;  5EJC A;  2Y90 A;  4JS5 A;  3AHU A;  4M7D E;  4DA4 A;  3SB2 A;  3QPH A;  3L2Q A;  4QQD A;  2ZPB B;  3A8G B;  5FU6 B;  3JCM d;  1NPP A;  4MML A;  2LDM A;  2PVD B;  2E1H A;  5LL6 S;  2QA4 A;  5CCA A;  1I81 A;  4XK8 E;  4BY6 B;  1UGR B;  3HFO A;  4M7A F;  2GCX A;  1BI1 A;  3ME9 A;  1HXD A;  1UGS B;  2CZ1 B;  2CZ7 B;  1X01 A;  3M4Y A;  4C92 B;  3OS2 A;  2QEX T;  2A3L A;  3M9Q A;  5DLQ E;  2QF7 A;  1X6O A;  2JNG A;  2LT4 A;  2L3R A;  3DLM A;  3PMT A;  4M77 B;  4EMK C;  5LJ5 g;  3OYD A;  3CPW A;  1U1S A;  3CXC A;  2G3R A;  3CCJ A;  3V8K A;  4M75 F;  3X20 B;  1YHQ T;  1YJ9 A;  3BG5 A;  2D6F A;  3VJP A;  2WJ9 A;  3V7R A;  4BI4 A;  5I2S A;  2DXT A;  3WVD B;  1ZBX A;  3KUF A;  4E47 A;  1M90 U;  3FC3 A;  1Q82 U;  4BE1 A;  3M53 A;  2WSC E;  1BI0 A;  5GMK m;  1VQP A;  1NZ9 A;  3CMA T;  2DZ9 A;  5GAO l;  3UT1 A;  2DD5 B;  3QUI A;  2V8K A;  4C8Q B;  3JCM X;  5J39 A;  4N4I A;  3M5A A;  2K2V A;  2RB6 A;  2RH2 A;  3JCM P;  3A8O B;  3P8B B;  1O75 A;  2LX9 A;  3QII A;  4RCB A;  5KH6 A;  1M1F A;  2V8I A;  4M78 A;  4M7D A;  4M7A G;  3PT9 A;  4PJO E;  3MET A;  2QA4 T;  4CRI A;  2KR6 A;  2WAC A;  5GAO p;  4BE2 A;  1M8V A;  1QVP A;  3GP8 A;  4L6V 5;  3JCM f;  3OYM A;  2BS3 A;  3P8H A;  3OYI A;  3DKM A;  4R56 A;  2MWP A;  2P0P A;  1VQ7 A;  3LGF A;  3RKW A;  5FU7 B;  1S72 A;  2F5T X;  5LJ5 e;  4JUV A;  4QQG A;  3L2R A;  2ZZD A;  1Q86 U;  3A8M B;  2LNV A;  2EKO A;  3FJP A;  1N27 A;  3EFR A;  4R55 A;  2JTF A;  3HRS A;  1M1K U;  3QG1 A;  2CYZ B;  2M9U A;  4E7I A;  3GLX A;  3JAM E;  3H6Z A;  3RUX A;  3V8J A;  1G3Y A;  1I8F A;  3JSC A;  2GF7 A;  2RJC A;  4VUB A;  5D6Y A;  3JB9 I;  3G71 A;  1VQP T;  4MIM A;  1VQ8 A;  4EDU A;  3MO8 A;  2BS2 A;  1XQH A;  2QQR A;  2XID A;  1K8A U;  2RJF A;  1U8R A;  3MCA B;  2DJZ A;  4JJN K;  3E1S A;  3A8L B;  2ZPF B;  1QVF S;  3QKJ A;  3OMC A;  3M55 A;  5GAN 6;  3BDL A;  3QYH B;  3CCM A;  5CQX A;  2CKK A;  1KG1 A;  1FWZ A;  1M90 C;  3L2U A;  1VQN A;  1Q82 C;  2EJG A;  4M78 G;  5CVI A;  4M7D G;  3OYA A;  2E10 A;  1M1G A;  4EMK A;  2BS4 A;  4MFD A;  4M7A D;  3J7A F;  4OGE A;  1YBY A;  1VQ9 T;  4AI6 A;  2DD5 A;  3EAE A;  4QVD A;  3ER0 A;  5GMK h;  5CKH A;  3CCV T;  5GAM h;  1S72 T;  4WF2 A;  3QZ5 B;  4M7A C;  1SSF A;  3CC7 A;  3A8H B;  1Y7X A;  5I2M A;  5LJ3 h;  3PMI A;  3TEE A;  1LJO A;  4LD6 A;  4C5I A;  3CCL T;  4M75 D;  1LNX A;  5LJ5 j;  3CC2 A;  3I55 A;  3QXE B;  4IUP A;  2DXU A;  3HPW A;  3GNG A;  3SD4 A;  4DQ2 A;  3HHT B;  4M75 C;  4JS4 A;  1KQS A;  4NL3 A;  1K73 U;  2RHY A;  4E7J A;  1VQL A;  2X4Y A;  3A5Z B;  2DK3 A;  4BD3 A;  5GAN 7;  2PUK B;  1Q86 C;  4XTX A;  3OYN A;  3OS1 A;  2CZ0 B;  4ATO A;  3M57 A;  3CC4 A;  3FEO A;  5FRM A;  4PNO A;  2R58 A;  1G3W A;  4PLL A;  2X4W A;  2OAU A;  3LGL A;  1VQN T;  2CS7 A;  2RHI A;  1VQM T;  4L59 A;  4JX6 A;  1QVG A;  3ZFJ A;  1UGP B;  1I5L A;  2K5F A;  5KE3 A;  2GFA A;  3TW7 A;  5LJ3 g;  1K8A C;  4NC6 A;  1OI1 A;  4LD9 K;  2LCC A;  3NFC A;  4PJO G;  2XD0 A;  5L8R E;  3RER A;  4M75 E;  3RIR A;  2LVM A;  1B34 A;  2DPP B;  3VV0 A;  3HRT A;  2RO0 A;  3X25 B;  4JDS A;  4LOC A;  2KMG A;  2VGN A;  5GAN 2;  4JRP A;  3CC2 T;  3I55 T;  5IN1 A;  2ZCF B;  5GAN 5;  4RG8 A;  3CCE A;  3PIP A;  3GIB A;  3RES A;  4XU3 A;  2RI5 A;  1QW1 A;  2RK2 A;  2DO3 A;  2QEX A;  4JRQ A;  3HSB A;  1YJN T;  4HLQ A;  4JRK A;  4QVZ A;  4M78 B;  1VQL T;  4M7D B;  1N8R U;  2GQV A;  1G5V A;  2D9T A;  4FIB A;  3UDC A;  3QYB A;  2JOY A;  3OQ5 A;  1G3T A;  4BDY A;  4BI3 A;  1BIB A;  4HA8 A;  2JZ2 A;  4A54 A;  2QFZ A;  5GMK e;  2DIG A;  3MEU A;  2CGH A;  1Y96 A;  1VIF A;  3OBW A;  1HK9 A;  4RKU E;  5EG2 A;  3OS5 A;  4C0Z A;  5GAM e;  5LJ5 d;  5LJ3 e;  1K73 C;  2ZZD B;  3M4G A;  5KCH A;  4B9W A;  4M7A A;  2RJD A;  5C0M A;  4BDZ A;  4F7U E;  2KAF A;  2XG8 D;  1WPY A;  4J6X A;  2PU9 B;  5IAY A;  4XAX B;  3HP9 A;  4C0G A;  5IT9 E;  5FRN A;  1NE8 A;  4IUU A;  4J6W A;  1KQ1 A;  1XOV A;  5CKB A;  5A0G A;  4JLG A;  4M75 A;  2YHT A;  4PJO D;  4FL6 A;  1RL2 A;  1UB4 A;  3LLR A;  2AHJ B;  2H3J A;  4HNV A;  2YLC A;  4QVC A;  1YJW T;  3JB9 H;  3JB9 F;  4PJO C;  4ELZ C;  3ASK A;  3OYF A;  4JX4 A;  2JVV A;  4HCZ A;  4XTU A;  5KCO A;  4Y28 E;  5HKC A;  5A2Q E;  3JCM Q;  4HCB A;  3OMG A;  2MAM A;  3F70 A;  4O5V A;  4ME7 A;  3T9N A;  2HD0 A;  4A53 A;  2G77 A;  3INZ A;  4PJO B;  2EAY A;  5A0D A;  2RI3 A;  3OA6 A;  1W4S A;  2BIV A;  3SFM A;  4EMK B;  3CCU A;  4FU6 A;  4GY5 A;  3QZ9 B;  1O9S A;  2LCL A;  3R6O A;  4J6Y A;  3OYJ A;  3CME A;  4CI0 C;  3OYC A;  5KE2 A;  5D6W A;  5GMK j;  2GFU A;  5GAM j;  3L2W A;  1BKB A;  3VYG A;  1N8R C;  1P92 A;  3L1A A;  4KUL A;  2JUF A;  5LJ5 f;  5LJ3 j;  3NTH A;  2FYK A;  1KHC A;  3MEW A;  4OB3 B;  2RI2 A;  3L42 A;  5GAO m;  3JB9 G;  1VQ6 A;  2A7Y A;  4EMG A;  1FKM A;  3QWL A;  3LYI A;  2LRQ A;  4M75 G;  4MDW A;  3ZBD A;  2FL7 A;  4NOY A;  5GAN 3;  5GMK i;  3I56 T;  3X26 B;  3CCV A;  3UPU A;  4OB0 B;  3MP6 A;  3JRZ A;  1OZ3 A;  2DTI A;  5GAN 4;  3TCJ A;  3OYG A;  4F7U F;  1QVG S;  2XDP A;  4ELY C;  2E5Q A;  4LDW A;  3CCL A;  5FRO A;  4OB1 B;  4BBS M;  3CCR A;  1KD1 U;  2RD1 A;  3DLL A;  1Y71 A;  1YI2 T;  5CO7 A;  1OZ2 A;  3CCU T;  4II1 A;  3G4S A;  4AKG A;  1M5Q 1;  3CME T;  1B34 B;  4C8Q E;  1WQ7 A;  5CK9 A;  4IKF A;  1XNI A;  4HKE A;  4BI8 B;  3M59 A;  2EJF A;  2E41 A;  1VQO T;  1WJS A;  1VQM A;  4OGC A;  1Q81 U;  2K3Y A;  1KC8 U;  3RMQ A;  1VQ6 T;  4PJO A;  4F7U G;  2VXF A;  1M9S A;  1N9S A;  1WNL A;  2VXE A;  3OYE A;  4B9X A;  3LWH A;  3VKH A;  1AHJ B;  3JB9 D;  2KSS A;  4X9D A;  4E7K A;  4RCC A;  3GPL A;  4IUT A;  5GAN h;  1W2B A;  2DXC A;  1Y96 B;  5CR2 A;  1WQW A;  3CCR T;  3G6E T;  4KBM B;  3L2Z A;  2NLU A;  3BW1 A;  2X4J A;  3M58 A;  4FSX A;  3OYB A;  3CPF A;  3PFS A;  4OVA A;  4M7A B;  3CD6 T;  4J8O A;  1VQ4 A;  2MI6 A;  4XU0 A;  3OSS C;  4OMF B;  4Q5W A;  4N4G A;  3G4S T;  2KMT A;  4BB7 A;  1YJN A;  2DZC A;  2P0K A;  1JBM A;  3OW2 A;  4C92 F;  2DIQ A;  2LC4 A;  4N4H A;  2K4Y A;  3QSU A;  1JB0 E;  3OS0 A;  2YRV A;  4M75 B;  2DTH A;  4M77 F;  1VIE A;  4LDY A;  1M1K C;  1K9M U;  1KD1 C;  2LQK A;  3GOX A;  3CPW S;  1JJ2 S;  2Y4Y A;  3RKX A;  3CXC S;  3TRE A;  5GAM g;  3S6W A;  2HBP A;  2M0O A;  3QYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...