2ZPTX

Crystal structure of mouse sulfotransferase sult1d1 complex with pap
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mSULT1D1, a mouse catecholamine sulfotransferase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Tyrosine-ester sulfotransferase
total genus 107
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zptX00
1SKYB 3LA6A 1X1RA 2OBLA 4MA4A 3K8YA 1OIVA 1OHHD 4GI7A 3N70A 4TMXA 5HE8A 3LD9A 4NYJQ 4DLRA 2ZI5A 4Q9IA 2A7QA 4LZZA 1G3RA 1VG0B 5JBQA 3P27A 4MKHA 1MOZA 2IHBA 2N1BA 3B1WA 1YR9A 2DFNA 3DKPA 3I8SA 4XJXA 4BLSA 2BWJA 2TMKA 1GVNB 4UKDA 5EE9A 2FSHA 3PITA 4YQFA 5FTNA 3NC0C 2JLSA 5FTJA 1E3MA 1HV8A 3DOEA 1AS0A 2NOAA 2IYLD 1FW6A 5JJKA 5L3SA 3EA0A 3T5GA 4S35A 2QP4A 5EXXA 1GKIA 5FPHA 5DHAA 3BFKA 2VP0A 4HAWA 2YWGA 4P3YA 5AJYA 4OQLA 1DG3A 5FR2A 5G41A 1E6CA 3AVTA 1TQ6A 1NIPA 4KXFB 3AP3A 2ZJ5A 4D0LB 4QBIA 2GTPA 2HCJB 1DELA 3KTAB 4OHVA 2VP9A 5DYIA 4V03A 4ZI2A 3OE7A 4KO8A 1KKMA 1UDXA 1MABA 1R7RA 2J1LA 5JHHB 2XOKA 1K5DA 4OK5A 2B21A 2G88A 1UF9A 1CU1A 2KE5A 2YOHA 2XNSA 3K0CA 2HJVA 4QHTA 1P2TA 4JYCA 4KBFA 2OFWA 3UWOA 4KITB 3DKVA 3NKVA 1T91A 2Q21A 4II7A 1KMHB 1R5BA 1AA9A 1XTRA 3OESA 1OIXA 4Q4JB 3IBGA 4WAUA 1F2TB 4LBWA 3IIKA 1GOTA 3I5YA 1U94A 4IHQA 1KDTA 3KL4A 3A4LA 5CLQA 1UBCA 2GJ9A 1RYHA 2BMJA 2E9SA 3T12A 621PA 1XMJA 3A8TA 2NO1A 1KI2A 1NP6A 4K8OA 3WP1B 4M1MA 3I73A 2XSZA 3KTAA 2CE2X 2G0NA 4LI0A 4Q7KA 2RCNA 1GZSA 2GK7A 2WJYA 3AV0B 3FVQA 1NNEA 5AJVB 1P60A 3GPLA 5FBLB 5C1BA 5TY0A 1L8QA 2PX0A 3K0EA 2R65A 1NY5A 2FV8A 1JR3D 4B2LA 3GJ7A 5L3QA 1TEXA 2QMEA 4X8OA 1JNYA 3S1AB 2VSOA 5FOTA 1PLLA 2Q3MA 3KQNA 2CL6X 3U3JA 4B76A 4B6EA 2V8OA 3T1QA 3R8FA 3GCGA 1YRBA 2BJVA 4P31A 4W5HA 3GLFE 3BH0A 3U6BA 1YR6A 1W4RA 3NDBB 1KJWA 2YHSA 3QNUA 2D2EA 2CCGA 4EPWA 4OHWA 3W3AA 1Q44A 1IBRA 2BBTA 2XZLA 1II8B 3KUCA 4BPBA 4DCNA 4CEJA 3UXMA 4BLQA 1YQTA 1OT3A 2ANCA 1FL9A 2ZU6A 1K5GA 3CRW1 3H1TA 3WP0A 4LOAA 5L3SB 4EIWA 2GDJA 5F9FA 2GILA 5DE3A 3O47A 1G7SA 4I99A 2ZRHA 2F3TA 1FQKA 1ZU4A 2A5GA 2QPTA 1SXJA 3BE4A 2AFIE 2VP6A 3K70B 3Q5DA 4NONA 4XWKA 1F5NA 2BMEA 3PUWA 1A82A 1H8EA 1MO6A 4PC7A 1DO0A 1RRGA 2ZAOA 4TQAA 4F38A 5JRJA 5KDOA 2W0SA 3TAUA 3THXB 2RGGA 1RJ9B 4DDWA 4LJ5A 5DI3A 2ZRMA 4MDEA 1EFUA 1T5LA 2A9KA 3TR5A 4B32A 2ZIAA 1E9BA 1WDTA 2CBZA 3LAWA 2ZI7A 4FMDF 2QEQA 4L5BA 3OEED 2AX4A 2ZS8A 1XBTA 1SKYE 2W2VA 1K6MA 2ZI3A 4JZKA 3QEOA 4QRHA 2YWFA 2J3EA 2I1QA 1T0JB 2QY9A 4Q9KA 4CIDA 4BECA 1E9DA 1II0A 1R5NA 1E2IA 8OHMA 2XJ9A 3MWLA 2WSMA 4DLYA 4NU0A 3DPUA 4G5QA 4IEIA 2Q6TA 3RANA 1R0WA 2WWGA 4IVPA 1NJGA 1ZYUA 3VR5A 4A8JA 3KFXA 4ZIRB 1N0UA 2VPPA 1JQJC 4HSEA 1W36C 4OHZA 2A2ZA 1E94E 2CJWB 4FI3C 3RC3A 3SC3A 2DWQA 3F5FA 3QBVA 1JECA 2GJ8A 4TYYA 1YZGA 3P4XA 2F1RA 3GJ3A 4KVGA 3CPJB 4M9XA 1CRQA 3FMOB 5KHOC 3ADKA 4B3BA 1EFRA 1GDDA 1XEWX 4ON9A 1S4QA 4TLAA 2WICA 4G3XA 1W44A 3RRYA 3U60B 1UPTA 4D4JA 3R7WA 1ANKA 1TF7A 1UKVY 4FCTA 4JJZA 3RLFA 1WCV1 2AR7A 2QNRA 4TMWA 4KHZA 2QPOA 5B64A 4EDHA 1W5SA 3KQHA 1CS4C 2G1JA 1SULA 4JJKA 4B3CA 2HLDA 4HAXA 3EPJA 1GNPA 5DIFA 5B30A 4D6PA 4HB0A 4LX0A 1NLFA 1XD2A 4LDJA 1G17A 3LWNA 1R8QA 1G19A 2XXAA 1VHTA 1N2CE 4Q4HA 5EP2A 3FHOA 4QJ3A 1Z83A 3MJHA 3EPHA 821PA 2JLRA 4MRRA 5GVSA 5EUMA 1G6HA 3C5CA 2YNMA 1FPMA 2GCNA 3KB2A 4RZ3A 2FEOA 4DLUA 1XXHA 3GLGA 1VCOA 3D31A 1TF2A 3L2OB 1G41A 2L0XA 4JLJA 2VP2A 1R8SA 1U81A 5EE1A 4D80A 3QPVA 1E0SA 3R9WA 4D81A 1CF4A 3PUZA 6Q21A 2F9LA 4I1OA 4Z1MD 4DSOA 4F4CA 4AURA 1DTSA 1T5IA 2B6HA 3AVPA 3IDQA 4F7WA 4IKEA 1QBKC 3GLIA 2D7CA 1KI4A 2BC9A 2VP4A 1MH1A 2WJIA 4JSTA 2V6IA 1KMHA 3I4LA 2ONJA 3NBXX 1KK2A 3THXA 2Z83A 2D74A 3V4FA 3A1TA 1AZTA 2J7KA 3HPRA 1CJTC 3RSOA 2H18A 4M4SA 2OSBA 3KKQA 1BS1A 1E2PA 1P72A 1A2KC 2YC4C 4QM7A 5P21A 4Z54A 1W46A 1CP2A 3PEVA 4UXIA 5J5CA 3OAAA 1ZW6A 2I1VB 4JLVA 1KHTA 2CVHA 2ZRJA 1D9XA 4TL7A 3BK7A 1IXSB 4A15A 4P32A 4QHYA 1KAGA 2XAUA 2YZ2A 4D2IA 3C15C 1I4DD 3SJBA 1JALA 4QGGA 2OESA 2QZ4A 1QF9A 4A9AA 1QDEA 1Q3HA 1P61B 1VYTA 4TTPA 2IEZA 1Z07A 4ITRC 4DJTA 2JLQA 2JJ2A 5DNYB 2B7CA 3IIMA 4D82A 3K1JA 1COWD 1TUIA 1P2SA 1G5TA 2RHMA 4Q9LA 3UG6A 2WIBA 5FUVA 1YVDA 2RGNA 1RVDA 4RZUA 1G3QA 3GD7A 3KXKA 2EU8A 1KIMA 3DDCA 3Q8XB 4QFMA 3B82A 2OBNA 1GNRA 1OLOA 3E1SA 1G4UR 2GJKA 4BZQA 1E99A 3UWKA 3GLIE 1UFQA 4HB4A 5IK2A 1WA5A 1Z28A 4KAXA 1S1MA 1L4UA 2UZ3A 1GTVA 2F9MA 3LNCA 2BCJQ 1YZTA 2A78A 2Y8EA 5GJWC 4EPTA 5E4FA 5KNBA 2CE7A 1XP8A 2I3BA 4KLNA 1YZQA 1HEIA 2CHQA 2R62A 1EX6A 2J0SA 3FGNA 5C4GB 2O8DB 2GZDA 1TMKA 2WMOB 1Q21A 4TT3A 5JFGA 3EX7C 4MKGA 1NL3A 2JLZA 2WTUA 2WWFA 2RAPA 4MYCA 1OFUX 4Q7MB 2ZS9A 5FR1A 2CL0X 2C9OA 4EUNA 3A58B 3VHLB 1G3IA 3E5HA 2QQ0A 3B7GA 3SDZA 2LWIA 3BH6A 4YMWA 1ZJ6A 3QPWA 1IN5A 3DEFA 3TKLA 5EZ6B 4XVUA 1YHNA 1ZD1A 2H5EA 4EFMA 4AKIA 1E96A 1JPJA 5BYJA 2P2LA 2IYSA 3B8HA 4LBYA 5DSZA 3NXSA 3WXMA 3M4YA 3CNLA 2GWHA 2WIAA 2C03A 1QHHB 5H70A 5SZKB 3ADBA 3QF4A 5H8WA 2AXNA 3RYTC 1KK3A 2QRZA 3P1JA 3ZLJA 2Z0MA 1AM4D 4A8JC 1EFTA 2VTKA 3ZS9A 5KTYA 2MSEB 1TL7C 2GCOB 2BV3A 2W6ID 4DC9A 2DPXA 4BASA 4JLPA 2F1IA 4UNSA 3C8UA 1DPFA 1QHHA 2QU8A 3AF1A 4WVFA 4XSGA 3WY9A 1XPUA 4XD7D 2ZR0A 4LYFA 3LO5A 5CK5A 4B34A 2Q0HA 3QKSB 1WBDA 4W5WA 4ILEA 1KSJA 3EZ6A 5LB2A 1G5PA 2JLVA 1E2MA 3KKPA 3AF2A 1G5RA 2X8AA 4P33A 4R98A 4TYPA 1Z0FA 4C0LA 1W2HA 3AKDA 3M1IA 4HLUC 2AKYA 4LJ6A 3TNFA 1IJFA 4HB2A 3VR2A 3MFYA 3SNHA 2OHFA 2EFHB 4NHOA 3VQTA 5AJWA 3PVSA 1KGDA 5DI9A 5JS7A 1O87A 5C46F 5IK2D 3W8NA 2GXSA 2XEXA 3IHWA 4HB3A 3UPUA 2FZ4A 4GMDA 4OBEA 5CDFA 5JWRA 1XMVA 4CF7A 1TX4B 2HDNB 4JBYA 4US2R 2C2HA 4IW3B 5ELXA 1E0AA 1OE0A 3GJ0A 1G8YA 2IUSA 2VHUA 3EZ2A 4U00A 5JHGB 3H0KA 4MUAA 2GJSA 2PJRA 4JLOA 4Q47A 3RWMB 3ASZA 5TV2A 4EPYA 2W0MA 4KSBA 4Q1FA 4FMBB 4ZO4A 3CM0A 3LLMA 1E9RA 2ERXA 4US1R 4Z8XA 2EWWA 3X1ZA 1TQ4A 4QG7A 3ZIAA 3NC1C 4HLQB 4BFYA 4DB4A 1DAHA 1U8AA 3A4MA 3MD0A 4AWXA 2QAGA 5TXGA 1G4AE 1PLKA 1OXTA 2BHRA 5KUTA 3LXXA 2A5DA 1G7CA 1E2DA 1U0HC 4JIMA 5G53C 5IHPA 4A8JB 1SVLA 1PVOA 1OH8A 4YDSA 1XTSA 1SHZA 3B6EA 3KXIA 3G5UA 1XWIA 3PQCA 3K70D 2YC2C 1HQYE 4A1FA 4BZXA 3K0FA 3LQQA 4V0ME 2IWHA 3T1TA 4JL6A 4QBHA 1A1VA 3EC2A 1DAMA 4OQNA 3IPXA 5BN3A 4KVAA 5J47A 1XMSA 5FI1B 1WXQA 1GRQA 2F1JA 3PXGA 1VG1A 5FTKA 1R5OA 4WBSA 1QVRA 4XIGS 4G5OA 4OK3A 5KU1A 2J41A 3W5IA 1ZC3A 4FW9A 4LV8B 1MRSA 1WF3A 1XNJA 4DEXA 3H86A 3AEZA 3AUXA 5EE5B 2O5VA 1XCGB 3NHBA 4DT1A 2AD1A 2IW3A 1DBSA 1FX0A 1I4TD 1ZM7A 2P5TB 2V1XA 1KZGB 2C8VA 1RKBA 3LDAA 4ZCIA 1IOZA 2JLXA 4N1AA 3T1VA 2J5XA 2FSGA 4M9ZA 3ONWA 2QAGB 3B13B 4NCJA 2GETA 4RY2A 1Z8FA 3K9NA 4LBZA 1N3BA 2QSZA 2HJGA 2BKUA 1BKDR 2IXFA 5L3RA 3P4YA 2NZ8A 4EPVA 5HZHA 4UQOA 3C14C 3MGCA 3PUXA 3RS3A 3ZH9B 2Z4RA 2OAQ1 3KJHA 2QE7D 1RRFA 4Q5IA 3TSZA 4Q4LA 2W6JD 3CIOA 2ZYTX 3N2EA 2C98A 2GRJA 2ODWA 2H92A 1JEDA 5DLQC 4JVMA 5JWHA 3CX7A 2VA8A 4U5XA 4LCBA 5JEEA 1O3YA 3EIQA 4PSVA 1G8FA 2GHIA 4MITA 1W48A 1Q3TA 2PEZA 1NIJA 2J59A 4ERNA 1MT0A 3OEHD 5D3MA 1E79A 4W9MC 4BE7B 3ZVLA 4CT5A 4Q4HB 1BYIA 2QQEA 3F0TA 1UM8A 4TSFA 1YRAA 3F8TA 4B73A 2GF0A 4A0RA 1KI7A 4OI0A 5LBIA 3D8BA 5J4HA 1SVWA 3MG9A 3NEYA 4M9SA 4DCUA 1HA3A 4M22A 5CLLA 1VCMA 4AKEA 1Z47A 3AH8A 3DOFA 3Q85A 3B1ZA 3D7MA 4V02A 2IYVA 2O8EB 2ORWA 1V5WA 3C7KA 4GP7A 4DUGD 1XTIA 1XFAA 1OF1A 3E2IA 4MDFA 1HUQA 2R2AA 1OW3B 1IM2A 4ZPXA 4A4DA 2OBMA 1XTKA 1S96A 4LHXA 3AKYA 1OH5A 2EWVA 1XEWY 2WWYA 4V0NA 2FPLA 4BRUA 4HUTA 1KO7A 3ZGXA 5DO9A 4EPRA 5FPKA 3O8RA 5KSYA 1E2GA 2DFLA 5HKKD 4Q9JA 1I4LD 1IJEA 1RFLA 1JJVA 1ZNXA 3V4RA 2JCSA 2O0HA 3ZD7A 1SVMA 721PA 4EQ6B 4QKQA 4ACBA 1J7KA 3MSXA 1GSIA 4WXRA 4IDQA 3IEVA 2A5YB 2K5UA 3HPQA 4Q19A 2GXUA 2VF8A 3CRMA 4GMXA 3RHFA 4S2EA 1KSFX 4A92A 3VAAA 1T8TA 4US0R 5JRZA 2C9YA 3RRZA 1AKEA 2ZRLA 1EX7A 4A6XA 2GCPA 2CL7X 2VEDA 4OI4A 1OXSC 5FPYA 3ZZUA 3R8CA 1KI3A 1IQPA 5B2ZA 2WVJA 2ZI6A 3UMSA 4JLKA 5E3HA 4MGZR 3TE6A 4WZBE 5A4JA 3QG5A 2ZRCA 3FWYA 4DCVA 1IY2A 1JAIA 4TSFD 1SVOA 3NTUA 3KZ1E 2FPKA 2G9NA 1E1RA 2H7VA 5J4LA 4B3XA 3BIFA 4TMKA 1W49A 3MRSA 1U9IC 2F1HA 1FUKA 5C2JB 1ZAKA 4NYIR 5EP1A 4DLXA 3KDSE 2F55A 4A6PA 4DCTA 2NZJA 4G01B 3MUFA 2LCFA 1T0HB 4JT4A 3T15A 1Y63A 1KO4A 4B3FX 4BFTA 2ZE7A 4PXAA 1NI3A 5BQ5A 1VYUA 5IF9A 2F3RA 4DUGA 1DEKA 1LF0A 4Y0VA 3WMFA 4BRWA 3AVXA 2O0JA 1D8TA 4C4PA 2VP5A 5FL7D 1U90A 1CJKC 4Q1CA 2QENA 2V7QA 3AKEA 2A30A 3SS8A 4BGDA 2Q9AA 3W6NA 2WMNB 2YKGA 1UADA 3ZQ6A 1GRRA 5CIWA 4TL8A 5JS8A 4TL6A 3R20A 1G1MA 2ZJZA 4TMTA 4LJ9A 2QROA 1S8FA 4JBWA 5HCNA 3QSYA 2O8FA 4IOJA 4IRUB 4A0FA 2FOLA 3Q7PA 4NKRA 5FUXA 1OH6A 2JJ1D 1KI1A 2BDTA 2DFTA 4PAQA 3TR0A 3I92A 3BS4A 3SN6A 3T06B 4TLEA 2PJZA 3B60A 3LBHA 4JYBA 4EJSA 5CITA 4AG5A 3VKHA 2VHTA 3X1DA 4RD0A 1VPLA 1RRPA 1XU4A 2HXYA 1MO4A 4TLBA 3U2QA 1M7BA 1E0KA 3A1WA 2GZAA 4RD4A 3THWA 2IF2A 1GAJA 3KJEA 4HLDA 1JQLB 4AC9A 3L8ZA 4YXWD 2O8DA 2GAOA 4TN1A 3KKMA 2XTNA 1GG2A 3RS5A 3G82C 1ONBA 4TZ0A 1XD8A 4N3NA 1XTJA 3SJAA 3OFND 3U3RA 2ZRAA 1Z6XA 1N6LA 1NVVR 2ZRIA 4M1YA 1Z0DA 4IXMA 4B33A 3EWSA 1X1SA 1LW7A 3VR4A 4D26A 1LNZA 1EFHA 1KJZA 3QY0A 4CDGA 2BCGY 4KCGA 3EIEA 2PZGA 4B6FA 5JCZA 1U8ZA 1E98A 1OXXK 5A5GA 5BWMA 1UBEA 1R10A 1Y3AA 4RD1A 4MH0R 5CYOA 5KPDA 1SGWA 5L8VA 2QL6A 4P4SA 2KB0A 5FL7A 5FH9A 2VHQA 2NMVA 1NMZA 4OQFA 4RJLA 5JEDA 3HYTA 1KKLA 4L16A 1W0JA 1OB2A 1JBKA 4A82A 2B8TA 4Q21A 4PFSA 2G83A 4URYR 3GLIB 2J9RA 1X3SA 1TTTA 2H57A 1KI6B 4R2IA 1ETUA 3PV0A 1KO5A 4RD2A 1QHGA 2J0VA 3B9PA 1FNNA 2OCBA 1II8A 2FFAA 3MWYW 4QC2A 2JJ1A 4W7SA 1WBBA 1B0UA 3NIBA 2QGZA 4FMDB 1AKYA 5EE3A 3GFTA 3LXRA 1AS3A 4MGYR 5G40A 4B43A 3FMIA 2IA5A 4OQXA 4DB2A 1TU3A 3BC1A 1V43A 2OCAA 2QSYA 1ZUNB 2JEOA 3I61A 1NKSA 1L4YA 3W90A 1S3GA 3HU1A 4BQSA 2QBYA 4DLVA 5CM8B 1B23P 1VG9B 2VLIA 4D4MA 2ZXUA 5HZKA 5GJBA 3WNDA 1W47A 2RGXA 1GL6A 3C16C 5AUQA 4GOXA 3K0CC 2F7SA 1ZUHA 1M6NA 3TQFA 2XB4A 1P62B 2G0TA 4OL0A 2ATVA 4HYYA 3AF3A 2WWIA 1KDPA 4NYMR 3W9YA 3B78A 1CR1A 2D06A 4WZ6A 1S2MA 1IN7A 1Z6GA 2IX3A 2CMKA 2V6JA 3OHMA 1WE2A 3FPAA 4KODA 3ZD6A 1Q0UA 4ZCLA 1GRNA 2IXEA 1F48A 4J0QA 5K8TA 2BMDA 4B75A 3BJIC 2XB2A 3MMPA 1SXJD 3R9XA 3TUZC 4H1UA 5IRCD 2ZYVX 3WBJA 4FINA 3HU2A 1Z0KA 5CDFE 3ICEA 3ZQJA 3CW2A 3U6KA 3I1FA 2R9VA 1XF9A 1FTNA 5EQTA 4BFVA 2BM0A 3QKUA 2NTYC 4CEIB 3ZIAD 1RPZA 2QAJA 1AIPA 4HDOB 4AYTA 2FSFA 4Z8YA 2ZS7A 4GSYA 4BFSA 2BMFA 3RRMA 2ZITA 4IOKA 3A1UA 1GUAA 1PJRA 4NYIQ 4KU4A 1GIAA 2IYYA 3ASYA 1U98A 4OK6A 4PC1A 3PEWA 3CUEF 1E2QA 2Z5FA 3O8BA 1ZNYA 4TYWA 4G5RA 4KBGA 5K8LA 3GLFB 1YU9A 4LBVA 5LD2B 2IS4A 3CPEA 2CCJA 1Z63A 2JDID 1XPOA 3LBIA 3CX8A 3TW8B 3WRXC 2VHCA 4LHYA 2X2EA 4MRVA 4WIAA 4N0DA 2G6BA 4KYUA 1T8UA 1GKYA 2IXGA 1G7TA 3AP2A 3B1XA 2ZM5A 2P67A 4M1SA 2ZYUX 2NQ2C 3AF0A 3MLEA 1OFTA 3QF7A 2P3SA 2ZJYA 3EA5A 2ASEA 2IS6A 4IFEA 1M7HA 1CXZA 4IJMA 5JMTA 2XXAB 3K0AA 1TF5A 3AVVA 4O2RA 5CJ2A 4WW0A 4FIDA 1DO2A 2MMGA 3SE0A 2GF9A 4TZ6A 1Z22A 4A0HA 2WKPA 4OQMA 1J70A 4F4IA 4ZCMA 4GPTA 2YJTD 1CLUA 4GZLA 5F2EA 5FUWA 1DAFA 1HT1E 2C96A 2ERYA 1TU4A 1P2UA 3KB1A 1G8GA 3BFXA 4DCSA 3FTQA 2GAAA 1XJQA 2WOJA 1N6NA 3U3OA 1H8HA 2ATXA 2W6JA 5KNDA 3FB4A 2PT5A 2J0QA 4C30A 5AJZA 3S1AA 4KFTA 5DH9A 4B3DA 5SZHB 1KZ7B 3T5DA 1IONA 4ZI3A 3V00A 2GZHA 4FWIB 1BYUA 3H84A 4FN5A 2W2XA 3K70C 3PEUA 2WZQA 5JLJA 1R2QA 1ZINA 2F6RA 4XVRA 4Q1BA 2CNWA 3A36A 2FGKA 2RGDA 3GP8A 1AGRA 3UIEA 4OHYA 1KNQA 4LV6A 3SR0A 3WHLA 2AD5A 2QN6A 1OH7A 4NL4H 3KQKA 2E1RA 1WRBA 1KDOA 2NO0A 1OXVA 2FEMA 2R8RA 2YOGA 4QOSA 2A5FA 3D3QA 3QXHA 3WMEA 1AK2A 4EAQA 5CB8A 1P4SA 3BAFA 1J2JA 4KLZA 1RJ9A 2VF7A 3CF2A 2RKOA 1P6XA 2JATA 4DIDA 1G64A 1TAGA 3MJRA 1QZXA 3BB1A 2C04A 1J8YF 1YJ5A 1LV7A 2ORIA 2YV5A 1PV4A 4KFRA 3EARA 2WWWA 3U4QB 1NVUQ 4Q4AA 3LVQE 3REGA 2H16A 3ZVMA 5DN6D 4OI2A 2ZR7A 1TADA 3L0OA 2W58A 3EASA 5KDDA 2KI5A 2WWXA 5J4YA 4EJSB 1N5KA 1E2EA 1HYQA 3QUSA 2N46A 3GLHA 3W8RA 4UNNA 4JLNA 3PENA 2OO7A 4PC2A 4JL8A 3DHWC 1VTKA 1FZQA 4HUQA 1MR3F 2FG5A 3GMTA 1AN0A 2JJ2D 4PPGA 4BWYA 1OHHA 2FX3A 2ZJ2A 3FFBA 4UNQA 1CTQA 4DKXA 4PPNA 4CEHA 4PHFA 1H8HD 5A0FA 2QAGC 2O8FB 1C9KA 1S3SA 3CNOA 3NG1A 4Q1AA 3SHWA 4AIIA 2OXCA 2BEJA 1M7GA 2C99A 2NG1A 4JKYA 1CJVC 1II9A 3K9HA 1YR8A 3NBZC 3CBQA 2G1KA 3VKGA 4ZDWA 4M2LA 2AXPA 2J0UA 2W00A 2I4IA 2OT3B 2JASA 1LS1A 1N6PA 4OKSA 1UDWA 1JAHA 1X6VA 2ZANA 1QG2A 1IN4A 1VIAA 3FMPB 3HR8A 4D4KA 3PEYA 4URZR 4IEEA 4LJ7A 1N5LA 3TW4A 1QG4A 3TK1A 3QEJA 2ZYWX 3QXXA 1X86B 1ZVQA 2BM1A 3A4NA 4X8LA 4YMVA 4URXR 4MGKR 2VH5R 2PCLA 1BOFA 5D3QA 1F2UB 3TIFA 2RH5A 4Q01A 1ZNWA 2ZSEA 4TQ9A 3RNLA 4DXAA 1UBFA 4TQUS 3LW8A 4HZIA 5HR5A 4AYXA 1GITA 4TYNA 2RGCA 2PMKA 4YLGA 5KNCA 2R6GA 3GJ8A 4JL5A 4RKEA 3CKLA 2RGBA 1W2GA 2WKRA 2O8CA 4ACAA 3AVWA 2DB3A 5AUOB 2V7QD 1ZD8A 1KSHA 4GOKA 3ZVRA 1G3UA 4B74A 3O8DA 1A4RA 4GT1A 5BW8A 3HDTA 3FYHA 2ZSDA 4M53A 3X2SA 1ELOA 2JIZA 3KJIA 2IYUA 4M0LA 4P0TA 4GFDA 2HT6A 3NHAA 3EIHA 3WBKA 2FGJA 3CRVA 2BBSA 2JAQA 4QNMA 4YMTA 5J4VA 4N0EA 3LQRA 4GBMA 4NCIA 4C9BA 1NSFA 3W6OA 1D9ZA 2PX3A 1Z5ZA 2IT1A 2WOOA 4PX9A 3TSOA 3CH5A 2NO6A 4QBGB 4D25A 4LYHA 1DARA 1RE0A 3AGQA 2ZRKA 3BBPA 3QG1A 1BIFA 5TDHA 3K0AB 1UKYA 2QM8A 4PZZA 1XX6A 3B1YA 1JR3A 3HR7A 1E2KA 1Z6AA 2F43A 2ZE6A 2ZEJA 1WQ1R 3C5HA 4YC7A 5DYGA 3MWKA 3NBFA 4MYHA 4UJ3A 4P4SB 1C4OA 3AM1A 4DDTA 2OG2A 3TQCA 2OEPA 2AK3A 1KAOA 1OKKD 1SXJB 2ODNA 3BB3A 2REOA 1W0KD 4RZXA 3W34A 2V3CC 4MGIR 1N5JA 2DR3A 1W1WA 1DG1G 2J87A 2IHYA 4P4TA 2X77A 1HH4A 3VX3A 4CVNA 3DO6A 4PR0A 3EG5A 4OJKA 1H8ED 1NVXQ 1VIYA 2OE2A 4JBXA 1XXHB 1KYIA 2HF8A 1NG9A 2RHDA 4TTQA 4KFSA 4AY2A 2BKEA 1G9XA 5HTKA 1QHIA 3DZ8A 3WYFA 1ZM4A 1NMXA 4JS0A 3OIUA 2VSXA 4IOLA 2OCPA 1E4YA 4QJ4A 3QI2A 1F2UA 1OFHA 1A2BA 4BFUA 2VSFA 4GOJA 1IXZA 2HXSA 4PAOA 4TYQA 1M1YE 2GBLA 2ZVPX 3OEEA 1CR0A 1NY6A 3GJ6A 1Z0IA 2NPFA 4R9UC 4L8GA 3VMFA 1IN6A 3QVVA 3K0SA 1DAKA 3EZFA 1G8HA 4O0MA 3QOFA 4O25A 2CK3A 3SBEA 4B2IA 2IYZA 1ZIPA 4Q1EA 4MKIA 1NVVQ 3BD9A 3QKRB 1ESMA 3VR3A 3KX2A 5SZIA 2AHOA 1NRJB 1P3JA 1AGPA 3ADDA 1T3HA 3GFPA 1DE0A 4JLAA 4BFWA 1JXMA 4M1TA 2X19A 2WHXA 2P6NA 2P6UA 1SXJC 3WHKA 4G5GA 2ZR9A 5AWFC 2QP3A 3ECCA 5KDLA 4BEBA 3L82B 2X2FA 2B8WA 1E1QD 3U3KA 1OB5A 1E9EA 2ZE5A 2DHRA 4CGZA 1EWRA 4LC0A 1E2NA 1IN8A 1RIFA 1YE8A 1NF3A 1ZM2A 3NEJA 2V4ZA 2ZRGA 3A37A 3RWOA 1LFDB 2QUZA 3T61A 2DCUA 5KYKA 4NYJR 3EC1A 3GJXC 2HLDD 1UBGA 3EW9A 3OIVA 3FHTA 4XVQA 2EFCB 2P6RA 1E69A 2MMCA 3OZXA 4JSYA 1VKJA 3CLVA 1NBME 3A1SA 4PQYA 4Q48A 4IDHA 1KO8A 3K0FB 3TUJC 2EW1A 4CT4B 1AQUA 1MKYA 1CRPA 2ZE8A 2WM9B 1G291 3IHLA 3TUIC 2ZRNA 3BH7A 2GXAA 4OJQA 2Q9CA 1LF5A 1J90A 1EXMA 1W36D 1Q1QA 1Z6YA 1AQYA 4HAVA 2HEIA 4E09A 1W4AA 2Q3HA 2ZRBA 2X1VA 1XEXB 3U44B 3X1XA 4KV9A 1G21E 1G6OA 4EFNA 4AKHA 2HYIC 2ZPTX 1PZNA 2YINC 3CPHA 3K09C 2C95A 4G1UC 2J7PD 2FFHA 5CYPA 3B2EA 3LV8A 5TARA 4AD8A 2XNDA 1NBMA 1KK1A 2RMKA 4MYTA 4FMCF 1DVRA 2R6CA 1ZRHA 1SXJE 2ZJBA 3QQ5A 1TEVA 4RD6A 4F92B 3EWAA 4R7ZA 1F3OA 4KJZA 4RSGA 1HY3A 4IDNA 3Q5EA 4M1OA 4ZV4A 2D2FA 3U7HB 2R6DA 2AK2A 2Q9BA 4JVSB 3GJ4A 1YZLA 2KSQA 2ZSAA 3FKQA 3SBDA 3C4JA 3VU9A 1YZKA 5B57C 4DSUA 521PA 3RSLA 1F6BA 4DWJA 3CR7A 4B47A 4RD3A 3FOZA 1E9FA 4NP6A 3UG7A 4XSHA 4I1SA 5FPTA 4I81A 1UAAA 2DBYA 3RS7A 2VBCA 3H2YA 2JGNA 5J40A 3AB3A 3BWDD 3VU9B 4CRWB 1N6OA 2D62A 5HKKA 5JJLA 4LJ8A 3SYLA 2V9PA 3KQUA 1E2FA 4Q7LA 1XRJA 4A2QA 1R0ZA 2ANBA 4LWZA 3B85A 5DGXA 4F91B 3AVQA 4I1VA 4IXNA 3REFA 1NVWQ 4C7OB 1G3MA 2GEVA 2BVNA 1Q1BA 1OFIA 3CB4A 2PEYA 3AVOA 4FMCB 4NCKA 4DIEA 1COWA 5EXTA 2FSIA 1OYWA 4M21A 1L2TA 4K81B 2CVFA 5EP4A 1K8RA 1UJ2A 1AS2A 3B9QA 4A2WA 4KI0A 1KY2A 4A0GA 1OXUA 3NH9A 4PZLA 4OI1A 4LHVA 2O8BA 2NO9A 1Q57A 5DISB 5C18A 3SYNA 1T3LA 2VYFA 4IFBA 1NN1A 3JZAA 4WXPA 3THYA 4CEHB 2GA8A 3AP1A 4EKDA 2FF7A 3I32A 2ZQ5A 4HDCA 1EWQA 3DM5A 2WJVA 1M34E 1ZCAA 4Q4AB 4QXAA 1XZPA 3PG5A 4E03A 2XOKD 2HF9A 3ZYCA 2B7BA 5L3VA 4TT3D 3FFAA 2XGJA 1M74A 1P7CA 4ZIRA 1XZQA 1G20E 2CHVA 3LY5A 3FE2A 4Q4JA 1P73A 4HLUA 1ZC4A 1U99A 1NSTA 4B3GA 4RFSA 3Q7QA 2LKDA 2ZSBA 1DADA 5FOWA 4LSGA 3W5JA 4ZKDA 2ZAMA 2JLUA 3CR8A 4QGFA 2VRWA 2GKSA 1J8MF 2IYXA 1FP7A 1X8LA 5AK0A 2ZRFA 3SQXA 1RW4A 2QRNA 4WA7A 1IAQA 3RDPA 2DWPA 5F3WB 2OFOA 5LD2C 4QBFA 1US8A 5KSZA 4AKGA 3VR1A 4Q1DA 2VHJA 3PJRA 4Y0AA 1XCPA 4QM6A 3U7FB 1N6IA 1Q12A 1OV4A 2W2TA 3BRWD 2QTHA 3A1VA 4MKFA 3U7GA 4NCHA 3DMNA 1FFHA 4PPFA 2NIPA 4PHHA 2PH1A 4NE2A 4LGMA 2D7DA 1LY1A 3TBKA 1FUUA 2XITA 5CB6A 1BO6A 4GP6A 1D6JA 3W3ZB 3CRQA 1N6HA 2IF0A 5TB5A 4RKFA 2RGEA 1J99A 3WYAA 4UXJA 1DOAA 1FNMA 2FA9A 4NDZA 4C2TA 2CHGA 5LPNA 1BH2A 3CWZA 4XH9B 4AYWA 4WOPA 2GCOA 3BGWA 4NYMQ 4EJSC 1GL7A 1NKTA 1RRCA 4QJ5A 3F3YA 421PA 1E9AA 1XJ0A 4LUCA 1Q1EA 4DVGA 5TVKA 3IILA 3QKSA 4YXWA 3U3MA 3X1WA 2WPDD 3VX4A 2C77A 4CYMA 4R71A 1GM5A 1UEJA 2KJQA 4NTZA 5BN4A 3QXJA 1Q22A 1SQ5A 1P75A 3ETLA 3IPYA 1NLZA 1YZNA 5BXQC 4A36A 1SVSA 4FCWA 4EQ6A 2AKAB 3DL0A 3CWQA 3L0SA 4NZYA 4HUQB 2OM2A 1GILA 2ZRDA 1M8PA 1ZP6A 1ZM3A 2Z6VA 3SFZA 5CM9C 1RZ3A 4H9GA 1BMFA 1AZSC 3VR6A 2BJWA 4QL3A 3RC8A 2JA1A 2IS2A 2XTZA 3VHXA 3WMGA 1HQCA 3L8YA 3CRRA 2IBMA 2RGNC 1TNDA 4B48A 4DLZA 1XTQA 221PA 3WNBA 4FXPA 3LLUA 5CK4A 5K8IA 5F98A 1W0JD 2RB4A 4WZAE 3QKRA 5JI3E 1N0VC 2J0UB 1KOFA 5CJPA 3AQ4A 2JIZD 1CR2A 4PPQA 5IT5A 3QXCA 1AJEA 4TMZA 4MRNA 3CX6A 1XCMA 3TSWA 4JKIA 4ARZA 2VO1A 1VYVA 4XTRA 3HP1A 3PCRB 5FFMA 4Q00A 3ADCA 3QF4B 2WJGA 3U7EB 1JJ7A 1ESNA 1IY0A 1VECA 4E5UA 1VMAA 3I62A 5GJCA 3L0IB 3VTKA 4DHEA 4G0NA 3GFOA 3R7WB 4Q03A 4JVNA 2HYDA 1KI8A 1Q20A 2ZJOA 3RABA 1CR4A 3WNCA 4C0HA 3RS2A 2VQSA 3B1VA 1EFRD 4Q9HA 4LK2A 4ARZB 2ZTSA 1PUJA 2ORVA 2QTFA 5FOXA 1HT2E 4IDPA 4ZDIA 3QJYA 3QPUA 5E7IA 2EQBA 1MO5A 3SQWA 3L0PA 4LJ4A 1D2EA 1XD2B 4LJAA 2WAYA 1OKKA 3OIYA 4ASUD 2IS1A 5EP3A 3VKWA 3I5XA 1W0KA 2O8CB 1Z0AA 1EG7A 2WPDA 1Z6TA 2EFDB 4GDFA 3QIAA 1KO1A 3NDPA 1U2RA 2J45A 1W4CA 4PQRA 3EPKA 2CJWA 2IEYA 2OLJA 2IWRA 1JI0A 3G0HA 2QE7A 2R6AA 1MO3A 1N25A 3AKCA 1G16A 4XWOA 3U44A 2PMDA 1W5TA 4R2HA 1P5ZB 2DFKB 4DRZA 1ZNZA 4TTRA 4L4UA 3ZVNA 1E2HA 2OCYC 4C0AC 1KDRA 2WKQA 2XJ4A 1D2NA 3HU3A 4MUBA 1E2JA 2SHKA 2WV9A 3H4MA 1I2MA 2IL1A 1R0YA 4I4LA 2PLRA 2QM7A 3LX8A 2OFXA 3ND9A 3P32A 4V0OA 2N42A 4MYUA 2WBLC 1MABB 3N5CA 1XB2A 3OEHA 4V0LA 4V0MA 1E79D 3CNNA 3P26A 2C5LA 2OAP1 4QNRA 5EXSA 3EZ9A 2GEDA 5H1YA 4AG6A 2OUKA 4BLPA 5JECA 3KUDA 4NH0A 2PLFA 2VIIA 3HYRA 3D6TB 3IIJA 2ZUDA 5LB4A 4DBLC 3CZQA 1R4AA 121PA 1QHYA 1KJYA 3TJZA 2JDIA 2YOFA 3UMRA 2DYKA 3Q9LA 3SHFA 4F93B 1US8B 1TQDA 1WMSA 1TUEA 3W6PA 4E22A 2ZROA 4ZDKA 3OIWA 3OAAD 3TMKA 1QRAA 2CLSA 5JSZB 2FWRA 4JMPA 4IVRA 4D0GA 3IUYA 3MWJA 5JI2E 4JLMA 1Z08A 5H68A 5K8UA 1TQ2A 3WYGA 1E1QA 1Z06A 5FPSA 4HAUA 1X8KA 2VL7A 5BN5A 1T3SA 3KKOA 4YMSA 1IY1A 2LKCA 3SZRA 5FOVA 1Z29A 4ASUA 4MRPA 4DSNA 1P2VA 5KO2A 2CLCX 2Q3FA 3BB4A 1JXOA 2ZSFA 3GEIA 5HCIA 2JLYA 1PUIA 1JB1A 1XXHE 1ZIOA 1XEFA 1W7AA 4LPSA 3THWB 2IYWA 3LVRE 2XZPA 1HE1C 2CEAA 1KSGA 1NMYA 2IUTA 1EFCA 4MQBA 5FTMA 2BBOA 2FNAA 4O2LA 3NBYC 2OV2A 1HE8B 5E7JA 4TLCA 3GLHE 3DMDA 3M0EA 2HCBA 3EZ7A 2P65A 2WAXA 5KPJA 3FDIA 4ZKEA 2EYQA 2O0KA 4KYIB 4PO9A 1E2LA 5CIQA 1G8PA 4HI0E 2J46A 3AVYA 2P5SA 2PBRA 3K9LA 1CEEA 5EJEA 1SKQA 3SI7A 2W83A 3GQBA 2FMXA 1N6KA 4D4LA 1OIWA 4AK9A 1L7VC 4LY6A 4B71A 3EAQA 2ONKA 5E7MA 2NPIA 5M04A 3IBYA 2REBA 3IO3A 4DLSA 3KJGA 5FL3A 2JJ8A 1IXRC 3RRNA 2XNDD 1NBMD 4LHWA 2O8BB 4IVQA 1E1RD 1MRNA 1EGAA 4G5SA 1CULC 3MAAC 2CDNA 3JZMA 2PZFA 2XTMA 1I2DA 1S1CA 2H8KA 4OHXA 5FOUA 2QORA 3FMFA 4Q66C 1KNXA 3IO5A 5IDVA 1OJLA 5GVRA 2GVZC 3JVVA 4XTCS 2OZEA 4LHZA 4C0BA 3CO5A 4PTLA 1OYYA 3ZJYA 1ZCBA 2ECKA 5AUPB 2AN9A 1DAEA 3U5ZB 2O52A 4URWR 4C3ZA 4RVCA 4RFVA 3TRFA 4QGAA 1X8JA 2GK6A 1JR3E 4NBSA 2HV8A 4A2PA 3NVAA 4ESHA 1XDBA 3CH4B 4C2UA 3VNUA 1VHLA 2A5JA 2YYZA 4E07A 2V1UA 4HATA 4PANA 2W6IA 2XSZD 2MSDB 4RFSB 3KQLA 2R6FA 4ESVA 1NJFA 2ODBA 2OXRA 4PSAA 1KTVA 1N0WA 2KBEA 1T9HA 1U0JA 2REXB 4PHGA 2UKDA 4XD7A 4M1KA 3TLXA 1FTSA 2QGNA 1SHKA 4BFXA 1Z0JA 2B92A 2AWOA 5EE0A 4BLOA 1GFIA 4LRWA 2Z4SA 2G3YA 1H65A 2A3RA 1G18A 1P9NA 4JVLA 4DZZA 1OSNA 4LPKA 3KXLA 4DLTA 3FKSD 3Q72A 4HZUA 4O3MA 1U0LA 3I3SR 5KSPA 4GL2A 1UKZA 1PLJA 4KSCA 2EFEB 3OFNA 2G77B 3UMFA 3I72A 1ZBDA 4PO1A 5JJIA 4GRAA 5B58C 5L3QB 1S9HA 4W5JA 3IQWA 3CZPA 4LJYA 2QT1A 2CXXA 2E87A 1N6RA 2FFQA 3ZS8A 2FPMA 5G3ZA 2OLKA 3BFVA 3O8CA 2FFBA 1VG8A 2F43B 2P0EA 2ZU0C 4MRSA 4PQFA 4LYJA 3N2IA 4D0NA 1YR7A 2Z43A 2FH5B 4DSTA 3SFVA 1QHNA 1CKEA 1YZUA 2QP9X 3L43A 3SEAA 3X1YA 1D2MA 1P9WA 2PZEA 4C0KA 1S9DA 2GNOA 4CEJB 4GZMA 4CEIA 1E0JA 3AF4A 1QHXA 2IYRA 1LVGA 2O8EA 4B44A 4C0SA 5EXPA 1ZM9A 1CBUA 4AI6A 2BEKA 2WJJA 3K9GA 4JT2A 4BLRA 2C9CA 2CLDX 2GEUA 3TH5A 3BXZA 3GLGB 4QHSA 1W36B 1EESA 1JPNA 4DEYA 4C0QC 1SVIA 3UKDA 4URVR 1GP2A 2IC5A 2ZUCA 2WSSD 5JWOA 1LS6A 3SU8A 3BERA 1U8YA 1U9IA 1KMQA 2IK8A 1DAGA 1N5IA 2ZUBA 3A6PC 1IHUA 2DWOA 4FD2A 2XX3A 5TMPA 4DLWA 2WWHA 4URUR 4HAYA 3B5JA 4B2PA 2HT1A 1NN0A 1MV5A 4XOIA 3QE0A 5HPYB 2IYQA 5FBWB 4RCZA 3THOA 2NO7A 1E4VA 2PT7A 5BYKA 3DZDA 3AVUA 3FKSA 4B35A 1Z2AA 4CZ2A 4BUJA 3SYKA 2EVWX 1A7JA 3I8XA 3PFIA 4IOMA 4P4UA 3WRYC 3Q3JB 2QG6A 4UNRA 3EPLA 1XJCA 2PCJA 4FWTA 3IGFA 2IYTA 5FTLA 2NGRA 3U4QA 5C4MA 1SVKA 3V9PA 5FBVB 4M8NE 3KFVA 2ZVQX 3LBNA 3MCAA 4U02A 2GVDC 4NCNA 1XD9A 4CW7A 3IEUA 2BBWA 5UKDA 1KI6A 1R0XA 2YWHA 3GJ5A 4HAZA 1XMIA 3FHCB 4YDHB 3DM9B 4NMMA 3R9IA 3RS4A 2D3WA 1VCIA 3TVDA 4OYHA 4UXHA 4X8MA 1UKEA 1DAIA 3NWJA 1LB1B 2AWNA 5JZVA 4K46A 2EYUA 1D5CA 3LX5A 4L9WA 3RVBA 1ODFA 2FJUA 4DT1B 4Z51A 2JLWA 3PUYA 1NN5A 2CCKA 3PR1A 1CJMA 1BMFD 1HTWA 3QBTA 1EK0A 2IUUA 4EPXA 1Q1ZA 3E70C 1GL9B 4ZDJA 5GJVC 3IQXA 4HZUB 1ZU5A 4NPHA 5EZ5A 1Z3IX 2MSCB 5DI3B 3HJNA 4LYAA 2AFHE 2WSSA 3VFDA 2BOVA 2YVUA 1F60A 4HDQB 2GJAA 3QKTA 4I1UA 1RYFA 5ANRB 4Z1MA 2GBLC 4DDUA 1ZD9A 3CF0A 3ZZ0A 4YMUA 1NLYA 1VCNA 4Q02A 3T35A 5SZJA 4PAMA 4GNKA 1G7RA 2QPAA 1KK0A 3TGPA 2ZRPA 4BLTA 2CK3D 3CONA 4XWAA 5JCPA 2EFGA 2ZETA 4PSKA 3U61B 2FZLA 3QVUA 5HE9A 3RS0A 2QT0A 2BIFA 5AR1A 3T1OA 2QMHA 1SZPA 1CJUC 2AL7A 2QA5A 5FOSA 4M1WA 1M2OB 5KSOA 3BORA 4L15A 4TWZA 2ZREA 3PUVA 2H1LA 4V0KA 1XPRA 4HEJA 5FBRB 1QVAA 3HWSA 3PIRA 2ODEA 4RCYA 2KBFA 1KI9A 3SJZA 4Q18A 1OPXA 1R6BX 1FP6A 3P20A 1W4BA 3IKJA 5KOYA 5FBQB 2ZI9A 3GEEA 4H1VA 3EXAA 1NN3A 4LC1A 4JLDA 5D3MB 3KKNA 4ABYA 1FOEB 4BZPA 3CF6R 3GLGE 3TAHA 3GEHA 3AGPA 4U7DA 4PZYA 2C78A 3UK6A 1DS6A 5F9HA 3C41J 3VNVA 2R44A 4M9QA 3UATA 1NG1A 3NH6A 4FCVA 1E9SA 2UZIR 2FE4A 5DHFA 2ZJAA 1ZMXA 2V55B 4BEJA 1VDZA 5FUYA 2V54A 4PC6A 3OF5A 3K09A 1GKUB 3GLFA 1WP9A 1ZUIA 2WJHA 4POAA 4HLCA 3UANA 1T4GA 3M6AA 3QXSA 4C0JA 2UVQA 4DDVA 1F2TA 1TPZA 1P9RA 1Z2CA 2ZJ8A 3AUYA 4L9SA 4KFUA 4Q7JB 2FN4A 2CNWD 2QI9C 1HURA 1UEIA 1CIPA 3LH5A 1T6NA 4F4JA 1S0UA 1RC8A 1WB9A 2OILA 3SOPA 4BFZA 3T34A 3ND8A 4TMVA 5JSZA 4UNPA 2GESA 1FX0B 4PHTA 1QHSA 4X8HA 2XZOA 3LFUA 4EFLA 4JLBA 3LW7A 3OE7D 4PC3A 5FI0B 1GNQA 2YWEA 2GXQA 2J7PA 3LRPA 5GADl 1A5TA 3K53A 4QGHA 5G3YA 5LDDC 3J81k 4IDOA 4UJ5A 4YONB 3ZDQA 4TLDA 2QMOA 3THYB 3QENA 1JR6A 5E95A 5J4KA 3DVLA 3SJCA 1E9CA 1FMLA 3TVTA 3RAPR 2KWIA 2QMUA 3ICQB 2RGAA 1LTQA 4LV5B 3ZZTA 2ZI4A 2QTVB 5EUQB 1E32A 1FQJA 3GLHB 4PO8A 2QBYB 1C1YA 2PL3A 4RZ2A 2FU5C 2HUPA 1XEXA 1GWNA 4C7OA 5AUNB 1FMJA 2H17A 4TL9A 2D4HA 3BOSA 5AJXA 1JEEA 1KY3A 1YKSA 3JVUA 2FDCA 5DN6A 2DY1A
chains in the Genus database with same CATH superfamily
1SKYB 2Q41A 4MIEA 4KR9A 2DFDA 3HVRA 2F62A 4MA4A 1NHWA 1XVTA 4IMPA 1GNTA 4NEQA 4OFZA 1X1QA 2DUWA 3J81A 2FKNA 4XIYA 3KBBA 4XXHA 2Q4BA 5J63A 2UYGA 2D1RA 3N8IA 2MSKA 2QVYX 4KH0A 4EB6A 4PF1A 2GUWA 2R85A 3ESDA 4J2HA 1L9KA 1UMKA 3ZGYA 4BLSA 2N1BA 3N5KA 3SF8B 3TQQA 4O8ZA 4CW7A 3H11A 4OLAA 3ZWAA 3RJZA 1ZEMA 1OFUA 1A97A 2PXCA 3I2KA 1T2FA 3LDUA 3PITA 4YQFA 2PS9A 1XVAA 4ZFNA 3JRXA 5JJKA 4EYSA 1TAUA 4CMGA 2PRYA 4FHEA 4ZO6A 3EA0A 1T8WA 3KR1A 5KMGA 5EXXA 4DILA 2WD8A 3DC7A 2YWGA 2R4TA 4P3YA 4F5ZA 2VXOA 1R9JA 1E6CA 3SBXA 1TQ6A 5F7OA 1RC1A 2ZIGA 5AO9A 3JYOA 1UBMS 2GTPA 3KTAB 4QDUA 3TZBA 1NVAA 5J2UA 4JROA 2B4QA 5HTOA 1A98A 3QHAA 3IOYA 4I4NA 1ZGJA 1UDXA 2YHAA 4IV8A 2OD2A 4G0QA 2J1LA 2QAIA 4Y9SA 5AM4A 4ZOQI 1RLJA 3D4BA 4OHKA 1VQ1A 2XOKA 3KOYA 1PI3A 1A7UA 4PCAA 1LQ2A 3MWEA 1QTNA 1X38A 5F9MA 2EIHA 2NWQA 3RKUA 1YRYE 3LHKA 1Z18A 1PHPA 1CUFA 4XPZA 5DRYA 1PD1A 1YU6A 4GHWA 1CZKA 4UE6A 5JATA 2YOHA 3D0QA 4QHTA 1P2TA 1G8SA 1ZWLA 2OFWA 1C3EA 1T91A 1J8QA 3DVAB 1M2HA 1O2DA 3WV4A 4WNAA 5JQGA 5DYNA 2QX4A 3OESA 1EBFA 5IJ9A 1O03A 1OIXA 2FWJA 1H1DA 1P4JA 1ZH0A 2QU7A 5LP6C 1YRQA 2G70A 3HYCA 2A33A 3SKYA 4EKIA 1ADJA 2IYAA 3IIKA 1IQ0A 4PRKA 3D59A 4DDMA 1QK3A 2BFDA 5AXDA 4TVOA 4IHQA 1WAMA 3ZBPA 2I22A 3CLTD 3KL4A 4ONEA 1UOQA 3BTUA 3GGCA 1N92A 9MHTA 2GJ9A 1RYHA 3VH1A 3RUDA 1BNCA 2WU0A 3F6CA 3MXTA 3UK0A 3EUFA 1KORA 4KQHA 5H9WA 3RTBA 2QQ5A 4H35A 4LTDA 2XQGA 2VNSA 4GDMA 1P7YA 3CLKA 1I33A 2XSZA 4FS3A 2CE2X 2G0NA 2ZBVA 4EG4A 2IBSA 4Q7KA 1KH2A 2RCNA 2GK7A 2OYRA 4HNVA 5A05A 1MG5A 3NHZA 4DMLA 4PPYA 1Y48E 2QW1A 5HBGA 2YVLA 4UU0A 2GHTA 2PX0A 2Q4EA 2PX6A 4HR7A 1RMTA 1TEXA 1AX9A 3DT6A 3TTYA 5BNZA 3LC0A 3JQEA 1JU3A 1SHTX 3NZEA 4B76A 2VPZA 5B1YA 4BNDB 2V8OA 1GPUA 3T1QA 3P9YA 1SVNA 4XUDA 3H2BA 1YRBA 2BJVA 4IIJA 4JXZA 2W6PA 3EZXA 3U6BA 1UJ6A 1YR6A 3NDBB 1KJWA 1O95D 1MEOA 2YHSA 2Z1NA 3MQFA 1IBRA 2ZDHA 5AVXA 2WK1A 4BPBA 4IBOA 4DCNA 3UXMA 2XUJA 1YQTA 4B6RA 3TXAA 1FL9A 3OTGA 5AQEA 1ZX1A 3R8XA 4ZT7A 3TSYA 3CRW1 3N0VA 3WP0A 7MDHA 1U0FA 1JBQA 4QQRA 1WU7A 4EIWA 1XZIA 2IU4A 3D8NA 5D87A 2RC5A 5DE3A 5LUAA 1AH2A 3LX4A 4FDLA 1CUXA 1XHFA 2HM7A 2A5GA 3EAFA 4FJ0A 2AFIE 2VP6A 1DI0A 4NONA 1ID8A 2MSLA 1F5NA 1NJ1A 2BMEA 1Z7BA 1ECCA 2Q9UA 2V7EA 3GFVA 4IF4A 5AHOA 3ORHA 4BGIA 5C8XA 1RRGA 2ZAOA 1M8FA 3EQ6A 3ZDRA 2W0SA 1O6FA 5DGTA 3RUPA 3NO4A 3O83A 3AY7A 2RGGA 2HGZA 1KMMA 3CRNA 3DE5X 5DI3A 2ZRMA 3WJAA 4MDEA 1EFUA 1UBHS 3HJUA 2O5CA 3TR5A 3PDJA 1WDTA 1ZNQO 1TYAE 2CBZA 2IUYA 2IIVA 2YJ6A 4WZBA 3TMAA 4OYLA 2PAFA 2ZI7A 3HXMA 1XTVA 2QEQA 3RODA 5C8VA 2AX4A 2HUNA 4NNPA 1K06A 4N47A 3KOMA 3NATA 4MW1A 3FTCA 4RHEA 2NUTB 1QQTA 3R24A 5KJFA 4L0MA 1RXUA 3D0RA 3TZ6A 1FYDA 1T0JB 2ZBGA 4ETMA 4F2HA 3TQHA 2B9EA 1II0A 1G6Q1 3DZJA 2ACKA 2HC9A 4HWGA 1W25A 2XJ9A 1NW6A 2WSMA 3MWLA 1D5WA 3T3IA 4NU0A 1SEVA 4B7AA 4W9NC 4EY7A 5LN1A 2JG3A 5D84A 3G6WA 3D2CA 4HDNB 3P9XA 3G0DA 4AKSA 2Z98A 3WGGA 3L7JA 2RHHA 1DWQA 3PNSA 5G1NA 3ZI7A 4ALMA 1IIRA 5L7WA 1W36C 4DV1B 1P8AA 2JBAA 2XGOA 4FI3C 3RC3A 5F1YA 1WKBA 3IOMA 4XVCA 2PMCA 3QBVA 3UF0A 3U09A 1ZI9A 4OKIA 2CHEA 1F8YA 1YL6A 3OUTA 5DYWA 1H9AA 4WFIA 5IC5A 2G4VA 2XQJA 2PGIA 5F1PA 3CPJB 4E2WA 1LD3A 1JH8A 1EFRA 5TSDA 2VQFB 4TLAA 4HNAB 5DTEA 1QV9A 1W44A 2QPLA 1UPTA 3BIXA 3RLFA 4JJZA 3FRJA 2AYZA 4MVJM 2FPSA 2QNRA 4KHZA 4TMWA 4AIRA 1H9BA 2QPOA 4WNCA 5B64A 1W5SA 1R0SA 2NSDA 4KI7A 3KQHA 2G1JA 5JSHA 5IG2A 3RV3A 4B3CA 2HLDA 3H4VA 1XF1A 4AX4A 2HNKA 2PO7A 5DIFA 1N2BA 5JG7A 1EDBA 4AZVA 3WNVA 4HB0A 1Z45A 4LX0A 4RY9A 4KQWA 1G17A 4XWTA 3L6BA 4LF5B 5CA1B 1VP3A 2E4UA 3DXYA 3OX1A 4WKOA 3ZTTA 3ZDZB 2OECA 4DY4A 1MB4A 4RE5A 3ZW8A 1KEKA 3MCZA 4BL5A 2FWBA 1N2CE 5FJIA 5JASA 1PGOA 1YIAA 2B0JA 2WYOA 1GHTA 1KP2A 1IZ8A 3MJHA 1Y7PA 3ES9A 3PWTA 3H6GA 1G6HA 3C5CA 1TO6A 1FPMA 4PVCA 5AI4A 2XODA 3UTDA 3W9SA 5CH3A 3M8KA 3KRTA 3KVVA 1KDZA 1HX7A 1G41A 2L0XA 1WVGA 1MC1A 3F98A 5TJ9A 1SCNE 2O3TA 1R8SA 1C3OA 3LCVB 4GS5A 4IXTA 4W8OA 1U81A 5U9CA 1IBCA 2D2VA 4KIUA 3MAJA 4GLLA 1LI4A 2TMDA 4HGYA 4MI9A 3IURA 4RGQA 1E0SA 3R9WA 4Q3OA 3OA0A 3PUZA 6Q21A 2B2CA 4I1OA 4OIFA 3EG9B 3I04M 4OUDB 2OAGA 5JH7B 4AURA 2L82A 3N0XA 3IDQA 2QRUA 4OJTA 2OFFA 5BPHA 1XDUA 4KXVA 2WJIA 4CDRA 1FRFS 1W1IA 1S5PA 4JSTA 2ONJA 3I4LA 1KE1A 4X20A 1KK2A 2Z83A 1PFWA 5KYWB 4MDYA 1Y5MA 1ULUA 3N05A 4MV5A 4BNMA 5G4LA 1IZ9A 1CJTC 1LW6E 2X6RA 1SRQA 3ZLTA 4GD3Q 1TZCA 1R50A 1BS1A 1IB0A 1ZLYA 1P72A 1A2KC 2XMCA 4RVHA 1C9NA 3MCTA 4N5LA 2BHSA 1W46A 1CP2A 4O5OA 3URMA 3BMCB 2GERA 3VSEA 2QR2A 4DYDA 1SPBS 1E7SA 1ZW6A 2VHYA 2I1VB 4JLVA 4H1TA 4LHSA 2XRFA 2CVHA 1SZJG 1RQGA 3ZXSA 1SELA 1VKHA 4P32A 3QHQA 4QHYA 2NZWA 2Z8ZA 3ICCA 5T4BA 3TM5A 3ZW7A 5HEKA 5DNAA 2XAUA 2YZ2A 5A06A 5AKYA 2P40A 1DFGA 3NHPA 2L2QA 4KQGA 4QGGA 3BJMA 1N7GA 4KN6A 4U6SA 4LF4B 5IAOA 4RJKA 1ORIA 3ROQA 5L51A 1YCHA 2QTVA 2P5YA 3GXBA 1PJ2A 2IEZA 2VT6A 4IUDS 2Y1XA 4P3KA 5JD3A 1RWWA 1QIKA 3NBMA 3TZCA 2AMYA 3H9GA 4OA8A 1COWD 2J3KA 2CVZA 4HWPA 4C3UA 3PSHA 1C8KA 3H5TA 3U31A 5T4EA 5DASA 2JVIA 4QUBA 1U7XA 1P2SA 2Z3WA 2PZBA 5A04A 4GBJA 1NVKA 2WIBA 5FUVA 2PRKA 3WG9A 1U8UA 1QIIA 4LCEA 1JDZA 2ZBPA 4NVRA 5T3YA 1CFJA 3V97A 5IZCA 3KYDB 5ECDA 7ABPA 1L3CA 1MAHA 1TA9A 2V03A 4M9CA 1N8NA 3PFBA 4RY8A 3Q8XB 2I1LA 3IKVA 4F4HA 2VXBA 1GPKA 1H4VB 3ILVA 3EGVA 2GS9A 3NBKA 3UWKA 3GLIE 1SKMA 2I29A 3U39A 4KAXA 1U2EA 4EY8A 4EBBA 1KFBB 3WGVA 4U4AA 2QTZA 3LNCA 5GJWC 2A78A 3KB8A 4C2BA 1BXGB 3ZIUA 1XP8A 3QVTA 4PONA 3H2GA 2WV7A 4W1QA 1HNXB 4QTUB 1Z12A 1I0ZA 3FGNA 4B6OA 2FZWA 2WM8A 2DFVA 4GU5A 5TQ2A 5B4UA 2UYCA 3OEWA 1Q21A 3HEBA 4ZJPA 1B1CA 1ZIDA 3Q10A 4X84A 4CKZA 2NZ2A 2WTUA 1GPYA 1UBUS 3WWZA 1O6CA 4KIFA 5JS2A 4BV9A 4EUNA 2CNDA 2M1XA 3A58B 1AKWA 3VHLB 1EMDA 4YAUA 2QQ0A 3OCXA 1ZQ1A 1JLHA 2GN8A 4JASB 4CMBA 2QRMA 5B1DA 3DEFA 4R8KA 4II2A 1RQ7A 4ENQA 1J0DA 2QM0A 2AR0A 3A2MA 5DHQA 2Z6AA 1E2UA 1PQPA 4GZ3A 2RCYA 2P1RA 5BYJA 2P2LA 3K2EA 4UUMA 4CF3A 3DFZA 3WXMA 2IH2A 3M4YA 3CNLA 2GWHA 4CE6A 1QFXA 2C03A 3PRHA 1VJ5A 4R84A 3GQBB 4O2AA 3ZY2A 1OLUB 4R5MA 4PXYA 2QRZA 1JSZA 1XMXA 1PGPA 2CWDA 3OTHA 2FUEA 1LLQA 1AM4D 4JB3A 4KYTA 5K0TA 3PFNA 5JISA 1TL7C 2HRZA 2HU8A 2MSEB 4EG0A 5BN1A 3ESBA 5IJAA 4C78A 4JLPA 2JJYA 2F1IA 3RYIB 1TAHA 2HDWA 2OD9A 2I4LA 2OOKA 1GU1A 1GQSA 3PD1A 5F4BA 1OASA 2PKEA 1NMEA 3LO5A 3EMVA 3N8HA 3NDJA 3PC3A 4LYFA 2OYCA 4YK7A 5CA1A 1DQNA 3BWXA 3QKSB 4EFKA 4ILEA 5CPBA 2X9NA 3FVWA 1E2MA 2Y2VA 3BHIA 1G5RA 2X8AA 4P33A 3SQOA 3TOZA 1M34B 1V16A 1ENPA 3IV6A 4TYPA 4B4DA 1F0PA 4GKVA 2XVXA 1TC1A 5SICE 2QTCA 4UVEA 5C52B 3HABA 1W2HA 4UM5A 1L5QA 3NWOA 4AJKA 4YCMA 1TZ2A 4TN5A 2PHZA 4P7GA 3IRUA 1NXSA 4DDKA 2R68A 4Q48A 2OHFA 4V38A 2EFHB 1AO3A 2IW1A 2XZTA 4NHOA 5AJWA 3VQTA 1E4OA 1V4NA 2I8LA 4CV3A 5DI9A 4YY3B 1JKIA 4ID3A 1OQAA 1DWUA 3W8NA 5A0VA 1JILA 2XEXA 4HB3A 2P8SA 2PMEA 5AT1A 4MAFA 4GMDA 3QKWA 2F2TA 1L6RA 1OMOA 3FSRA 2B9VA 3M4NA 5CDFA 2XGSA 5JWRA 3A3OA 1RZRA 4CF7A 2HDNB 1H94A 2GA9A 2F64A 2O19A 2R00A 1E7WA 5K99A 2J5KA 2Y1WA 1DP4A 3EZ2A 1RBYA 1Z36A 1P0IA 4Z4EA 2B1IA 2GJSA 2LUOA 3OZEA 2VZ0A 4G1EB 4Q9DA 2FLWA 3FOWA 1DCFA 5TV2A 4KR3A 4MWGA 5FYQA 2XKKA 2CLOB 5JXGA 2TS1A 4Q1FA 1D09A 3K73O 4WLNA 1C9JA 5HX7A 3A1NA 4MV7A 3VV3A 3CM0A 3LLMA 2ERXA 3ZY4A 5L40A 2F8TA 3D4LA 4OHPA 4J0CA 1TQ4A 4UREA 5C5EA 1DAHA 1N2IA 1U8AA 1YB5A 1BMDA 2H0AA 5LZ5A 1UKBA 4OXRA 4EA8A 4EL5A 1Q84A 1JEOA 2QAGA 5TXGA 4JNCA 4ZVKA 3ZV3A 3LXXA 3BCSA 3KLBA 3FCUB 3P96A 4JIMA 4ZN6A 1U3UA 1KARA 1JEQA 1TIKA 2WRZA 4X24A 1E3DA 2FE1A 4MDHA 4JU9A 1SHZA 2NO4A 2X23A 4MKXA 3B6EA 3FJOA 3KXIA 3ZHUA 3VBCA 1F8UA 5MF6A 5KCMA 4Q1VA 1U7UA 2D0OB 1HZJA 2B1JA 2YC2C 1A96A 2BZGA 4X94A 4BZXA 2PKQP 3AETA 4OH1A 1L4LA 3H87A 4LIPD 5DTRA 2IWHA 4KO4S 3ZE1B 4AUNA 3T1TA 2W42A 5A5VA 5F2OA 4Z53A 4LZJA 2FZGA 5GWXA 1DAMA 3FPHA 3IPXA 4UTVA 3BF7A 4HV4A 3KFLA 2INGX 3KC2A 1Z38A 4UOZA 2VDMB 4R4JA 3B6KA 2FKAA 2OHOA 1JE0A 3JVDA 3LHDA 1M8GA 1VG1A 1R5OA 1Z2OX 4GYWA 2OZLB 4ZT5A 4Z0NA 4IJUA 2J41A 5LZ2A 5JYEA 1ZC3A 2DWUA 4S1NA 1PKXA 1V3TA 2DPGA 3GZTB 4HH3C 1BFKA 4K9KA 3CA8A 4Z99A 5E2AA 1RLTA 1YBAA 3BDIA 2WDZA 3MF4A 5E6RA 2FWMX 5KYVA 4R1PA 4PQEA 2EX0A 3EDQA 1VLJA 1O95C 1I4TD 3U5TA 6NULA 4DRXA 1A9TA 4FC7A 4O2BB 3T1VA 2PX4A 5BQPA 1UP4A 4MCAA 4ALNA 2I03A 4KK4A 5FNVB 2QZ9A 5TPWB 2YBDA 4NCJA 4QUAA 2CV0A 1M0EA 4LRTB 1TYDE 3DWEX 1EP9A 3G2MA 1YHZA 2NVUA 3VI3B 2QSZA 3I8OA 2HJGA 3H2KA 4LHEA 3LSTA 2WKWA 5TGDA 2LBPA 1XDWA 1T29A 4LMRA 5L3RA 2NZ8A 3WIVA 3FPFA 2B30A 3GN2A 3NHWA 3FLMA 4YRDA 5HHTA 3I9LA 3U16A 2Q4TA 2ZTHA 4H0CA 1W8DA 4Q4LA 3PFWO 3S1SA 5EHQA 2E89A 1NUHA 5D5QA 1JXAA 2ODWA 5EMNA 1IEWA 4ZAXA 5DLQC 1G55A 4WNIA 1PJBA 4IJKA 3QVJA 2H2FA 3V46A 1C30A 4I55A 2YH2A 4P98A 2GOYA 4YRFA 2YIMA 5H16A 2GHIA 4AZWA 4RK7A 5DNEA 2H2AA 4YBZA 2J59A 1R8YA 3NAGA 1MT0A 4RQTA 1J2YA 3G1WA 4KW7A 2IX9A 4KQ9A 4GLJA 3WV5A 3ZVLA 2X7HA 3KKMA 2D0PB 2F1OA 2PUHA 4CT5A 5CD9A 2ZZMA 4Q4HB 5FLYA 3NU1A 3F0TA 1UM8A 3C7TA 1YRAA 3WRVA 4B73A 1KI7A 1YCGA 1UMDB 2YMQA 5LBUA 2VAPA 3F9CA 2I6UA 5BR7A 3IUMA 4EDFA 1HA3A 3MWDA 5CLLA 1WVMA 3NTRA 4K6FA 3G7SA 3MJCA 3HVIA 2H9YA 3QSGA 3DOFA 3KTOA 2FR8A 3R0QA 2GUGA 4ND2A 5A1JA 3D7MA 4KQ2A 2A9QA 1JFFA 4IFTA 2YJ4A 2HB6A 5L4SA 2O8EB 3OI7A 2ORWA 5EHGA 5K0BA 3IVMA 4FE4A 5TS3A 2VDRB 3JQCA 2COEA 2HK9A 3U37A 2YV4A 1BC5A 4E11A 1XFAA 1E89A 5G0UA 1NXWA 4MWZA 3LPMA 1P74A 4DR1B 1IM2A 4NZNA 4ZPXA 1DKLA 1U04A 4KDFA 1XTKA 4U8HA 4FCCA 2VAWA 3G88A 2I2BA 3CTPA 1XEWY 1L4GA 4BNLA 2FPLA 1IUOA 2H1SA 1MIOB 1EK1A 2NSJA 4M98A 3VISA 1KO7A 1M2OA 1Y8RB 2W48A 4ARSA 1S8NA 3BF8A 2IHTA 3O8RA 5FPQA 1XT6A 2AI1A 1BS2A 3KLMX 4G86A 3RARA 4TS1A 3HC7A 2HX1A 4Q9JA 3EE6A 4J6EA 2PH3A 4FP9A 4YAEA 1ZNXA 1JJVA 4OVKA 3V4RA 1O6BA 1U5AA 1S6YA 2EJCA 3DUFA 4HVCA 1MMFB 1VP9A 3ZNPA 5AM0A 5C7OO 1A9XA 1RTKA 1XYYA 4OGLA 1CX9B 3K6RA 4D4IA 3QUTA 1GSIA 3FOCA 3VJRA 4Q19A 2GXUA 4J1NA 1KH3A 1E5QA 1YVUA 3IMKA 4XIJA 3A7EA 4GZ6A 4I9UA 3ROEA 3UCEA 1KSFX 4A92A 1Q0ZA 1ZRMA 3K7EA 3W6ZA 4BB9A 2C9YA 4M7PA 3MT9A 5LU8A 3CZ4A 2RONA 4ARVA 2I62A 2JCYA 4F11A 3RADC 2GCPA 2F3PA 5FPYA 5I9SA 4X92A 1QRUA 1DJMA 4NECA 4EB3A 4GVXA 1KI3A 4HT3B 4MVJF 1YD7A 3M5DA 4UCWA 4ZYXA 2O0LA 4Z1OA 2EATA 2R3SA 2R6ZA 3DMTA 2XD4A 4MGZR 5E3HA 4WZBE 3JPYA 1GQYA 4YUAA 3QG5A 2ZRCA 3PIIA 2YWRA 4HS4A 1Y9JA 4WE3A 1JAIA 3RFCA 1V6SA 1KL7A 5LJIA 1C0LA 1SZDA 1SVOA 1FF9A 1XRSB 2DLNA 4GF5A 4C7XA 1WXFA 3N8NA 4BMCA 3HY3A 1P5RA 1ULHA 1SUDA 4FUTA 5FX2A 3BIFA 3MRSA 1TRKA 2F1HA 1FUKA 4C1NA 4NYIR 1P8JA 1A77A 3DL7A 4RLQA 4WH0A 4JHXA 3JQRA 1H93A 1SY7A 4ZT3A 3RR2A 2VYND 3PRJA 4G01B 3LOPA 3LNTA 4DSZA 2LCFA 3FM9A 1L1FA 4RTRA 3D9QX 4M8SA 3T15A 1Y63A 1DQYA 1KO4A 3FUCA 3TVYA 3CKKA 4BJ3A 1X0VA 2ZE7A 2DR2A 2QRJA 1UZUA 3T95A 3RK4A 4EGAA 2VHZA 3G5MA 4QNNA 3ONVA 4G9GA 2BFCA 3L9WA 1DJQA 5B4VA 1D8TA 4I5IA 4EOGA 4EJ2A 3ANLA 4QEZA 2XUOA 3N9IA 2DM6A 3Q2KA 4OAPA 4PBRA 2CNLA 5BRJA 4PYMA 3UHJA 1OR8A 1SU7A 2BGMA 4NHEA 5I9BA 5JNUA 2ZUEA 3MS7A 3SS8A 3S2FA 4AVYA 3QX7A 3W6NA 4C5CA 2HMYB 1EZ1A 3ZQ6A 3L05A 3OE4A 4PV7A 5CIWA 3NTQA 4YRBA 2OENG 5JNVA 2ZJZA 3OF3A 5HJ7A 3VR4H 4HX5A 4JBWA 4NBVA 2WUFA 1ADCA 3INTA 2EKQA 2FOLA 3CCBA 3WOHA 2WPNA 3Q7PA 4NKRA 5FUXA 3UUFA 4RTLA 5JCOC 4DA6A 3TR0A 2B4AA 3BS4A 2FUNB 1VJRA 3F6RA 5H81A 5EQJB 5JAHA 1X42A 2IDZA 3H6KA 4TLEA 1ODSA 5I7AA 4YT4A 1RI4A 4J3NA 2JL1A 2XH8A 3LDHA 5C1PA 5TQ2B 5LZ7A 3TSWA 1A8SA 3V6LA 3ROPA 1VPTA 2HXYA 1FTYA 1XU4A 3U2QA 3V4LA 1PFVA 5HYVA 2JGMA 3L77A 1URPA 3PGMA 2R1TA 4YECA 3KJEA 4B82A 2BZSA 2QD2A 1HDCA 5ALMA 4N6NA 4L95C 4IIJF 5KNLA 3UT0A 5HS6A 4R0NA 3R9KA 3PC4A 4BX0A 1OILA 2WHRA 2OK8A 4F9FA 1NDHA 4YXWD 4ZMSA 3MN1A 5ESDA 4B3MB 1WZUA 2R84A 4BVEA 2Q8NA 1FXWA 1LU9A 3Q88A 4HDMA 3VVBA 2C61A 2C5EA 2B3TA 3LOQA 2F3SA 2Y1LA 3G2KA 1EJ2A 4M1YA 2GFHA 2WIJA 4LAFA 4MQFB 4B33A 3I42A 2XNHA 1LW7A 3SM9A 3C5WP 2XMZA 2BAGA 5KQMA 3T5TA 1H22A 1HRDA 2O20A 1E98A 1JDNA 3DCYA 1OXXK 5A5GA 5ITZB 1OFVA 3IV9A 3ZVNA 4EJ0A 5FWDA 1GARA 2VYVD 1UBRS 2B1QA 3MLAA 2ORYA 4J7UA 3ZC3A 2BGWA 3L9XA 1O94D 5F1OA 4QEKA 3WK5A 5L8VA 1Y6FA 1Y1QA 1TJYA 2IVFA 1M5UA 4P4SA 4N39A 4WERA 4MCHA 4EECA 5CXSA 3PDIB 2EDCA 3WDKA 1JG1A 3WSTA 4G25A 2PL1A 7REQB 3DP9A 2W2MA 4KUGA 2NMVA 1IRIA 5H4HA 1NMZA 1E7YA 1XELA 4YJHA 4HXGA 2CWWA 5I7RA 5BMOA 4HVLA 1P7WA 9GPBA 3EDCA 1W96A 2FRVA 1FUEA 4HTFB 5AOCA 1SRRA 4PFSA 3FKJA 2RFLA 1REQA 3L7CA 3HZOA 3KEOA 1CHDA 4OFBA 4A6DA 4D9IA 3OMWA 1X3SA 3KELA 1LLFA 2CD9A 1ETUA 3PT9A 1RWKA 2J0VA 3FOEC 2J4DA 1BVRA 1L7BA 1QFYA 1Z0UA 2I2FA 4UAUA 1Z4MA 2C29D 1K68A 2FFAA 2JJ1A 2SECE 3P0RA 3QI7A 2ZWPA 3NIBA 3LT5A 4PG6A 1L5KA 4FMDB 4F5DA 5JC1A 3FCYA 4AQYB 1NW7A 4E21A 3A05A 3KHTA 2VRBA 1ISHA 1U02A 2WHYA 2VK4A 4B43A 5AH0A 1ORTA 2IIPA 3WIBA 1ZAYA 3AB7A 1NGSA 2CDRA 5FA6A 4DB2A 3WR5A 1VM6A 4LZLA 2YFKA 3DNMA 3IAM1 2H9IA 1ZA2A 2AR9A 1NKSA 5JZ9A 5JS1A 1RABA 3WIDA 1TM4E 4BATA 3O0DA 5F51A 1QONA 3TLGB 4D4GA 3NEPX 1B23P 1MIHA 3PDCA 1EQUA 1CT9A 2GGSA 1GZVA 4RMIA 4FR2A 5GJBA 1W47A 3GDFA 5AUQA 4GOXA 4BHTA 2F7SA 2C07A 2F48A 5T4FA 1NW5A 2PA0A 2WF9A 3HGTA 1FP4B 3BXXA 1WXEA 3LDGA 2Q4RA 5D86A 2WWIA 4P92A 3B78A 4Q4CA 2Z3ZA 5CBPB 1K7XB 3HEMA 2HIGA 2D06A 3P2MA 4X00A 3ZDCA 3RJMA 1IN7A 1AQIA 4ZRMA 2RHJA 1QHEA 4BO3A 1KJJA 3C3WA 3L84A 1YDFA 1WE2A 1GRNA 5L45A 4J0QA 5K8TA 2QE6A 4OPMA 5DCWA 1KJNA 3RUAA 2ZLBA 4R6WA 3S8MA 4DSAA 4H7KA 5I5EA 2XB2A 1V45E 1SXJD 4TKZA 3IDZA 3BMNB 1OC2A 3RFUA 3R9XA 5IRCD 4PIMA 2HO5A 2H1FA 2QL5A 1HF3A 3ANTA 3BCHA 3WBJA 3G9UA 4KE6A 2AN1A 2WI8A 3HU2A 2QLFA 1XZDA 1Z0KA 3ENVA 1CY6A 2OBBA 1I30A 2WE7A 4R81A 4LFBB 1U1DA 4N76A 1FTNA 2NU6B 5LIRA 2ZFUA 3TD9A 2EJVA 4TKVA 1KEEB 3DAOA 4L4XA 4RA9A 1ECGA 4Z8YA 1C1DB 2NVWA 3FI0A 1DC8A 2ICAA 2IU3A 3DOUA 1FPQA 1MV8A 1N1MA 1SR8A 2PNJA 2GHRA 3CJTA 1T4CB 5DX8A 1D6NA 3QLUA 4I6GA 2A0YA 4QGBA 5DNDA 1R5JA 3YASA 1W75A 4CM4A 5IC4A 3UXHA 4HEHA 1DTWB 1ZH4A 4PC1A 5A4IS 3P5SA 3C85A 1QQAA 2P3OA 2QSJA 1E2QA 3OJLA 1ONSA 1ZNYA 3SLRA 3MTBA 3OC6A 2HRDA 5LD2B 3N8DA 5DP2A 2XT0A 4H4DA 2CCJA 1Z63A 4IX9A 1VGRA 1VLVA 3UT5B 3LBIA 3SJ7A 3R3JA 2H4JA 4LHYA 2X2EA 4OHFA 3D4PA 2VPIA 4MRVA 4ND6A 3LTEA 4ZJYA 3CZCA 4K1XA 2YR0A 5K8VA 3DV9A 4FKZA 4M1SA 4CKBA 4DG8A 2PVSA 5AXBA 5AW5A 2ZYUX 4YNBA 1QP0A 3FBWA 5JCXA 2GAFA 2ZJYA 3EA5A 2ASEA 4CHTA 3I2JA 1DBVO 1M7HA 3HCCA 3QEBZ 1ILWA 2XCQA 3WJ7A 1EFKA 1VSBA 2QD4A 1TF5A 3H3XA 3DBRB 2K7ZA 3I6ZA 4WW0A 4ETIA 4CIBA 2RI1A 1O1YA 2GF9A 1QVVA 3W4JA 5C5CA 1E6MA 1LTKA 4A73A 4TZ6A 1ZH2A 4IS2A 1J70A 3KBOA 4AJNA 4PW0A 1VE6A 2K7FA 4ZCMA 3PQEA 5K3AA 2PQ0A 1ZIXA 5DVZA 3UMVA 1TU4A 2JLBA 3TRDA 2Z6QA 1N9KA 3R23A 3KB1A 1DBQA 3G13A 4YQEA 5CXQA 3BFXA 2R4QA 2DVMA 1XJQA 4IYJA 1A9ZA 1N6NA 4Y6SA 2X7XA 2MSNA 2R1VA 5FULA 1H8HA 5C3MA 5AW0A 4WBNF 1M6HA 3FB4A 3ICWA 3I28A 1NRIA 1ADBA 1ISGA 4YAKA 1CZNA 1T6ZA 2JBHA 3QK7A 4ZP1A 4EJ6A 1QX4A 1O96A 1C3XA 3UA4A 3EVTA 3T5DA 4JBIA 4KSYA 1IONA 1XV5A 4LOIA 2H51A 1QQ5A 4V2IA 3B9RA 4MKRA 5HUJA 3OQNA 1U5BA 4FWIB 2GM4A 4R2KA 2ZSJA 3K70C 3K0BA 2YRFA 3L0BA 5JLJA 3PI7A 3W5AA 2J9XB 2EQ5A 4MO2A 2F6RA 2ZJ7A 2CNWA 4ZOLB 2HKIA 1ENOA 3COWA 1NUTA 5MN6A 3GP8A 5CXUA 1MJGM 3N28A 3UIEA 5A5FA 1D3AA 1NSYA 3IJPA 3UYKA 4RMGA 2CNNA 3E9DA 4GWKA 4MRAA 5M34A 4CIXA 2QN6A 3N3AC 3E4CA 3CF4G 4IPTA 1BGXT 3GFFA 1U0NA 1BQ3A 4E94A 3HLTA 4CMJA 4CCSA 2V7PA 2LRHA 1JPVA 2NO0A 3EA4A 1V6AA 4B3HA 2BFEA 4R1LA 2R8RA 2XA2A 2FWIA 4KMSA 4FYIA 3E2PA 3P9SA 4JI5B 5ALOA 4QOSA 1JHVA 4PRZA 4E5KA 4EAQA 3QXHA 3WMEA 3ZN2A 1LBIA 1W1UA 4GI3A 1JVNA 3S99A 3ZJ4A 1JSCA 1J2JA 3R5JA 3RK1A 3NBAA 3BL8A 4PZEA 4Q4DA 2JATA 3WTCA 4V24A 3RW9A 3MJRA 4O0LA 1QZXA 4CR8A 1U2GA 3GRAA 1I13A 1A50B 3ZI4A 1YJ5A 4MS3A 1LV7A 2GN1A 2QWXA 3PKIA 1FNBA 1EZZA 3OWHA 2IPMA 4KFRA 2GLXA 4G0YA 1PV4A 3WLQA 3MJDA 3ZVMA 5HJ5A 5DN6D 1XFDA 3BQNB 1Q1GA 1X77A 5BW6B 3ZTYA 5KDDA 1LPSA 3L7IA 5CDHA 1CUBA 1D7AA 1AZLA 1EXWA 2BM9A 5J4YA 4WA8A 1VRVA 5T67A 1A9OA 3I5AA 4RK1A 4CM1A 4EMUA 2EHJA 5IUKC 2N46A 4K6CA 1NUAA 3PENA 3ZWCA 1W6RA 2P9QA 2ROQA 2DHCA 4NG5A 2D6FA 1KYQA 3EWNA 1AN0A 1FDOA 2Z57A 2ZJ2A 3OZTA 2BRUA 4TGLA 3LXUX 4RZHA 5CA1F 1K27A 3NKFA 3L7DA 4JQOA 1X8XA 3A9SA 3CNOA 3SHWA 4EUEA 5B7QA 5MFPA 2OXCA 4E1VA 3MB8A 4FX2A 1CJVC 4OSPA 4AMYA 3LY8A 1H5UA 3K9HA 4PCUA 1RAEA 4R8LA 4XARA 4F3YA 1YR8A 4EL0A 3VH4A 1FYWA 3CBQA 2BGJA 1O4VA 3DR5A 2P4EA 3MOGA 4ZDWA 2A67A 4M2LA 1W9MA 4HDRA 4AKTA 2BP7A 3DNPA 4FSHA 2OT3B 4BVAA 2BH9A 3HRHA 1LS1A 1N6PA 2FLVA 3O90A 4L8WB 1UDWA 4V0QA 2BLLA 3MTJA 2QOEA 4FYJA 1VIAA 3FMPB 4D4KA 2I80A 3C8HA 1TFRA 1XCJA 2PH5A 2YIVX 3TW4A 4DJFC 2DH6A 1M0SA 3TK1A 3IQHX 1SPXA 1NR5A 4MMXB 4HDRB 3A4NA 2O8VA 4X8LA 9ATCA 2BHTA 1KXJA 4HQKA 3B2NA 1ZL0A 1ND6A 3NM5A 5H83A 3NNDA 4ZREA 1AU9A 4R9SA 4ETWA 5CLGA 2I4OA 2IPOA 1C30B 2FP3A 3RNLA 2NU9A 1UBFA 5EKUA 5JAUA 4DJEC 3HKDB 4U3JA 4GXTA 1IEXA 2I78A 4BNGA 1W88B 4LMBA 4TYNA 2RGCA 3MLBA 4OBBA 3GP3A 4YLGA 1A5AB 3G2LA 4TTAA 3GJ8A 4W6ZA 3VO2A 4CTMA 3CVWA 2H65A 3MUEA 5A4MS 3M34A 4BX3A 1FJ2A 1W2GA 1O8CA 1PR2A 2B8EA 2WKRA 3NR2A 3OE5A 4ACAA 4TMFA 1YV9A 2O8CA 2QYTA 4RKYA 1UDBA 5E8JA 2JZOA 2DEUA 1K5PA 5AVUA 3NDRA 3DHEA 2B2NA 3AWIA 7AT1A 4MB0A 1JDTA 2Y6UA 2JGIA 3KYCB 2ZSDA 3VU1A 4M53A 2O4UX 3ADPA 4WVLA 1ELOA 3OZAA 1ZKMA 4CMIB 1YIOA 3WQQA 3MINB 1SQSA 5C51B 1A9XB 1ZD3A 3L1UA 2FGJA 1G21A 2LVBA 2BBSA 1QPGA 3FTNA 2JAQA 5E3IA 1ORHA 3JQDA 2G8NA 3G2IA 4NCIA 2HLNA 3BTOA 5A4DA 4DOMA 2ZULA 3CH5A 4IZ6A 5FBZA 2EP7A 4QBGB 4LYHA 1DARA 3AGQA 4M0KA 3OQ1A 3BBPA 3VDQA 1TLLA 3NYQA 4XE5A 4CMEC 1XX6A 1KHHA 4M8IA 2ZEJA 1WQ1R 5EYPB 4YC7A 3C39A 1SUBA 2ETVA 4OX9B 4YQZA 2IQIA 3NBFA 1XRMA 4W1RA 3BA6A 3T3PB 1VLHA 1BGVA 1DKQA 2G5GX 3RRFA 3SHVA 2OG2A 3ORFA 3SLKA 3AM1A 2AK3A 3OKPA 1RWXA 1SXJB 2REOA 2DC1A 5HF8A 3AC0A 4JP8A 2HIAA 3RFVA 3OE1A 4REQA 5CGZA 2J87A 5KTNA 4PG5A 4ZOLA 1M1NA 4HEA6 1GNLA 1WMDA 4QWMA 1USKA 3CE9A 1UANA 3LECA 1X7ZB 1T6BY 3Q9SA 4PR0A 2PLAA 4UEQA 4WESA 1QIFA 3E0QA 4OJKA 4ZOEA 3W7VA 4F4FA 4J8PA 4LJSA 4ND1A 2YVQA 2VJBA 2HF8A 3N87A 3IESA 3V1MA 5A6SB 4TTQA 2P2YA 5AP9A 4AY2A 3PQFA 4GBED 1T4MA 2P2DA 5HTKA 5I7WA 2J8ZA 3H5LA 3HN7A 3WYFA 1JYSA 1B41A 3M6LA 5E6UB 4WLOA 1UIMA 2FCRA 3S2UA 1E4YA 3P0FA 1BS9A 1I24A 2ODAA 2ZWMA 4GMGA 1A04A 5AI0A 4R01A 5DLDA 4BFUA 1Y4ZA 1Z39A 4JUFA 2VSFA 5JLAA 5AW4A 4MNTA 3ILSA<