2ZPTX

Crystal structure of mouse sulfotransferase sult1d1 complex with pap
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
DVFRRELVDVEGIPLFWSIAEHWSQVESFEARPDDILISTYPKSGTTWVSEILDLIYNNGDAEKCKRDAIYKRVPFMELIIPGITNGVEMLNNMPSPRIVKTHLPVQLLPSSFWKNDCKIIYVARNAKDVVVSYYYFYQMAKIHPEPGTWEEFLEKFMAGQVSFGPWYDHVKSWWEKRKEYRILYLFYEDMKENPKCEIQKILKFLEKDIPEEILNKILYHSSFSVMKENPSANYTTMMKEEMDHSVSPFMRKGISGDWKNQFTVAQYEKFEEDYVKKMEDSTLKFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-ester sulfotransferase
publication title Crystal structure of mSULT1D1, a mouse catecholamine sulfotransferase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 107
structure length 288
sequence length 288
ec nomenclature ec 2.8.2.9: Tyrosine-ester sulfotransferase.
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zptX00
5E4FA 4GDFA 1FP7A 3X1WA 2C2HA 3T1VA 2F1RA 3LQRA 1VYVA 2QMUA 3PV0A 4FCVA 4QJ4A 3PR1A 1NVXQ 4FWTA 3VR3A 3B1YA 1XD2A 5GVRA 1ZW6A 3W9YA 1O3YA 2P6RA 3OEHD 3TK1A 2V9PA 2OT3B 2NO6A 3Q7QA 3VQTA 3EA5A 3O8DA 2WWGA 3QJYA 2PLFA 1PV4A 2WPDA 1LVGA 2WKRA 2QORA 2QM7A 4KSCA 1XTIA 4XTCS 1H8EA 2HV8A 4UQOA 4G5SA 1PZNA 2Z0MA 1RKBA 1FL9A 2WHXA 3T06B 4BRWA 5CM8B 1KO7A 1FFHA 4TZ6A 2VL7A 4C0BA 5BXQC 1AIPA 2IEZA 4P31A 3MWYW 4B3CA 2QMEA 2JLYA 3NIBA 1ZMXA 3T5GA 3E1SA 5JCPA 3K0AA 1KO1A 4MKHA 2ZJ5A 2R62A 4C3ZA 4AKEA 2ZI6A 2QP9X 1U9IA 3REGA 4FWIB 4HYYA 1FW6A 2RGGA 5G40A 2QT0A 2DYKA 1XEWX 2KBEA 4PO8A 5H1YA 1DADA 1E1QD 1U0LA 2BIFA 3KJHA 3PQCA 5SZHB 3ZS8A 5GVSA 4HAVA 4KI0A 4MRVA 2ODNA 5KDLA 4UNPA 3ICEA 3F5FA 1M34E 3OEED 1S1MA 4HUTA 4BFSA 1M7GA 2NOAA 2ZSAA 3RS4A 4KYUA 4B3XA 3CLVA 2EWVA 1Z0IA 2ZPTX 3CRQA 1W36C 4GP6A 2LWIA 1QHHA 3B85A 4Z8XA 5JSZB 1Z0AA 4FD2A 1GG2A 4AYTA 2CL6X 3MMPA 3VTKA 2O52A 1R5OA 2CHVA 2QRNA 2HF8A 4YDSA 1BIFA 3WMFA 4DSUA 1SVMA 1H65A 3HYRA 5J4VA 1N6PA 4CYMA 2B92A 4KXFB 1JPNA 2H18A 2WKQA 4URWR 2RHDA 4MYTA 3RS3A 3EZ6A 1U98A 4M9XA 5CITA 4NBSA 3AQ4A 3DDCA 1UDXA 5IRCD 4W9MC 2J7PD 2VSOA 3OFND 1KI6B 4UXHA 2GJSA 3CRVA 4XWAA 3UPUA 3THWA 1FQJA 2RGXA 2VP9A 1FMJA 2ZVQX 4Q18A 3PVSA 4D2IA 1F6BA 3KFXA 4POAA 3CNNA 3X1DA 5DHFA 4ZDIA 1NBMA 4ZDJA 2DFLA 4BZXA 2DPXA 1UADA 2JDID 2WWIA 3QI2A 1B23P 4Q9HA 5TARA 2QTFA 3QE0A 3NHAA 4RSGA 4DSTA 2QTHA 4QL3A 2IS6A 2N46A 1SVOA 1YR8A 3QF7A 5EQTA 2Q9CA 4Q4AA 1DTSA 2EU8A 3UWOA 4C0AC 1DVRA 2OHFA 2CE2X 1SXJB 1OPXA 2JLZA 1TF2A 2ZRJA 4K81B 4DCTA 1KNQA 5GJWC 1Z6AA 5DYGA 3C5HA 4ZKDA 2ANCA 3PCRB 3ASYA 1RZ3A 4V02A 3CONA 2GDJA 2BMFA 2FX3A 2WSMA 1Z06A 1DARA 5JS7A 2GRJA 1XMIA 2RHMA 4US0R 2VF7A 4D6PA 3H4MA 3HP1A 3PEVA 3AF0A 4TSFD 2GILA 2OBLA 3W8NA 3L82B 5KU1A 3KQUA 3I61A 3WMEA 2PL3A 1OFHA 2BMJA 2PJZA 1YKSA 1UJ2A 1XD8A 1Z3IX 1GL7A 1KI3A 2R6DA 1XPUA 3V9PA 3TIFA 5H8WA 2YWFA 3WRXC 2O8BB 1KO4A 2XGJA 2ZRLA 1EXMA 3CF2A 3GJ7A 1WCV1 2C95A 4P0TA 4BEBA 4DLWA 3I8XA 1G3UA 3OAAA 1TQ2A 1W0KD 3CR7A 3OHMA 4URYR 3W6NA 3WNDA 4TLCA 4PC6A 2HXSA 3P27A 4OHVA 1N6RA 2IYWA 4U7DA 4M0LA 1P62B 2FF7A 3H0KA 4HDOB 5H70A 4PC7A 4QGAA 3A4MA 1DAFA 1AS2A 1UBFA 1KK3A 3ZD7A 1HV8A 4WW0A 3RRYA 3KB1A 3QY0A 1KO8A 4Q7LA 3B2EA 2UZIR 3KXLA 1RRGA 4URXR 4DRZA 1IONA 1ANKA 3UMSA 2KWIA 4KO8A 2P0EA 5A5GA 1WMSA 3VKHA 1HT2E 4Z1MA 3ASZA 4YMSA 1H8HD 3SHFA 2DY1A 4MH0R 1W4BA 2VHJA 3U2QA 3K70C 4DLUA 4BASA 1NIPA 1OXXK 1P9RA 4PC2A 1DAIA 3VU9B 3CWZA 4D4JA 3L2OB 1T6NA 1N6HA 2RCNA 2JEOA 1FMLA 1E0SA 3HU3A 3P32A 3THOA 2FGKA 2JAQA 1V43A 1GUAA 1P60A 4GOJA 4UKDA 2QSZA 3W3ZB 1JAHA 4MKFA 1UKVY 4GP7A 3QPWA 1LF0A 3Q5DA 4HATA 1IY1A 1U90A 1Z47A 4C4PA 1SXJE 3VKWA 3IPXA 4AG6A 2EFHB 2VF8A 3CPEA 3WBJA 2J59A 4ITRC 3B1WA 1OXUA 4DUGD 2A3RA 1NY5A 2VSFA 3U7EB 2WIBA 1CF4A 1E2JA 1G6OA 2HCJB 4URZR 1ZYUA 4KFRA 1RW4A 3A1WA 1SVSA 2QBYB 1PLKA 4F91B 1N0UA 3IGFA 4ZO4A 4B43A 2IBMA 1IM2A 2QT1A 4LC0A 2Q3HA 1IOZA 2F9MA 4GFDA 2PBRA 2CNWA 4JLJA 4LC1A 1VG1A 1GP2A 3KZ1E 4LJ9A 1E79A 2ZI4A 3KUDA 5HCIA 2OBMA 1W36B 4PX9A 1LTQA 2B6HA 4OQLA 4PANA 2BMDA 2FFHA 4ZI2A 4GMDA 1D8TA 5KOYA 3RDPA 4QKQA 3OIYA 1MRNA 5LD2C 2ORIA 4ILEA 1JQJC 4ASUA 5SZIA 1ODFA 1OFUX 1IN5A 3GJ5A 1NVVR 4DZZA 4Q9IA 4WBSA 2Q0HA 2LKDA 4DBLC 1X86B 4QOSA 3GLGA 1L8QA 4Y0VA 1Q3HA 4W5WA 5DI9A 3M4YA 4JLAA 4OI0A 2FSHA 4KFSA 3ZIAD 1WRBA 5DN6A 1E9CA 4CDGA 1CKEA 2FNAA 3AVQA 4PZZA 2D7DA 5KDOA 1K6MA 1AZTA 4LBYA 1Q21A 1S1CA 2A5GA 4M1YA 2FGJA 4Q9LA 2D62A 4YMWA 1VPLA 1JR3E 1XEWY 4P4SA 4HAZA 1AM4D 3QG5A 5F98A 3AGPA 4LDJA 1E0AA 4N3NA 3TNFA 5A0FA 2L0XA 1GFIA 2WZQA 1NN5A 4OK3A 3RAPR 4EPRA 4M1MA 2J0UB 3KXKA 1J8MF 3CRMA 1SKQA 4CW7A 5FPKA 2P6NA 1G3RA 1PVOA 3HR7A 1TF5A 2QSYA 3AM1A 2WJVA 1LV7A 2VEDA 4XSHA 4M8NE 4QGFA 1RJ9A 1RRFA 1R2QA 1G8PA 4NYJQ 4B76A 5L3SB 4R2IA 1IQPA 1OH5A 4C0SA 3QEOA 4MRNA 3GLHA 4FMDB 4OK6A 1XD9A 4PAQA 5CIQA 2IHYA 5DGXA 5J5CA 2DFNA 3VX4A 4W5HA 3VMFA 4A9AA 3AH8A 4HZUB 1RIFA 1MO3A 4NDZA 2GHIA 1FTSA 1QG2A 2DBYA 1N6LA 1VTKA 3LX8A 2GCOA 4FI3C 1U0JA 3NEJA 1WDTA 4L15A 2WJHA 4DKXA 3MAAC 3NBXX 4EPVA 2V6IA 4GI7A 3QNUA 3GLFA 2XTNA 3TMKA 4LOAA 2ZRBA 4CT5A 4NYIR 2BCJQ 1KNXA 2OCYC 5JWHA 1QHYA 2GXUA 4Q1EA 3B6EA 5EP2A 4GL2A 3SFVA 3NHBA 1G20E 1DAGA 1S96A 2FZ4A 2F3TA 3BXZA 2YZ2A 1GOTA 4JL8A 2VP0A 4IVRA 4NONA 1B0UA 3K9NA 1YZLA 2ONKA 2Z6VA 2R2AA 3U44A 4D4LA 4DC9A 3QKRB 3CIOA 2BBOA 3BS4A 3FGNA 3BBPA 5B30A 4DDWA 2GWHA 4F4JA 1X8KA 5B58C 4U00A 1KAGA 2V1UA 1Q1EA 1N5LA 1M7BA 1E2EA 2H5EA 4Q4HA 4A92A 4EJSB 2GZDA 5B2ZA 3G0HA 2P3SA 1II0A 2EFCB 3T5DA 2WMOB 2C98A 4DEYA 1M6NA 3A1UA 3ADBA 2XXAB 3SYKA 3RC3A 4GMXA 5FPYA 1GKYA 1N6IA 3KQKA 4A0FA 1GAJA 2VH5R 3U4QA 4CEJB 2BHRA 3LV8A 5EE5B 2A30A 2F1HA 3CX8A 2B21A 3EPKA 4LPSA 2O8EA 4F7WA 3NWJA 4YLGA 2W00A 4C7OB 3NTUA 4HUQB 4PSVA 3U3RA 4YMVA 4JKYA 5L8VA 2IYTA 1OKKA 3KKNA 5FPHA 2CK3A 4K46A 1OV4A 1TPZA 2G3YA 1NLZA 3BH0A 4FMCF 4JIMA 2NO7A 4I1UA 4B34A 5TMPA 4M21A 3KL4A 5KPDA 5CLLA 4X8MA 3ONWA 3WHLA 1IHUA 1JPJA 1OSNA 1Z6XA 1AGRA 1JECA 1NN1A 1TEXA 1YQTA 1DO0A 3PUWA 3T1QA 4B47A 3CH5A 2VHTA 2G77B 2ZYTX 1XCPA 4QM6A 1VKJA 1AS0A 1G3QA 1M7HA 3A4NA 3B78A 3R9WA 1R4AA 2ZU6A 4L8GA 3R9IA 3CBQA 1RE0A 3AV0B 2XOKD 1ZC3A 2E1RA 4LUCA 2G1KA 4ZIRA 2YV5A 5KNDA 5D3MB 1FZQA 1BO6A 3GEIA 2IL1A 4JLMA 5DNYB 1W5TA 3TSZA 2OLKA 1TQ4A 2C03A 5GJCA 1IXZA 2QMOA 1NLYA 2P65A 5CK5A 5TB5A 1N25A 1NRJB 4QG7A 4TT3A 3EARA 4M53A 5EE3A 3TUZC 1YHNA 4EIWA 4EPTA 2R6AA 1A2KC 4RZ3A 3T35A 1W36D 4CEHB 2PMDA 521PA 2J9RA 3MJRA 4LWZA 3ZQJA 3OAAD 2FPKA 1PLLA 2D74A 2IXGA 4Q1DA 3I1FA 4ZCMA 2R6FA 4PSKA 4IDPA 1WB9A 3FVQA 4L5BA 3PUXA 2QPTA 3T34A 3UG6A 2O0HA 3SDZA 2J5XA 1QZXA 3C16C 3K0SA 3LNCA 1G291 2NZ8A 2P6UA 3GJXC 3H84A 4NCKA 4KV9A 4JLVA 2YC4C 4WZ6A 3ZYCA 2LCFA 2BBWA 1N2CE 5GADl 2WWHA 1CR2A 2Z43A 3AKDA 1P5ZB 4AYXA 1X3SA 1UKEA 4EFLA 3V00A 2O8FA 2KBFA 4WZBE 5AUOB 4Z1MD 2RGBA 2WJGA 2G0NA 1S2MA 1TX4B 3K0CC 3NC1C 4M1SA 4V0LA 3W6OA 4DLYA 3U3MA 2ZJZA 2H57A 1D5CA 2QY9A 2CJWA 4LBVA 4V0NA 2BKEA 3UKDA 4Q02A 5AJZA 4X8LA 3RABA 1R6BX 5KDDA 5L3QB 1EESA 4S2EA 4Q7MB 2WAYA 2QI9C 4DDTA 2BBSA 1AN0A 1F2TA 4R9UC 4QJ3A 3FHTA 2FPMA 4XD7D 4AKHA 2EYQA 1J2JA 5FOVA 2ZI3A 1HUQA 2OXRA 4TTRA 3ZVNA 2ZEJA 2ZRCA 1RFLA 3MWLA 4GNKA 2ZSFA 4N0DA 1SHZA 4TZ0A 3A6PC 1GZSA 1MABB 1E6CA 5CLQA 4HDCA 3TE6A 1WQ1R 1P2UA 2IF2A 2JJ1A 5JMTA 1N5IA 4AYWA 1IN8A 3P26A 4GZLA 3UXMA 5JI2E 1XNJA 1CLUA 1U8AA 2ZUCA 5EXSA 1L4YA 4XWOA 1T5LA 3K0FB 4OJKA 1US8B 4MYHA 5JJLA 1CRPA 2CNWD 1G7CA 1KOFA 4PHHA 2J45A 4HLQB 4FINA 4TYPA 4D4MA 4XWKA 1TNDA 3D8BA 1DAKA 2P5SA 3AKEA 2NMVA 2VP2A 2F43A 4O25A 4N1AA 4PSAA 4A1FA 3BC1A 1L4UA 4HZIA 4ASUD 2RGAA 1GDDA 4C2TA 4TTPA 3U6BA 2ZANA 5G3YA 4LHXA 4NH0A 3DL0A 4BRUA 4Q4JA 3DMDA 4LX0A 4B3BA 1E2FA 1XTJA 3D7MA 3PUZA 5B57C 1G1MA 2CDNA 3BGWA 4TMKA 1RRCA 4EQ6A 2HUPA 2CCGA 2JGNA 3VFDA 2JLQA 1BYIA 2CLDX 3KKMA 5CB8A 5DN6D 3T61A 3VNVA 4CVNA 3PG5A 4EDHA 4Z8YA 1Q0UA 2JLVA 5FR2A 2AKYA 4MUBA 4AURA 4WVFA 4BLQA 3K0CA 3AF2A 4OHYA 3K70D 4DLVA 2BJVA 4LHZA 5LBIA 3L0OA 4NZYA 5E7IA 3IIKA 5JECA 1AGPA 4HB0A 1U9IC 4LY6A 1ZU4A 1R8QA 2OAQ1 2X8AA 3R7WA 2P67A 1D9XA 3THYB 3SN6A 2HJVA 2K5UA 2VYFA 3AGQA 2GXAA 1NMXA 3B82A 4P4TA 1GIAA 3DOFA 3QXXA 2DFTA 3BB3A 4YC7A 2IUUA 4IFBA 2C04A 1T5IA 2IYXA 5FOUA 4B32A 1HQCA 1I4TD 1GSIA 2FSGA 1GL9B 4FMBB 3RS0A 1UBGA 1VDZA 3AF1A 4RJLA 3M0EA 1XEXA 5EXPA 1W2GA 1KJWA 1Q44A 3LAWA 4RZXA 4WOPA 3HPQA 1OW3B 1CR4A 1C9KA 2NZJA 2ZSDA 1SGWA 3CNOA 4PAMA 4XVUA 1DOAA 3CB4A 4I1OA 3BH7A 1E99A 2JJ8A 5EUMA 2A2ZA 2CCJA 1E9AA 2JIZA 1OXSC 2OESA 3I5XA 1II9A 1P73A 4QHYA 2XX3A 1D9ZA 3IILA 1JB1A 4PQYA 1NSFA 2IW3A 4KLNA 5E3HA 2H8KA 3O8RA 1FNMA 3MRSA 3QIAA 1LW7A 1G8YA 2GJ9A 5JJKA 1G7TA 3ZQ6A 2F7SA 3K0EA 1BS1A 5IT5A 1KTVA 4DB4A 2B7BA 1Q3TA 1W0JD 1UDWA 4QGHA 3ADDA 2R6GA 4MQBA 4CEIA 3LBHA 3SJZA 4ZI3A 3I62A 1VCIA 4FIDA 4ON9A 3UMRA 4NU0A 4R98A 1ZJ6A 3I4LA 1KO5A 5J4YA 4LK2A 2BVNA 1BOFA 2AX4A 5BYKA 3E2IA 3WBKA 5CDFE 5L3VA 2IS2A 3HDTA 5E7MA 4YXWD 1EX7A 4MKGA 4D80A 3G5UA 2O8CA 1WF3A 2WJYA 3BIFA 1R0ZA 3AP2A 3N2EA 2OM2A 2JCSA 1S9DA 4DSOA 1ZU5A 3WYGA 2ZREA 4AKIA 1KSFX 1D2NA 5TV2A 2YWGA 2ZSBA 2REOA 2TMKA 4CRWB 2ZJOA 4AK9A 5FBLB 3LXRA 4D4KA 5G53C 1ZD9A 3AF4A 4GSYA 3THXA 5EXTA 1ZM2A 3IPYA 1VCNA 2FJUA 1ZNYA 3B8HA 1OXVA 5L3RA 2OEPA 1OKKD 5FH9A 1Z5ZA 2CK3D 5KNBA 3SZRA 1N0WA 2PH1A 5FUWA 5J40A 4TN1A 1GM5A 4NYJR 1EFUA 4HLDA 1KGDA 2IHBA 1LS6A 3QKSB 2W0SA 3HWSA 4LHVA 1JBKA 2A9KA 1CULC 4I81A 2H92A 3R8CA 1Q12A 1GVNB 3LRPA 2QE7A 4PQRA 3EWSA 1R0XA 1EFCA 1X8JA 3TLXA 2VSXA 4PC1A 1T8UA 2ZAOA 4F92B 3B9QA 2V1XA 2A5DA 2CHGA 3BB4A 4ARZA 821PA 1KDPA 1N5JA 1KAOA 3ZJYA 2QA5A 1OYYA 1F2UA 1DO2A 5DHAA 4DT1A 3SJAA 6Q21A 1CTQA 3PEUA 3U3JA 3DO6A 4HLUC 1XFAA 3AKYA 4ERNA 4ZKEA 5A4JA 3HR8A 1G4UR 3KX2A 1SVKA 1ESNA 1CJKC 3L8YA 3C41J 2QPAA 5AR1A 2C99A 1UAAA 4TT3D 1N6KA 1A5TA 3SJBA 1XD2B 3FMOB 1S3GA 2HF9A 3H2YA 4IRUB 3SU8A 4RFSA 5CJPA 1IN4A 2QGNA 1O87A 3L8ZA 1QG4A 2QAGC 3PUVA 4O2RA 1QHNA 3QOFA 3KB2A 1JEDA 3R8FA 3WMGA 3FB4A 3AVVA 1DS6A 2CL7X 1YZQA 3IHWA 4TMTA 1KDTA 4A6PA 3U6KA 2CHQA 1K5GA 4KYIB 1S4QA 4FCTA 2BV3A 3R9XA 1YE8A 4U5XA 3LO5A 1W2HA 1HTWA 1OYWA 1XZPA 2R8RA 2X1VA 3QVUA 1W4CA 2RH5A 3K0AB 3TSWA 4A8JC 3IEUA 4BFZA 621PA 4LBZA 2ZJ8A 2ATXA 4OQMA 3EPHA 1HT1E 2DCUA 2VA8A 4Q7JB 3FMIA 3KTAA 1FOEB 2XTMA 3ZVRA 3GJ0A 5AUNB 4M2LA 3C4JA 4JSTA 1GKIA 3K9HA 4IW3B 4LCBA 5LB4A 1J90A 2CEAA 2ZSEA 2GCPA 5D3QA 4B3GA 4A0HA 4OKSA 4OQFA 1TUEA 5EP4A 3U3OA 1UEJA 2XZLA 3DOEA 3SEAA 1KSHA 3OE7A 1QHHB 2A5JA 3SBEA 5JS8A 1CBUA 1M1YE 2QNRA 1TUIA 4JZKA 4MA4A 4C0LA 3PIRA 3QG1A 4KVAA 1ZUIA 5FBRB 1ZIPA 4RZ2A 4OI1A 4DDUA 5KO2A 1XCMA 3EG5A 3WP1B 2V3CC 3E5HA 1OHHA 4JLDA 2IXEA 3J81k 1QBKC 1W4RA 3GQBA 3K9GA 4TMZA 2DWOA 2JJ1D 4BLRA 4DLTA 3B5JA 3SS8A 4HLUA 1RVDA 4DLRA 4LJ4A 2YOGA 3SHWA 4D26A 1Q20A 3HU2A 2WV9A 1N5KA 1MRSA 3MJHA 3THWB 3SFZA 1MO4A 4PO1A 4RD0A 1P2TA 3NKVA 2ZS7A 2GJAA 2GEUA 1ZINA 1OF1A 3IUYA 2GF0A 2R44A 2QAGA 2XSZD 4B3FX 2GNOA 4TTQA 1AS3A 1QHXA 3LBIA 5HKKA 1ESMA 4LV5B 4MYCA 4LYFA 4Q4AB 3DM9B 4P3YA 4IOMA 2OE2A 1G9XA 2QEQA 2QTVB 3SNHA 4A8JA 5KYKA 4JJZA 2CVHA 2DFKB 3K1JA 4LSGA 2RGEA 4MGKR 3LX5A 1SULA 4KSBA 4BZQA 3ETLA 4E22A 2PCJA 5KHOC 3B60A 4CT4B 4AC9A 4NCNA 4P4UA 4JYBA 1E2DA 3CR8A 1KHTA 4NHOA 1I2DA 3W5IA 4B2IA 3ZLJA 1J99A 4NL4H 3EIHA 1MOZA 1NI3A 5C4GB 1U8YA 1HQYE 1KJZA 2GAOA 2AR7A 4II7A 4WXRA 1KK1A 3CRW1 4TMVA 5TVKA 1HY3A 1E4YA 3RRZA 5EZ6B 4FXPA 1G8HA 4YQFA 2DWPA 2ZYWX 1KJYA 2WOJA 3IDQA 4BWYA 5JFGA 1D6JA 1ZM3A 3ND8A 5FTJA 4A6XA 4EPXA 5FUVA 1Q1BA 4RD6A 4RCYA 5HTKA 1Z0KA 3A4LA 2HLDA 5EZ5A 2JATA 4GOKA 4DHEA 3RWOA 4OHXA 4B6FA 1FUKA 2YWEA 1GNPA 2HEIA 1AQYA 2VHUA 3Q8XB 5FFMA 3ZVLA 1NSTA 2VHCA 5JLJA 1G5PA 1N6NA 2HJGA 4KAXA 1KZGB 1G6HA 3CW2A 1MKYA 3KJGA 5BN4A 1KK2A 3PUYA 5TY0A 1NNEA 3MSXA 5SZJA 4GOXA 4BFUA 3EA0A 1NG1A 1XF9A 4LV6A 4QNRA 1EWRA 3ADCA 1E2QA 2AD1A 3MGCA 1AKYA 4PAOA 4EPYA 2FA9A 1QDEA 5EJEA 4TLEA 2XJ4A 4US2R 1ZD8A 2JIZD 1E1RA 3KKPA 4QBGB 2Q3FA 2I3BA 4GZMA 3H86A 1NBME 1JALA 1E2NA 2IA5A 3LH5A 1YZTA 1Q1ZA 1QHIA 1NN3A 5JZVA 5K8IA 4I1SA 4N0EA 1CJUC 4L9WA 1XTQA 1E0JA 2MSEB 3FKSA 3EZFA 5FBQB 3DKVA 4G5GA 1GTVA 4LJAA 2QRZA 4UNSA 1GNQA 2WPDD 3QF4A 3LDAA 4Q47A 1H8ED 4A0GA 3M1IA 1DBSA 1SVIA 4IDHA 1E3MA 4G0NA 2QM8A 3SE0A 4EKDA 2AFIE 2FFAA 3NBYC 4XSGA 3UIEA 2O0JA 3TR0A 2CLSA 2JLRA 3ECCA 2EVWX 3TH5A 4Q1CA 3NDPA 1P4SA 1NKTA 3IIMA 4QM7A 5JRZA 3U61B 3DM5A 2AHOA 4H9GA 1YZKA 1E2LA 1EFRA 2GBLC 2WICA 1T4GA 3B13B 3F3YA 1MR3F 4JKIA 4RKEA 3TRFA 3VR5A 1CEEA 2C9YA 1R8SA 2BJWA 3OIUA 1KI2A 1VYUA 1YJ5A 1DAHA 3GFPA 3FDIA 5BQ5A 3B7GA 4A36A 4M9QA 1OH7A 2ORVA 4A2PA 2YHSA 2GVDC 4JL5A 4JLOA 1U0HC 5FI0B 3AVTA 3GLIA 3GLGB 2QPOA 1XCGB 3D6TB 3F0TA 5J47A 1M2OB 1ZP6A 2GTPA 2H1LA 4BUJA 2NTYC 3P20A 3EPJA 1ZRHA 3KXIA 5CIWA 3AVWA 3L43A 3GJ3A 2QE7D 2JLXA 1G3IA 4JBXA 1XXHA 1Z29A 3KQNA 3FMPB 1XX6A 3RLFA 2X2FA 3K70B 3C7KA 2IYQA 2DHRA 4Q9KA 4P4SB 1UPTA 2RGDA 3ZZTA 4JLBA 2ERYA 5LB2A 1ELOA 3RRMA 3X1ZA 3SQWA 2DWQA 3BB1A 2EFEB 4JLKA 4Q9JA 1E2IA 1F3OA 2ZRAA 1GITA 2ORWA 1G4AE 1MV5A 4KITB 5FI1B 3PXGA 1ZM9A 2ZE5A 1T0HB 1R5NA 2H17A 3U7GA 2PZEA 2BCGY 1RJ9B 4MYUA 5AUQA 2AK2A 5DSZA 1II8A 3SYNA 1NBMD 221PA 3C14C 3LLMA 5HE9A 3GLHB 5FOTA 1Z2AA 3EXAA 2CVFA 2VP4A 3AUYA 4KVGA 2V8OA 2FV8A 1NMZA 3SBDA 4B2PA 2G9NA 4EFNA 3WRYC 4M22A 4ZDKA 1ZVQA 4G1UC 2ERXA 5ANRB 1YZGA 421PA 2YWHA 3TBKA 3QPVA 2GCOB 3UG7A 2ZR9A 4HB3A 1PJRA 1UEIA 1ZNZA 1PLJA 3LW8A 3O8CA 4DIDA 2BWJA 2RGCA 3GLFB 2GBLA 1FUUA 3HYTA 4W7SA 3FYHA 4BEJA 2VLIA 3C8UA 2AFHE 2FEMA 4KBFA 1OB2A 3EZ9A 2V6JA 2QP4A 5F2EA 5E7JA 1EWQA 3QXSA 5LD2B 4TQ9A 4IJMA 1VHLA 2R65A 3G82C 3NEYA 4BFWA 4YDHB 4JT2A 5EP1A 4P33A 2HCBA 4F4IA 2ZR7A 4O2LA 3TAUA 1P9NA 2CXXA 3U44B 2GCNA 1Z63A 2J41A 2G1JA 2XAUA 3NVAA 5JEDA 1VYTA 2IYYA 1XB2A 2ZRKA 3I92A 5FL7A 3GLIB 2X2EA 3QKUA 1YZUA 1VCMA 4Q7KA 1C4OA 4AIIA 3OE7D 3S1AA 2DR3A 2PX3A 1CP2A 1HA3A 3GLGE 2XB2A 2FFBA 2JJ2A 5FTLA 3UMFA 1E94E 1Z28A 3DMNA 4TYQA 1WXQA 4Q4HB 3WNBA 4C9BA 2C9CA 4BLOA 2EQBA 2NPIA 3BWDD 4UNQA 5EE1A 3WXMA 1OHHD 2I4IA 1P75A 5JWRA 3EASA 2QENA 2ODEA 3W8RA 2OZEA 5DIFA 5FBVB 2P5TB 2GK7A 1R0YA 2Z5FA 4C0JA 2ZRDA 3DZDA 3NDBB 3U4QB 1FX0A 2FG5A 3LW7A 1G19A 3EZ2A 3MCAA 4GBMA 2O8EB 2XB4A 1BKDR 2A5YB 1E2GA 1OLOA 4ZPXA 4BLSA 4O3MA 2OBNA 2O8DA 4BFYA 2OSBA 2N42A 4PZLA 3FWYA 1G7RA 2ZJAA 1C1YA 3SR0A 1BYUA 5AJVB 4LPKA 3L0PA 2RAPA 1K8RA 3I72A 4JYCA 1SVWA 1OXTA 1OB5A 2IYVA 1W7AA 4M1OA 5KTYA 1W47A 1FTNA 3GLHE 1EK0A 2WBLC 2MMGA 3LVRE 4M9ZA 3CKLA 4D82A 1E9FA 2V55B 1X1SA 1XTKA 1E9RA 3QBVA 1QRAA 4TL7A 3PEYA 1F60A 1JJ7A 3Q9LA 1GNRA 2ZRIA 4MUAA 1GRNA 2QP3A 3VR2A 5EE9A 5G3ZA 2REXB 1EFHA 1W0KA 1KKMA 1TADA 3IKJA 5CYOA 3W34A 1CJTC 4ZIRB 3GLFE 2LKCA 2XTZA 3DHWC 1AA9A 3IQXA 3X1YA 3OF5A 1IN7A 3ZDQA 3TJZA 4EPWA 1WA5A 2N1BA 2J0VA 2HDNB 1COWA 3A58B 3TSOA 2EFGA 4PQFA 1KMHA 1ONBA 2IX3A 3ICQB 3Q85A 1Z6TA 3X1XA 3KQHA 1CU1A 4XVQA 2GZHA 2GF9A 1NN0A 2RB4A 4B44A 4K8OA 2ZETA 2P2LA 1E79D 3K09C 2YOHA 5CM9C 3BFXA 4F4CA 3P4YA 1SHKA 3DZ8A 1VIAA 3L0IB 3NG1A 4W5JA 4BE7B 2GVZC 4MITA 2FEOA 1ZM4A 3SJCA 4E09A 3FFBA 1E9DA 3GLIE 5IK2A 2ATVA 1IN6A 4DDVA 3BAFA 5KUTA 3EWAA 1LF5A 2ZUDA 4KODA 5HCNA 4LI0A 2HLDD 4KFTA 4ZDWA 5KSYA 1SQ5A 1T8TA 4HAXA 1HE8B 2VTKA 4KJZA 5EXXA 4I4LA 1OH6A 5DI3A 5KNCA 3GPLA 1HEIA 5JHGB 1XXHE 4NKRA 2FZLA 4Q4LA 2IUSA 1Y3AA 2IUTA 4KBGA 3BH6A 3V4RA 1NMYA 1E98A 2J3EA 2V7QA 1OIXA 2FN4A 2J0QA 2O5VA 4RFVA 1KDOA 2H7VA 4MGYR 4IVQA 1SZPA 2BC9A 2KB0A 3Q7PA 5K8LA 2O8FB 3BJIC 1KI4A 3QKTA 1TEVA 4MDEA 1ZNXA 3BK7A 3FHOA 3CRRA 4HB4A 3CNLA 4DUGA 2CJWB 4JVLA 1OIWA 5J4LA 4PPQA 1E1RD 1SVLA 1Z83A 2YJTD 2F55A 1TL7C 2WSSA 3CM0A 1SXJC 5FL3A 2FDCA 1F2TB 3AVPA 1KY3A 3IO5A 1P7CA 4NYMQ 3JVUA 3QVVA 2GXSA 2OILA 4IKEA 3V4FA 3LWNA 1N3BA 3ZS9A 1BMFA 4IXNA 1IBRA 4FMDF 2HYDA 3CZPA 4QBHA 2ZE8A 3CF0A 2NPFA 1XPRA 1ZCBA 4NCHA 4C0KA 3AF3A 1P2VA 4WZAE 4LJ7A 4IEIA 4IOJA 1I2MA 1CRQA 1S8FA 1G7SA 2ZXUA 2AWOA 2IEYA 4US1R 4DVGA 3AKCA 2IF0A 2QG6A 3TUJC 3ZD6A 2A5FA 2MSCB 2IYRA 4DCNA 2GXQA 3K09A 2W58A 3QXJA 4FN5A 2HT1A 5JCZA 3NH6A 4JBWA 4PO9A 2OO7A 3KUCA 5JSZA 1WBDA 1M8PA 2OXCA 1EFRD 4GPTA 3VHLB 4UXJA 1DAMA 1A82A 2YVUA 4BECA 1FP6A 2O0KA 2OCPA 2NIPA 4BPBA 1Z07A 1ZNWA 5KPJA 4JL6A 2WJJA 1E2KA 1G16A 1ZUHA 2F43B 1KKLA 1Q1QA 3MWJA 4PHTA 1CJMA 2BMEA 1UFQA 3BORA 5HE8A 1E4VA 1R10A 3GFTA 2EYUA 5K8UA 3PJRA 2VBCA 4Q4JB 4WA7A 4LV8B 1IY2A 1IAQA 1SKYB 4F93B 5FPSA 4EQ6B 1S9HA 1XJCA 2J0SA 8OHMA 1KI6A 4JSYA 5TDHA 1NKSA 2FMXA 4HAUA 4BQSA 2FSIA 3GEEA 4LJ6A 3EW9A 3SI7A 2E87A 4JS0A 1AQUA 1TU4A 2IYSA 4R71A 1NP6A 3FE2A 2UKDA 4EUNA 4L9SA 2F1JA 5CB6A 4NMMA 3A37A 1ZCAA 3T12A 4M1KA 4G5QA 4QGGA 5EP3A 5HZHA 5LPNA 2BM1A 1NIJA 5AWFC 3OESA 2IT1A 2ZVPX 4LYJA 1SXJA 3RANA 3R7WB 2VQSA 2IWRA 4JVNA 1Z6YA 4PHFA 1NLFA 1XMSA 4C0QC 3IEVA 2R6CA 3LY5A 1Z2CA 1E9BA 2IS4A 1ZIOA 1J7KA 2W6JA 3GP8A 4DB2A 2BEKA 1RC8A 1AZSC 2IXFA 4NTZA 1E0KA 3TGPA 1QF9A 3GJ4A 3RS7A 5BN5A 5GJVC 3T15A 2KJQA 2C96A 2EW1A 3PENA 1XEXB 2XNDA 4X8HA 4Z54A 4CF7A 2WIAA 1EG7A 2Y8EA 3QQ5A 3QXHA 3RSOA 2CL0X 4LHYA 3SYLA 4UNRA 4QHTA 5JJIA 2O8BA 4QBFA 2C8VA 4HEJA 2RKOA 2GZAA 2A7QA 5DO9A 4AKGA 1W49A 3RC8A 3IHLA 4G01B 4Q5IA 1W44A 2ZU0C 2OFWA 3CPJB 1XBTA 4MRPA 4PPNA 1XPOA 5C46F 121PA 4ESVA 4ACAA 4D0LB 3K9LA 2KE5A 3A36A 2VO1A 3NH9A 1ETUA 5FTNA 3BOSA 4JLPA 1KI7A 1NJGA 2GJ8A 4BGDA 1YRAA 4RD1A 4KU4A 2PT7A 1KI8A 1G18A 2JLSA 3RS2A 3ND9A 3I73A 2PJRA 1OH8A 1OJLA 4RD4A 5FL7D 4CEIB 1Z6GA 2FWRA 1JR3A 1UM8A 1T3LA 2C77A 721PA 1L7VC 3TUIC 4XTRA 1SKYE 2QL6A 3BFVA 2JJ2D 2WJIA 4QC2A 2ZITA 4FMCB 1ZAKA 2G0TA 3VU9A 4LYAA 4C0HA 1TTTA 2O8CB 1JAIA 3IO3A 2QROA 2AL7A 1Z08A 3AVUA 2IC5A 1DG3A 4LJ8A 4MGZR 4M9SA 4WAUA 4AD8A 3AVYA 4V0OA 1Z8FA 1RRPA 1YR9A 3LLUA 2QQ0A 1JI0A 4PPFA 3LVQE 2VP5A 1P72A 3TQCA 3THXB 5C2JB 1CR0A 2OV2A 1A4RA 4IOLA 4UJ3A 4OI2A 3CX6A 4Y0AA 3LXXA 4JVSB 5AJWA 2XOKA 3ZGXA 4E03A 3EZ7A 2QUZA 4IOKA 3MUFA 1HYQA 3GMTA 1GL6A 2ZI9A 2AD5A 3BFKA 3MD0A 3O8BA 2D06A 3RNLA 4B35A 2CLCX 3KFVA 4B33A 1ZC4A 1TU3A 1VIYA 2QBYA 2CBZA 3AVOA 2ZR0A 4HB2A 3T1TA 4TYYA 1HH4A 4XH9B 1RYFA 2PEZA 1CS4C 1Z0DA 3EAQA 1NJFA 5FR1A 2D4HA 1IXSB 3AUXA 2YINC 3CO5A 3KKOA 4M1TA 3ZZ0A 3EIEA 1GRRA 4ARZB 3KJEA 4HLCA 2OLJA 1ZUNB 3HJNA 2EFDB 3A1VA 4TWZA 5FOWA 2C9OA 4HI0E 2IYZA 2OG2A 1JJVA 1W48A 3ADKA 1F2UB 3K53A 4DT1B 5AUPB 3FKQA 3W6PA 1XZQA 3VHXA 3ZZUA 4EFMA 2NQ2C 3D3QA 5F9FA 1COWD 1XWIA 1Y63A 5P21A 4TMXA 2V54A 2QN6A 3LD9A 3FOZA 4JT4A 3NBFA 3DVLA 4H1UA 4RFSB 4OJQA 3B1ZA 1R7RA 1GWNA 4DIEA 2BKUA 4A82A 4LBWA 5M04A 2HYIC 1UF9A 3HPRA 5FUXA 2XJ9A 3R20A 4BFXA 2OCBA 4TQUS 1Z22A 1P9WA 4QRHA 5IK2D 4EJSC 2ZJYA 3HU1A 2RMKA 4TLDA 1PUJA 2GESA 4PXAA 1LFDB 5DYIA 4URUR 1Q57A 1OT3A 2J0UA 3AEZA 4IXMA 1XTSA 1EFTA 3UATA 1KSJA 4OI4A 4TQAA 4A15A 3OIVA 3I3SR 1G17A 4XD7A 1I4DD 1G8FA 2F1IA 2V7QD 4PPGA 1QHGA 3A1SA 2G6BA 3KTAB 2C78A 2VHQA 2VRWA 4F38A 3B1XA 5L3SA 3VR6A 3C5CA 1NL3A 3CH4B 1N6OA 1Q22A 2ZRGA 4PFSA 2NO1A 4PZYA 4D0NA 1OFTA 2Z4RA 5KSOA 1TF7A 5K8TA 1XJQA 3WYFA 4HZUA 4PC3A 2F9LA 3VNUA 4Q03A 1QVRA 3EC1A 2WSSD 4DCUA 3OIWA 1ZD1A 3TR5A 2J7KA 3I8SA 4C30A 3UWKA 2JLUA 4DSNA 2REBA 4BLTA 3CX7A 2QU8A 4PTLA 3TW4A 1R0WA 1U94A 1V5WA 1AJEA 1BMFD 4Q48A 2J87A 3VAAA 4MKIA 1S3SA 2OCAA 3QUSA 3TAHA 4NP6A 4DJTA 1MO5A 2ZRNA 2ZS9A 1MO6A 2WWXA 2YYZA 2FU5C 5AK0A 5KSPA 2ZIAA 3GJ6A 4ACBA 1IJEA 3PEWA 1VG8A 2XZPA 4B3DA 4DLZA 2OFXA 1F5NA 3A1TA 1M74A 1Z0JA 4UNNA 3UANA 4IHQA 2SHKA 2F3RA 3IQWA 3N5CA 3QKRA 3SQXA 1EGAA 1W46A 3QXCA 3PITA 1BH2A 1YVDA 2QAGB 5DLQC 4LHWA 2XITA 4V0MA 2Z83A 3FTQA 2QZ4A 1T91A 4B6EA 4L16A 1DEKA 1XU4A 4FCWA 4V03A 4Q1FA 3Q5EA 1XMJA 3AP3A 3O47A 4EJSA 2OFOA 4NPHA 1GRQA 4J0QA 4LJYA 2A78A 2ZRPA 1NG9A 1U81A 3U60B 2XXAA 1XP8A 4TL8A 4XVRA 1QHSA 1R5BA 1XJ0A 4JVMA 3MWKA 3NBZC 4IDNA 5IF9A 4CEJA 4A8JB 1XRJA 5B64A 2YKGA 1FPMA 4YMUA 3L0SA 1YZNA 1DE0A 3N2IA 4ZCIA 3RRNA 4C7OA 4AG5A 4GT1A 4UJ5A 2PZGA 4HUQA 3A8TA 2IWHA 2GK6A 1FNNA 3C15C 3CZQA 4A4DA 1EX6A 5IHPA 1A2BA 3CPHA 4HSEA 5C4MA 3GFOA 2JA1A 2IYUA 1LB1B 2PX0A 3KJIA 2ODBA 2E9SA 3GEHA 3TQFA 1OIVA 4G3XA 1VG0B 3B1VA 4RVCA 1U8ZA 1E2PA 4LYHA 5JWOA 2GEVA 4Q1AA 4BZPA 1VMAA 1UBCA 3AP1A 1SXJD 3F8TA 4A0RA 5FTMA 2Z4SA 3EPLA 1PUIA 2R9VA 2WMNB 3JZMA 5CK4A 2FE4A 4B48A 3SOPA 2PLRA 2FH5B 5AJXA 2W2XA 2ZE7A 2W6IA 1T3SA 4YMTA 2W6JD 4NYMR 1UKYA 4CZ2A 5D3MA 2QGZA 3P1JA 4JJKA 1G41A 3JZAA 4Q1BA 4JBYA 2XNDD 3RYTC 5DISB 2D2EA 3OEHA 2ZI5A 2AXPA 4CEHA 1N0VC 2FFQA 1IY0A 1W0JA 2H16A 1DPFA 3WNCA 1A7JA 1DG1G 5J4KA 3EX7C 3X2SA 2DB3A 2ZJBA 4QBIA 3I32A 4RY2A 3CF6R 1YR6A 1G5TA 4AY2A 3MG9A 3CUEF 1CJVC 2J46A 1KMQA 2NO9A 4OQNA 1CXZA 1AKEA 4HAYA 4B71A 3Q3JB 2Q6TA 2W0MA 1T0JB 2PCLA 3MFYA 4YXWA 1HE1C 1YRBA 2ECKA 2ZRFA 2J1LA 5JRJA 1KIMA 4NE2A 2WVJA 3EIQA 2VP6A 4QFMA 1JR6A 5BN3A 2ZUBA 4DWJA 1E1QA 1W1WA 4KLZA 1E2HA 1JR3D 3QF4B 1TQ6A 3LFUA 3ZVMA 1L2TA 2ZROA 3LA6A 2W2VA 1OFIA 2FSFA 4KHZA 1E2MA 3TKLA 4AI6A 3OEEA 4MRRA 4XOIA 4DLSA 4H1VA 2GJKA 2AKAB 2G83A 5HPYB 3LBNA 3EC2A 1WE2A 4QHSA 2CMKA 1NVWQ 1Z0FA 1E32A 4L4UA 1JXMA 2G88A 2BM0A 3KKQA 2BOVA 1IXRC 4OQXA 1VHTA 2Q21A 5L3QA 5FPTA 2X77A 5CYPA 1GKUB 3W90A 2XNSA 4RCZA 4OHZA 3U7FB 3VX3A 1RPZA 1YR7A 2ZM5A 4BLPA 4M1WA 1NF3A 4EAQA 1KI9A 5GJBA 4DLXA 3BD9A 5JHHB 1JQLB 2WWYA 3MLEA 4HDQB 4C2UA 5AJYA 4ZCLA 1G64A 2Q9AA 1MABA 1NY6A 1E9EA 4U02A 4R7ZA 4PHGA 3WHKA 2GAAA 3U5ZB 2GKSA 2J7PA 4M4SA 3OFNA 4KCGA 4B73A 1J70A 1W4AA 2WAXA 2WWFA 4Q01A 4LZZA 4S35A 1NVUQ 2MMCA 3K0FA 2ANBA 1KSGA 1US8A 1XEFA 2AWNA 3BRWD 3DKPA 2VIIA 4IFEA 1LNZA 1ZM7A 3QBTA 2FPLA 2C5LA 4B2LA 1FQKA 1XXHB 5C1BA 2I1VB 4QNMA 1X1RA 4E5UA 2JDIA 1OE0A 4TLAA 2IS1A 1J8YF 1S0UA 2EWWA 5HR5A 1JNYA 1MT0A 5UKDA 5LDDC 5TXGA 2WTUA 3BE4A 3TVDA 5FUYA 3VR4A 4UXIA 4DXAA 3AVXA 3RSLA 4MGIR 4DCSA 2WOOA 1P3JA 1P61B 2YOFA 3RWMB 5EE0A 1LY1A 4V0ME 5F3WB 1KI1A 2QAJA 2NGRA 2ZYUX 4IDQA 2YNMA 2PEYA 1II8B 2AXNA 2WM9B 2KI5A 3SC3A 3P4XA 5CDFA 2CCKA 2GA8A 2GEDA 4TSFA 4RKFA 5HKKD 2ZYVX 2OUKA 2I1QA 2ZQ5A 4OHWA 2KSQA 4Q19A 2V4ZA 4G5OA 5EUQB 5SZKB 1HURA 4BFVA 1KYIA 2W83A 4MDFA 1KK0A 1K5DA 4TMWA 3B9PA 1RYHA 4O0MA 5KSZA 4ESHA 3DPUA 2UZ3A 1X8LA 4XIGS 1G21E 4XJXA 3VR1A 4ABYA 5JI3E 2NG1A 3THYA 3DEFA 2UVQA 2BBTA 1I4LD 1NVVQ 3K8YA 4KFUA 4TL9A 3ZH9B 2ZRMA 4D81A 2D3WA 3TVTA 1A1VA 4WIAA 1E69A 4WXPA 4URVR 4DEXA 1TQDA 3M6AA 4IEEA 5JEEA 4I1VA 4CGZA 1UBEA 3PFIA 2HXYA 2ODWA 5ELXA 2ZS8A 2RGNC 4OYHA 3T1OA 5JBQA 2ZJ2A 5H68A 3WP0A 4RD3A 3FFAA 1TAGA 3NC0C 4Q66C 3W3AA 4NCIA 2XZOA 2PT5A 4B75A 3S1AB 4RZUA 2ZTSA 1U2RA 3I5YA 1XMVA 2OAP1 4Q21A 2AN9A 1H8HA 1KY2A 1T9HA 3NXSA 4TLBA 4B74A 5BYJA 1P6XA 3RHFA 2ASEA 3JVVA 3QPUA 3RS5A 2B8WA 2XSZA 1G8GA 2JLWA 2AK3A 2Q3MA 4V0KA 4A2WA 4MRSA 2JASA 4X8OA 1D2MA 3WY9A 3IIJA 2PMKA 4YONB 5E95A 1VECA 4QXAA 4OK5A 5DE3A 1AK2A 1FX0B 4E07A 2ZRHA 2HT6A 2ONJA 4PR0A 5BW8A 1T3HA 1WBBA 4TYWA 2O8DB 4I99A 2PZFA 3OZXA 2CE7A 3H1TA 2QQEA 3QENA 2X19A 4Z51A 3RVBA 3U7HB 2VPPA 1CR1A 2WWWA 3BERA 2ZAMA 1ZBDA 2IK8A 4LJ5A 4A2QA 4TL6A 2NO0A 4IVPA 2QMHA 4NYIQ 5DH9A 3QSYA 1MH1A 2XEXA 1TMKA 1UKZA 1P2SA 3IBYA 2WKPA 4G5RA 1G5RA 4DCVA 1XTRA 1W5SA 4JLNA 3FKSD 4R2HA 1GILA 4GRAA 3N70A 1KDRA 3FHCB 4CIDA 2D7CA 1G3MA 1LS1A 3KQLA 3D31A 5F9HA 1F48A 4AWXA 3AB3A 1X6VA 2F6RA 4LGMA 3FPAA 3E70C 4OBEA 1DAEA 2MSDB 4ZV4A 4FW9A 1D2EA 2B7CA 1KMHB 2W2TA 4OL0A 3W5JA 1JXOA 1KZ7B 2Q9BA 4LRWA 2YC2C 2RGNA 4IDOA 1WP9A 4NCJA 5FTKA 4BFTA 1XDBA 3VKGA 3GCGA 5BWMA 4Q00A 1E96A 2IYLD 5G41A 3QKSA 3REFA 3ZIAA 4D25A 2BDTA 1IJFA 4RD2A 4TYNA 1JEEA 3GD7A 4JMPA 5FBWB 2ZI7A 2D2FA 1U99A 4P32A 1CIPA 3WYAA 5IDVA 3QEJA 2BEJA 1DELA 3U3KA 3UK6A 5CJ2A 5HZKA 4QJ5A 3IBGA 5FOSA 4D0GA 1QVAA 2ZE6A 3Q72A 1YU9A 5J4HA 5C18A 3FMFA 2W6ID 1E9SA 3KDSE 4HAWA 5FOXA 3GJ8A 2GETA 3LQQA 1VCOA 3CWQA 3TW8B 1VG9B 2B8TA 2FOLA 5DI3B
chains in the Genus database with same CATH superfamily
1H9BA 2JCBA 1U4SA 5E4FA 3UJNA 1FIUA 2YVQA 3RJZA 2C2HA 1N7HA 1OUMA 3OM9A 5TQ0A 4FCVA 3PV0A 9LDBA 1YXMA 4CKWA 3FCAA 1CUZA 1U8EA 3PT9A 4XW2A 4FWTA 3NHJA 3VR3A 2HWXA 1RMTA 2ECPA 2QTZA 1E7MA 2RBKA 3H7IA 2BMVA 1O3YA 2AA3A 4FUTA 5TLSA 2O1XA 2P6RA 3I9LA 2IHJA 2OT3B 4BQPA 2W6PA 3AOEC 5IT9A 5TS3A 3AOGA 3VQTA 1BNCA 3O8DA 1BOOA 4GE0A 1NASA 3VDMA 2WWGA 1N5MA 2VWQA 2I4LA 1LVGA 3I6IA 3L4BC 2WKRA 3JYQA 2QORA 3LUKA 1T0PA 2QM7A 3BTOA 1B8NA 4KSCA 2FX2A 4R68A 1SCUA 2V97A 4ZCRA 3NWOA 2X9VA 4UHEA 3UK1A 1TB4A 1I51A 1K5HA 2ZB2A 2R3SA 2G9VA 1GUFA 3EZNA 2VXBA 3G9TA 4H3VA 2VS1A 3DWFA 3SQDA 1KO7A 1FFHA 3OE5A 5IYZA 4C0BA 1CC1S 1AIPA 2IEZA 3ICPA 3MWYW 8LDHA 3QYJA 5K7SA 1VJTA 2IOQA 2HEGA 3D02A 3Q3CA 3EHEA 3BXHA 5FNVA 4DZRA 5IAAA 1QMGA 2ZI6A 2RK3A 16PKA 2B1IA 1U9IA 2NN3C 2X86A 3GXBA 3MTAA 2JK1A 4ZOLF 3D3WA 2CWWA 4CIBA 2VPXA 1U0LA 1UZUA 2BIFA 3M70A 3GA5A 5EQFA 3TYXA 3W77A 1H4QA 1RWKA 4CG0A 1WOMA 4YJ2A 4WHMA 1V6CA 4RZHA 4RF5A 3WV4A 3LFTA 1XZ8A 3I0MA 2W2NA 2QRJA 2HDOA 3ON5A 4N3AA 3OEED 3QOXA 2NOAA 1SVNA 4B3XA 3CLVA 2HF2A 3HDJA 4YH1A 1ZWKA 1UBTS 3F7MA 2N47A 4YP1A 3OCVA 2LTAA 1OBCA 1QHHA 3B85A 4MEBA 3V4PB 1Z0AA 4D3ZA 1GG2A 2I4TA 5AW2A 1A27A 4AYTA 3N0VA 1GDHA 2IHKA 3JQFC 3V3KA 3C5EA 2JHGA 4M38A 1COZA 3H19A 3UN1A 5IJZA 5HSGA 4W4TA 2R7MA 2VDQB 4WFQA 4DSUA 1KQNA 1H65A 1M9NA 1SK9A 4EG8A 1YBHA 3DLCA 1L6RA 1DU4A 3Q9SA 3G88A 1DG9A 2C4TA 2RHDA 2HPZA 2EKZA 2PTGA 3EZ6A 3QIVA 4MYTA 4D8TA 5CITA 5IDWA 1EJ6A 1E3JA 1UMBA 2GLUA 1UDXA 4L08A 4G6ZA 2VSOA 4UREA 5BQFA 3SDSA 3ACDA 4KWIA 1BXGA 5HF8A 4XWAA 3CRVA 4GMHA 3T5TA 2QTWB 3OFSA 5IJ9B 5CLGA 3IUBA 4KK4A 2FHPA 2ZVQX 3G2PA 2PZMA 1N1MA 3PFHA 5J2UB 3PVSA 4D2IA 3EGXB 2VUHB 4P5PA 3X1DA 4CQMA 1ZGJA 3V4OA 3ENNA 3T5BA 1NBMA 2DFLA 4BZXA 2DPXA 4U5QA 1UADA 2WWIA 4BNZA 2DKOA 2WIDA 3D2CA 4HEHA 1PQYA 5TARA 3H04A 1JYEA 3SLRA 3HO1A 4RSGA 2REQB 4DSTA 1M8GA 5D7BA 5IKOA 4HRXA 1QWSA 1U7XA 2B2XA 2Q0QA 3HNRA 4WNAA 4M9RA 5EQTA 5H02A 4QLBA 5BT8A 1LRJA 5LQAA 2AYZA 4Q4AA 3QVJA 4UATA 4C0AC 4NOLA 1AV7A 1EVEA 1GR0A 2ZJ4A 3I45A 3I9V6 2JLZA 1VHDA 2ZRJA 5HCUA 4K81B 4S2UA 4MR9B 2Q4RA 3M83A 4MMYB 1M1ZA 1PHRA 1UPBA 2JARA 3BHMA 1U04A 3PCRB 3ZEAA 1RZ3A 1V45E 3CONA 4RGQA 4G9GA 4EKEA 3NV9A 3UJ8A 3ZCQA 2LPMA 4ZAVA 4IZ6A 1GTL1 4FBMA 1TU0A 1JXQA 3SC2A 1VFPA 4US0R 2VF7A 3V5NA 1A7AA 2J5QA 3L84A 2AC7A 3H4MA 3G59A 3HP1A 1L1RA 3OMXA 5BN5B 3S0JA 1RE1A 3PNVA 4RPGA 4EZIA 4YPOA 5KU1A 3KQUA 4H1TA 2PL3A 3FSGA 4CM1A 2WYIA 1VFNA 5HUHA 3W1VA 1R0BA 3QHPA 4IDGA 1XD8A 4EJ0A 1KI3A 1LI5A 1XK6A 2R6DA 1KAQA 2V5UA 3ZK9A 4E30A 4FC6A 3HP4A 2WHQA 2YWFA 1H9AA 4PZPA 3V9PA 3NKFA 4DJAA 3CF2A 3GJ7A 1WCV1 4DLWA 4BEBA 3OAAA 1E8DA 4P5DA 3H2IA 4GKVA 5EGSA 3BF7A 1VA5A 3CR7A 1ZRMA 4URYR 3W6NA 4TLCA 3ZI0A 4OHVA 3W5UA 5B7QA 4U7DA 2YIMA 4LXQA 1P62B 1SUCA 4H6WA 2FF7A 3E27A 3H0KA 1PR5A 3MZ0A 4YHBA 1BXRA 1M8KA 4ZVQA 4PC7A 3K6JA 5K3FB 5TGZA 3D3EA 3II6X 1DAFA 1DIGA 1UBFA 1TUGA 2D1FA 2I7VA 2WHRA 5CFOA 4RTMA 1HV8A 4WW0A 3RRYA 1JIJA 1AC5A 1T5DX 3N2GA 4QSMA 2I1WA 3LHKA 1FPQA 1Y48E 2AOWA 3J7TA 4P22A 4Q7LA 4KTVE 1GXSB 1NMQA 2OY0A 1I6KA 3KXLA 1IONA 1UBMS 3L79A 4G5YA 4MQFB 1LJUA 2WYWA 4XB2A 4YCDA 2GS9A 2KWIA 2DHCA 1WXIA 4N54A 2I2DA 5AI6A 4CF5A 4XDGA 2P0EA 1J0BA 1JG7A 3DZIA 1AURA 4D6YA 1KGSA 4EB3A 3LLSA 1FU4A 1FXWA 1SKBA 4YMSA 2DY1A 2W4IA 4CQMB 3ZU6A 3EY4A 3VYRB 4NABA 1NIPA 4PC2A 1P9RA 3VU9B 4D4JA 3QLEA 1E1CB 2OO3A 3CWZA 4OKNA 1X2BA 3L2OB 2O7RA 3DF9A 3HM2A 1ACMA 1HDCA 4G1EB 4NK5A 5IWCA 1V43A 4FDMA 2IH5A 2HA6A 3H87A 4TLMB 4ZZ3A 3IE2A 1JB9A 2CXQA 3FSEA 3H9GA 3HY6A 1AX9A 3T9AA 3DDWA 2ZUEA 1UKVY 5F2OA 1NV9A 1NJ1A 1JV2B 1LF0A 1T36B 2Z56A 4MLPA 5L9AA 5DKFA 1I0IA 3KAPA 4BYMA 1AMOA 1RWPA 1Z47A 3R2JA 2DF8A 4KI7A 4B45A 4IIJB 1RLIA 2RAFA 1MAAA 3CSDA 2OORA 5EZYB 1JEQA 1U2QA 3IPXA 3VKWA 2AN5A 2D0PB 1XQYA 4IHJB 5EEHA 1DRUA 3WBJA 1YJAA 2J59A 1G0OA 4AO7A 4ZT7A 5I9NA 1K0UA 1H42A 1NY5A 4ZQGA 4BRZA 3R5HA 2HL6A 1CF4A 3ANNA 4BIIA 3GPBA 3LM8A 2JFYA 2RARA 1RW4A 1ISHA 3UAZA 2QBYB 2QTBA 1PLKA 4F91B 3N2KA 4KG7A 1JDPA 4EELA 4CQNA 3AL3A 5C35A 5LZ4A 1SU7A 2QSJA 1TIKA 1GGJA 2B1GA 2I78A 2O2YA 4TWAA 1E5QA 1GP2A 2WAMA 3KZ1E 5IW8A 1E79A 1NBIA 2OBMA 1TEZA 2FOIA 3DDOA 5L7TA 1XJ5A 4MGEA 3PNKA 2OCGA 1D8TA 5KOYA 1DQSA 1F6DA 1UWKA 2HRDA 2E4ZA 2O7SA 2XMQA 3CZ4A 2WDPA 3OIYA 4MB0A 4F4UA 1NBOA 1P0PA 3F71A 3K35A 1C9JA 1HL7A 2QLJA 1QFMA 2XH8A 3DCYA 4JB2A 4PCLA 4YQYA 5AKEA 1B76A 4BO1A 3ODGA 1GPUA 1Z4JA 3GAFA 4DBLC 1CRZA 1X86B 3DOOA 3BXPA 4QOSA 4Y0VA 1Q3HA 4RH3A 5JMPA 3S2YA 5DI9A 3UYKA 4EEXA 1N2BA 3EH1A 3OQBA 4JLAA 4KFSA 2V7UA 1WRBA 4GLFA 3JQ8B 4CDGA 1N92A 3PZRA 3GLSA 3CVUA 1PWXA 1XVLA 4FEAA 3BD8A 1FYDA 4XGQA 4NOJA 3WYNA 3AVQA 3OJCA 1CDZA 1NI5A 3WLOA 1Y5IA 5EHIA 3V7WA 1K6MA 3FNRA 4LBYA 5KYWA 1HZJA 4RJIA 1F51E 4M3NA 4Q9LA 5KEIA 1MVLA 2XTAA 1VPLA 1JR3E 4J7UA 3LCCA 5F98A 1AM4D 2EOAA 1UXIA 3IB6A 2PSDA 3R3SA 1ARZA 4XM0A 5DB4A 4B3RB 3TNFA 1BHSA 5DNWA 3KKLA 1I0LA 1Z68A 2IZOA 2F00A 3DNPA 4LE0A 4AJPA 1NURA 1J8MF 1R0RE 1SKQA 3RW9A 1GQSA 4HJXA 1DBRA 1F0KA 5ALGA 2WJVA 1LV7A 2G5TA 3LUCA 4XSHA 3Q8MA 2WB4A 1MB3A 2I2FA 1T9AA 4UAUA 3BJEA 2B69A 2CHEA 3NJ8A 1G8PA 1NMEA 2V74B 1RPAA 4WOCA 5L3SB 3L8DA 1OH5A 1S7GA 1PK9A 1AKVA 3QEOA 1L6IA 1DRJA 1GGEA 1XD9A 4PAQA 2VAVA 3KEGA 3KJZA 3KQMA 4G1FA 4O4HF 3VMFA 2B20A 4IL5A 1YMVA 3BTVA 3UJBA 3AH8A 3WJ1A 2CLOB 4UMEA 1FTSA 1QG2A 2DBYA 4MJLA 5EPUA 4B84A 5JDIA 1N6LA 1VTKA 3LX8A 1M0TA 4FI3C 1Y6FA 2I4RA 3JWJA 1R9MA 4D8UA 1JHRA 3GDGA 1JKFA 5CDSA 4TKZA 4CIYA 3QNUA 3KKKA 3GZTB 2Q2OA 3ZDEA 4LOAA 1QG6A 3X1MA 2JZNA 3GPIA 1GN9A 1T2AA 1LBTA 3LSTA 1TCCA 2WTAA 2FR8A 4XPIA 4F4DA 3N76A 4B6QA 1RRVA 4LXYA 5AKXA 1U3GA 1YFZA 3MLAA 5EOVA 1E3SA 4P86A 2C4MA 4XASA 2HMVA 4HNAA 2ESRA 4WJKB 4Q9NA 4RDXA 2FZ4A 3COWA 5C1PA 5C7YA 2YZ2A 3CRZA 2VP0A 3LDUA 4NONA 2QZSA 3KCQA 2PRIA 1YZLA 1RXCA 1W4ZA 1KAMA 3PFNA 2CFOA 4C01A 1C8BA 1C3VA 3QBEA 4B6GA 4D4LA 4DC9A 1KL7A 4GX5A 3Q11A 1GZUA 5K05A 1UJ4A 1MVOA 2FG7C 1CZKA 3FGNA 4NE7A 3RSQA 1CG6A 3VYWA 3N1UA 4X44A 4C21A 1JBEA 2V1UA 1Q1EA 3QOYA 4E5VA 1N5LA 2YQ5A 4D8XA 3A14A 1KAHA 3I4FA 4YRKA 5JS2A 2EATA 3T54A 2WRZA 4DQDA 1QFYA 4DW8A 3PGVA 4FD3A 2X1HA 3L7JA 2OOKA 4ZAXA 2C98A 4DEYA 1K98A 5IT0A 2F62A 3LJKA 4BNGA 3ROMA 1V1RA 3SYKA 3RC3A 1I4EB 5LA6A 4BMDA 2X76A 3I37X 4RZSA 4A0FA 4U2GA 1GAJA 1WIWA 5A3SA 1YUBA 4HDSA 3VNSA 2A30A 2DUUA 2F1HA 1A97A 3CX8A 5BORA 1RAFA 4ZK6A 2OO5C 3E7FA 5TIIA 4OXRA 3NTUA 4HMPA 1X0VA 3NCTA 4DIFA 4PSVA 4YMVA 5I9LA 4JKYA 5L8VA 3KKNA 1G21B 1OKKA 1QP8A 3BGIA 1YB2A 2EGGA 1UAGA 2G3YA 1T3ZA 3GAMA 1NLZA 3BH0A 1N4AA 4B34A 4IIVA 4JEMA 4MS3A 1KWGA 4CCYB 5KPDA 3A2KA 5DHTA 1PFWA 5D7NA 1PL0A 1Y1KE 5EG5A 4NK4A 5FQOA 1ABBA 2HOQA 1YQTA 3IP9A 4KDCA 3NBUA 3ILVA 3PUWA 1OXBB 4XUEA 3T1QA 3ZNPA 4B47A 2E89A 2JCXA 2TMYA 4BNWA 1RQXA 4R3WA 4E5KA 1MN6A 1VKJA 1AS0A 1EVKA 2YFYA 4ND8B 4QAQA 4CM8A 1SZCA 3B78A 1DX9A 3CX4A 1B3RA 2CLEB 3SJUA 4L8GA 5DHSA 2YX1A 3E22A 4NESA 5MHTA 1AHNA 4PRLA 2VTVA 1IQ0A 1ZC3A 3AEKA 4YJ3B 2EL7A 4ZIRA 1QQ6A 4CIAA 2H3HA 3AFOA 1AUPA 2P2CA 4LSMA 2BUBA 2GPTA 3K15A 3V2UA 3NM4A 2R97A 4N0MA 1KEZA 2BGKA 2ILTA 1SB8A 5DNYB 4CV2A 1SR8A 1TQ4A 2I6FA 1CNEA 3HYSA 4KXLA 1IXZA 2IVFA 3IRUA 4XRGA 3GJTA 1Z26A 3LL7A 1E64A 1OWPA 1XZAA 1NLYA 4UPEA 4REMA 4RL4A 1CQXA 1UXKA 5CK5A 1N25A 3EARA 1F5SA 3H5NA 2VUSA 3LC1O 2XOEA 4CDMA 2R6AA 3SYMA 5B1EA 2BM9A 5AK4A 3V8RA 6NULA 5K03A 1W36D 1TCBA 3MJRA 3BEOA 4PONA 4AZ3A 2HIMA 4NWIA 4FFNA 3GOQA 4BTLA 4TRRA 4D79A 5GV7A 3OKAA 3TOVA 1PLLA 1RXSA 2MYNA 4BTEA 2IXGA 4Q1DA 2G82A 3RIXA 2R6FA 2C42A 4MR8A 4PNZA 3RFFA 3SIPA 4PSKA 3L7OA 4IDPA 3FVQA 4YRDA 1H94A 2YWRA 1I3NA 2DC1A 2O0HA 2XIQA 3B7WA 3JYNA 2V7PA 2PD6A 3CEJA 1HETA 2BUAA 3C5VA 5KMGA 3K0SA 4UOEA 1T6BY 2P6UA 3GJXC 3H84A 4M36A 3SXJA 4IIDA 1CEXA 4NCKA 2Y1DA 5KAMA 1WXWA 1YT5A 4KR3A 1PFYA 2Q5HA 5BN3B 3T7DA 1KFBB 2WD7B 3L7KA 4J4TA 1SA0A 3G7SA 3IA2A 3BFJA 3TB4A 1XLUA 1T25A 1O9GA 2J4FA 2WWHA 3DFZA 4DNXA 4DMRA 5J2TF 5AOVA 4AYXA 1N8NA 1HRKA 3EGEA 1QANA 1VL1A 2CHFA 1TCAA 1U6JA 2W6CX 4D42A 2RGBA 3L0DA 2WJGA 4V0LA 4M1SA 1RIIA 3BFPA 5K0JA 3K72B 2ZJZA 2H57A 3U3MA 2QY9A 3JASA 4L8WB 3UAVA 2XBMA 1ULBA 3EXEB 2E82A 4WD3A 3CT6A 1R6BX 3WDSA 4C7VA 3PQDA 1CEQA 5F23A 4S2EA 4CDRA 2CJYA 1XU7A 2V9ZA 4DDTA 1P81A 4R9UC 1H0SA 1L4FA 2FPMA 3O1JC 1SRQA 2G9QA 1ETHA 4UULA 4GZ5A 2Q8PA 3IT0A 1Y4UA 3UAWA 3ZVNA 3VR6D 2ZRCA 1Y7PA 2FW8A 2XVAA 2AB0A 2ZSFA 4G25A 1T0BA 4GNKA 5JNTA 1SHZA 5KYYB 3PI7A 4RVDA 1Z4IA 5AKKA 3GVHA 3TE6A 4FS3A 2GR9A 4AFNA 4NV3A 5JMTA 1O7JA 1N5IA 3ZDBA 4Z3DA 3RREA 3C98A 4GZLA 3SAJA 2ZYRA 4GZ3A 4NX2A 3ZHUA 1PGNA 3GG9A 3CSSA 2BKXA 2OKCA 2N9UA 1U8AA 2QTTA 4XWYA 5G0SA 3ZIUA 1CERA 1H2HA 3S29A 1PKEA 3TOCA 4OQ4A 2F59A 4XEUA 1GPKA 1PX2A 1V11A 1BMQA 1C0PA 1TM3E 3GHHA 2HF7A 4ND4A 3FUVA 5EC8A 3SX0A 2CNWD 3TQOA 3W5BA 2UYQA 7ADHA 2J45A 2VBGA 1SIUA 1Y6ZA 5C3MA 1PZXA 3TJRA 3ZYZA 1JVNA 1DAKA 3DTTA 1TXGA 4XUDA 2P5SA 1P7VA 3ZXUB 2NMVA 5LXTA 3AI3A 5KB3A 1J5XA 1XHEA 4WKOA 4IEFB 4N1AA 1S3IA 1W59A 2DECA 4QPZA 4A1FA 1AF4A 4X1YB 1JN0A 1U0NA 1L1EA 5ESRA 1N3IA 2EZ4A 3MJCA 4M8KA 3TWOA 1GAXA 4NH0A 3MJEA 3VMMA 2VNHA 4Q39A 3DL0A 4BO2A 4HNTA 1RRCA 1BN7A 3IC5A 3JPYA 4EQ6A 2FWBA 3K1ZA 3Q8KA 1RI2A 1UBKS 1PTJC 5K0LA 2MJLA 5GZ1A 5AJHA 3M6WA 1BYIA 5DN6D 4YAKA 3FBGA 4PF1A 1C3EA 4CVNA 4LC9A 1P7PA 2BHNA 3ZTWA 5FR2A 3IOBA 4KGXA 2VYVA 3CG0A 2YY5A 3HBLA 4ZO6A 5M7EA 4MUBA 5CDHA 4AURA 1Q0ZA 4CQLB 3FLAA 4BLQA 1CHDA 3K70D 4M37A 1NE2A 4WV3A 3VPHA 4RJKA 3VJKA 4DLVA 5LL6P 4B31A 2P90A 3ZHRA 4TLLB 3RTEA 3EUEA 5JECA 3UJAA 1X1QA 1JILA 1J2EA 1TRHA 2AVDA 3HB5X 1E62A 4LMPA 1U9IC 1A7KA 1ABEA 1IC6A 1R8QA 1S3FA 2X8AA 4LY6A 4AT1A 2RG7A 2P67A 2QRPA 1BQ3A 1I10A 3LP5A 3SN6A 4O5AA 4AZTA 3THYB 4GG1A 2P79A 1XZKA 1P6UA 3DOFA 2WE8A 3QXXA 2DFTA 3BB3A 4DV7B 4AS1A 1EVLA 1DTEA 1RT9A 5DF1A 2WNSA 3CF4G 4L74A 2RG1A 1T5IA 1KZYC 3AX6A 1HZZA 1YS6A 4I4TB 4LTNA 5FOUA 4S12A 4B32A 1I4TD 1GSIA 2FSGA 5CBPA 3NEPX 3PQ8A 4COKA 2FUNB 4KIGA 4W5OA 4FE4A 1O58A 5J9FA 2P9JA 3F7TA 1VDZA 3AF1A 2ZPUA 4L4SA 1XEXA 2C3UA 4RJLA 1KJWA 1N36B 3LAWA 4QXRA 1GDTA 1OX6A 3THRA 1QF6A 1CR4A 2VYCA 1TLTA 2J9XB 1P3DA 2JFUA 3ZCPA 4XIIA 2ODQA 3B1FA 8ABPA 2O2JA 4URHA 4XVUA 1GY8A 3K9WA 5IARA 5DBOA 5JSHA 1IY9A 3OBBA 3LK7A 5T4FA 5A3RA 5HWSA 3BMQA 4PNEA 3F6YA 3ZKWB 1X94A 2PLWA 1LC3A 1MFZA 2IEGA 1N0IA 2CCJA 3U80A 1E4EB 1OXSC 1I01A 2YRWA 1P73A 3ZQ4A 3M34A 4UTRA 1XYYA 1FNDA 3IILA 3UZUA 3D64A 1VGRA 2EBFX 4AJ2A 2H07A 3EUAA 2IW3A 4D45A 3NKLA 4TT8A 1VMEA 2VRCD 5DWQA 2P9FA 5FLEX 5TQ2B 1GU1A 5DK6A 4E46A 4R2JA 1PJLA 4DSAA 4EWLA 3AEUB 1J06A 2F7SA 5JFOA 3ZU2A 3DTNA 2JGDB 2NTNA 1Z74A 3HUEA 5TPZD 3FOEC 4J2TA 2VUTA 3UGJA 1UDWA 4QGHA 2R6JA 3ADDA 1GSOA 1AKUA 2QLLA 1C80A 3ICWA 4MQBA 1GSHA 1FBNA 3LBHA 3G5TA 4HH4A 1F17A 3I28A 4O2BA 4UUAA 1ESZA 1ZD4A 1VCIA 4J29A 4OMFG 5ALNA 4AN4A 2NTEA 4AJ4A 4FIDA 1V1MB 2IPOA 4OEHA 2ZT6A 5KYUA 4DPLA 1ZK0A 1VE9A 4Y1EA 5J4YA 1KO5A 1W1IA 4LK2A 1JLSA 3REQA 1OZFA 2F8LA 4FE3A 3V2HA 2NU7A 4LSWA 5BYKA 4HMOA 3WBKA 3QEMB 5CDFE 5L3VA 2G71A 4FEYA 3EDRA 4GU5A 4MKGA 4AUMA 1X7GA 1C3LA 4TRJA 1WF3A 2IEDA 4OMCA 3TLYA 1UZAA 4G9EA 1L4LA 3AP2A 3NIWA 1S9DA 5JTUA 3GI1A 3KR2A 1UOQA 3S8MA 4YROA 1Y3BE 1PZMA 1VXRA 4YAJA 4C88A 4CFSA 4CRWB 1F7UA 1VL2A 3L40A 5FBLB 3PR2B 1IJBA 3PWZA 1AQLA 1E9VA 3DE4X 1F8GA 1ZD9A 2PZAA 4LRSB 3THXA 1YDFA 1ZM2A 5B36A 1HDXA 3NQ41 1ZEMA 3B8HA 2OEPA 4F5YA 2OBFA 1N2OA 4UDXX 4YIKA 1PJTA 1E7WA 2J8ZA 3A70A 4TN1A 3UFBA 3SZOA 1I2AA 4HLDA 1KGDA 2IHBA 4KN5A 1M6VA 2A9QA 3QKSB 1BE1A 2PNJA 1TCVA 2GCIA 3OZSA 1UH5A 5K09A 3N3BC 1RWBA 1CZNA 3R8CA 3TZHA 3R44A 1GVNB 2QQ5A 3LRPA 2VZ0A 3FWZA 3P9QA 3QE3A 1BC5A 1R0XA 2A1TR 1DBWA 4DLPA 1NBAA 2JGIA 4YAEA 4PC1A 2J3DA 3RU7A 3TQRA 3V4ZA 3A7DA 2F48A 4ARZA 1P4JA 2CZCA 2VXOA 2WT9A 3L8CA 4J1TA 4MV7A 4MVWA 5J5AA 5TGDA 2GFIA 3STVA 1YTUA 1V8FA 2JKZA 4DMGA 3AYXB 1KA9H 4X20B 4ER7A 3SJAA 2OMKA 3DO6A 4HLUC 1TYAE 1XFAA 3Q1KA 3N53A 4N40A 4QEKA 2P9EA 4UVGA 3W2TA 1ZOLA 1CJKC 4LOLA 1ZL0A 2JKYA 2YICA 2D59A 4TT3D 4FYYA 4R7GA 3ETHA 3FMOB 5ELLA 1ZICA 2HF9A 3SU8A 4X85A 1OYVA 4RFSA 5LLSA 5E2AA 2QGNA 3K30A 2A0KA 4G2TA 1GFSA 1FYEA 4FZ5A 5JY1A 3PUVA 5DGDA 3TSAA 2D6FA 3KB2A 2WG1A 3CY6A 1TVMA 5A3JA 3R8FA 4N39A 3AVVA 3BG5A 2VTBB 2J4CA 4LZPA 2I67A 1KORA 1V95A 3GJQA 3IHWA 4XYLA 1A9XA 3VZSA 3VI4B 4A6PA 1DC3A 2CHQA 4H6XA 4ZRNA 4KYIB 4LYEA 4YJFB 4RPKA 1FMCA 1W2HA 4ZU6X 1U2DA 1B6SA 4DLKA 5B55A 5DLPA 4X66B 4WFKA 2PXAA 4HQNA 3VA7A 3LT4A 2PRJA 1ML3A 4PLWA 3S27A 4LHEA 4CF3A 5LOVB 4IIFA 2JANA 1BJTA 2ZJ8A 3EYWA 2NU8A 4C7XA 2YJ5A 1TD1A 3IAS6 2NYRA 3OCXA 1Z12A 3KTAA 4QVIA 2XTMA 4PGMA 3JD4A 3L0ZA 4JSTA 4MPDA 5AI5A 2G5CA 3E9NA 2HO5A 4PVCA 1PEYA 4B6PA 1J90A 2FPIB 4B3GA 5EP4A 2X58A 3ADPA 3E8SA 3JWPA 2XZLA 1YCDA 3TOSA 3FPBA 2ZAGA 3K5PA 1HFKA 3SBEA 5JYBA 4PX5A 4FR5A 5BWNA 5EWJA 2QLBA 5T3YA 1GCUA 3C48A 1BWPA 1NUUA 1TQ8A 2QVBA 3TPFA 5B7NA 1SCAA 5ELMA 5FBRB 4RZ2A 4DDUA 4ZMSA 1XZHA 1XCMA 3DC2A 3K8OE 5IXJA 1GA1A 3IKTA 5IBCA 1SOWA 1JG6A 2R7AA 1QE3A 4LOHA 4GH5A 4R1UA 3M6MD 3BMOA 4YRIA 1QBKC 4YGXB 1VQ1A 5F1OA 1SG0A 3RASA 3GQBA 4TMZA 4WCVA 3PTLA 5JS6A 2BUCA 3KKEA 4NBRA 5JYCA 2C59A 3SS8A 4N01A 3R7FA 1OYOA 2YOGA 3OOHA 5BQPA 1KWKA 1W73A 3THWB 1E3TA 3IQZA 4J0IA 1JIXA 4RABA 4PO1A 2C88A 2CKDA 2GJAA 3MINA 1YJQA 1ORVA 3AY0A 1OF1A 4CL0A 5LQJA 2GF0A 5JCXA 2R44A 2QAGA 3ES9A 3NP9A 4JVOA 4L51A 4FQ5A 4U3JA 4FFPA 3QVGB 1THGA 4FFSA 4L07A 1A8SA 3L8FA 3SQOA 2GNOA 4LF9B 2DUWA 4U8GA 2VNAA 2FW6A 4ZI7F 1C2YA 1CUVA 4LV5B 2RFLA 3SE7A 3KNZA 3TCXB 3GNTA 4P3YA 1VPTA 1WU7A 4FVTA 4EGAA 2QZPA 4MS4A 2X8JB 5ICGA 3BAZA 1IZ8A 3K6SB 1K75A 3RSFA 4P1ZA 1C7QA 2FUG1 3HG7A 4A8JA 3AHCA 4G0UA 2HK8A 1NVMB 1HDYA 3MGKA 5AJUA 5AICA 3K1JA 2HMWA 5TT1A 4MTCA 3IEPA 4JI1B 4UVIA 5D86A 4RK1A 2TSYB 3RQIA 3BIOA 1PBNA 4BP9A 2OHHA 2I6UA 2DUMA 4CT4B 5DBGA 3VH1A 1I9CA 2XGSA 4GQIA 4KV7A 1HTBA 1MH9A 4YGYA 4F1KA 1E2DA 2BEUA 3OQIB 4BUZA 3W5IA 4XYEA 4FN4A 4WA8A 3ZLJA 2QX7A 2Y67A 3D0KA 1L5SA 4NL4H 2XMCA 3W7AA 5A4FS 2OHVA 3NO4A 3EFOB 4F9FA 1BZYA 3HKEB 1HQYE 2GYWA 1JJBA 3AETA 4BX0A 1KJZA 4WXRA 4UDOA 3ZDYB 3K9BA 1AD2A 3H7AA 3TLMA 2IYAA 3CRW1 4TMVA 3DBLA 4FGSA 4QVGA 3OZVA 1G8HA 4YQFA 2ZYWX 4UU0A 2BZ0A 4BWYA 1IPFA 1JDBC 1EE1A 5EY5B 3G9QA 5AW9A 5HTKA 4J3NA 2GBIA 3LT0A 4MQ4A 5GWXA 3NP7A 3S2UA 2JATA 1K7SN 1XCBA 3SSAA 5EJ8A 1QDLB 4DHEA 4B6FA 1FTWA 3GZ4A 3VZCA 4BKUA 2EDCA 2AQIA 1TW3A 2HEIA 1WXXA 3TSCA 1PFQA 3WGJA 1JE0A 2I7TA 2X0KA 4DZTA 1MQ8B 1ZBQA 1V71A 3R74A 4B6RA 3BCSA 3CW2A 1MKYA 3M3HA 4TXMA 5BN4A 1KK2A 1YVRA 1UBJS 3FDJA 1LVUA 4KO2S 2EEZA 2KPOA 1NJ8A 4YT8A 2LE0A 5SZJA 3QFSA 1JVSA 5JNWA 4LFBB 5LMUB 3MRTA 1NG1A 1HXHA 3EVAA 4PZ0A 2NU9B 3ZE9A 3CE9A 3KM0A 2DTDA 4QXQA 2UXDB 4R0MA 3UUWA 1X39A 3RV3A 4EPYA 5KTKA 3JPWA 1DTWB 1QDEA 3M6IA 1EGQA 3RHSA 1VHWA 4BFLA 4US2R 1B2RA 2JIZD 1KXZA 2CUZA 1CD5A 2FWJA 3RKUA 2R8XA 1QIMA 2XNCA 2J3KA 1WM1A 3N8HA 4GZMA 4II3A 2IEBA 2I3GA 2PUGA 2IA5A 3A05A 3D2BA 4CMGA 4YCMA 1E6MA 3CHYA 3I05A 1JFFB 4Y2RA 1Q1ZA 1O1YA 3HV0A 3PFWO 3G2KA 5LIRA 2JEYA 1GUDA 1E6KA 3A9WA 2ISQA 2MSEB 1N8KA 3D9QX 1CB0A 4Z4FA 1KZ1A 2BL4A 1YDWA 3DOIA 2WHPA 3EZFA 3HO8A 2BGUA 1QC5A 4W7IA 4Y1RB 4ZVVA 4LJAA 2QRZA 5T4EA 4BQRA 1LW6E 4LJKA 2GJ4A 3P97A 1MA0A 3DMPA 3PX3A 3RBXA 2BGRA 4F4HA 1QH8A 5ILOA 4OGKA 2ABWA 4MP8A 4HNHA 4PEVA 3QTTA 4UPVA 4ZYUA 1JLMA 5DBHX 5EJ2A 3SE0A 2QI9F 1XMOB 2FFAA 2KW5A 2G6TA 1E1NA 3CSUA 1W5FA 4XI9A 5J1TB 4FYJA 4Z7OB 1F20A 1FJ2A 1Y6JA 1YBFA 3NDPA 2KLBA 3S6JA 2IITA 1QQBA 1EK5A 4EX6A 3HFJA 3EDYA 4TM8A 3VR6H 1LLCA 3ZLTA 4D9NA 3UT5A 2V6FA 3F3YA 3B13B 1OI4A 2BHSA 2PSEA 3AESB 1G98A 4FUQA 4KDFA 4M46A 4F6RB 1XNGA 4X1OA 3E84A 3H1EA 3QVOA 5E3JA 3IMEA 2BJWA 2QRGA 4IX1A 3LUBA 4CCWA 2MINA 4RQTA 1YJ5A 3GW8A 3QZUA 1DAHA 3FDIA 3MGGA 3TXXA 4DIKA 2ORVA 4JELA 5I3ZA 1X1TA 1UFKA 1H6DA 4JL5A 1EZ4A 3DF7A 1F6WA 1QVZA 1U0HC 5KNBD 5FI0B 2O3SA 2Y1LA 3KUXA 5CCDA 2QPOA 3JV7A 1BMTA 1ZRNA 2AMLA 3D6TB 3F0TA 1M2OB 4DQKA 5CA0B 3OLQA 4B5KA 5E6UA 1MC4A 1DT3A 1QV6A 1GZ6A 1R4MA 1U11A 1X9GA 3P20A 3TNJA 4D4HA 5EIFA 3AVWA 2RGWA 1HE2A 3AWDA 3RLIA 2PDAA 3AHDA 2UUAB 3T4EA 1Q7GA 3UJCA 3VAYA 2JLXA 4KX3A 1DQNA 1B74A 1Z29A 4WY2A 1WD7A 4JXKA 4C4RA 5B6PA 3C7KA 1EEXB 2PUEA 3TNDA 4Q9KA 2CKMA 2GB4A 2YJ4A 1WY5A 4JLBA 3UAYA 2ERYA 3X1ZA 1U6IA 1V25A 3BB1A 3WS7A 1KARA 2EFEB 1E3DA 2QR3A 2YMMA 1E2IA 4WEQA 1C3XA 1X87A 2ORWA 4K9OA 2WUFA 1CLEA 4K6OA 4TX1A 1G4AE 1OWNA 1EFAA 4MWTA 2IZZA 1WL8A 2PO5A 2H9IA 4KMMA 4OXQA 2Q1YA 1ZM9A 4S24A 4OX9B 4PVDA 1T0HB 4W63A 2H17A 2R96A 4BE4A 1RJ9B 3O21A 3DBHB 4I9NA 4FW8A 2AZMA 1Z45A 2GEFA 1WVGA 3MSCA 1B41A 3D6HA 4Z7QB 3LLMA 4MAAA 1IULA 4ZVSA 3EXAA 4B2PA 3AUYA 2V8OA 2FV8A 1NMZA 1OI3A 2PA3A 4ZVOA 2Y9PB 1XDZA 3GDFA 2WT4A 2AEEA 4M22A 3VXKA 3LLCA 4G1UC 4ZDKA 1PYDA 4H3SA 3BGSA 421PA 4OUDB 2YWHA 4ARAA 4L0MA 1ULSA 4C14A 4FPXA 1FYWA 2R8EA 2I6TA 4HB3A 1UEIA 2O7QA 3LW8A 3GLRA 5F3DA 3FDZA 2UZAA 4DCGA 3VKVA 4DIDA 3SEQA 2RGCA 3DS8A 3GLFB 2JGLA 4LCEA 4I46A 3Q6NA 3FVRA 2IUEA 1RFGE 5JQGA 1OB2A 2C8KA 3LX6A 1T24A 4D43A 1T4CB 1IYZA 1E2UA 3M5PA 1P31A 4RANA 4R8RA 2BI8A 5F2EA 4TQ9A 1EXNA 3B6MA 2BW0A 2B83A 4BWGA 1E3EA 4AMYA 2JH9A 2WE7A 3PX2A 3CVJA 4WLOA 4WNIA 5AVKA 5G4KA 4DRXB 2XA9A 2FPXA 4TV8B 2I7XA 4O2LA 1XOIA 2IZ5A 3F97A 2CXXA 2GCNA 1BCRA 2XAUA 3NVAA 4HH3C 1HEYA 2GD0A 4LOJA 4QULA 1PV1A 5K0NA 4DQVA 2O3TA 1H05A 1XB2A 3I92A 4MW4A 4Y2HA 2GVNA 2HH9A 2X2EA 1YZUA 4JQCA 3EHDA 1C4OA 3A11A 1UOEA 2DR3A 2PX3A 3BE6A 4B7CA 1M8JA 2R1TA 2FFBA 1HNWB 4KBYA 4U6NA 2F4VB 3UMFA 2XB2A 2F9FA 1L7NA 3DMNA 4HVTA 3AR3A 1TLFA 4MIOA 4PZUA 3K0BA 4UNQA 5EE1A 3LBAA 3NW9A 1G8AA 4QYSA 2I4IA 3H13A 3WXMA 1CIVA 3EASA 2O57A 3UK0A 4V1CA 1TKAA 1Y89A 4C6HA 1OTHA 4ZYYA 1YA6A 2OZEA 5FBVB 2FYTA 5TQVA 2SCUB 3TLAA 1M1UA 2ZRDA 3VO8A 1NV8A 2XE4A 4D3DA 1QQ7A 1U5AA 5F9MA 1GGKA 2DJ5A 3TQTA 2D2IA 1G19A 3EZ2A 3MCAA 4JUIA 4GBMA 1WMAA 2XB4A 1ODCA 3A25A 5AQEA 5DNVA 1E2GA 1MB2A 1HYGA 2MSNA 2O8DA 2HFJA 3CVWA 2CFSA 4WXHA 4BFYA 4PZLA 5IJ0B 4ZHQA 4IILA 1G7RA 4XIFA 1AMNA 1LH0A 1RJDA 1XWFA 1YDHA 4M86A 3SR0A 4RESA 2AI1A 2O0MA 2QMZA 3ANSA 4JYCA 4B3MB 2VAMA 1OXTA 2FEWB 2IP4A 3AFNA 3EQ6A 3EFEA 1IJKA 3AHEA 5E6RB 1I5OA