2ZPTX

Crystal structure of mouse sulfotransferase sult1d1 complex with pap
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-ester sulfotransferase
publication title Crystal structure of mSULT1D1, a mouse catecholamine sulfotransferase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 107
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zptX00
4V02A 1A4RA 2GCPA 4RFVA 5EE5B 1FQJA 1RRGA 1X1RA 1R0XA 2C99A 2HYIC 4JVNA 3PUVA 1ZNZA 3TR0A 1E69A 4LC1A 4Q4AB 4X8MA 2GCOA 4DLYA 5DYGA 3SN6A 2VHCA 4YC7A 2W6JD 1YZGA 3A1VA 3K09A 3FKSA 5FOWA 2F3TA 2LCFA 2J59A 1XZQA 1VG9B 4CRWB 2CJWB 1P62B 1NVWQ 2ZEJA 1CR1A 2AK2A 3EIQA 4NTZA 4F4IA 1OHHD 3LO5A 2XB4A 3T06B 4A8JC 2ZYUX 1AGPA 1K5GA 4V0OA 4NZYA 3ND8A 2P67A 3V9PA 5FBVB 3LX8A 2WMNB 5ELXA 3SBEA 4R71A 3A37A 1NLYA 2F9LA 4IJMA 5FBQB 3PCRB 3ASYA 1PZNA 2CLCX 1JR3E 3CNLA 3QKRA 4NCJA 1W46A 5DSZA 2A5DA 2XTMA 4RSGA 3BB3A 2GHIA 4DXAA 4QBGB 2MSEB 3WBKA 5B30A 4H1VA 5IHPA 3KXLA 1OYWA 3ZJYA 4F92B 3K9NA 2PCLA 1E4YA 3D3QA 2B92A 2EW1A 2RGNA 2ODEA 3EPJA 1J70A 1N6RA 1DADA 3L2OB 4NP6A 4GPTA 4C0KA 3ZD6A 3M0EA 2JCSA 4RCYA 2IK8A 2HXYA 4C0AC 4ESVA 3X1DA 4DCNA 4PHTA 2IUUA 3EARA 4U02A 3PXGA 1U0HC 1B23P 3HU1A 4MGKR 1VCIA 2AHOA 3CF2A 3K0EA 2FWRA 4QOSA 3QXHA 3A8TA 3T15A 1G291 2W83A 3CZQA 1YR9A 2V6IA 2W0MA 3SQWA 2DB3A 2BC9A 3HDTA 4D4MA 3IUYA 3SHWA 5G53C 1KI4A 4PX9A 3DOFA 3TSWA 2E87A 2ONKA 2D4HA 2WSSA 3TUJC 3O8CA 1P2SA 3BC1A 5KHOC 1N3BA 3UG7A 2ZXUA 5DI3A 1JR3D 2FFAA 1KAOA 3NWJA 2YWEA 4HAUA 3T61A 1GWNA 4B32A 4GL2A 3SE0A 3IBYA 2C9OA 2OXCA 3G82C 4NYJR 3AF0A 3AVOA 3IEUA 3O8DA 4LJ7A 4NMMA 4DZZA 1OKKA 4ZCMA 1HEIA 2ZE5A 1VCNA 3VR6A 1U9IC 2J7PD 3KUCA 2ZQ5A 2QSYA 1CJTC 1ZNWA 3ND9A 3CWZA 3I62A 4A0FA 2WIAA 2OLKA 1KKLA 4RCZA 2WPDA 2OILA 3NKVA 5FOUA 2Q21A 1XTSA 3DO6A 4OI0A 1SZPA 1S4QA 1FX0A 2X77A 4KBGA 1N6IA 4G3XA 1HA3A 3OFNA 4OYHA 2Z43A 1Z08A 2AK3A 1R8QA 1P6XA 3GJ5A 5FTKA 3CKLA 3B85A 4K46A 3TNFA 4N0DA 5KPJA 3AF4A 3BFKA 3GLHA 3R9XA 1XD2B 2F6RA 1H8ED 3OIUA 1NIJA 2GCNA 1R7RA 2XSZA 2AFHE 3HPQA 2ZRCA 3LBIA 4BUJA 2WWIA 1L2TA 2ZRDA 3AGQA 4M4SA 1GKUB 3ZH9B 3QXSA 1OYYA 1AKYA 3WRXC 4KCGA 4LPSA 2J0UB 2IYRA 5L3SB 2XOKD 1T0HB 1OE0A 5LBIA 1ZYUA 4DLWA 1NVXQ 2B21A 3ZD7A 1P60A 2XEXA 4TL8A 4NH0A 2CK3D 2KJQA 3Q3JB 2P6UA 4JYCA 1ETUA 4Q4LA 5CLLA 5KNDA 1NVVR 1ZINA 1DO0A 1DAIA 5FTMA 3TGPA 3R8FA 3IO5A 2WAXA 2ZSBA 2PBRA 1Z0AA 3HU3A 3TQCA 4CIDA 5JS8A 4W7SA 1RRFA 4OI4A 4TMTA 2XXAB 5GADl 1JI0A 4FMCB 1OFTA 3B1VA 4MKFA 1N25A 1HQYE 2GDJA 3C8UA 4OBEA 4OJKA 1NBMD 3AM1A 1ZIPA 2YNMA 2ZRKA 1KSGA 3O8BA 1IXSB 3MCAA 3DOEA 2HF8A 3CZPA 4P0TA 2P0EA 1ZJ6A 2PX0A 2VH5R 4Q02A 1JPJA 2LWIA 3CBQA 2OCPA 1WMSA 2BBTA 4ZCLA 3CX8A 1UKVY 1TL7C 3SYKA 1PVOA 2VHTA 3WYGA 5E3HA 3CM0A 2JLQA 1RJ9A 4D25A 4BLOA 2FE4A 3BGWA 3MWJA 1Z2CA 1Q1EA 3WNCA 2IW3A 5HTKA 1ESMA 4ASUD 1A1VA 1Z3IX 3THYA 1M7GA 3LH5A 4D6PA 6Q21A 5CK4A 1LB1B 4YXWD 1N6NA 3R9WA 1NIPA 3K0SA 2L0XA 4EFMA 2R6CA 4AIIA 2CNWD 2CL6X 3MMPA 1E2MA 1US8A 2ATVA 2BOVA 4AG6A 1IN4A 1II9A 2J3EA 1KO7A 1E0AA 4DSTA 2VP6A 3OEHA 5DE3A 3QXXA 4FI3C 4YMVA 5F9FA 1U94A 4PPGA 2IT1A 1A2KC 1EFTA 2YZ2A 2FEMA 1W5TA 1C9KA 3W5IA 1XCGB 3K0FA 3BBPA 1KJYA 5TB5A 2Q6TA 1MABA 4C0SA 2CDNA 2JIZD 4RZXA 5JSZA 4O25A 1E2IA 1P2UA 2QE7D 4PQRA 3KKOA 4EIWA 4EAQA 4XVUA 4UNQA 3QEOA 3QG5A 2JEOA 4U00A 3L82B 4IEIA 5GJWC 3TKLA 1G3RA 4HB2A 3CF0A 2JLSA 1OFUX 2JJ1D 1G7TA 2CLSA 4LBZA 1U8ZA 2BWJA 2OHFA 4I1VA 1XTKA 3E5HA 1E9DA 3TH5A 2BJWA 2GVDC 4LJ6A 1Z0KA 1E0KA 3EW9A 1R0YA 1Z07A 2FFQA 1P7CA 2ORWA 3RRMA 1E9SA 5DYIA 5CB8A 3BAFA 4PHHA 1II8B 2QQEA 4QC2A 1OH6A 2H17A 2A30A 1W36D 1KK0A 4DUGD 1KSFX 3EZ9A 3OIVA 2B8TA 4ZIRA 1QHIA 5GJVC 3GPLA 1U81A 1GM5A 1QHNA 2VLIA 1S3GA 1VG1A 4BASA 4LWZA 1E9BA 1OF1A 3GFPA 4KXFB 4X8LA 3NBFA 5B2ZA 2ZVQX 4L16A 2FSIA 2IYVA 2RGAA 2VP9A 1PLJA 2IXGA 1DAMA 4QBHA 2AR7A 2WJJA 4Q4HA 4NCIA 4Q48A 4MRSA 3K53A 1U90A 2OLJA 3RVBA 2NO1A 3U3JA 4BZPA 1XMJA 1W44A 2VSXA 1EFRD 1G20E 3B9QA 5FL3A 4KITB 1VHLA 4B3GA 3TAHA 4F4JA 1ZU4A 3CR7A 2I3BA 1F48A 3RABA 5C18A 1X86B 3B6EA 3A1SA 4WVFA 1LF5A 4MH0R 2DHRA 4UJ3A 3U6KA 3KTAB 4Z51A 4BRWA 5KOYA 3DPUA 2QZ4A 2GRJA 2OEPA 5HR5A 5K8UA 1ZNXA 4HLCA 1RVDA 2BVNA 5FPSA 1G16A 4I4LA 3K0AA 4A1FA 1XRJA 5CLQA 3N5CA 3ZIAD 3SS8A 2CJWA 2VHUA 3KL4A 3EASA 4DSOA 1GNPA 3GMTA 2R65A 4LHYA 1COWA 3TE6A 2RGEA 2P6RA 4LBWA 1N6OA 5KDLA 2IA5A 4TYQA 2Q3FA 1TF7A 1KNXA 2ODBA 1U98A 4Q1AA 1L8QA 4BLQA 5K8IA 2AX4A 1T0JB 3B78A 1NVVQ 4LYJA 4RD0A 5FUYA 5EJEA 3MJHA 2MSDB 2QI9C 3L8ZA 3C7KA 4DB2A 2FX3A 1XWIA 2FFHA 1Z06A 1QBKC 4JL6A 1NY6A 1UAAA 3CW2A 2OXRA 1W4BA 1OV4A 3EC2A 2FMXA 3RAPR 1UJ2A 5AR1A 4BFSA 4XSHA 3CRQA 3CPEA 5KU1A 3U4QA 1JEEA 4B76A 2PLRA 4EJSC 3K70C 2PT7A 3H0KA 3KQKA 3I1FA 1N6LA 1KTVA 3I73A 3MLEA 3GEEA 1GP2A 2IYUA 2RGGA 2R8RA 4LCBA 4WXPA 3KQHA 4IFEA 2ZE7A 4XTRA 1VIYA 2W2TA 4A15A 1XCMA 3SFZA 3FHCB 4B3CA 2Y8EA 4OK6A 4V0ME 1KY2A 1SXJC 1G7RA 2R44A 1OJLA 2BDTA 2CVHA 1E4VA 2QGZA 3T1VA 3QKRB 4URUR 2WJIA 4L15A 2ZS9A 4ILEA 1OIXA 3AGPA 4G0NA 2QN6A 4IOLA 3O8RA 1FPMA 3F0TA 3HJNA 1WE2A 1HT2E 4IVPA 1JQLB 5FOXA 4KVAA 4CW7A 5JCZA 5TMPA 3C16C 1MO6A 4TYPA 1XCPA 3OF5A 4WIAA 4A8JA 5E4FA 3GEIA 4N0EA 4B33A 2ASEA 4B47A 2HXSA 3U7EB 4PZYA 1XEFA 4FCVA 1Z28A 2O8DA 1VECA 3NBZC 1R5NA 3UMFA 2B7BA 5TXGA 3AVYA 3WP1B 4XH9B 4BLPA 4JT4A 5IT5A 4M9SA 2IXFA 1UKYA 5FTJA 3VR3A 1G4AE 2V7QA 3IQWA 4LJ9A 2FPKA 3FGNA 5FBRB 4FCTA 3AEZA 5SZHB 3WHLA 3LW7A 3GLHE 1II0A 5KPDA 3TIFA 2FFBA 3NEYA 3QIAA 2DFTA 1Z47A 3PENA 4GSYA 4E22A 3BJIC 3FHOA 4QGFA 2WWFA 4KBFA 5EP3A 4EDHA 2ZRHA 5DI3B 1BYUA 3RYTC 5EXPA 1J99A 3VNUA 2BBOA 1Z0DA 1O3YA 3TUZC 2IS6A 4NYIR 2OFXA 2FH5B 2IUSA 4PHGA 1W4AA 2HCJB 1YRAA 5EE9A 1ODFA 4EKDA 4QG7A 3ZS9A 2F43A 1TQDA 5JHHB 2J0QA 1NN0A 2OO7A 1YZNA 1NG9A 1ZM2A 2WPDD 5L3RA 2J0UA 3P26A 1VKJA 2ZI6A 3VR2A 4C30A 2WWWA 2P5TB 4PPFA 4EFNA 2J0VA 4LJAA 5M04A 1F3OA 5EXXA 1FX0B 5IK2A 4M1MA 4TYYA 2YJTD 2PMKA 2D3WA 1D2EA 1IN5A 2QA5A 4NCNA 2ONJA 3AVUA 1FQKA 3L0IB 3A4NA 1CP2A 1K6MA 3VR1A 2NO9A 2QQ0A 3WNBA 3IGFA 2H18A 3GLHB 2XSZD 2ZRNA 5CB6A 4RVCA 2GF0A 2O52A 2AFIE 2QTVB 4QBFA 2DWPA 1U9IA 2K5UA 3IPXA 3QXCA 4N1AA 2P5SA 4LV6A 3B60A 3UWOA 4TZ6A 2Q3MA 3AF1A 4V0LA 1T4GA 2IHYA 2VL7A 1CRQA 1N0WA 4QGHA 4AWXA 1VCOA 2RGBA 3TW8B 5DI9A 3QSYA 1SKQA 2P2LA 1E99A 2JDIA 2GXSA 1GL9B 4FMCF 2DWQA 3QBVA 3WHKA 1IY2A 4TLAA 5KSYA 2YHSA 4B2IA 4E03A 1KDTA 1W0JA 3KKQA 3HR8A 4WAUA 2JLXA 3EZ6A 2R6GA 4AY2A 5BN5A 1TEVA 2IYYA 2X1VA 4NBSA 2XJ4A 3TLXA 1LVGA 2RGCA 1NSFA 1ZBDA 1WCV1 3BB4A 1LV7A 3BH6A 2AD5A 3N2IA 2HT6A 1KMHA 3ONWA 4FIDA 3QNUA 4QJ4A 4JLBA 4GOXA 1AKEA 2ZRJA 3LBNA 2PH1A 4TL6A 3PR1A 3PUXA 2IWHA 2GXQA 4TMXA 5P21A 3W3ZB 4AURA 2ZAMA 1HT1E 4IDPA 4M1KA 4YQFA 1W7AA 1FNNA 1QHGA 1OLOA 1RJ9B 4PAMA 3SYLA 1Q12A 4HDOB 4MUBA 4QJ5A 5J4YA 5E7JA 4B3FX 1HE1C 1LW7A 4TYWA 5EUMA 2ZIAA 4LUCA 2NZ8A 3CX7A 4NDZA 5AK0A 3EA5A 2PCJA 3THYB 1TQ4A 4KLZA 3GFTA 1EFCA 1LF0A 2XX3A 4OJQA 2YOGA 3MWLA 3W90A 2EFGA 4KFUA 4KYUA 4UNNA 4L8GA 2FN4A 2GAAA 1US8B 5LB4A 1M34E 4C0BA 2ZI9A 3DVLA 4KYIB 3QVVA 2RHDA 4Q5IA 1E94E 3QEJA 4TL9A 2QENA 3DKPA 1JEDA 1ZW6A 3I32A 5EE0A 3K0FB 2AD1A 1MABB 1G3UA 5JSZB 3F3YA 4DCTA 1IONA 1AN0A 2P65A 1OT3A 3QQ5A 4O2LA 1GUAA 1YRBA 4R9UC 2IYZA 1KI6A 1WF3A 3LXXA 4JKIA 4OL0A 5EXTA 1MOZA 4QKQA 5FOVA 3KKNA 5HCIA 2VF8A 2C78A 2NZJA 2A9KA 4KU4A 4NCKA 1PV4A 5KDOA 4D0NA 1MO4A 5A0FA 4BFYA 5JEDA 1AQYA 3PITA 3X1ZA 1UFQA 1E9CA 4CGZA 2VRWA 4CEIA 1KOFA 1ZC4A 4LK2A 1Q0UA 3QPVA 2QGNA 3QKSA 4DLVA 4TMZA 4QGAA 1G6HA 4WXRA 2WWHA 2PZGA 1YZQA 5FTNA 3UK6A 1HUQA 2QUZA 2XGJA 3B1YA 4NL4H 5D3QA 1YE8A 2CE7A 3HU2A 3NHBA 3WMFA 2J0SA 2QEQA 3B2EA 3Q8XB 4NYIQ 1YR7A 4ZIRB 1CRPA 4MYTA 4PC3A 3U3MA 5TY0A 1NMZA 3U3RA 1IN7A 4LSGA 3PV0A 3Q7PA 3D7MA 2ECKA 4Q4HB 2ZR7A 2J1LA 3E70C 5HKKD 3PIRA 2PEZA 4M9ZA 1BKDR 1X6VA 1X3SA 5CIQA 4LBVA 3MJRA 5EZ6B 1Q1QA 2HV8A 2O8EA 4JVMA 4TN1A 2O8BA 3NH6A 3Q5EA 2NIPA 3EXAA 3Q72A 4JLKA 1P4SA 3MD0A 3WRYC 1MO3A 4Z54A 3SJAA 3BRWD 2GZAA 3J81k 1IY0A 2OUKA 2VBCA 4TL7A 1P9WA 3IBGA 4A92A 4CEJA 1T3LA 1NN3A 3KQLA 1E2KA 2GTPA 1XB2A 3K9HA 3REFA 3K0AB 4ZDJA 3QF4A 4L9WA 3VR4A 5J4HA 1R0ZA 2YWHA 2GILA 3VKGA 2WZQA 3B1XA 4GZMA 2X8AA 2R62A 5J5CA 1GDDA 2H1LA 3QI2A 3V00A 1VG8A 3U44B 4BWYA 1QHHB 3CO5A 4TLCA 3ZDQA 1XEXA 4QHSA 3GLIE 1Z0JA 2O5VA 5AJVB 2GNOA 5HE9A 5AUNB 5A4JA 5TVKA 1SKYE 4M22A 4TLEA 2KB0A 5EP4A 2ZJ8A 4BZXA 2ZS8A 3LLUA 4Q1FA 1ZIOA 1F2UA 4PR0A 1ZNYA 1CJKC 4JBYA 4QHTA 5TARA 2WM9B 1GZSA 1OIVA 1N2CE 1R10A 3FMOB 1MRSA 4LHXA 5KNBA 1VTKA 1ZMXA 4LJ4A 2YVUA 2YWGA 1M6NA 1Z6TA 2Q9CA 2BHRA 4DCUA 1NI3A 4URYR 2XZOA 3VKWA 1DAHA 3LXRA 5HE8A 3U4QB 1UDWA 2A7QA 4IDQA 3N2EA 1OXXK 3TSZA 1Y3AA 5IDVA 2XZLA 4CEHA 1GKIA 1S1MA 4LY6A 2WKRA 2EFEB 3OAAD 721PA 1E9EA 3CLVA 5BYKA 3OE7A 2XZPA 1IN8A 1NJFA 1D6JA 3FHTA 1DOAA 2HJGA 4HAYA 3A6PC 3SJZA 2D2FA 3GLIB 2BKUA 1W4RA 3EZ2A 3AVXA 1N0UA 4LYAA 2EFCB 1X8JA 1FP6A 121PA 5AUQA 1SKYB 3TAUA 2PZEA 1NRJB 1YZTA 2IUTA 2VF7A 3U6BA 4B2LA 2CCJA 2DPXA 4V0MA 3C5HA 4EJSA 3NEJA 1NMYA 2BMJA 1A7JA 2H57A 2J87A 3Q85A 2W6ID 1RPZA 3THXA 4TT3D 4A8JB 3SBDA 2QMHA 2OV2A 3QE0A 2X2FA 4DDWA 2H7VA 5KTYA 3EPLA 2IS2A 3FTQA 2O8DB 5F9HA 3DL0A 3L0OA 3QKTA 5JRZA 3U5ZB 5DGXA 1RYFA 1SXJA 2BM0A 3SOPA 4AKGA 1M7BA 4HB0A 2KE5A 3AB3A 1P2VA 4UXJA 2V7QD 4PPQA 5BQ5A 4Q1EA 3LNCA 4HDCA 4K81B 2ZRIA 3FMPB 1BIFA 1PJRA 3EX7C 4PC2A 4MRVA 2G0TA 5AJZA 1E2GA 1IXRC 5JWHA 4F7WA 1EK0A 3GLFA 4JLDA 1MT0A 3R20A 3GLGA 1U0JA 4TLDA 4JBWA 3PG5A 1KI3A 2ZREA 4QFMA 1SVOA 4WA7A 4RD2A 3WMEA 3D8BA 2C2HA 2OCYC 1PUIA 1W5SA 5J47A 2ZE6A 5J4LA 1KK2A 3OEED 1F60A 3SNHA 1DEKA 1G3QA 1ESNA 1JXOA 1ONBA 2IYXA 3CH4B 2JLRA 3T5DA 4GI7A 1HURA 2OFWA 2G3YA 2YKGA 3AKDA 1SVIA 3RRZA 4EPRA 2F43B 5KO2A 3NDBB 1CJVC 2AWNA 3CRVA 4WBSA 1JECA 1XP8A 4LRWA 3RC8A 2J5XA 5FOSA 2OAQ1 1B0UA 2BEJA 2ZJ2A 3P20A 2NMVA 1UF9A 1TF2A 4FMDF 2ZTSA 1DO2A 2FSHA 3KJIA 5AJYA 3ZLJA 4KODA 4ITRC 1XX6A 5LD2C 4RD6A 3NXSA 3TUIC 2CHQA 5CJPA 8OHMA 2KBFA 4LZZA 1E2PA 3BXZA 1DAKA 4C2UA 2EYQA 1FTSA 4NKRA 3UG6A 5E7MA 5FI1B 3B82A 4JLMA 4PO9A 5SZJA 3HR7A 2FA9A 3OIWA 4RFSA 1NL3A 2GVZC 1OPXA 4MA4A 1W2HA 2O0KA 4P4TA 1E1RA 1JPNA 2IXEA 3CRRA 2KSQA 4CF7A 1CR2A 1CR0A 521PA 2O8FA 4XWOA 4G5RA 3H2YA 1T91A 3ZQ6A 3W9YA 4NONA 3RRYA 3RRNA 1DG1G 1HY3A 2B6HA 3M1IA 4Q18A 5CYOA 3SFVA 4JLAA 3FMFA 1X8KA 5B64A 4C0JA 3QUSA 3WNDA 4GFDA 2ZI4A 1M7HA 3EZFA 3DMDA 4TWZA 1CLUA 3BH0A 2C5LA 4IEEA 1HTWA 1MKYA 1AZSC 1V5WA 5CIWA 5JWOA 2EU8A 4I81A 4D2IA 4A4DA 2J7KA 1KMHB 2H8KA 2R6FA 1KNQA 1WBBA 1UEIA 1EX7A 2BV3A 4DJTA 1A5TA 1HQCA 2FGKA 3T35A 1IQPA 2REBA 1DVRA 4G5OA 3IHLA 4AYXA 2OE2A 3ZZTA 4PO1A 4OHZA 4DRZA 5JECA 5KSZA 1CBUA 2GEDA 1W1WA 3HYRA 4GMXA 1W36C 3EPHA 5FPYA 2A5FA 1S9HA 1Z0IA 2JGNA 2ZYTX 3KXKA 3VNVA 1KAGA 2OFOA 3I8SA 1E79D 1RKBA 1G7SA 4QGGA 3UMSA 4LC0A 4AYWA 2PJRA 5FI0B 1KZ7B 2DBYA 3BD9A 3FFBA 4JSTA 4JZKA 4PFSA 1E2JA 5JJIA 5JWRA 1Q22A 1U2RA 2C98A 3EAQA 4WZAE 2IX3A 1I4LD 4IOJA 5BYJA 2B8WA 4KHZA 2GF9A 1KKMA 1NLZA 1R2QA 2N46A 1Q44A 4ACBA 2Z6VA 1T8UA 1U99A 2VHQA 3W34A 3LRPA 2AXNA 3UKDA 3MAAC 4BE7B 1CJMA 4LV5B 2O8CA 4IOMA 2MMGA 1E1QA 1W0KA 1KDRA 3FPAA 3W6NA 3ADDA 1Z6YA 2F7SA 2FF7A 4QXAA 4TTRA 2REOA 3W5JA 4TQ9A 5EE3A 1ZUHA 1KI6B 2NGRA 1JB1A 1I4TD 2FPMA 1O87A 5KSOA 2GZDA 4G5GA 1NG1A 3X1XA 2QMOA 2QORA 3FDIA 4IXNA 4B3BA 2DY1A 3FKQA 4BGDA 621PA 4BECA 4P3YA 3F8TA 5L3VA 3ADCA 3ZQJA 4CEIB 5AJWA 3U60B 3QKSB 3SQXA 1N6PA 4I1SA 3AVPA 1YZKA 3TW4A 4Q00A 2FDCA 1WBDA 4B6FA 1VMAA 2W0SA 4MKHA 4U5XA 1KK1A 3C41J 2JAQA 2W2VA 2CCKA 2NPFA 5HZKA 3VKHA 4O2RA 2Q0HA 4RD4A 2BIFA 2GJ8A 4HZIA 1ZUIA 4A6PA 3IILA 2XTZA 4CT5A 2ZI3A 5KUTA 1QVAA 3KFXA 4MGZR 5CJ2A 1S9DA 2Z0MA 4PXAA 5DH9A 3SI7A 2KWIA 4B35A 5JJLA 2P3SA 3AKCA 3HYTA 2ZYWX 3S1AA 5FBWB 2AKYA 3MG9A 1RYHA 4HLDA 3VX3A 3NBXX 4GZLA 2N1BA 1XNJA 2J45A 3U44A 5JI3E 1QHHA 4YMSA 1QDEA 1RIFA 4TTQA 3HWSA 1FOEB 2CE2X 5LB2A 4ON9A 2ANCA 2O8EB 2ZUCA 2O8BB 4NYMQ 2F55A 2A5JA 1YQTA 4HAVA 2UZ3A 1IM2A 1J90A 1GIAA 1ZCAA 2C95A 2VTKA 3VTKA 1XXHE 2W6JA 4KJZA 2DR3A 5FUVA 4LHZA 4IW3B 4CEJB 3FKSD 3RNLA 4HLUC 5AUPB 4C3ZA 3QF4B 3K8YA 4LJ8A 4PC7A 3NIBA 3E2IA 1E3MA 1R4AA 4DWJA 3LVQE 3QOFA 2ORVA 3AF2A 1IN6A 1YR6A 4PPNA 4GBMA 4DT1A 1RRCA 4Q9LA 5KSPA 2R9VA 4B71A 4HYYA 1XEXB 3EA0A 2N42A 2UVQA 1G5TA 3K9GA 3TBKA 4A6XA 4A82A 2JLZA 3W8NA 3WYAA 2VHJA 5GJBA 4X8OA 4S2EA 4AI6A 3AVQA 2GK6A 2XTNA 4JLNA 4KI0A 1P5ZB 3R7WA 4C0LA 1F2UB 1U8YA 4H9GA 4OHYA 4US0R 5BN3A 2HCBA 3GD7A 1I4DD 2QY9A 3GLIA 1Z83A 1KJWA 2AXPA 1QG4A 2QTHA 1VPLA 4YMWA 4ACAA 4JJKA 4TLBA 4FINA 4QRHA 2GBLC 2IL1A 2G88A 4LPKA 1G8YA 2R6DA 3IIMA 4TMVA 4JL8A 5C46F 1KIMA 4YDSA 1SXJE 2GXUA 1CU1A 4C2TA 4DC9A 1XXHB 1SHKA 2B7CA 5H70A 3C15C 3FE2A 5H8WA 3U7FB 1QVRA 2GXAA 4CEHB 1NN1A 2QT1A 3PUWA 5JFGA 2PL3A 2UZIR 2WV9A 3OE7D 3Q9LA 1TF5A 2DFLA 1KI9A 4Q66C 4MDFA 3GLFE 1G7CA 2BBWA 2ZETA 3QKUA 1M74A 4ABYA 3GLGE 4E09A 2WOJA 3KZ1E 1VCMA 2HLDA 4IVRA 3D31A 3THWA 3SYNA 4JSYA 4IKEA 3MUFA 2DYKA 1G64A 1CS4C 1FMJA 4E5UA 1XTIA 3EWSA 4H1UA 1GSIA 1TQ6A 1IHUA 1XEWX 2WSSD 3I8XA 5DN6A 1IOZA 4Q9IA 3K70D 2WWXA 1MV5A 4S35A 3E1SA 4EJSB 3K70B 1NMXA 4MITA 1RFLA 3MWKA 4PANA 3THXB 1GL6A 4BFUA 1TUEA 3JVUA 1TMKA 4XD7A 1QZXA 5G3YA 4D0LB 4WOPA 3EG5A 3L43A 4B75A 4Q7KA 1T5IA 2HJVA 1OFHA 2QBYA 1OKKD 5J4VA 4MYCA 2PZFA 4O3MA 4XWKA 2WKPA 2FG5A 2ZJBA 1A82A 3AQ4A 4OI1A 2QROA 1SXJB 4LYHA 5UKDA 4BEBA 1G8HA 1KI2A 4BLTA 1BO6A 4EFLA 1XPOA 3KQNA 1N6KA 4GP7A 1GAJA 2QRZA 1WB9A 1JQJC 4KAXA 2ZRPA 4ZDWA 4TQAA 1J8YF 2NO6A 5G41A 3G0HA 4DSUA 4QL3A 4ESHA 2ZR9A 3BFXA 2OBNA 2RMKA 3OFND 1E2FA 4A0HA 1E6CA 3GLFB 2CXXA 1FZQA 4QHYA 5FH9A 4LGMA 3GLGB 4B73A 5SZKB 1YVDA 1T3HA 4QM7A 2FU5C 3L8YA 4FMDB 5BWMA 4PC1A 4NCHA 3T1TA 1KO8A 4JLJA 5GJCA 3VHXA 1GITA 1N0VC 3EZ7A 3IHWA 4FW9A 5FOTA 1XMIA 4GRAA 1RZ3A 5A5GA 2ZRLA 2Z4SA 2XOKA 1OH7A 1XEWY 1DPFA 1CEEA 1NNEA 3U3KA 1GL7A 2FZ4A 2CEAA 1N6HA 2CK3A 2RHMA 2YOFA 1D5CA 1QG2A 1UPTA 3H1TA 1E32A 1OIWA 2EQBA 3EC1A 4Z8YA 4UNRA 1F6BA 3CR8A 3I4LA 4TQUS 4XTCS 5L3QA 3TJZA 3M4YA 3KFVA 3P4XA 2BM1A 2G1KA 3AP3A 3GJ4A 1P3JA 4KFRA 1FL9A 1NBMA 2Q9BA 4DDVA 2IEYA 4JL5A 1SVWA 2QP3A 4RFSB 2ZYVX 2VP0A 3BS4A 3VU9A 1E1RD 4HZUA 3EPKA 3P1JA 2CBZA 4OHXA 4XSGA 3B8HA 3CRMA 3VFDA 1K8RA 2OESA 1OXSC 1DE0A 3Q5DA 4XVQA 4HUQA 4RY2A 2ZE8A 3B7GA 4BZQA 4BFTA 2ZSFA 2O8FB 4PQYA 5JEEA 3DHWC 3DMNA 2A3RA 3SZRA 3LAWA 3FVQA 1AS2A 5JLJA 3BFVA 1W48A 4BQSA 3RS3A 4OKSA 1MR3F 2WMOB 4ASUA 5G3ZA 5JBQA 3MRSA 4DLSA 3KUDA 4P4UA 2I4IA 1W49A 2I1QA 1W2GA 1Z2AA 2J9RA 3JZAA 3RANA 3GFOA 4ERNA 2CNWA 1NJGA 1E9FA 1IAQA 1NVUQ 1ZAKA 3DEFA 4YMUA 3I61A 1OB5A 2XITA 4QNRA 3CB4A 2D74A 3ZS8A 3GJ0A 5FL7A 3WP0A 3OIYA 1C4OA 3OEHD 4MYUA 2ZRGA 3B5JA 3RS0A 3SC3A 2ZVPX 421PA 1UADA 4GDFA 2OCAA 1E98A 2VEDA 3UXMA 1VHTA 3GJXC 3RWMB 4GOJA 4HAZA 3VQTA 4URVR 3AP1A 3LD9A 4BLRA 1JR6A 4W5HA 4U7DA 4OHWA 4BFWA 4MGIR 4ZV4A 1OH5A 1GKYA 1YHNA 4BFVA 3U7HB 2CVFA 2VSFA 4A2PA 4DDTA 5B58C 2BMFA 1EFHA 4J0QA 4Q4JA 1EG7A 1ZRHA 1X1SA 3GJ3A 2FV8A 3A4LA 3WYFA 4ZDKA 4JIMA 2ZROA 2WSMA 1CKEA 1UBEA 1LY1A 4MKIA 2EYUA 4AKEA 4QM6A 4HB4A 4BFXA 2FZLA 2FSGA 3RS4A 2V6JA 1G3IA 4PSVA 3SR0A 2QRNA 3DZ8A 4Q47A 1NKSA 5CYPA 1S96A 1OXTA 2ZJAA 5H1YA 4DSNA 3P4YA 2O8CB 1IY1A 3LDAA 4BLSA 2IS1A 5LPNA 4WZ6A 1ZM3A 2EFDB 2H92A 4GOKA 2CCGA 1VYTA 3LQQA 3UWKA 4AYTA 1OFIA 4RZUA 4PC6A 2OAP1 1WDTA 4FMBB 2ZJ5A 4QNMA 3AKYA 1UBFA 3WMGA 1AS0A 2JLWA 1SVKA 4K8OA 1AK2A 1EFRA 2D2EA 3W6PA 4GT1A 1D9XA 5DIFA 2PEYA 4G5SA 3T1OA 1Q3HA 1D2MA 2BMEA 3KKMA 2J41A 5FPHA 5CITA 2ZI7A 2XNDA 3R9IA 1DS6A 2ZRMA 5EZ5A 5DHAA 1AGRA 1IJFA 4PHFA 1G41A 4I1OA 4YONB 3W6OA 2Z4RA 2G1JA 2C9YA 4PAOA 3P32A 3TQFA 1R6BX 4OQNA 4DHEA 1UDXA 4QJ3A 4D80A 1XJCA 4JLVA 2GAOA 5DO9A 3X1WA 3S1AB 1COWD 4LX0A 2XB2A 1T8TA 1Z0FA 3ETLA 3T34A 2KBEA 4PTLA 4JT2A 1GRRA 3AV0B 1KMQA 1L4UA 4XWAA 4IDNA 3TVDA 1XMVA 4DIEA 4C7OA 2ZSAA 3LA6A 1Z8FA 1GILA 3LX5A 4FD2A 2QP4A 5F3WB 3T12A 2GJKA 4JJZA 2R2AA 1G21E 2QU8A 3DM5A 4CYMA 2OT3B 4CZ2A 1J2JA 1MRNA 2OCBA 2ATXA 2XAUA 2BEKA 4BFZA 3Q7QA 5K8TA 3BH7A 4A9AA 4LOAA 1GOTA 2JATA 5KDDA 4A0GA 1KY3A 1Z5ZA 2LKDA 1SGWA 1LTQA 2QPAA 3QXJA 1Q1BA 2VP2A 1XXHA 4DT1B 3DZDA 2ZUDA 1G8GA 3I5YA 4IFBA 4HATA 4YLGA 4Q1CA 1BOFA 4C9BA 1QF9A 2CL7X 1ZUNB 2WJGA 4OQFA 1TQ2A 3BK7A 2H5EA 3A1UA 1XZPA 4V0NA 1EWQA 4MKGA 3R7WB 2IS4A 5C4GB 2JLYA 3G5UA 2JJ8A 4RZ3A 1IXZA 4HLUA 5EE1A 1R5OA 4UNPA 3W8RA 1OXVA 4F93B 2AKAB 1AZTA 1DTSA 1FFHA 2NQ2C 2VO1A 4IDHA 1FP7A 3EIHA 3BERA 4JKYA 5C2JB 2V8OA 5E7IA 2ORIA 1E2LA 2F1RA 2DCUA 4LBYA 1G4UR 1XD8A 2LKCA 3TVTA 4PO8A 3I3SR 4MYHA 1EWRA 4JS0A 2PMDA 2WWGA 5AWFC 2G77B 5SZIA 1N5LA 5FPTA 3BE4A 2QAGC 1YZLA 1ZP6A 1JALA 3K0CC 2V4ZA 1KK3A 1AIPA 3LLMA 2HLDD 4JLOA 5TV2A 4CDGA 1EESA 5DNYB 1KYIA 3OESA 3RC3A 5HPYB 4ZCIA 3THWB 2IF0A 2G0NA 2GESA 5DN6D 3O47A 2ZAOA 2GBLA 2EVWX 3H86A 4G1UC 1VYVA 3V4FA 1TUIA 1KO5A 3CRW1 5AJXA 2ZM5A 4B34A 5GVSA 1XTRA 3QENA 3QPUA 4JLPA 4XD7D 1Z6AA 4B2PA 4KVGA 1CIPA 1W47A 2YINC 3MFYA 2GWHA 3AUYA 4Q9JA 2QMUA 1ZD1A 2QBYB 3AVWA 1P75A 3ECCA 4ZKDA 3NHAA 3OZXA 2OBMA 3D6TB 5EUQB 1KO4A 3PEVA 1T3SA 4P4SA 1DELA 4A36A 1CTQA 5D3MA 3GJ7A 5JS7A 2Q3HA 2C8VA 5L8VA 3V4RA 1AJEA 4C0HA 2ZRBA 5HZHA 1P73A 4D0GA 1NBME 2G83A 4RJLA 5J4KA 1G1MA 5JHGB 5IK2D 3ASZA 1XD9A 1Q57A 2GJ9A 4OQLA 1P9NA 2X2EA 5JI2E 4NYMR 1KHTA 2IYSA 3EIEA 3IEVA 4A0RA 1SVMA 3RSLA 1UM8A 4IRUB 3SHFA 3LQRA 4ZPXA 2E1RA 3KJEA 4OQMA 2QAGB 1MH1A 4PQFA 3IO3A 3LBHA 2ZSDA 2IF2A 3U7GA 1S0UA 3PVSA 1XPRA 2ZITA 5FFMA 1F5NA 4D4KA 3CWQA 4HAXA 3AVVA 4M1TA 4BPBA 1NY5A 2J46A 3A4MA 4US1R 3LWNA 4XIGS 4ZI2A 3A1TA 1V43A 4M1YA 2JDID 3CH5A 1ELOA 2X19A 2C04A 5DLQC 1L7VC 1IJEA 2C9CA 4D4LA 4EPXA 1FUUA 1W0JD 1JAHA 2YC4C 4HEJA 3H84A 5G40A 5L3QB 4MDEA 2VYFA 2V3CC 1KI7A 1OXUA 3KDSE 2IYTA 4MRRA 2WJYA 4QBIA 4Z1MA 4Q21A 1G17A 1NF3A 2IYWA 2QT0A 1OB2A 3VU9B 4HZUB 3ZZ0A 4JVSB 4TMKA 2GZHA 3T5GA 5GVRA 2FJUA 1F2TA 3IQXA 4L9SA 4M53A 4HUQB 4DBLC 1FUKA 1I2DA 3IKJA 4TSFA 3KKPA 1RW4A 4MRNA 4P33A 4YDHB 1R8SA 5F98A 3KJHA 1P9RA 3LFUA 1XDBA 2NOAA 2NPIA 5LDDC 2ODWA 5LD2B 3ICQB 1T5LA 1KDPA 3UPUA 3F5FA 3GEHA 3FMIA 4D4JA 1P61B 4EUNA 1N5KA 2MMCA 4R7ZA 1WA5A 2QMEA 3AF3A 3LVRE 4IXMA 3CNNA 3GCGA 2RAPA 5CDFA 2RCNA 2ZI5A 4BRUA 3RS5A 3TK1A 1H65A 2CL0X 1JBKA 3CPJB 4OK3A 4LYFA 3VHLB 2QSZA 4UJ5A 5FL7D 4NPHA 1WQ1R 3IIJA 4BEJA 2REXB 4Q03A 1BMFA 1JAIA 4HB3A 2BCJQ 1XU4A 3U3OA 2VP5A 3GJ6A 4B74A 2KI5A 2JLUA 2GKSA 2GA8A 3FYHA 3SJCA 4G5QA 4Q01A 4KO8A 4B3DA 4L4UA 1ZD9A 1YKSA 2ERYA 3FWYA 2PX3A 4KFSA 3ZVMA 1U0LA 3I5XA 1NP6A 2XJ9A 3TR5A 3LW8A 1H8HA 4ARZA 4EQ6A 2YWFA 3ZZUA 2E9SA 1UKEA 3PEUA 4XJXA 1NLFA 1TNDA 3B1WA 3KXIA 4AC9A 2A78A 4HSEA 1GVNB 4PSKA 4Q4JB 1S8FA 4Q19A 4ZKEA 2GETA 2JJ2A 2DWOA 1BH2A 4Y0AA 2ANBA 4M1WA 1PLLA 2ZJZA 4Q7MB 1L4YA 4CVNA 4F38A 2RB4A 1XPUA 3DDCA 3NC1C 1ZD8A 4R98A 2RKOA 1DG3A 2XNSA 5CM8B 3QPWA 1DAFA 2WBLC 1OH8A 2QPTA 2D7CA 2QAJA 5CM9C 1W36B 2ZU0C 1D8TA 2P6NA 2VQSA 3K9LA 5TDHA 4URZR 2WAYA 4NYJQ 2FEOA 2F3RA 3AUXA 2YOHA 4B44A 4FCWA 4HAWA 3HP1A 3K09C 3UATA 3NTUA 1GRNA 2ZUBA 3TSOA 3UIEA 4LJ5A 4P31A 1ZU5A 1QHXA 2ZSEA 3PEYA 1T9HA 1DAEA 3CNOA 4FN5A 1KSHA 4JMPA 2GJAA 1EXMA 4POAA 2QL6A 5HKKA 4UNSA 2VSOA 1WXQA 3H4MA 5JRJA 2PLFA 2HEIA 2FPLA 3IPYA 1Q21A 4KFTA 3LY5A 1NKTA 2YYZA 1Z29A 2BKEA 2IHBA 4Q7JB 4NHOA 2XNDD 3TMKA 5FTLA 5DHFA 1SULA 4W5JA 4Q4AA 3LV8A 1A2BA 3ICEA 1XJ0A 1G3MA 4AKHA 3NH9A 4O0MA 4GMDA 4UXHA 4D26A 1E0JA 4C4PA 2F9MA 1SHZA 4DCVA 3BOSA 1TX4B 1P2TA 5E95A 1ZC3A 3MWYW 2F1HA 3ZVNA 3AH8A 2WJHA 5B57C 2RGNC 3DKVA 4XOIA 1PLKA 4IVQA 1JJVA 2AL7A 1OHHA 3R8CA 1XF9A 2V54A 5EXSA 4I1UA 4F91B 3PEWA 2CMKA 4PZZA 2D62A 1MO5A 1E2DA 5BXQC 4C7OB 1EGAA 2EWVA 2OBLA 3SU8A 2FOLA 2GEUA 2RH5A 3VR5A 3U61B 4DDUA 2JA1A 1TU4A 1LS1A 2OZEA 4Q9HA 5EP1A 2GCOB 1GG2A 1GFIA 3NVAA 4B3XA 3KB1A 1G19A 1YZUA 2IBMA 1E96A 4HLQB 3BORA 1S3SA 1TADA 1ZM9A 4WW0A 2AWOA 2QP9X 3C5CA 5EQTA 2VA8A 2ZR0A 3NBYC 4PAQA 3WY9A 4HUTA 2O0HA 3B13B 1DBSA 4ZO4A 1X8LA 1SVLA 2V9PA 1KO1A 1D9ZA 2DFKB 3ZYCA 2GK7A 4JYBA 2WJVA 3QVUA 1XTQA 1YJ5A 5JCPA 5FUXA 3PQCA 4KSBA 3X1YA 1TAGA 3PFIA 4EPWA 2HYDA 1G9XA 3OAAA 1G8FA 5C4MA 4KLNA 4L5BA 4LHWA 5F2EA 2EWWA 4R2IA 3SDZA 5KNCA 4DLUA 2BCGY 2BJVA 1S2MA 1Z22A 4LDJA 1GNRA 1KJZA 1ZM7A 2QNRA 1J8MF 2TMKA 3BB1A 1AS3A 4RKEA 4YMTA 1HE8B 2NO7A 3QJYA 4LI0A 3A1WA 4UQOA 1IBRA 1LFDB 3BWDD 1KZGB 4IDOA 3WXMA 4AK9A 1RC8A 4V03A 1G8PA 3CPHA 3K1JA 4JVLA 821PA 5CK5A 3BIFA 3KJGA 1JXMA 2WTUA 4LV8B 5FBLB 4A2QA 1JR3A 5BW8A 2W6IA 4TT3A 2EFHB 3FOZA 4EPVA 5DISB 2QM8A 1FTNA 1PUJA 2ZS7A 2ODNA 1I2MA 3OHMA 5FPKA 3CIOA 4Z8XA 4GNKA 1N5IA 3L0PA 3RDPA 1UBGA 2WWYA 4B43A 1Q20A 2J7PA 4GP6A 3PJRA 3NG1A 1SXJD 2VIIA 1XMSA 3REGA 3SJBA 2YV5A 2OG2A 1AA9A 4Q1DA 4RKFA 4C0QC 3AP2A 2F1IA 3TRFA 4OK5A 1G6OA 2GJSA 2G9NA 1Q1ZA 1Z6GA 3PUYA 1FW6A 1CXZA 1VYUA 5JZVA 2WHXA 1K5DA 2HF9A 4DVGA 1LS6A 2FNAA 2I1VB 2QM7A 1UBCA 1ZVQA 4NU0A 3C4JA 2JLVA 3CF6R 4X8HA 5C1BA 5IF9A 2BMDA 1KGDA 1XD2A 4DB4A 4TMWA 1HH4A 3OEEA 1E2HA 1C1YA 2D7DA 1QRAA 2RGXA 1H8EA 2RGDA 1DARA 1NSTA 2F1JA 1E2NA 3RWOA 2VPPA 1FNMA 2VP4A 2QAGA 2IYQA 1TTTA 1GRQA 5L3SA 4OQXA 4IHQA 3K0CA 4DEYA 3RS2A 4P4SB 4ZDIA 4F4CA 4RD1A 4DIDA 1LNZA 5D3MB 4W9MC 5JJKA 2A5YB 3JVVA 1W4CA 4LJYA 3A36A 4II7A 2ZJYA 4FWIB 4V0KA 2G6BA 3RSOA 4TZ0A 4M9QA 1P72A 5BN4A 2DFNA 2HDNB 2V1XA 4JBXA 2XXAA 1T6NA 1Z6XA 3EWAA 2WICA 5H68A 1R5BA 4DLZA 1YU9A 2AN9A 1M1YE 2IYLD 1CJUC 3CONA 4UXIA 3ZGXA 3HPRA 5FR1A 1E2EA 2A5GA 3A58B 4AKIA 4PSAA 1DAGA 4TTPA 3KX2A 1QHYA 3ZVLA 2ZU6A 4OHVA 3CX6A 3IDQA 3I72A 4HI0E 2CHGA 2H16A 1ANKA 4IOKA 3VAAA 3M6AA 1VIAA 3C14C 2W2XA 2UKDA 4URWR 4TYNA 2A2ZA 4FXPA 2ZANA 3QG1A 2YC2C 1XJQA 2IC5A 4M8NE 4Q1BA 5ANRB 3T1QA 4D81A 4NE2A 3SEAA 4EPTA 5CDFE 2O0JA 4XVRA 3QBTA 4WZBE 2W00A 4EPYA 2IEZA 4W5WA 4DCSA 5KYKA 4PZLA 2NO0A 5FUWA 1GNQA 2R6AA 4Z1MD 5JMTA 2SHKA 4YXWA 4R2HA 3ZVRA 2PJZA 5J40A 1WRBA 3UMRA 3GJ8A 2ZJOA 5IRCD 2QG6A 1CF4A 2CHVA 1E0SA 1JJ7A 3FFAA 3JZMA 1VG0B 2ZRFA 2PT5A 3NDPA 2WOOA 1ZM4A 2ZPTX 1CULC 3RHFA 3ADKA 3WBJA 4DKXA 2Q9AA 1F2TB 4TSFD 4MQBA 1M8PA 4UKDA 2NG1A 4KV9A 1TEXA 1NN5A 4B6EA 2JIZA 1KI8A 1RRPA 3DM9B 4N3NA 1E79A 2D06A 2Z83A 4MRPA 2QE7A 1TU3A 1XFAA 4E07A 4M2LA 2HT1A 1D2NA 4HDQB 2QPOA 1RE0A 2GEVA 1AQUA 4MGYR 2JJ1A 4M1OA 1E2QA 1G5RA 1J7KA 1OW3B 1UEJA 3UANA 4FWTA 1HYQA 1KI1A 4AD8A 4KSCA 4ZI3A 2OM2A 1KSJA 1BMFD 3AVTA 1S1CA 3PUZA 4A2WA 1UKZA 3QF7A 3RS7A 1JNYA 3B9PA 2NTYC 1QHSA 4URXR 1II8A 3THOA 2FSFA 3IIKA 2Z5FA 3MGCA 1U8AA 2W58A 4DLXA 3MSXA 4DUGA 1Z63A 3I92A 1E1QD 1W0KD 2FGJA 2OSBA 1R0WA 3N70A 4OI2A 4DEXA 3ADBA 4I99A 5K8LA 3RLFA 1H8HD 4RD3A 4DLTA 4Q7LA 4G01B 2V1UA 1FMLA 4ARZB 5FR2A 4Y0VA 4EQ6B 5AUOB 3CUEF 2ERXA 5HCNA 1BYIA 3FB4A 3X2SA 1EX6A 2HUPA 1N5JA 1G18A 1Y63A 2JJ2D 2QTFA 2WVJA 4AG5A 4CT4B 1Q3TA 2BBSA 1TPZA 4M0LA 2IWRA 3GP8A 1E9RA 2JASA 4D82A 2C03A 3KB2A 3L0SA 4DLRA 1XBTA 2C77A 2ZRAA 3KTAA 2V55B 1BS1A 2WKQA 4M21A 1OSNA 5EP2A 2C96A 3VMFA 3GQBA 4P32A 1GTVA 1SQ5A 4LHVA 221PA 4MUAA 1VDZA 4US2R 1AM4D 2CLDX 1SVSA 1EFUA 3U2QA 3AKEA 1ZCBA 1G5PA 1M2OB 4RZ2A 1HV8A 3ZIAA 4Q9KA 3VX4A 2WIBA 3QY0A 3NC0C 1YR8A 1XTJA 1CR4A 3P27A 4M1SA 3B1ZA 1KDOA 4M9XA 1WP9A 4B48A 3W3AA 2MSCB 3KQUA 1E9AA
chains in the Genus database with same CATH superfamily
1DO8A 1J22A 4Z0HO 2GCPA 1R0RE 4HQFA 1RRGA 4HYTA 4HHEA 4X1IA 4JVNA 3ZLVA 2H4YA 4GGOA 3VPCA 3ZWYA 4ARBA 3CVVA 1AQLA 1EJ6A 4BKMA 1XVIA 2G25A 2IYAA 5FOWA 4G23A 3FKSA 2CZCA 4MCHA 1IBCA 3O8NA 3GFRA 2CV0A 3FVTA 1SD2A 3C70A 2PIDA 3WJ1A 5LBTA 1P62B 2VP3A 4RGBA 4CCYA 5TIIA 2W4QA 1CR1A 2ZEJA 4BMNA 4D0SA 1A96A 2X9QA 3PQDA 1OHHD 1JR4A 3K94A 4W8HA 1SU7A 1HMYA 2XB4A 1JBQA 2YIMA 2FZVA 2UVPA 1P4GA 4EITA 4ERXA 1B74A 1A8SA 1P5HA 1XN1A 3W4KA 4MWZA 3AESA 3Q7SA 1MB4A 3V9PA 1UWLA 4JEUA 3SBEA 1U5CA 1JSXA 5HM8A 5FBQB 1NLYA 1UBHS 2F9LA 4A10A 5HIAA 5KQGA 4FHGA 3I9V6 1IN1A 1D2RA 4P5DA 3PCRB 3U7QB 4MV4A 3GNSA 2FPUA 1GU7A 4U3JA 5FBZA 3QKRA 1DT3A 1LK7A 4MHSA 4GUAA 5HBRA 4Q0MA 2A5DA 2XTMA 4C88A 3LA8A 1RHUA 2I34A 4DXAA 4IQFA 3O74A 1FQWA 3JQAA 3WBKA 4EB6A 5B30A 1XLTA 1OYWA 4YUYA 1EKXA 4J0KA 4QULA 4YWHA 5KVVA 5EHXA 2IW1A 5IS2A 1PCXA 2EW1A 3SC2A 2ODEA 4IUBS 1YDHA 2HU7A 1Y1LA 1DADA 4S1NA 1YQQA 1THZA 3GFVA 2VDRB 3M0EA 2VQ6A 1GGMA 1USUA 2ATCA 2XT0A 2CMDA 3F6CA 4HBGA 3I9MA 4BLWA 1A9XB 3EARA 4PLWA 4FDTA 4BP3A 5JAQA 1YZHA 1ZK1A 1TRHA 4B17A 5A4AA 4B7ZA 3OWHA 3K0EA 4FOOA 4QOSA 3I9FA 4QU0A 5KNCD 4F6CA 3A8TA 3CZQA 1NW3A 2HCFA 1DHRA 1PG5A 2XF8A 1GR0A 4AJLA 3F7NA 2W6OA 3STVA 4D4MA 4E2ZA 2P2GA 3IUYA 4ZN6A 2QW0X 2Q5HA 3FR8A 4PX9A 3E8MA 4U6QA 5BWCA 4N49A 3HVHA 2FR8C 5FPPA 1LX6A 3IEXA 4CF6A 2D4HA 2PT9A 1SXGA 4P2GA 3BC1A 3O8CA 3GIWA 4D5GA 4JOSA 1EUYA 1ZCJA 3I0ZA 3HBLA 3KQTA 3WKCA 5IANA 1JR3D 2DERA 3FHJA 2GM3A 3FPGA 1XNGA 3NWJA 4WUTA 3AG6A 3B8EA 3E23A 3T61A 1UXIA 4S1WA 1GWNA 1WMFA 4WERA 1YQ9A 3S2UA 3E9ZA 2PGLA 3PQ3A 4QPZA 4N7RA 3IBYA 1DQSA 3HXKA 4NYJR 4WECA 4DZZA 5AVZA 3IEUA 3TDKA 1SXQA 2AYZA 1HOTA 1LBEA 1NUTA 1HEIA 4RANA 3IVMA 4IZOA 2VBGA 4M0FA 4ZQCB 2V7WA 1X2EA 2J7PD 3EW7A 3NASA 2OSVA 1DQPA 2AEFA 4ZTBA 3Q88A 3OOYA 4WEQA 4A0FA 4GU5A 2M32A 2WIAA 2WPDA 1D4AA 2A0YA 2OILA 3NKVA 4N8EA 1M76A 5FOUA 3TLYA 3EPRA 3HABA 5DXAA 3UBTA 1NJ1A 2B4YA 2DTDA 4KBGA 2P4SA 1N6IA 4ENSA 5A04A 2RGWA 4G3XA 4JJ7A 3NHZA 2Z43A 4L5YA 1E7YA 3TKAA 5FTKA 4DBZA 2FWPA 4K46A 1YS7A 1EBBA 2P4UA 2Z4TA 3BFKA 4FFMA 1ZJ4A 4MR9A 3K1ZA 4YJ3B 3R9XA 3OIUA 2J09A 1I4WA 2VJBA 3BX1A 2PPLA 4S12A 3VPHA 3W8EA 2I7XA 2HMWA 4PG7A 1OT5A 4JJGA 4N0PA 1OBVA 4YI3A 1B42A 3H8VA 1T5OA 4NQZA 5D6NA 3AGQA 1HK7A 2WSLA 4NZ9A 5L6MB 4V2IA 5LNK6 4B45A 4NOKA 3P9IA 3QXSA 5GV7A 5LA6B 5LLTA 2HXGA 3E1GA 5L3SB 2IDZA 1T0HB 2XOKD 5LBIA 4CR7A 2HJRA 1WOMA 4MW4A 3TIVA 3TLCA 3UGQA 4DLWA 4CHTA 3OEYA 7MDHA 2O20A 1H4TA 1ODKA 4ENUA 1VHJA 3BE8A 4TL8A 2OGTA 3TOVA 3HUFA 4M0UA 4UUMA 1SELA 4ZP1A 4YV1A 3IJPA 1NVVR 3ACBA 1GTL1 1ESZA 3CBGA 1SC3A 4E1BA 2Q0XA 3D43A 1BKYA 5TMBA 3LYLA 2IODA 2RC5A 4YROA 4TMTA 4CIDA 2XXAB 3BXHA 3I6ZA 2P9TA 1OFTA 3CG4A 4QU5A 1H1LA 1E63A 1UC9A 3JZDA 2GDJA 4PVDA 4HQ0A 2Q3CA 4OJKA 1ZIPA 2XOXA 2EKPA 3NQ41 3PUKA 3QLEA 3QM1A 3O8BA 3T9FA 4RPKA 1R4NA 2BFMA 1BG6A 3KWFA 3PXUA 1P33A 3WX0A 5IF3A 4MEAA 3NBKA 3CTPA 5M34A 4B3HA 1HKUA 3EFBA 1U2GC 1WMSA 2GZ2A 2V7BA 2VAWA 3MERA 3TB4A 4ZCLA 1HFJA 5AM4A 2DUWA 1RM0A 2IYOA 4C6HA 4IY1A 1UKVY 1IY8A 3SYKA 1P8JA 3L0BA 2WF8A 2D54A 1CB0A 3EF3A 3PYXA 3NFRA 4QT0A 3WYGA 2GPYA 1J25A 2JLQA 3A1CA 3L41A 2OGSA 2BI4A 5DRYA 4IH9A 4DG9A 1PFGA 5IDQA 1UOOA 1SN7A 5GGXA 1ZK0A 2VJDA 1C1XB 4PIPA 2P40A 5HTKA 2ZSKA 2I2AA 3BEDA 2J3MA 3M4JA 1XYVA 2QTRA 1USWA 3DNMA 3Q3CA 4C6RA 4YAGA 4QWWA 3LH5A 3I64A 2OXIA 1NRXA 3JV7A 1H6AA 4RH0A 4KO4S 1CV2A 1T26A 4EB3A 2FZGA 1XYYA 3OCVA 4DBLE 3N74A 3CVYA 3K0SA 1TA4A 3QKIA 4EFMA 2R6CA 2FRXA 4LFAB 4AXBA 1IJBA 3A05A 3EQ7A 3PXDA 1US8A 1DKPA 3HSYA 1ZW1A 4WFIA 4RBNA 5ADHA 3Q2OA 3LCRA 1JL3A 3CO0S 4OLFA 4QECA 4WN9A 4KWCA 1YGYA 2W6NA 3KWMA 3VPFA 4CM3A 4X0EA 5IKOA 1U11A 1A2KC 1NJ2A 1NOKA 2FWAA 4FC7A 1W5TA 1ML4A 1UFKA 4MLZA 3ZIUA 3BBPA 2P9ZA 3D4BA 5TB5A 3MCWA 1MABA 3ZZMA 2AZXA 2FPPA 4AN4A 4C0SA 2DG2A 3M34A 3SVTA 2I3ZA 2IOHA 3BRQA 4CQLA 3FFWA 1E2IA 1P2UA 4RPLA 4EG8A 2F00A 5A2QA 4XVUA 2B78A 3QEOA 4UNQA 4ZYWA 3QG5A 4AQYB 4H3HB 2XE7A 4K9NA 2JEOA 4BXOA 2PZMA 2C1XA 2WYVA 2Z8YM 3GRFA 2VK4A 4HB2A 3CF0A 4U7WA 3EGDA 4IVNA 2EG5A 1U8ZA 2BWJA 2R8ZA 5TQ0A 1YRQA 3C98A 5BSEA 5CD9A 1XTKA 2QR3A 3EB9A 3KR9A 4IF4A 5DGTA 4B81A 4CCWA 5NULA 4FQ8A 5LQDA 1BWPA 3EW9A 1R0YA 1Z07A 4Z0TA 3K30A 2YDYA 3CEPB 2ORWA 1WUJS 3KYCB 4JODA 5DBOA 5L53A 1V41E 1KYQA 5DYIA 4WQMA 3BMCA 3C3CA 3CCBA 4JJFA 3BAFA 3IYLW 3Q7RA 4QJBA 4QC2A 1WCYA 1D7AA 2GO1A 1W34A 4WY2A 3WLSA 1PTJC 1FFXA 4DUGD 3OLQA 3H16A 5EZYA 1KSFX 1AKTA 2O3RA 5HKBA 2RARA 3I5AA 5K01A 1QHIA 5GJVC 1U81A 1T9KA 2VLIA 1M34A 1DEOA 2H07A 2GUWA 3GT0A 1EFPA 3HLKA 3N2GA 4BASA 3GMIA 4CMBA 1RZRD 1YZFA 4MJ3A 1T0PA 2ZJ0A 2ZVQX 1NNLA 3R4VA 4ROTA 2IYVA 1SWVA 3PGKA 2RGAA 5EQJB 1PNRA 2WMYA 3ZWDA 2ZBDA 3AR7A 4LIPD 2VP9A 3M9XA 4K8RB 2FRVA 2OHXA 2HFKA 3H4IA 1DAMA 1WCXA 2QYTA 3ZGOA 4WFJA 5H4GA 3RUEA 4Q3LA 3DLPX 4KX5A 5DN9A 1DB3A 4U8HA 2NO1A 4TVKA 4YTEA 1XMJA 3MXOA 3WZMA 4ML3A 1EFRD 1G20E 1LCIA 1OBCA 2R11A 3B9QA 3IA2A 3NNSA 4YJDA 5FL3A 4F4JA 3QMWA 4QZVA 3TR6A 1ZU4A 2IDKA 1PUXA 1T1JA 1TYDE 1J0EA 1Y8RB 2QPLA 3HKEA 1H3EA 1F48A 1Z5GA 3TEJA 3IUEA 3QKWA 3IFSA 5K8VA 1X86B 2Q1YA 3A1SA 3NAMA 1LF5A 1HYGA 1J56A 4GMFA 2J67A 3E48A 4HDMA 4I6JA 4UJ3A 5KOYA 3CNHA 1SNYA 2D5AA 2WTNA 2V7XA 2BVNA 3LFTA 1MMFB 1YB5A 5ED4A 1XA4A 3UUEA 1TYZA 2OO3A 3T9BA 1Q3KA 5IJWA 1XRJA 1SRRA 1FU8A 5CLQA 3N5CA 5ALLA 2YZ7A 2I4OA 2RAFA 1RXSA 2CJWA 2VHUA 2WF5A 3CGWA 3EASA 3KL4A 5F73A 1E61A 1GNPA 1CUYA 2AMJA 3GMTA 1JU3A 4X6YA 2HREA 1ZIXA 3Q0IA 4EGSA 1COWA 3ZV5A 4MUMA 1A9PA 3NM4A 3ONEA 4UUOA 4TXMA 1YF3A 2Q3FA 5IAJA 4C2AA 4YRBA 1BX0A 4TSRA 4M0PA 3TTWA 4YA6A 3MQ2A 1HDIA 1NVKA 3JAWB 3I12A 4HQ6A 3DMTC 4AWAA 4ITVA 3IODA 3WA7A 3ZHRA 5K8IA 5E3IA 1W4LA 1NVVQ 1JKJB 3PTAA 3EWIA 3WGUA 5BQXA 5C32A 3L8ZA 1G4HA 4WESB 2FX3A 2FFHA 4XJSA 4EGQA 2QUJA 4TVSA 1QRSA 4II3A 2HK9A 3ZJTA 2F3PA 1O5TA 1S02A 1UAAA 4N6NA 2O19A 3E9QA 4OUDA 4AY3A 1FDIA 3EC2A 4I36A 4JC5A 3G9QA 1SH7A 1ZXBA 3BKXA 2OD9A 2TMDA 4DR2B 5A4FS 5D51S 1JEEA 4B76A 2X3UA 3H0KA 5CT9A 2KQUA 3IAM1 4CG1A 5B12A 2PUHA 2V45A 1N6LA 1QCZA 3GEEA 1GP2A 2IYUA 4QTYA 2R8RA 2YN0A 3KVVA 4WXPA 1AKMA 1XLWA 1KAQA 4U7JA 3WZ2A 3RQSA 3AHIA 3AK4A 4FGZA 3KLOA 2VKTA 3IV6A 3PNMA 3LG2A 1S2IA 1Q95A 2VSQA 5DDIP 3H5NA 4V0ME 1G7RA 3EZXA 1K6IA 5K9ZA 1DBIA 2R44A 3VVMA 1QAOA 2XGGA 1EXWA 1UWCA 1CIVA 3D5TA 3FWHA 1J2TA 5KX5B 3HN6A 2WJIA 3D1JA 4L15A 1TTQB 1Y80A 3EE6A 1FU7A 2P9BA 4G0NA 1CLEA 1Y4UA 4KO2S 4IOLA 2H1CA 1M66A 3A3YA 3ETHA 4EKEA 2HBYA 3HJNA 4M9RA 4F9GA 1Z0UA 2OHGA 3HJFA 3CMMA 1COZA 4G25A 2Q29A 1RXYA 4KVAA 4CW7A 5JCZA 1MDFA 4GM4A 4K1XA 4TYPA 1USGA 1NI4A 1Y9EA 3DSRA 4EYEA 2D5BA 1F7VA 3SVLA 2JFUA 3HYCA 4G89A 4YRCA 4YP9A 2CVPA 4FILA 4B47A 1PYOA 3PEFA 2ZYHA 4F45A 3RF6A 1G6KA 2EX1A 3FCSB 3L8CA 1WX1A 1XTTA 2H2FA 1ABFA 4X3OA 2GTIA 1VMDA 2ZG6A 4BLPA 4JT4A 4L0MA 4M9SA 5K6RA 2IXFA 3I9OA 3FRHA 3RIXA 1C81A 2M1XA 3RE1A 5DW0A 4YJ2A 3BE6A 3H97A 2V7QA 3IQWA 1YRYE 2JGLA 2FE1A 5B1HA 2Q8QA 3AEZA 5FNVB 1JEQA 3LW7A 3L7OA 1II0A 4LW8A 1E3LA 3RVLA 3VBCA 1A8IA 2GD0A 3NEYA 5J3JA 3L8EA 3N87A 4JNCA 4GSYA 4RL6A 5M29A 3BJIC 3FHOA 5BV1A 2WWFA 4KBFA 2DBZA 3GGJA 3HWX1 2ZRHA 1MQSA 1KJ8A 1P1RA 2EKQA 1L3CA 5EXPA 4DJDC 1J99A 4DRXB 1LDMA 3ACCA 2OV3A 3I2HA 2BGLA 5ICMA 2VZEA 1ODIA 4K86A 4UTXA 4ZMSA 2ZJ1A 4G0UA 2Y1XA 3FJYA 4PYLA 2WTXA 1YRAA 4FBMA 5HIMA 5EE9A 1ODFA 5CLJA 4W82A 5IULC 5J1TB 2YRFA 3BL6A 3NWBA 4BB6A 2J0QA 2V98A 5C8YF 4PBSA 5LZ2A 1YUBA 2EL7A 1E77A 1YZNA 3R3YA 3NHFA 4KV7A 5LQAA 3F49S 1DUSA 2J0UA 3PWSA 1VKJA 4I2NA 4XKJA 3L0CA 1TQHA 5JAMA 4L07A 4A1OA 2WWWA 1Q7BA 3LGSA 1TJ3A 4YX9A 2VTBB 4C4AA 4IQ8A 1JDTA 4LJAA 1W85B 1T6YA 2P91A 5EXXA 2WJ3A 1QAMA 4R69A 4BVEA 1RM5A 3PSAA 2YJTD 3GG2A 3PHBE 1YAJA 3WWOA 2VJOA 4B2YA 1OD6A 9ABPA 2CWWA 3OLVA 2QQ0A 4DBVO 1ULHA 1RAHA 4QD3A 5EIFA 4LE2A 3GLHB 5CB6A 2JH3A 1JTFA 1ZX1A 3IE2A 2QTVB 3C6KA 3DXXA 5E4YA 2DWPA 1NNUA 2JHCA 2QVGA 3DMYA 3JQ8A 4N1AA 4PVCA 3DE3X 3MJEA 4JWTA 4UCFA 4MO2A 3STUA 3OJWA 3UV7A 3UWOA 3WQSB 4EMTA 4EW2A 5JTTA 4TZ6A 5EEHA 1CRQA 2P1RA 1HSZA 3DP7A 4H1TA 4A0QA 3F9IA 1WVMA 4AX4A 1SM4A 4Q3DA 4AWXA 1DI0A 3TW8B 2IQIA 4EZBA 3K1TA 1URPA 3D8NA 3D7RA 4IR7A 4BQOA 2JDIA 4U9IS 2GXSA 3T6KA 2DWQA 3E9RA 1N9ZA 2XGMA 3BF7A 3OX4A 3WHKA 4BUCA 4E03A 1XNQB 3KKQA 3HR8A 5JOQA 1K6JA 1JMYA 2XYGA 4CV2A 5BN5A 2YBEA 3Q8LA 1GTJ1 1N2EA 3IMEA 2D5LA 1DMSA 1C29B 4MW2A 4RMHA 3FKJA 3GLSA 4RPHA 4E2XA 1PEKE 5J9FA 3TLXA 1LVGA 4F4HA 1F17A 2HI0A 4MO9A 4PO3X 2QAIA 4CMHA 1CQZA 3DVQX 4MRAA 5IXSA 1WCV1 1GYPA 3BH6A 2HT6A 4BX8A 3QNUA 3A6EA 3QHAA 1UFOA 4HNQA 3IJ5A 1YK0A 5FCDA 3D2LA 2ZRJA 1GFWA 4EYKA 1DGQA 2G9UA 2PH1A 4TL6A 5CW1A 2XUPA 4I4TA 1OZ0A 3I5MA 1W87A 1YFLA 1C14A 2I2FA 1KYVA 3Q15C 1B8VA 2O9JA 5JXHA 4M1KA 3DMFA 4CG3A 1W7AA 1FNNA 1QHGA 2EKZA 4MUBA 2EJUA 4RM2A 3EFOB 3OPVA 3OQHA 4B3FX 5JALA 4DIKA 1LW7A 2FY8A 3PNPA 2NACA 2ZIAA 1JLSA 4OP1A 2JCXA 2NZ8A 1ODSA 3C1OA 4X90A 5AK0A 1C9MA 3ENZA 4KLZA 2RKWA 2YMMA 4A7PA 2C7OA 3D4NA 1EFCA 2Q4BA 1V1JA 2XX3A 4U1RA 1ZXLA 4IZHA 2FN4A 2GAAA 4XUEA 2WFMA 3LRXA 4QPCA 5DGDA 3L7DA 3RGWS 2VNIA 5EKXA 1JTEA 4RJKA 3AEUB 3UNXA 1OR8A 4KYIB 3KPYA 2RHDA 3SSNA 4CQJA 1E94E 3BWEA 2X0EA 4O2AA 4I8DA 1LDEA 2A9PA 2YJ5A 4RQBA 1JEDA 4PYNA 3L49A 1MD9A 3I32A 2VHZA 1TFUA 2B2NA 1FTQA 1HORA 2X8JB 2YWDA 4YRRA 1PR1A 2EP7A 1JDVA 2QLNA 2CWDA 4MJLA 5ILGA 3ZIDA 3OWOA 4JXZA 4AMVA 4ZI7B 1M5UA 9GPBA 1KI6A 2SICE 3B53X 4YP7A 5K3FB 5BSRA 1YIDA 4OL0A 1U2DC 2UVDA 3SZGA 1K8ZB 1MOZA 2MU1A 2Z8XA 1MOQA 4WKBA 5FOVA 1XCJA 4M7WA 3G23A 2NZJA 2ON6A 4R1LA 5AVKA 1PV4A 4L95C 1CDDA 5JEDA 5HJ7A 4AJEA 4BEVA 1PK8A 2XMGA 5L7TA 1J23A 2CXSA 2J4FA 4HTFA 2GF2A 4OH7A 1GSOA 4LK2A 5HUQA 1VP3A 1QOZA 4HRAA 1NBAA 3VNRA 2HJWA 4TMZA 2IIVA 2Y0PA 5CA1A 2ZT8A 4ESEA 4IWNA 3FPKA 3HI4A 1G6HA 4QGAA 1Z7BA 2EW8A 4QUDA 3B7WA 3ZHQA 2A9QA 2PA3A 4R01A 4LDZA 3UK6A 4AY6A 3JRXA 3L1JA 2QUZA 2ZUVA 3PC8A 4K87A 5CU7A 3B1YA 1NVMB 3N6RA 4ARSA 3OSZA 4NIMA 4OFZA 2W70A 1QWSA 2FJPA 2QEQA 4IDFA 4RDXA 1PAUA 1HLDA 4I55A 4PC3A 2JIOA 3JCZA 5M5BA 5TY0A 3GGOA 2EARA 2C8LA 4F21A 4H4EA 1AO3A 1IN7A 4B6JA 4QA9A 4MX8A 3Q10A 2GLUA 4LSGA 5JASA 1PE0A 2EGGA 3PV0A 2G28A 5ALSA 3G02A 1IZ9A 2B36A 2ECKA 2OD2A 1XZFA 1YWGO 1BFKA 1IH8A 4FWBA 3L6BA 3D6AA 4MV0A 3VO9A 2NZ2A 3Q40A 4FX2A 3EOZA 1S8NA 3EGOA 5FHRA 2ONZA 4LBVA 3MJRA 5EZ6B 2D6FA 2HV8A 4WNAA 4JVMA 5JE8A 2O8BA 4KK3A 3Q5EA 3UMVA 4KIGA 5I7OA 3Q72A 3RTGA 3IT1A 4G6ZA 1FMTA 2XYVA 2VYQA 3SBXA 1FMFA 1A71A 1K8YB 2GZAA 4EF5A 2A1UA 2VBCA 4TL7A 4BX0A 3FUTA 4CLRB 3I1YA 4ZFNA 2F8SA 1P9WA 1G20A 1JVSA 4C1NA 4XZ3A 3D0KA 1PNVA 4OM7A 4KWEA 1NN3A 1HZZC 3MBKA 2XQJA 3K0AB 3OJCA 2FW1A 3BE5A 2HA0A 1JDBC 1C4XA 2UZ0A 3QF4A 4I5IA 4I3FA 3U4GA 3X0DA 1R0ZA 4GX1A 4GZMA 5DRTA 4BCDA 5J5CA 3V00A 1JG7A 4QEKA 4JMLA 5HSGA 3IH5A 3LUJA 1M2VB 4HGNA 2H65A 1NQVA 2Z2XA 4LRSB 4CKBB 3GLIE 1LRLA 2ZZNA 2QMYA 4GPIB 3PYMA 1CT9A 4RZSA 3ETNA 4FE7A 2AOUA 5AKIA 4M22A 4QO7A 4ZV7A 1PV2A 2ZUUA 5EP4A 2QD3A 1U6IA 3L7KA 3H9CA 1H2RS 1L8LA 1Q1AA 4Q1FA 3PVCA 1GZSA 3UYLA 1R10A 3U0VA 4CJXA 4P54A 2HRQA 2REQA 4TKVA 2YWGA 5JAIA 1Z6TA 4L76A 5HHTA 3FDZB 1FUEA 1FSPA 1EQ2A 3VKWA 3KB6A 5COQA 2H1VA 3ZGLA 1UZLA 5HE8A 4BNTA 3QEAZ 3EVTA 2QR2A 3IPRA 4IDQA 3UAGA 3QVTA 2DCMA 1XL0A 3N2EA 4LXUA 1Y3AA 3OU2A 1SUWA 2FPWA 1W1IA 3DTTA 3NYRA 5TEWA 3ROXA 2XZLA 1FDRA 1WB6A 4CEHA 1JE1A 1RCUA 1GKIA 1S1MA 4LY6A 4JI8B 3TGWA 2QZJA 1EQAA 2PX4A 3HVJA 1VB3A 3OAAD 5DEOA 3DO5A 1ZH6A 2Q2NA 3T7JA 5BYKA 4CGYA 1C8KA 2XZPA 1IN8A 3NDIA 4AT1A 1MJGM 1D6JA 1THMA 5LYJB 2HJGA 3FHTA 2QUHA 4YFYA 3SJZA 3AI2A 3ABSB 1NW8A 1UXGA 3EH2A 3GRRA 3II6X 4G86A 5CP8A 4W1RA 5TPWB 3IS3A 5J2TA 1GGJA 5EL0A 4EHJA 1VBNA 2ZDHA 2EC5A 2OQIA 4C03A 5PNTA 3BIOA 4O4JF 5TS3A 1P18A 4N01A 2IUTA 3U6BA 1EGVB 1EVJA 1EVIA 1PQ4A 1VL1A 1WQ3A 4ZVMA 2FCRA 2DPXA 3FPLA 4V0MA 4A2CA 4EJSA 3EQ8A 1D1QA 2G4VA 2QI9F 1A7JA 2H57A 3HV2A 1N2CB 3GL9A 5F5NA 1VI6A 2DRIA 5C37A 3THXA 3L06A 3SBDA 3IDZA 2Q1XA 4YUWA 5C3MA 2GD2A 2KW5A 2PKCA 3ABQB 4XIYA 1A8HA 1EJ0A 1P45A 1Q6YA 3EVBA 3K7EA 3FTQA 5KTYA 1BC5A 3JQFA 1A5BB 5F9HA 3DL0A 4QXMA 4X85A 3VMMA 1JYSA 3QKTA 4NAHA 4CR8A 5JRZA 1U1DA 3ZHZA 3U5ZB 1SXJA 4NPCA 2PQ2A 1J2RA 1R8XA 3TRIA 2O1SA 3RT9A 3S5UA 2KE5A 4RK4A 5EKSA 4YMHA 4ZHQB 3MT0A 5B1YA 2VR1A 3LNCA 3R40A 4Q1EA 1Z12A 3W5DA 3HXQA 2IHJA 3EX7C 2IBTA 2WSYB 5K0TA 1LNQA 4PC2A 3F3KA 5ALMA 1XA0A 2O6LA 5T4BA 3DJFA 5JWHA 1GU0A 2CHEA 1ZBQA 2NUAB 3GLFA 1MJFA 3GLGA 1L4KA 3ZKWA 2ID9A 4CUZA 3OLWA 1WEHA 2CYCA 1Z68A 4QFMA 4JBIA 1AO0A 3DQQA 4IHJF 2VNAA 1PUIA 3VSCA 3OEED 4B3RB 1D6SA 3OJXA 2AOVA 3OZDA 3RU9A 1H2EA 4AZ3B 1KH1A 1ESNA 1ONBA 2EXXA 2WG0A 2Y1OA 4DV0B 2C61A 3ZXIA 2R8BA 4ALMA 1KPGA 4HFMA 3QX7A 3FOEC 1X1DA 1I3MA 2FDRA 3DL4A 3RRZA 3ZU5A 5HIJA 4EPRA 5JJCA 3NIWA 2BEUA 4BEWA 1JLLA 1V39A 2PL5A 4WBSA 3VR2D 5C7IO 4LRWA 1VI2A 5EMJA 1BQEA 1TKCA 2C3MA 1OWPA 5AW9A 2C59A 3UWDA 1HNWB 3BJZA 4KP7A 4RM3A 5AJYA 4WJKB 3ZLJA 4ENRA 5IM5A 2QQFA 1BXGA 3OE5A 1CUDA 1XEAA 4ITRC 4B6PA 3C8DA 4AMBA 2HJSA 2JHFA 3ENNA 1GG9A 1ZN8A 4GLLA 3FB1A 2CHQA 4XGQA 2JVIA 2AFVA 1E2PA 1QZZA 1YJQA 3BXZA 4C2UA 2EYQA 4DA4A 2VCYA 4U2KA 1FJHA 5HWSA 3DULA 1N8SA 3HR7A 4RA6B 4TGLA 4XB6B 4E11A 2FA9A 3WDKA 4RFSA 4BNIA 1BWQA 1IULA 3HHPA 1NL3A 4UMDA 4WLOA 1GDHA 4XM2A 4ZK6A 3FFXA 4G09A 1JPNA 1N8KA 2VHVA 3CRRA 1CR2A 1ZMBA 1ADBA 1A88A 4BB0A 2DBQA 1XKLA 1JH9A 3N0XA 3H2YA 3BN3A 3NI2A 1I10A 4J4BA 3OQIB 4KC0A 2YZGA 3M83A 1SPBS 5DHUA 5ESXA 5JS6A 1U9YA 5GINE 5A3RA 3O38A 5AD1A 1N32B 1V25A 1GCOA 2LXNA 1GUBA 3SFVA 1QPBA 4JLAA 4F5ZA 1QQ6A 1C2TA 2OORC 3BTUA 4R0VA 5CFQA 2Q2WA 4GKAA 2MSNA 1ZH0A 3ED5A 3QUSA 3TVYA 1E64A 2V6BA 4EBFA 1XVVA 4L5AA 4DJ5X 5LQJA 1QPGA 5JPIA 2Z8ZA 1U0TA 4YH1A 3MTEA 2AKEA 2ZI4A 3R3VA 1I33A 4UZEA 3EY9A 1AURA 1DJLA 1MKYA 1EX1A 1AZSC 1V5WA 3H1FA 1B76A 3TRHA 1NQWA 4CG0A 5JWOA 2V97A 1L4FA 3OMLA 3EVFA 5BV8A 1CS0A 2J7KA 4MKXA 1WBBA 5F1KA 3DLIA 1UEIA 2BV3A 1TYBE 3W05A 1XAHA 1IK4A 2FGKA 1BD3A 1IQPA 1C2YA 2ACEA 3KPUA 2QTAA 4MR8B 4D1YA 2OE2A 1OYVA 2B9EA 4PO1A 1TYCA 3F74A 4OQQA 5JECA 3SDBA 5KSZA 2GEDA 3DPIA 4M0MA 5CRIA 2RBGA 2V5VA 3LXUX 3V8PA 1U3WA 3A3KA 4K0KB 2CXOA 2V7TA 4DR3B 3S29A 4HS4A 2PXAA 4JC4A 2AYYA 3CVOA 4IS3A 1E3WA 1V11B 4QPPA 3AB7A 1G7SA 4QXPA 1JP7A 1TLTA 1RRVA 3L7IA 3FFBA 2DBYA 4MTLA 3HMKA 4MVCA 1UFVA 5CX1B 3NLLA 4DAEA 2JLWA 4I50B 2QYSA 3GYBA 1TT5B 1N7IA 2ZR8A 2X9LA 4XD2A 4G4IA 4HMQA 4WZAE 1WNTA 5EJFA 1I4LD 4IS2A 4POOA 1BJKA 2OO5C 2DOKA 4R68A 5BYJA 4FZJA 5DBIA 3SZUA 4DV4B 1R2QA 1PS8A 1Z8HA 4G8CA 1E0DA 2V6GA 5INTA 1QC5A 1OLSA 3W34A 2AXNA 5CD1A 1NVAA 1WZCA 2O8CA 1TZCA 1UBSB 3NXKA 3QPAA 5ISMA 2F48A 1R0BA 1UJMA 2BKLA 2MMGA 3JQGB 3FPAA 3L6EA 1KDRA 3MJDA 4LDQA 3W6NA 3M70A 1OILA 3AHJA 4XB1A 4HNUA 2FF7A 3G0GA 4QXAA 3WSWA 5ALXA 4AJ2A 1QDUA 2B0CA 1ZUHA 1G1AA 2BJHA 2NGRA 3LDGA 1ECGA 1FLAA 1I4TD 3KELA 4G5GA 2IEAA 3ELWA 3SX2A 1NG1A 1UMCA 2W42A 3P96A 4M1EA 4EP1A 1M54A 3U7IA 2GBCA 3DBOB 3WSTA 3K32A 5DNVA 4ZAXA 1LTKA 3WBBA 4BGDA 1K0FA 2J9XB 4EUSA 2DHEA 3KSBC 1K5PA 3F8TA 2YHIB 4HVCA 5AJWA 1J39A 1VPDA 1U4SA 2C2WA 4PRZA 4AG3A 1M6EX 1N6PA 2VYCA 3P0RA 4I1SA 3OZGA 3A31A 4Q00A 3F3SA 3T7KA 1WBDA 4B6FA 4MKHA 1KK1A 4DY6A 3GN2A 2NPFA 3HK2A 3VSAA 3VKHA 3TZEA 2PXHA 2I7VA 1SEPA 3CZAA 5EYPA 3X2FA 1D03A 4ENTA 3MGAA 3GLKA 2EGHA 3IILA 3BZBA 3GJTA 4CKWA 3SICE 3UAXA 4C6TB 3V7UA 5CB4F 3R6TA 4R1PA 4HVTA 1TOAA 1K75A 3DFIA 4ADSG 1QR2A 2CFTA 1Z7EA 3QFRA 3QMVA 4MVJH 3UENA 1J7JA 3AJRA 1Z4NA 5FBWB 1NA5A 3A9RA 4D57A 3EXHA 3MG9A 3IP9A 1T15A 1L0BA 4HLDA 3KHKA 2CLMB 3NBXX 1XOIA 1YJBA 1XNJA 2FEWB 3T52A 3S8EA 3U44A 4QEDA 2PUBA 1PSWA 2JBWA 4UUPA 1EK5A 1VSBA 1A5ZA 4JQSA 1OXMA 3AIIA 4X3CA 5CEFA 2CE2X 2ZWVA 1G8JA 1U9CA 4FGSA 2O8EB 3MWDB 2JVJA 1JHQA 4H6XA 4ZQHA 1WDKA 3HWRA 2A5JA 4FUQA 2UZ3A 1IM2A 4GYWA 4EHIA 2HRZA 4LYGA 1Z17A 2H08A 4S1OA 4X41A 3VTKA 4KJZA 4EEZA 3GJYA 1JQAA 4TVOA 4HLUC 4LF7B 5AUPB 3HV0A 3BZWA 3OWXA 3RJ9A 1RCTE 2W6QA 4L8FA 3K8YA 2Q2VA 3UC5A 3NM5A 1A7AA 1RHKA 3E2IA 1NXSA 3SKYA 3RSFA 2ZJ7A 3K0HA 3QOFA 1JGTA 1S8AA 3ANLA 4GBMA 1RRCA 4L0CA 1DJNA 1N0HA 2R9VA 2PH7A 5JARA 1TVCA 3AYXB 4XRGA 1N34B 1HR0B 1KAMA 4ARAA 4UBOA 2X0DA 2GN8A 4INPA 1FFWA 1YDFA 1FF9A 4PNZA 1KEVA 2C4VA 4AI6A 1IZ0A 3AEKA 3AVQA 1YL5A 4KI0A 4JLNA 1Y9JA 1P5ZB 3IVAA 3R7WA 5IUJC 3U1VA 1VQ1A 2ODAA 4RK0A 5DGCA 1XMXA 5H7XA 2ZB2A 1I4DD 2CHUA 4P7BA 3F71A 2VF2A 3UO8B 2H4WA 2PO5A 4CF5A 1P1HA 1SAYA 2AXPA 4EATA 3GLIA 4Z9XA 4B7CA 1VPLA 3V3TA 2C8KA 1XGKA 3RU2A 1GA1A 1G21A 1Q74A 2G88A 5C46F 3PFGA 3N2YA 3GU3A 1F4PA 4YDSA 1H3NA 2C0QA 4XA8A 3HUDA 1EHIA 1XXHB 1SHKA 1PQWA 3KTFA 3KZXA 1JEOA 3Q3VA 4RTKA 3C15C 3FE2A 5H8WA 1QRDA 4KQ2A 3P9XA 2OC9A 4EKGA 2IXTA 3RSZA 1IWBB 2R4QA 4HRVA 1U9JA 3GNQA 1TFRA 2B98A 2UZIR 4FXOA 5T57A 2GCEA 2GFQA 3OE7D 1BDIA 2IPLA 1QFJA 2C57A 1J42A 3ZY6A 1KTIA 1KJJA 3COSA 3G17A 1O97C 2CJPA 1CFJA 2QY6A 4MDFA 2ZB8A 5AK5A 3TNDA 1IWPB 1JTVA 5HOQA 3THWA 1W6RA 3IUBA 4INJA 2XCRB 4Y9UA 5HP4A 4GICA 1KKUA 2DYKA 2BH2A 1G64A 1FMJA 1PW5A 1XTIA 3EWSA 4C7VA 1TQ6A 4D4GA 5JD6A 2BR5A 3CR3C 5DN6A 4ECAA 3DFFA 4Q9IA 3GEBA 1ZH4A 1CJCA 3K4HA 1E89A 5CNIA 1I2AA 1Q0HA 3MWEB 4D9CA 1N0IA 3J81A 4EB8A 2GFHA 2QRGA 4L0DA 4RVOA 1TUEA 2Z9DA 1TMKA 3I6IA 5KBYA 4U2CA 2AOTB 3JVEA 4D0LB 1JMVA 4RA9B 4M38A 2WLTA 4YJ2F 4Q7KA 1T5IA 2HJVA 3LPLA 4N9WA 3Q7IA 1GPKA 1YOVB 4O3MA 2PZFA 4GLJA 5BSMA 3DCNA 1KJQA 1TCBA 3H8WA 2QR5A 2AJTA 3PQ4A 3ZDFA 1YA8A 4ID3A 4LYHA 1FA9A 5UKDA 4JI7B 4BLTA 1K92A 4EFLA 1XPOA 2HTFA 2IP4A 4BQNA 1N6KA 4GP7A 4XEUA 3KPVA 4U7GA 2OQVA 3FTNA 1K4MA 1JQJC 3EXG2 3JX9A 2JAWA 4ND8A 1MLDA 4ZDWA 1P1FA 2NO6A 4GH5A 2PNJA 4QL3A 1RKXA 2QRVA 3CUYA 1ZXXA 3LZ6A 2RMKA 3VXKA 1E2FA 4GAEA 2BGJA 4BU0A 3IELA 3IA7A 3JVDA 1GAEO 1JHVA 1SVUA 3ZX4A 4QM7A 1YONA 1TM4E 4LVOA 1X0VA 2J9YB 1BEZA 3NRBA 4V24A 4TMYA 2G0AA 5C1PA 1YHYA 1RLMA 3ZWKA 1ORRA 5GJCA 2COUA 3EDMA 3VHXA 3WA6A 4B83A 3TECE 3MRXA 3ZHXA 5ERGB 3V7YA 3I30X 4BKPA 2QBYB 1YA6A 1Z7WA 3WI7A 1T5HX 4PYKA 2Z4SA 3BGSA 5A5GA 3H4VA 5DXJA 4QLAA 4I4NA 1C4WA 1XEWY 4BKQA 1C7JA 3JQDA 4AAYA 1BWRA 3D3EA 5GIOE 1KDYA 1ZJYA 2CK3A 2L17A 2YOFA 4QOGA 5AMXA 1SOAA 1UPTA 2I33A 2YZNA 1EVYA 3H3FA 4FUTA 4Z8YA 3WLPA 2FEAA 3CR8A 5H59A 1NQAO 4UARA 5ULLA