2ZPYA

Crystal structure of the mouse radxin ferm domain complexed with the mouse cd44 cytoplasmic peptide
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
b'KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis for CD44 recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 87
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2zpyA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2zpyA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zpyA01
2R09A 1FAOA 2LOZA 2N9PC 5DPRA 2ZCCA 1WX9A 1KZ7A 3I3TB 1H8CA 3RYTA 3ZNID 5FR6A 2DHJA 2IY0B 3R3MA 3RULA 1UNQA 4KZ0A 1NTIA 3CSFA 3CIKA 4HLEA 1BTNA 1EUVB 4CO7A 1V5UA 2KN5A 3X0WA 2RVBB 3A8QA 1UD7A 1GC7A 3KH0A 1PQSA 1WYWB 4II3B 5D3VA 3QK0A 3SUZA 2KWVB 3SD5A 2EMSA 2LASA 3QCAA 1WY8A 3U8ZA 2LBBA 2M38A 2KWCA 2YSZA 2UYZB 3N3KB 4FA6A 3SV1A 1RFAA 3S2AA 4ICUA 4K2PA 4MGYE 5LONB 1V2YA 2KQ7A 1GUAB 2V76A 2LKOA 1WM3A 2KMCA 2UVMA 4TUUA 4GDKA 2AEHA 3D8FA 3LJUX 1XQQA 1LM8B 2AWTA 4B6WA 2PPHA 1EF1A 1V5TA 1Y19B 1YIWA 1WZ3A 1WGUA 2RLOA 4H8SA 2MBQA 3PHWB 4IG7B 2MWNB 4PNKA 3DXEA 3X23A 1P9DU 2BCJA 4J6IA 3QX1A 2A5UA 4FHJA 2M1MA 4TYZA 2IO2B 1M94A 2DTCA 2DYMA 3UINB 2FCSA 1WJUA 2KK8A 3TO1A 3IHPC 4A20A 3V61A 4PS3A 1XODA 2CHWA 3H9DA 3UQBA 3ZO5B 1LW3A 2NBWB 1WFYA 3NOBA 2C9WB 4MT7A 3M62B 2D10A 3TVVA 4KIKB 2KFKA 3VAWA 3NHEB 3VOQA 2NZ8B 1EF5A 5DPSA 5J3QA 3BJIA 4K81A 2DA0A 2KTRB 2Z0EB 1WI1A 2DHIA 2VRRB 3C0RB 2CU1A 3HK0A 4GXBA 3VUWA 2G3QB 1S1QB 5JHBA 3DVGX 1T0YA 4IW0A 2MFQA 4A5KA 2YS3A 2P0FA 3ZVRA 2DX5B 3ZNHB 2QKMA 2D9WA 4AWJA 2JY6A 3PG7A 2B3AA 5JZEB 2BGFA 1E5WA 1HE8A 2I5FA 2KXJA 4KZCA 4AP4C 1QC6A 4MDKE 1P6SA 2N9EB 3IFWB 4GGQA 2LULA 4WWPA 2CKHB 2RPQA 3JYUA 2VSZA 2O2VA 3FSSA 4XWXA 4CHKA 2NPTB 3KYDD 1TGZB 3QA8A 2LOXA 2V1YA 3DXCA 4CHMA 2KLCA 1I35A 1AQCA 2JVCA 4M8NA 2N9XA 1WIAA 3A33B 2L2IA 2ASQA 1V61A 4IM2A 1PFJA 3QBVB 5HKHA 2FCNA 5E6PA 2L0FA 2Q13A 4RM8A 2CAYA 2M4NA 2BYVE 3KW5B 2KDFB 4NAWB 4KV2A 5J18A 1YQBA 2KX3A 2YVCA 2P8VA 2WX0A 1X05A 2ELAA 1NDDA 1PMSA 2G45B 3KUDB 3HW2B 3SU8X 3RZFA 2D9ZA 4FULA 2L3ZA 5TR5A 4BVUC 3PT2B 5JHAA 4OVUA 3Q3JA 1UZXB 2DZJA 1WGQA 3SYXA 3U30A 4FLHA 4IWQA 2QKLA 2FCQA 3AULA 2C60A 1H10A 2W2XD 1ZKHA 4K7WA 3PVLA 2XBBC 2L7RA 1MAIA 2JWZA 2JXXA 3A9JB 4YONA 1RRPB 2Z0PA 2CS4A 3PTFC 2ROVA 2NBVB 2AL3A 4ANUA 4W9LA 2R0DA 3ODXA 4WAAA 2LGXA 2KTRA 1TBEA 3VH4B 3WALA 2IY1B 4ANXA 1WJMA 2MWSB 4K7SA 3QIJA 3OJ4B 4F7ZA 1UBQA 1U4AA 5CHFA 2KFJA 5HE3A 2UZSA 4HJKA 1U5GA 2Y8FA 1IRSA 3A98B 1P98A 2EC1A 2KOXA 1V5MA 2R2OA 2K1FA 5G55A 3FEHA 4A6FA 3EHVA 2KDIA 1WGYA 4F7HA 3O65B 2IO3B 1NBFC 1ZC3B 4EEWA 4BBNF 3R7RA 4HDOA 3AU5A 4A6KA 5AZHA 2KUPA 4KHBB 2MBHA 1WGGA 2XQNM 2CR5A 2ZNVC 1WXSA 2IFSA 3H7PB 4NJ6A 4OVVA 1UEFA 5BO4B 2BKRB 2IBIB 1J8CA 1P3QU 3GOEA 3LJ3A 3RZWC 3APFA 4ZRKA 4NAWA 2WYQA 4W9KA 4KSLC 2LG1A 2KCJA 3SNHA 1UELA 2FCMA 2ZVNA 1KLVA 2DN6A 3A4RA 3A8PA 4MGZE 3MHSD 1GNUA 4CHJA 1U2BA 2H7DA 2D07B 2IYDB 3QC8B 2WH5A 2PE9A 3L13A 5E6OA 4HAUB 1SIFA 2ZVOA 1VD2A 5HE0A 2V3SA 1E90A 1OGWA 2GJYA 3H6NA 2NCNA 4WJPA 3TCAA 2DHKA 1MK9B 5DI9B 3G9WA 3NS8A 2KFKB 2WDTB 3A9JA 3MJWA 1TTNA 4MK0A 4FJYA 2GS0A 2KJ6A 3T06A 4CYEA 4JL9A 2WWZA 4EMOA 1XD4A 4AJYB 2D3GA 2JZZA 2KLGA 1A5RA 5C5BB 3L10B 5DCNA 3UIOB 5JHHA 2MP2B 3AI5A 4GZUA 3NY5A 1EVHA 2LGDA 4WJOA 3V5WA 1IPGA 3ZNZB 2AL6A 2P0HA 4JQWC 4N9F4 2JF5A 4WQOB 3F5RA 2DLWA 2HD5B 1V49A 2REXA 3KVFB 2JPHA 3IG3A 3M63B 4C0AA 3N32A 4G11A 3PEGA 5L81A 2O2VB 3MPXA 1FGYA 1UGMA 2YS1A 1ZW7A 1K5GB 4JGHB 1ZSQA 2KQSA 4E3CA 1FB8A 2LXCA 3QWMA 2YF0A 5IA7A 4K17A 2C5LC 1P1AA 1VCBA 2CHXA 3L17A 1GC6A 1L2NA 2DYOA 1OY2A 1LXDA 2MDXA 2ROZB 4IFSA 4MJSA 4KDLB 3H7PA 2LYDA 2LGYA 2RGNB 2MSED 5D2MB 2KZRA 1DROA 2O6VB 5DH9B 2N4FA 3QARA 4I6PA 1WMHA 3CXBB 3ZTDA 1NTVA 5C6RA 1J0GA 4E74A 4LDTB 1EO6A 5AZGA 2FIFA 2FDQA 5KHOA 5JH5C 4WVFB 2CRFA 2RSUA 4AJWA 5G2NA 1WX7A 2COCA 4W9EA 5GMVA 4KDIC 2C7MB 4NY0A 1LB1A 4EKUA 4B6HA 1SGHA 5CTRC 3TL5A 3AXCA 1M7EA 3ULCA 2YLMA 1EAZA 3DQVA 2I1JA 4WWNA 4EZJA 1QQGA 4TKNA 4IC7B 4GN1A 3P6AA 4HWIB 5J17A 2HJ8A 4HXDA 3PREA 1YX5B 4DX8A 2GOWA 4KHAA 1E7VA 3DBHI 1EGXA 2KMAA 2FJ9A 1M7RA 3VHTC 3KRWA 4BKSD 2KO3A 4TQ1A 2N1WA 1P0RA 2GBMA 2L05A 2G35A 1W1HA 1L7YA 2KWUB 3V60A 4BKTA 1TZ1A 1XT9B 2EMTA 1HBKA 3T9LA 5C5BA 2K00A 3KRXA 1D3ZA 4HAZB 1DDWA 2MP2A 2FUHB 4DBBA 5J3TA 1UPRA 4ANWA 3ZVVA 4MEMA 1YD8U 3DXDA 1XCGA 2JT4B 5KQ4A 1V5OA 1BTKA 5J2RA 2LD9A 4IM3A 3R66C 2FAZA 3ZIMA 4HDQA 2H7EA 3QAQA 1Q1OA 2YRYA 1V81A 2J7QB 4W9HA 5HE1A 3DBSA 2RNRB 3WAPA 4A6FB 2DZKA 4L6EA 4KSKC 4ZDVA 1SE9A 4G50A 2E2XA 1F9JA 3APCA 1GG3A 2K8HA 3PRMB 1WRDB 1IP9A 2V4LA 1U5EA 1MKEA 3ZDMC 2LRUA 1S3SG 2K39A 1ZC4B 2L8JA 2JRHA 2KTFA 2ELBA 1FGZA 4DHJB 1UNRA 2W9NA 2LWPA 4MSMB 2PE6B 4IWOA 1KM7A 3CSTA 1MPHA 4HAYB 4K2OA 2O6VA 5D3XA 4F8CB 3ML4A 3VTUA 2ZCBA 1V89A 1DYNA 4GOCA 3ONSA 3UQAA 1NTYA 1MIZB 3WIMA 3VQIA 2D9VA 3LDZE 1WXAA 3HIZA 5DIFB 3UZTA 1I2HA 4URKA 3EECA 4GMXB 4W9DA 1YX6B 4MM3A 1OEYA 2AYOB 4WJNA 4A3PA 2DYQA 1V88A 2BWFA 2Y5BB 1J19A 4GPTB 3ZKJC 2KNBA 5CHWA 3W1SC 4G0NB 4PYUA 2J0JA 2W2XC 3HQCA 2CQUA 4WSFA 4GB9A 3NZSA 2IYBA 3VH3B 4BFRA 3ULBA 2FNJB 2UZRA 3JVZX 2ZPNA 3DOWA 2ZPYA 4GDLB 2I5CA 3QJZA 1H4RA 2Z0QA 5D7GA 4HPMB 4KVGB 2K2JA 2MX2A 5C16A 3DVGY 1OMWA 3H7SA 2YS5A 2DAJA 1WR6E 2VKIA 4KAXB 1UPQA 2LRWA 2M17A 1K8RB 2CY5A 3DCGA 2G4DB 2JZ3B 3VUYA 2L1CA 4ZRJA 4FHKA 4EFOA 2N0YA 2C7HA 2XEWA 4RM9A 4IWPA 1WJNA 2MA9B 2KGXB 2KDEB 3JSVB 3GYOA 1X86A 4DHZE 5C1ZA 2HE7A 1ZVRA 5L95C 2NBUA 1YJ1A 3UF8A 2LVOA 2MW5A 4AUQC 4I6LB 5LLIA 5D6JB 3PLVA 4JIOU 1U5FA 1ZM0A 3RT3B 2HTHB 2D4QA 3V6EB 2ZNVB 5DHFB 3TBLD 3CMMB 2CY4A 4MJSB 5DPTA 1OQYA 2CHZA 3JW0X 2KJRA 1TQZA 5CLLB 3P7ZA 3PV1A 1X1FA 3DBLI 4MELA 2M0XA 1SHCA 1V9JA 3VTWA 1WMHB 3L54A 3D8DA 2LZ6A 4WWOA 2KJHB 4ICVA 2LUEA 1Z87A 3NZUA 2KKCA 2I1KA 1ACAA 1JRUA 4NPNA 2Z0OA 3FLVA 4Z2NA 1WI0A 4ANVA 3DVNU 3PLUA 1FOEA 1X1GA 4F7UP 2NR2A 3W1SA 3D32A 2Z59B 3O96A 3L0WB 2LVQA 2RUKB 3DVNV 2L76A 2KHWB 1MIXA 2GCJA 5E6NA 1Y5OA 2K6DB 4D0NB 3TIXA 3GYPA 2DX1A 4DX90 2DYNA 3KZ1A 3WA0A 2EKEC 3WANA 3UIPB 4ZRIA 1OQNA 1FHWA 2PZ1A 3ZTCA 1DDMA 2LXAA 3M95A 4GDLA 1G6JA 3PRZA 2BYFA 2JUOA 1KOTA 2XK5B 1Z5SB 2FJLA 2C7NB 4II2B 1BWNA 3PPAA 2NVUI 4NSWA 1OEYJ 1DBHA 2NS5A 5JHGA 3ZNGC 2QHOA 5FI0A 1IYFA 4E71A 1RRBA 4HB2B 1WM2A 1LQBA 3WYFB 2DHZA 2GCLA 2P0DA 3JSVA 4IAPA 2X18A 2MBEA 3AJ4A 1C3TA 2KD0A 3ECIA 1RAXA 4TQ0A 2OJRA 2COAA 3L16A 2CB8A 3D8EA 1AWEA 4HAXB 3ZRCA 4Z2MB 1V80A 3IBEA 3GZNI 2OTXA 4W9GA 2YT0A 3OLMD 4HHVA 3SHQA 4HCPB 2G4SA 1TJ6A 4HB4B 2HTHA 3PHXB 3VIAA 2M8SA 3K9PB 2A4ZA 3KUZA 4LJOB 4BKGA 3HHMA 1U5DA 4RMAA 1P3RA 3VDZA 2FIDA 2Y8GA 1V5PA 2OOBB 5IJMA 3PRPB 5D27A 4DDGD 2DFKA 3BINA 4I6NB 4NQLB 4B9KA 1E8YA 2BF8B 3PVWA 5AZFA 3APDA 1HB6A 3A9KB 1C1YB 1U27A 3QQ8B 3M3JA 1BAKA 4NQKE 5HE2A 4FN2A 5EDSA 3U7DA 4GU2A 2J0KA 1WGHA 4HVBA 4K1RB 2DZMA 1WJ4A 2L0TA 1E8ZA 5C23A 3RUIB 2R2QA 2DKQA 2DAFA 2BWES 4A6HA 3KY9A 1WF9A 2DZIA 4DWFA 4MY6A 2JRIB 3SO6A 3TMPB 4HAWB 2O6VD 4KHOA 4XC2A 3AU4A 1Q0WB 3NSUA 3ZLZA 1Z2MA 1AARA 2DENB 4LDTD 4IUMB 4W9CA 2RR9A 5L83A 2XK5A 3B1LX 2IO1B 2MKRA 1ZGUB 3IVFA 3PSCA 3V6CB 3F0WA 5KCVA 1Y8RC 3QHTA 5CHVC 1I7AA 4WJQA 3ODWA 5JLJB 1GJZA 4ASWC 2MBOA 3N30A 1KJTA 4BBKA 4EZKA 2YT1A 4NJ7A 1WGDA 2M14A 4PS7A 3A4SC 3N7CA 5LOPB 2N23A 1U29A 5KQ1A 4F1SA 1OTRB 3V62A 3DBRI 4BOZB 4MGKE 3WAMA 3QWZB 2ABDA 5CLQB 4FJVB 1DDVA 4W9JA 1WE7A 3OAWA 4W9IA 2GMIC 2MQJA 5D94A 4DHZB 4Y94A 4XX5A 4FBJB 1WGRA 2J59M 3ML9A 1WG7A 4F7GA 1CMXB 2ZJDA 1J0WA 1X11A 3K9OB 2IZVB 2J0MA 3B0AA 4AOFA 1WE6A 2RSGA 4M8MA 3SDLC 5JP4A 1XKEA 1Q5WB 4FJZA 4DXAB 1K5DB 3PGEA 2ZEQA 2LVPA 4GIVA 2CODA 3ML8A 4JLCA 3DDCB 1R4MI 1V6EA 4TV3A 2K2UA 2PEAA 2COFA 1WJ6A 5EFXA 3TW1A 2K6QA 2Z0DB 2MLBA 1LFDA 2IO0B 4LCDE 3A9KA 4IOYX 4YL8A 4FADA 3PS6A 4MSQB 2K8CA 4EZLA 2PJHA 3RD2A 3DPDA 4DDID 3B08A 1R4NI 2N7EA 1P5TA 4PYZA 4BKSA 4DHJD 3BY4B 1E8WA 5LXHA 3FP5A 2LI5A 5FI1A 5C79A 1W1DA 2BPSA 4HCNB 2GBRA 4HB0B 2Y7BA 4DK5A 2D2QA 5KHQA 5J3YA 3ZUNA 3EFUA 1WH3A 2EJ8A 1X1MA 3HM3A 4XZ4A 5D3YA 3A1QB 2DYBA 1UBIA 3VFKA 1NVLA 4P7IA 2K25A 2RGFA 3RCZA 1ISNA 3Q3FA 2HRJA 2MBBB 2GBNA 4G3XB 1XX0A 3ZDTA 3W1YA 3MDBC 1MK7B 4KIKA 2D9XA 1E7UA 4HB3B 3M1IB 4HATB 2N7DA 4PS8A 5AEKB 3MTNB 2KDBA 4MH0E 1FHOA 4W9FA 1NI2A 2RQ1A 4DBGA 2JP2A 4IM0A 5DPWA 2WX1A 3PZDA 4EOYA 5D3WA 4BBNC 2N1VA 1NU2A 1RJ2A 4A3OA 4WJ7A 2DX5A 4BOSC 1UH6A 1QZEA 2NMBA 3R7QA 2BYEA 2DKPA 4PQ0A 5LXIB 1KZGA 3L08A 3FM8C 1V86A 1FHXA 3PVUA 1WX8A 2NPTA 4EUTA 2MCNB 1XD3B 1PLSA 1FXTB 4K7UA 2UWQA 2KC2A 4X57B 3OANA 2KANA 3ZRFA 3KYCD 1E8XA 1MG8A 3VXWA 2D11A 1UNPA 4GDKB 2ZZPB 3H1UA 5GOWB 3EC8A 3PSEB 1WXVA 3PP2A 3ODOA 3T8MA 3VUXA 3EPYA 2GBJA 4EJNA 3P2BA 3CF6E 5DHAB 4NNJB 3ZW3A 3TJPA 2KX0A 3OJ3A 2KVRA 2K8BA 3ALBA 2MRPA 1WR1A 4MGIE 4B95A 3VTVA 2RD0A 4HPLB 1RLFA 1Q67A 2ADZA 2VRWB 1WXMA 3WAOA 1ST7A 4HK2A 1BT0A 1WZ0A 3KSYA 4GMVA 3RCPA 2KC1A 2LJ5A 2BKFA 4M0WB 4GSWA 1I42A 5IAAC 4LJPB 1W1GA 2D9YA 1N3HA 1KI1B 3A1QA 5CX3A 1HB8A 3TFMA 2W2WA 1B55A 1WJ1A 3ENEA 1XR0B 3KUCB 4HAVB 2L00B 3VVWB 3UGBB 2COPA 1TXDA 4ZYNA 3HM6X 2OQBA 2GBKA 1WVHA
chains in the Genus database with same CATH superfamily
2R09A 1FAOA 2XN9C 3U52E 4MACA 2LOZA 3HIEA 1DYQA 2N9PC 5DPRA 2ZCCA 3SFDB 1Y56A 2G9HD 1WX9A 1KZ7A 3I3TB 1H8CA 3RYTA 3ZNID 5FR6A 2DHJA 2IY0B 3R3MA 5TSSA 3RULA 1UNQA 4L23A 2LHEA 4KZ0A 4JPSA 1NTIA 2V3PA 4RCOA 3CSFA 5IN7A 3CIKA 4HLEA 1BTNA 5JVLA 1EUVB 3I9V1 4CO7A 1T6BX 1V5UA 2B76B 2KN5A 3AB5A 3X0WA 2BBCA 1QF6A 2RVBB 3LYYA 1D6EC 2M56B 3A8QA 3NVYA 1UD7A 4LK0M 1GC7A 3KH0A 1PQSA 1WYWB 5EE1A 1RFKA 5HFYA 4II3B 3C8YA 5D3VA 2G1EA 2EKIA 3QK0A 1TY0A 3ETRA 4DXGA 3SUZA 2KWVB 4L1RA 3SD5A 2EMSA 3NG0A 2LASA 3QCAA 1WY8A 3U8ZA 2LBBA 2M38A 2KWCA 1XLQA 2YSZA 2UYZB 3N3KB 4FA6A 3SV1A 2KQ4X 1RFAA 3S2AA 4ICUA 2L32A 4K2PA 4MGYE 1F2RI 5LONB 2MHJA 3N1ZC 4D6WA 1V2YA 2KQ7A 4KHBA 1GUAB 2V76A 2Q5WD 2LKOA 1XF5L 1WM3A 2KMCA 2UVMA 4TUUA 1D5XC 4GDKA 2AEHA 2BYTA 3D8FA 3LJUX 4RFBA 1FRDA 1XQQA 1LM8B 2AWTA 4B6WA 2QDFA 1DOIA 1ZXHA 4A9AA 2PPHA 2FUG1 1EF1A 1YMHE 1V5TA 1Y19B 1YIWA 1WZ3A 1WGUA 2RLOA 4H8SA 2MBQA 3PHWB 2AQ1B 4IG7B 2MWNB 4PNKA 4R3DA 2W3RA 1FCLA 2D3BA 3DXEA 1UF0A 3X23A 1P9DU 5LNK1 2K0PA 3GP7A 2BCJA 4CSQA 2NTSA 3DCXA 4J6IA 1JDEA 3QX1A 2A5UA 4FHJA 4M0WA 2M1MA 1KFYB 2INNE 4TYZA 4JX1C 2VH2A 2V9HA 1VR9A 2IO2B 1M94A 2DTCA 2DYMA 1IGCA 2DBYA 4US8A 2WXFA 3UINB 2FCSA 1WJUA 2KK8A 3TO1A 4YT0B 3IHPC 4A20A 3V61A 4PS3A 1XODA 2CHWA 3H9DA 3UQBA 3ZO5B 1LW3A 2NBWB 1WFYA 3NOBA 2C9WB 4MT7A 3M62B 1F77A 5EE0A 2D10A 3DBHB 1HA5A 3TVVA 1HTQA 4KIKB 2KFKA 3VAWA 4JWUC 3NHEB 3VOQA 2Y5CA 2NZ8B 1EF5A 4XDDA 5DPSA 5J3QA 3BJIA 5BMHA 4K81A 4GLSC 2N7JA 2DA0A 2KTRB 2Z0EB 3KWLA 1WI1A 2DHIA 2I38A 2VRRB 3C0RB 2CU1A 1GB4A 1EU3A 4JKGA 3HK0A 3MC9A 4MH8A 4GXBA 1M4VA 3VUWA 2G3QB 1S1QB 5JHBA 2QMTA 1FFUA 3DVGX 1T0YA 1JW9D 4IW0A 2MFQA 1OFFA 1UWMA 4A5KA 1T0QC 4JKDA 5I2SA 2W82A 2YS3A 2P0FA 3T3NA 4N59A 3ZVRA 2DX5B 3ZNHB 2M0AA 3P63A 2QKMA 2D9WA 4AWJA 2JY6A 3PG7A 2B3AA 5JZEB 2BGFA 2WXRA 1E5WA 1HE8A 2I5FA 2KXJA 4KZCA 2QCZA 1KRHA 2E3TA 4AP4C 1N63A 1QC6A 1I4RA 5G5GA 4MDKE 1P6SA 2N9EB 3IFWB 2WXLA 1EWCA 2IPKD 4GGQA 3TEYA 2LULA 2RRFA 2BB6A 4WWPA 3BYTB 2KYWA 2CKHB 2WDVB 3E9PA 2RPQA 3JYUA 2VSZA 2O2VA 2VZKB 3FSSA 4XWXA 1BUIC 3CWIA 3MC8A 4CHKA 5H92C 2NPTB 3KYDD 1TGZB 3QA8A 3AEFB 2LOXA 2V1YA 3U12A 3DXCA 4CHMA 2KLCA 1I35A 3NS1A 2KUQA 1AQCA 2JVCA 4M8NA 4JK9A 3R8BA 2N9XA 1WIAA 3A33B 2L2IA 2ASQA 1V61A 2WS3B 1ZXIA 4IM2A 1WSPA 2LUMA 1PFJA 4WAFA 3QBVB 4OZBA 4ZHPA 5HKHA 2FCNA 5E6PA 2L0FA 2Q13A 4RM8A 2QJLA 2CAYA 2M4NA 2BYVE 3KW5B 2KDFB 4NAWB 4TMAB 4KV2A 4ILHA 1YQ4B 5J18A 4OZAA 1YQBA 2KX3A 2YVCA 2P8VA 5HG2A 2WX0A 2WHIA 1X05A 1MHHE 2ELAA 1NDDA 4JWSC 1DIKA 4DIXA 1PMSA 1C77A 2ACZB 2G45B 3RNAC 3KUDB 3HW2B 3SU8X 3RZFA 2D9ZA 3AE3B 4RF0A 4FULA 2L3ZA 2DWQA 4LNFA 2WXQA 5TR5A 1L5PA 3NRZA 1TYGB 1I7HA 4BVUC 3KQ4A 3PT2B 5JHAA 2RPVA 4OVUA 3VRAB 1WXQA 1KC7A 3Q3JA 1XO3A 1UZXB 2DZJA 2YEPB 1WGQA 4C7ZA 3SYXA 1FPYA 3U30A 4FLHA 2X8XX 4IWQA 5AUKA 5BYSA 2QKLA 2FCQA 3AULA 2C60A 1GGOA 1H10A 2W2XD 3AE6B 1ZKHA 4K7WA 3PVLA 2XBBC 3AMZA 2L7RA 1HTOA 2WXJA 1MAIA 2JWZA 2JXXA 2SEBD 3URYA 3A9JB 4YONA 1JROA 3E9LA 1RRPB 4JKFA 4K3BA 2Z0PA 1L0YB 1KLGD 2CS4A 3PTFC 2ROVA 2NBVB 2AL3A 1MHXA 4ANUA 4JK7A 1JWUD 4W9LA 2R0DA 1N62A 3ODXA 4WAAA 2LGXA 5G5HA 2KTRA 1TBEA 3VH4B 3WALA 1KF6B 2IY1B 5BMIA 4ANXA 1JALA 3EUB2 1BXTA 1WJMA 4OW0A 3KWVA 2MWSB 2YEPF 4HEA1 3B9JA 4K7SA 3HUIA 3QIJA 1KBLA 3OJ4B 4F7ZA 1UBQA 3E9SA 1U4AA 1FEHA 1FMAD 3BVMA 5CHFA 4A55A 1QQRA 3KLSX 2KFJA 2WXNA 5HE3A 2UZSA 3P42A 3W5UB 4HJKA 1U5GA 4Q2JA 2Y8FA 4P6VF 1IRSA 3A98B 2KIEA 1P98A 2EC1A 1FXAA 1L4DB 2KOXA 3UI3A 1XLPA 1V5MA 3RN9C 2R2OA 3GS2A 5C2TB 2LGIA 2K1FA 5G55A 3FEHA 3NUHB 3ENBA 4A6FA 3EHVA 1JRPA 2KDIA 1WGYA 2CU3A 4F7HA 3O65B 2HJ1A 2IO3B 1E0ZA 2WXMA 1NBFC 1ZC3B 4EEWA 4BBNF 3DHIC 3R7RA 1RWSA 1SE3A 4HDOA 3AU5A 4A6KA 5AZHA 2KUPA 4KHBB 2MBHA 2PVGC 1WGGA 2XQNM 2CR5A 2ZNVC 1WXSA 5IRSA 5GXGB 2IFSA 3H7PB 3ZYYX 4NJ6A 4OVVA 1UEFA 5BO4B 1MJDA 2BKRB 2QSDA 2WDQB 2IBIB 1J8CA 4HKZE 1P3QU 3AV8A 3GOEA 1C78A 3DBLB 3LJ3A 3RZWC 1V97A 3APFA 4ZRKA 2J42A 4NAWA 2BT6A 2WYQA 4W9KA 4YWGG 4KSLC 3OHMB 2LG1A 2JYTA 3RNFC 2KCJA 3SNHA 1UELA 1FXIA 2FCMA 2ZVNA 1KLVA 3R2IA 1K51A 1I4HA 3FAHA 4L1BA 2DN6A 3A4RA 3A8PA 4MGZE 3MHSD 1GNUA 5IKCM 3Q3OC 4CHJA 1U2BA 2FBWB 2H7DA 4P16A 2D07B 2JXTA 3RNCC 4ZRQA 2WLBA 3NVWA 2IYDB 1FNWA 3QC8B 1ACCA 2WH5A 2PE9A 3L13A 5E6OA 2OEDA 4HAUB 1SIFA 2PKOA 1PYWD 2ZVOA 2MH7A 1JCKB 1TKYA 1VD2A 5HE0A 2V3SA 1E90A 1OGWA 2WXPA 3E56A 2GJYA 3H6NA 1ZYIA 3TSSA 2K22A 2W54A 2JYEA 2NCNA 4WJPA 3TCAA 2DHKA 2IJ0A 1MK9B 5DI9B 1IGDA 3G9WA 4IOIE 1QKZA 2HDEA 3NS8A 4HRSA 2KFKB 2WDTB 1TT5B 3A9JA 3FKYA 3MJWA 4REZA 1TTNA 5IOIA 4MK0A 4FJYA 4UDUC 2GS0A 2KJ6A 3T06A 1N6ZA 4RH6A 2NBVA 3FC4A 2WGSA 4CYEA 4JL9A 4C80A 2WWZA 1KH0A 4M02A 4JKGB 4EMOA 1XD4A 4AJYB 1C4PA 2D3GA 2JZZA 3LXFA 3SBTA 2KLGA 1A5RA 5C5BB 5EE9A 5IO9A 3L10B 5DCNA 3UIOB 3BYYB 3B2FA 5JHHA 1JMLA 2MP2B 3AI5A 4GZUA 3NY5A 1EVHA 2LGDA 4WJOA 1F0ZA 3V5WA 3W9CB 1IPGA 4US9A 3ZNZB 1SEBD 2AL6A 2P0HA 3R2TA 4JQWC 4N9F4 2JF5A 4WQOB 2ON8A 3F5RA 2X38A 2DLWA 2HD5B 1V49A 1T77A 2REXA 3HVZA 2D3CA 3KVFB 2IGDA 2GUMA 2JPHA 3IG3A 3M63B 2PTLA 3AN1A 4C0AA 3N32A 4G11A 1CQVA 3AEDB 1TJEA 3PEGA 1SF0A 5L81A 2O2VB 3MPXA 1FGYA 3GZNB 1UGMA 2YS1A 1ZW7A 3L4PA 1HZ5A 1K5GB 2K9XA 1F52A 4JGHB 1ZSQA 2KQSA 4E3CA 1FB8A 1ZE3D 2LXCA 3NZ3A 3QWMA 2YF0A 5IA7A 4K17A 2C5LC 1P1AA 5AUIA 1VCBA 2CHXA 3L17A 1GC6A 3RNGC 2DYOA 1L2NA 1OY2A 1F1HA 1LXDA 2MDXA 2ROZB 4IFSA 1V8CA 4MJSA 2BW2A 4C56C 4KDLB 3H7PA 2LYDA 1VZ6A 4RF1A 2LGYA 2RGNB 2MSED 4JKCA 1SJHD 5D2MB 2KZRA 1DROA 2O6VB 5DH9B 2N4FA 3Q6BA 3QARA 4I6PA 1WMHA 3CXBB 4LNIA 1XLNA 3ZTDA 2IGGA 1NTVA 3BK2A 5C6RA 1J0GA 1F2RC 4E74A 3RMKC 4LDTB 1EO6A 5AZGA 2FIFA 2FDQA 4WQMA 5KHOA 4WVFB 2CRFA 5JH5C 4RGMA 2RSUA 4AJWA 2GRIA 5G2NA 1WX7A 2INCC 3V05A 2COCA 4W9EA 5GMVA 1L6VA 4KGTA 4KDIC 2C7MB 1TZOA 1T3QA 4NY0A 1LB1A 2INDC 4EKUA 4B6HA 1SGHA 5CTRC 3TL5A 3AXCA 1M7EA 1WGKA 2EELA 3ULCA 2YLMA 4HJGE 3N1YC 4XE0A 1FRRA 1EAZA 3DQVA 5I2MA 2I1JA 4WWNA 4EZJA 2INPE 5BYQA 1QQGA 4TKNA 4IC7B 4GN1A 1NYQA 1UGJA 3P6AA 4HWIB 4JK8A 3MJ5A 5J17A 1TS3A 2HJ8A 4HXDA 1FCCC 3PREA 1TKGA 1YX5B 1SJED 1SBBB 4WURA 2ICIA 4DX8A 1V1PB 4KHAA 2GOWA 2V3NA 2PVOD 1E7VA 4TSSA 4S0RA 1R7SA 3DBHI 3ZXVA 3DHHC 1EGXA 2KMAA 2FJ9A 1M7RA 3VHTC 3KRWA 4BKSD 2KO3A 4TQ1A 1VZ7A 2H89B 4C7YA 2N1WA 1P0RA 2GBMA 2L05A 2RDBC 2G35A 1W1HA 1L7YA 1P7FA 1A70A 1QOGA 2KWUB 4XDCA 3V60A 2MJ3A 4BKTA 1TZ1A 1E6EB 1XT9B 1C4AA 1XCTL 2EMTA 1HBKA 3BIID 3T9LA 5C5BA 4RGOS 2K00A 3KRXA 4RNAA 3GB1A 1C9FA 1D3ZA 4HAZB 4A6QA 1DDWA 2MP2A 3CIRB 2FUHB 3IT4B 4DBBA 5J3TA 2AQ2B 1UPRA 4QAYA 2KWDA 3Q14C 4ANWA 4GOUA 1HZ6A 3ZVVA 1MPEA 4MEMA 3U4EG 2QIEB 1YD8U 3DXDA 1XCGA 2JT4B 5KQ4A 4P1CC 1V5OA 1YN4A 4OZCA 1BTKA 1BMLC 2RDGA 5J2RA 2LD9A 5BYRA 3DBRB 2L83A 4IM3A 3R66C 2D5GA 2FAZA 3Q8CA 3ZIMA 4HDQA 4K3CA 2H7EA 4JKEA 3QAQA 1Q1OA 2YRYA 1V81A 2J7QB 4W9HA 5HE1A 2KR0A 2WQYB 3DBSA 2RNRB 4HROA 3AECB 2L1AA 3WAPA 4A6FB 2DZKA 4L6EA 4KSKC 3AEGB 4ZDVA 1SE9A 4G50A 2E2XA 1ENFA 1F9JA 3APCA 4NJCA 3AE4B 1GG3A 2K8HA 3PRMB 1WRDB 1IP9A 2V4LA 1U5EA 3TUOA 1MKEA 3ZDMC 3RPFC 1CZPA 2LRUA 1IBXA 4JKBA 4L2YA 1S3SG 2K39A 1ZC4B 2L8JA 2JRHA 1XXGA 5EE3A 2KTFA 4LLGM 4XWTA 4B0EA 2ELBA 4DXFA 1FGZA 4DHJB 1UNRA 2W9NA 2DNFA 2LWPA 4MSMB 2PE6B 4IWOA 1KM7A 1ZPSA 3CSTA 2WP9B 3AE8B 1MPHA 4HAYB 4K2OA 2WXOA 2O6VA 2K8EA 5D3XA 4NZLB 4F8CB 3ML4A 3VTUA 1FM0D 1L0VB 2ZCBA 1V89A 1DYNA 2LFIA 4GOCA 3ONSA 3UQAA 1NTYA 4ZRPA 1MIZB 3WIMA 3VQIA 2D9VA 3LDZE 2I2YA 2R61A 1WXAA 4PT5A 2VZKD 3HIZA 5DIFB 3UZTA 2H88B 1I2HA 4URKA 3EECA 4GMXB 4W9DA 1YX6B 1GB1A 4MM3A 1OEYA 1N61A 2AYOB 4WJNA 4A3PA 2DYQA 1V88A 2BWFA 2Y5BB 1J19A 4GPTB 1ROEA 3ZKJC 2KNBA 5D3DA 5CHWA 1R4NB 1E7PB 1CK1A 3W1SC 4G0NB 4PYUA 2J0JA 4N6EB 2W2XC 3HQCA 2CQUA 4WSFA 4GB9A 3NZSA 2IYBA 4USAA 2JZPA 3VH3B 4BFRA 3ULBA 3EA6A 2FNJB 2UZRA 3JVZX 2WU5B 2ZPNA 3DOWA 2ZPYA 4GDLB 1NEKB 2I5CA 2NTTA 3QJZA 1H4RA 1V1PA 2Z0QA 4CQNA 5D7GA 4HPMB 3TEWA 4KVGB 2K2JA 2MX2A 1DGJA 2VH1A 2DLBA 2PLPA 5C16A 3DVGY 1OMWA 1JWAD 3H7SA 2YS5A 2DAJA 1WR6E 2JWUA 5E6JA 1HXYD 3NVZA 2VKIA 1XLOA 2BTEA 1RM6C 3DHGC 4KAXB 1KTKA 1UPQA 2LRWA 2M17A 3VR8B 1K8RB 2CY5A 1NENB 3DCGA 2G4DB 2JZ3B 1WWTA 4YSZB 3VUYA 2L1CA 5BMGA 4ZRJA 3OG5A 1HEZE 4FHKA 4EFOA 2N0YA 2C7HA 2XEWA 4RM9A 4IWPA 1VBHA 1AWDA 1WJNA 2MA9B 2KGXB 2KDEB 4ARCA 2BVCA 2X0SA 2LHDA 3JSVB 3EFCA 3BWUD 3GYOA 1X86A 4OVZA 2JQRB 4DHZE 5C1ZA 2HE7A 1ZVRA 5L95C 1HQRD 1PGBA 2NBUA 1NI3A 1E9MA 3Q8BA 4LNOA 1K50A 1YJ1A 3UF8A 2LVOA 2OJWA 2MW5A 4AUQC 4I6LB 4KKJA 5LLIA 2L52A 3Q8AA 5D6JB 1GPXA 2NMQA 1ESFA 3PLVA 1MFWA 1I4QA 4JIOU 1YJIA 1U5FA 1J7AA 1ZM0A 4HKQA 3RT3B 2HTHB 1PDXA 2D4QA 1D5MC 3NW8A 3V6EB 2ZNVB 1ZDXA 5DHFB 1K53A 3TBLD 4A8XC 1CJEA 3CMMB 4YTPB 1VDVA 2CY4A 2J53A 4MJSB 5DPTA 1STEA 1OQYA 2CHZA 4QJ3B 3JW0X 2KJRA 1TQZA 5CLLB 3P7ZA 3PV1A 1X1FA 3DBLI 4MELA 2M0XA 1SHCA 4B0MA 1TS5A 1V9JA 3N1XC 1J7CA 3VTWA 1WMHB 3L54A 1GAQB 3D8DA 1LO5D 1C76A 2LZ6A 1QOBA 4IKGA 4WWOA 2KJHB 4ICVA 1JWSD 2LUEA 5C3JB 1Z87A 3NZUA 2KKCA 3U7ZA 2I1KA 1ACAA 1JRUA 4NPNA 2Z0OA 3FLVA 2LJIA 2IDYA 1YNTE 4Z2NA 1WI0A 2K49A 4A90A 4ANVA 3DVNU 3PLUA 1FOEA 1X1GA 4F7UP 2NR2A 3W1SA 3D32A 2Z59B 5FK9C 3O96A 3L0WB 2LVQA 2M19A 2V0GA 2RUKB 3DVNV 2L76A 4BZAA 2KDMA 1FNUA 2KHWB 1MIXA 2GCJA 3AEBB 5E6NA 4AQ7A 1Y5OA 2LGSA 2K6DB 4D0NB 2QEJC 3TIXA 3GYPA 1SIJA 2DX1A 4DX90 1SE4A 2DYNA 1B9RA 3KZ1A 3WA0A 2EKEC 3WANA 1PGXA 3UIPB 2WU2B 3NJTA 4ZRIA 1OQNA 1FHWA 2PZ1A 4MT5A 3ZTCA 1DDMA 2LXAA 1D5ZC 1MG4A 3M95A 1MI1A 4GDLA 1G6JA 3PRZA 3HRDD 3RNEC 2BYFA 3ZGZA 1GOZA 2JUOA 1KOTA 3Q2AC 2XK5B 1Z5SB 2FJLA 2C7NB 1L0XB 3I5JC 4II2B 1BWNA 3PPAA 4C00A 2WDRB 2NVUI 4NSWA 1OEYJ 4QJ5B 1DBHA 2NS5A 4HPPA 4KKIA 5JHGA 3T3OA 3ZNGC 2QHOA 1QILA 5FI0A 1IYFA 2SAKA 4E71A 2N0SB 1RRBA 4HB2B 1WM2A 4ITKA 2MJEA 1LQBA 3WYFB 1TKEA 2IGHA 2DHZA 1K52A 3Q69A 2GCLA 2P0DA 3B77A 3JSVA 1DOXA 4IAPA 2X18A 3SFEB 2MBEA 2LMCA 3AJ4A 1QLBB 1C3TA 1SE2A 2KD0A 3ECIA 1RAXA 4TQ0A 2OJRA 2COAA 3BZDB 3L16A 2CB8A 2N9KA 3D8EA 1AWEA 4HAXB 1L4ZB 3ZRCA 4Z2MB 3J9CA 1V80A 3IBEA 3BK1A 3GZNI 2OTXA 4W9GA 2YT0A 2QILA 3OLMD 4HHVA 3SHQA 4HCPB 2WXGA 2G4SA 1TJ6A 1Q10A 4HB4B 1C79A 2HTHA 3VIAA 3PHXB 1TS4A 2M8SA 3K9PB 2A4ZA 3KUZA 4LJOB 1IBXB 3V3XA 4BKGA 3HHMA 3W5VB 3C19A 5H8YE 2KT7A 1U5DA 4RMAA 1C4CA 1P3RA 3VDZA 3IXSA 4OT1A 2FIDA 3FILB 2ZKMX 2Y8GA 1V5PA 2OOBB 5IJMA 4H2AA 3PRPB 3O13A 1WYGA 5D27A 2BS3B 4DDGD 2DFKA 3BINA 4I6NB 5M4YB 4NQLB 4B9KA 1E8YA 2BF8B 3PVWA 1YN5A 5AZFA 3IAM1 2Z13A 3APDA 3AE5B 1HB6A 3A9KB 1C1YB 1U27A 3GE8C 3QQ8B 4LTUA 2KMMA 3TEXA 3M3JA 1JQ4A 1BAKA 1FFVA 4NQKE 5HE2A 4OHJA 4DQOC 3N9YC 3OWEB 4FN2A 4MM3B 3U7DA 1SXTA 4GU2A 5EDSA 2J0KA 1EU4A 3NWAA 3ZJTA 3AE9B 2KIGA 1WGHA 1PFDA 2Z59A 1QT9A 4K1RB 4C4VB 4HVBA 1OQQA 4WIPA 4JE3B 2DZMA 1WJ4A 2L0TA 1E8ZA 4XGAB 3B2GA 5C23A 3RUIB 2R2QA 2DKQA 2DAFA 4AS1A 4YTMB 2BWES 4A6HA 2HTME 3KY9A 1WF9A 1T0RC 2DZIA 1VBGA 4DWFA 4MY6A 2JRIB 3SO6A 3MFGA 3TMPB 4HAWB 1VZ8A 2O6VD 4KHOA 4ZYSA 3ZJVA 1UUPA 2OHFA 4XC2A 3AU4A 1Q0WB 3DWGC 3NSUA 1JWBD 3ABVB 3ZLZA 1Z2MA 1AARA 2DENB 4LDTD 4IUMB 4W9CA 2JX5A 2RR9A 4RGNA 1J7BA 5L83A 2XK5A 3B1LX 2Z8LA 1TIFA 2IO1B 2MKRA 1ZGUB 3IVFA 4QJ4B 3PSCA 3V6CB 3F0WA 5KCVA 1Y8RC 3QHTA 1VJKA 5CHVC 1KLUD 1I7AA 2WXHA 4WJQA 3ODWA 1XCQL 5JLJB 1GJZA 4ASWC 2MBOA 3N30A 1LGRA 1DOYA 1KJTA 4BBKA 4EZKA 2YT1A 1YN3A 5FKAC 3SR6A 4FXCA 4NJ7A 1WGDA 2GI9A 2M14A 4PS7A 3U2SC 3A4SC 3N7CA 2UU7A 5LOPB 3ZXRA 2N23A 1U29A 5KQ1A 4F1SA 3SBGA 2R82A 1OTRB 2PMVA 2RMMA 2W3SA 2LEKA 3V62A 4BAXA 1IUEA 3DBRI 4BOZB 3TEZA 2AQ3B 4MGKE 3WAMA 1NVID 2V4IB 3QWZB 2ABDA 5HI1A 5CLQB 2WXKA 1DDVA 2YT2A 1QOFA 4FJVB 4W9JA 1WE7A 4J3OD 3OAWA 4W9IA 2GMIC 2MQJA 2Y3AA 5D94A 4DHZB 3VRBB 1D4BA 4Y94A 4XX5A 4FBJB 1WGRA 2J59M 3AE1B 3ML9A 1MVKA 1WG7A 2KN4A 4YSYB 1E10A 4F7GA 1CMXB 3BVZA 2ZJDA 1J0WA 4ARIA 1X11A 3K9OB 2IZVB 3SEBA 2WXIA 2J0MA 2KACA 3B0AA 4AOFA 1WE6A 2RSGA 4M8MA 3SDLC 4WH4A 5JP4A 3AEAB 3RNBC 1XKEA 3FVCA 1SB3C 1Q5WB 3VR9B 3MC0B 4FJZA 4DXAB 1K5DB 2DIKA 2KVZA 3AM9A 3FILA 3PGEA 3Q3MC 1FNVA 2ZEQA 2LVPA 4GIVA 2CODA 3ML8A 4JLCA 3DDCB 1R4MI 1V6EA 4TV3A 2K2UA 2PEAA 1R4MB 2XNAC 1T5XD 1PGAA 3I57A 1AN8A 2COFA 1WJ6A 5EFXA 3TW1A 4YTNB 4KX6B 5D3IB 1TY2A 2K6QA 2Z0DB 2MLBA 4RGTA 1LFDA 2IO0B 1ZOYB 4LCDE 3A9KA 4YXDB 2K5PA 2QC8A 4IOYX 1UNSA 5IP4D 4YL8A 4FADA 3PS6A 4MSQB 4WWMA 2K8CA 5LG4B 4EZLA 2PJHA 3RD2A 5T8IA 4ILGB 2GB1A 3DPDA 4DDID 3B08A 1R4NI 4IDIA 2N7EA 4C4VA 2PIAA 1P5TA 2N9LA 4PYZA 4BKSA 1ZDVA 5HHDG 4DHJD 3H8HA 2E6XA 3BY4B 4O1NA 1E8WA 5LXHA 3FP5A 2JSVX 5FI1A 2LI5A 5C79A 1W1DA 1ET6A 2BPSA 4HCNB 4PK1A 2GBRA 4HB0B 2Y7BA 4DK5A 2W55A 2D2QA 5KHQA 5J3YA 3ZUNA 3EFUA 1EWYC 5MPOA 1ET9A 1WH3A 2EJ8A 1X1MA 3Q8FA 3HM3A 4ZOHC 2JU6X 4XZ4A 5D3YA 3A1QB 2DYBA 1UBIA 4P1BC 1N60A 3VFKA 1NVLA 4P7IA 1YOVB 2J52A 2K25A 3A58A 1MI0A 2RGFA 1T0SC 1EM7A 3RCZA 1ISNA 3E9OA 3DWMA 3Q3FA 3ZJUA 2HRJA 2MBBB 2GBNA 4G3XB 3PZ7A 1XX0A 3ZDTA 3W1YA 3MDBC 1MK7B 1QOAA 1JWMD 4KIKA 3NWFA 2D9XA 1RYJA 2R2YA 1E7UA 4D2KA 4HB3B 3M1IB 3W2DA 3IT6B 1I4GA 4HATB 1SSNA 2N7DA 4PS8A 5I4DA 5AEKB 3MTNB 2KDBA 4MH0E 3RFZB 1FHOA 4W9FA 1WRIA 2BS2B 2FJUB 1NI2A 2RQ1A 2ONQA 2RDHA 4DBGA 1N5WA 2JP2A 4IM0A 3MHZA 5DPWA 2WX1A 3PZDA 4EOYA 2ZW0A 5D3WA 2Y5PA 4BBNC 2N1VA 1NU2A 3AH7A 1RJ2A 4A3OA 2FE8A 4WJ7A 2DX5A 4BOSC 1UH6A 4M00A 1QZEA 3AE2B 2PW9A 2NMBA 4LNNA 1L6UA 3R7QA 2BYEA 4S17A 2DKPA 1VLBA 2WNMA 3AE7B 4PQ0A 5LXIB 1KZGA 3MP9A 1VRAB 2J4XA 3L08A 3FM8C 4YSXB 2CJOA 2CJNA 1FD6A 1FIQA 2Z14A 2BQQA 1V86A 1FHXA 4HSIA 3E66A 3PVUA 1N5XA 1WX8A 2NPTA 4EUTA 2MCNB 1XD3B 1P7EA 1FO4A 1PLSA 1FXTB 2K3UA 3P4QB 4K7UA 2UWQA 2KC2A 3NWDA 4X57B 3OANA 3ZQ4A 2KANA 3EGRA 3ZRFA 4JKAA 3KYCD 1E8XA 1MG8A 3VXWA 2D11A 1YJJA 3RI7C 2AX5A 5JXVA 1UNPA 1XEEA 4KGRA 1NYRA 4GDKB 2ZZPB 3P4SB 3H1UA 5GOWB 1I4PA 3EC8A 3PSEB 4N58A 2ZW1A 1WXVA 4OSNA 3PP2A 3ODOA 4XWWA 3T8MA 3VUXA 3I63C 3EPYA 3N20C 2GBJA 4EJNA 3P2BA 3CF6E 5DHAB 2Z4DA 4NNJB 3ZW3A 3HSAA 3TJPA 2KX0A 3AEEB 3PZ8A 3OJ3A 4KGSA 3PO0A 2KVRA 2K8BA 3ALBA 2MRPA 1WR1A 2BB5A 1OQRA 4MGIE 3HVDA 3P1MA 4B95A 3VTVA 2RD0A 2GLSA 4HPLB 1RLFA 1Q67A 3LB8C 2ADZA 2VRWB 1WXMA 2TSSA 3WAOA 1ST7A 4HK2A 1BT0A 1V1OA 1WZ0A 1ZP0B 3KSYA 4GMVA 4ZHOA 3RCPA 3IAS1 2MEKA 2MJDA 1I4XA 1B1ZA 2KC1A 2LJ5A 2BKFA 4M0WB 4NAMA 1AYFA 4GSWA 2BS4B 1I42A 5IAAC 4LJPB 1TS2A 4QXAB 1W1GA 1UWXA 2D9YA 4EE2A 4M01A 1N3HA 1KI1B 2KAJA 3A1QA 5CX3A 1PUTA 1HB8A 3TFMA 2W2WA 3NVVA 3Q3NC 1B55A 1ZUD2 1WJ1A 1YQ3B 3ENEA 1XR0B 3KUCB 4HAVB 2L00B 4JKHA 3BVGA 3VVWB 4ACFA 3Q8EA 2D3AA 3UGBB 2COPA 1TXDA 5FR3A 4ZYNA 3HM6X 4XYCA 2OQBA 3P4PB 1AW7A 2GBKA 3GE3C 4GNKB 3P4RB 3WCQA 4LNKA 4ILJA 1WVHA
chains in the Genus database with same CATH topology
2R09A 1FAOA 2LOZA 2N9PC 5DPRA 2ZCCA 1WX9A 1KZ7A 3I3TB 1H8CA 3RYTA 3ZNID 5FR6A 2DHJA 2IY0B 3R3MA 3RULA 1UNQA 4KZ0A 1NTIA 3CSFA 3CIKA 4HLEA 1BTNA 5JVLA 1EUVB 4CO7A 1V5UA 2KN5A 3X0WA 2RVBB 3A8QA 1UD7A 1GC7A 3KH0A 1PQSA 1WYWB 4II3B 5D3VA 3QK0A 3SUZA 2KWVB 3SD5A 2EMSA 2LASA 3QCAA 1WY8A 3U8ZA 2LBBA 2M38A 2KWCA 2YSZA 2UYZB 3N3KB 4FA6A 3SV1A 1RFAA 3S2AA 4ICUA 4K2PA 4MGYE 5LONB 1V2YA 2KQ7A 1GUAB 2V76A 2LKOA 1WM3A 2KMCA 2UVMA 4TUUA 4GDKA 2AEHA 3D8FA 3LJUX 1XQQA 1LM8B 2AWTA 4B6WA 2PPHA 1EF1A 1V5TA 1Y19B 1YIWA 1WZ3A 1WGUA 2RLOA 4H8SA 2MBQA 3PHWB 4IG7B 2MWNB 4PNKA 3DXEA 3X23A 1P9DU 2BCJA 4J6IA 1JDEA 3QX1A 2A5UA 4FHJA 2M1MA 4TYZA 2IO2B 1M94A 2DTCA 2DYMA 3UINB 2FCSA 1WJUA 2KK8A 3TO1A 3IHPC 4A20A 3V61A 4PS3A 1XODA 2CHWA 3H9DA 3UQBA 3ZO5B 1LW3A 2NBWB 1WFYA 3NOBA 2C9WB 4MT7A 3M62B 2D10A 3TVVA 4KIKB 2KFKA 3VAWA 3NHEB 3VOQA 2NZ8B 1EF5A 5DPSA 5J3QA 3BJIA 4K81A 2DA0A 2KTRB 2Z0EB 1WI1A 2DHIA 2VRRB 3C0RB 2CU1A 4JKGA 3HK0A 4GXBA 3VUWA 2G3QB 1S1QB 5JHBA 3DVGX 1T0YA 4IW0A 2MFQA 4A5KA 4JKDA 2YS3A 2P0FA 3ZVRA 2DX5B 3ZNHB 2QKMA 2D9WA 4AWJA 2JY6A 3PG7A 2B3AA 5JZEB 2BGFA 1E5WA 1HE8A 2I5FA 2KXJA 4KZCA 4AP4C 1QC6A 4MDKE 1P6SA 2N9EB 3IFWB 4GGQA 2LULA 4WWPA 2CKHB 3E9PA 2RPQA 3JYUA 2VSZA 2O2VA 3FSSA 4XWXA 4CHKA 2NPTB 3KYDD 1TGZB 3QA8A 2LOXA 2V1YA 3DXCA 4CHMA 2KLCA 1I35A 1AQCA 4M8NA 2JVCA 4JK9A 2N9XA 1WIAA 3A33B 2L2IA 2ASQA 1V61A 4IM2A 1PFJA 3QBVB 5HKHA 2FCNA 5E6PA 2L0FA 2Q13A 4RM8A 2CAYA 2M4NA 2BYVE 3KW5B 2KDFB 4NAWB 4KV2A 4ILHA 5J18A 1YQBA 2KX3A 2YVCA 2P8VA 2WX0A 1X05A 2ELAA 1NDDA 1DIKA 1PMSA 2G45B 3KUDB 3HW2B 3SU8X 3RZFA 2D9ZA 4FULA 2L3ZA 5TR5A 4BVUC 3PT2B 5JHAA 4OVUA 1KC7A 3Q3JA 1UZXB 2DZJA 1WGQA 3SYXA 3U30A 4FLHA 4IWQA 2QKLA 2FCQA 3AULA 2C60A 1GGOA 1H10A 2W2XD 1ZKHA 4K7WA 3PVLA 2XBBC 2L7RA 1MAIA 2JWZA 2JXXA 3A9JB 4YONA 3E9LA 1RRPB 4JKFA 2Z0PA 2CS4A 3PTFC 2ROVA 2NBVB 2AL3A 4ANUA 4JK7A 4W9LA 2R0DA 3ODXA 4WAAA 2LGXA 2KTRA 1TBEA 3VH4B 3WALA 2IY1B 4ANXA 1WJMA 2MWSB 4K7SA 3QIJA 1KBLA 3OJ4B 4F7ZA 1UBQA 1U4AA 5CHFA 2KFJA 5HE3A 2UZSA 4HJKA 1U5GA 2Y8FA 1IRSA 3A98B 1P98A 2EC1A 2KOXA 1V5MA 2R2OA 2K1FA 5G55A 3FEHA 3ENBA 4A6FA 3EHVA 2KDIA 1WGYA 4F7HA 3O65B 2IO3B 1NBFC 1ZC3B 4EEWA 4BBNF 3R7RA 4HDOA 3AU5A 4A6KA 5AZHA 2KUPA 4KHBB 2MBHA 1WGGA 2XQNM 2CR5A 2ZNVC 1WXSA 2IFSA 3H7PB 4NJ6A 4OVVA 1UEFA 5BO4B 2BKRB 2IBIB 1J8CA 1P3QU 3GOEA 3LJ3A 3RZWC 3APFA 4ZRKA 4NAWA 2WYQA 4W9KA 4KSLC 2LG1A 2KCJA 3SNHA 1UELA 2FCMA 2ZVNA 1KLVA 2DN6A 3A4RA 3A8PA 4MGZE 3MHSD 1GNUA 4CHJA 1U2BA 2H7DA 2D07B 2IYDB 3QC8B 2WH5A 2PE9A 3L13A 5E6OA 4HAUB 1SIFA 2ZVOA 1VD2A 5HE0A 2V3SA 1E90A 1OGWA 2GJYA 3H6NA 2NCNA 4WJPA 3TCAA 2DHKA 1MK9B 5DI9B 3G9WA 3NS8A 2KFKB 2WDTB 3A9JA 3MJWA 1TTNA 4MK0A 4FJYA 2GS0A 2KJ6A 3T06A 4CYEA 4JL9A 2WWZA 4JKGB 4EMOA 1XD4A 4AJYB 2D3GA 2JZZA 3SBTA 2KLGA 1A5RA 5C5BB 3L10B 5DCNA 3UIOB 5JHHA 2MP2B 3AI5A 4GZUA 3NY5A 1EVHA 2LGDA 4WJOA 3V5WA 1IPGA 3ZNZB 2AL6A 2P0HA 4JQWC 4N9F4 2JF5A 4WQOB 3F5RA 2DLWA 2HD5B 1V49A 2REXA 3KVFB 2JPHA 3IG3A 3M63B 4C0AA 3N32A 4G11A 3PEGA 5L81A 2O2VB 3MPXA 1FGYA 1UGMA 2YS1A 1ZW7A 1K5GB 4JGHB 1ZSQA 2KQSA 4E3CA 1FB8A 2LXCA 3QWMA 2YF0A 5IA7A 4K17A 2C5LC 1P1AA 1VCBA 2CHXA 3L17A 1GC6A 1L2NA 2DYOA 1OY2A 1LXDA 2MDXA 2ROZB 4IFSA 4MJSA 4KDLB 3H7PA 2LYDA 2LGYA 2RGNB 2MSED 4JKCA 5D2MB 2KZRA 1DROA 2O6VB 5DH9B 2N4FA 3QARA 4I6PA 1WMHA 3CXBB 3ZTDA 1NTVA 5C6RA 1J0GA 4E74A 4LDTB 1EO6A 5AZGA 2FIFA 2FDQA 5KHOA 5JH5C 4WVFB 2CRFA 2RSUA 4AJWA 5G2NA 1WX7A 2COCA 4W9EA 5GMVA 4KDIC 2C7MB 4NY0A 1LB1A 4EKUA 4B6HA 1SGHA 5CTRC 3TL5A 3AXCA 1M7EA 3ULCA 2YLMA 1EAZA 3DQVA 2I1JA 4WWNA 4EZJA 1QQGA 4TKNA 4IC7B 4GN1A 3P6AA 4HWIB 4JK8A 5J17A 2HJ8A 4HXDA 3PREA 1YX5B 4DX8A 2GOWA 4KHAA 1E7VA 3DBHI 1EGXA 2KMAA 2FJ9A 1M7RA 3VHTC 3KRWA 4BKSD 2KO3A 4TQ1A 2N1WA 1P0RA 2GBMA 2L05A 2G35A 1W1HA 1L7YA 2KWUB 3V60A 4BKTA 1TZ1A 1XT9B 2EMTA 1HBKA 3T9LA 5C5BA 2K00A 3KRXA 1D3ZA 4HAZB 1DDWA 2MP2A 2FUHB 4DBBA 5J3TA 1UPRA 4ANWA 3ZVVA 4MEMA 1YD8U 3DXDA 1XCGA 2JT4B 5KQ4A 1V5OA 1BTKA 5J2RA 2LD9A 4IM3A 3R66C 2FAZA 3ZIMA 4HDQA 2H7EA 4JKEA 3QAQA 1Q1OA 2YRYA 1V81A 2J7QB 4W9HA 5HE1A 3DBSA 2RNRB 3WAPA 4A6FB 2DZKA 4L6EA 4KSKC 4ZDVA 1SE9A 4G50A 2E2XA 1F9JA 3APCA 1GG3A 2K8HA 3PRMB 1WRDB 1IP9A 2V4LA 1U5EA 1MKEA 3ZDMC 2LRUA 4JKBA 1S3SG 2K39A 1ZC4B 2L8JA 2JRHA 2KTFA 2ELBA 1FGZA 4DHJB 1UNRA 2W9NA 2LWPA 4MSMB 2PE6B 4IWOA 1KM7A 3CSTA 1MPHA 4HAYB 4K2OA 2O6VA 5D3XA 4F8CB 3ML4A 3VTUA 2ZCBA 1V89A 1DYNA 4GOCA 3ONSA 3UQAA 1NTYA 1MIZB 3WIMA 3VQIA 2D9VA 3LDZE 1WXAA 3HIZA 5DIFB 3UZTA 1I2HA 4URKA 3EECA 4GMXB 4W9DA 1YX6B 4MM3A 1OEYA 2AYOB 4WJNA 4A3PA 2DYQA 1V88A 2BWFA 2Y5BB 1J19A 4GPTB 3ZKJC 2KNBA 5CHWA 3W1SC 4G0NB 4PYUA 2J0JA 2W2XC 3HQCA 2CQUA 4WSFA 4GB9A 3NZSA 2IYBA 3VH3B 4BFRA 3ULBA 2FNJB 2UZRA 3JVZX 2ZPNA 3DOWA 2ZPYA 4GDLB 2I5CA 3QJZA 1H4RA 2Z0QA 5D7GA 4HPMB 4KVGB 2K2JA 2MX2A 5C16A 3DVGY 1OMWA 3H7SA 2YS5A 2DAJA 1WR6E 2VKIA 4KAXB 1UPQA 2LRWA 2M17A 1K8RB 2CY5A 3DCGA 2G4DB 2JZ3B 3VUYA 2L1CA 4ZRJA 4FHKA 4EFOA 2N0YA 2C7HA 2XEWA 4RM9A 4IWPA 1VBHA 1WJNA 2MA9B 2KGXB 2KDEB 2X0SA 3JSVB 3GYOA 1X86A 4DHZE 5C1ZA 2HE7A 1ZVRA 5L95C 2NBUA 1YJ1A 3UF8A 2LVOA 2MW5A 4AUQC 4I6LB 5LLIA 5D6JB 3PLVA 4JIOU 1U5FA 1ZM0A 3RT3B 2HTHB 2D4QA 3V6EB 2ZNVB 5DHFB 3TBLD 3CMMB 2CY4A 4MJSB 5DPTA 1OQYA 2CHZA 3JW0X 2KJRA 1TQZA 5CLLB 3P7ZA 3PV1A 1X1FA 3DBLI 4MELA 2M0XA 1SHCA 1V9JA 3VTWA 1WMHB 3L54A 3D8DA 2LZ6A 4WWOA 2KJHB 4ICVA 2LUEA 1Z87A 3NZUA 2KKCA 2I1KA 1ACAA 1JRUA 4NPNA 2Z0OA 3FLVA 4Z2NA 1WI0A 4ANVA 3DVNU 3PLUA 1FOEA 1X1GA 4F7UP 2NR2A 3W1SA 3D32A 2Z59B 3O96A 3L0WB 2LVQA 2RUKB 3DVNV 2L76A 2KHWB 1MIXA 2GCJA 5E6NA 1Y5OA 2K6DB 4D0NB 3TIXA 3GYPA 2DX1A 4DX90 2DYNA 3KZ1A 3WA0A 2EKEC 3WANA 3UIPB 4ZRIA 1OQNA 1FHWA 2PZ1A 3ZTCA 1DDMA 2LXAA 3M95A 4GDLA 1G6JA 3PRZA 2BYFA 2JUOA 1KOTA 2XK5B 1Z5SB 2FJLA 2C7NB 4II2B 1BWNA 3PPAA 2NVUI 4NSWA 1OEYJ 1DBHA 2NS5A 5JHGA 3ZNGC 2QHOA 5FI0A 1IYFA 4E71A 1RRBA 4HB2B 1WM2A 1LQBA 3WYFB 2DHZA 2GCLA 2P0DA 3JSVA 4IAPA 2X18A 2MBEA 3AJ4A 1C3TA 2KD0A 3ECIA 1RAXA 4TQ0A 2OJRA 2COAA 3L16A 2CB8A 3D8EA 1AWEA 4HAXB 3ZRCA 4Z2MB 1V80A 3IBEA 3GZNI 2OTXA 4W9GA 2YT0A 3OLMD 4HHVA 3SHQA 4HCPB 2G4SA 1TJ6A 4HB4B 2HTHA 3PHXB 3VIAA 2M8SA 3K9PB 2A4ZA 3KUZA 4LJOB 4BKGA 3HHMA 1U5DA 4RMAA 1P3RA 3VDZA 2FIDA 2Y8GA 1V5PA 2OOBB 5IJMA 3PRPB 5D27A 4DDGD 2DFKA 3BINA 4I6NB 4NQLB 4B9KA 1E8YA 2BF8B 3PVWA 5AZFA 3APDA 1HB6A 3A9KB 1C1YB 1U27A 3QQ8B 3M3JA 1BAKA 4NQKE 5HE2A 4FN2A 5EDSA 3U7DA 4GU2A 2J0KA 1WGHA 4HVBA 4K1RB 2DZMA 1WJ4A 2L0TA 1E8ZA 5C23A 3RUIB 2R2QA 2DKQA 2DAFA 2BWES 4A6HA 3KY9A 1WF9A 2DZIA 1VBGA 4DWFA 4MY6A 2JRIB 3SO6A 3TMPB 4HAWB 2O6VD 4KHOA 4XC2A 3AU4A 1Q0WB 3NSUA 3ZLZA 1Z2MA 1AARA 2DENB 4LDTD 4IUMB 4W9CA 2RR9A 5L83A 2XK5A 3B1LX 2IO1B 2MKRA 1ZGUB 3IVFA 3PSCA 3V6CB 3F0WA 5KCVA 1Y8RC 3QHTA 5CHVC 1I7AA 4WJQA 3ODWA 5JLJB 1GJZA 4ASWC 2MBOA 3N30A 1KJTA 4BBKA 4EZKA 2YT1A 4NJ7A 1WGDA 2M14A 4PS7A 3A4SC 3N7CA 5LOPB 2N23A 1U29A 5KQ1A 4F1SA 3SBGA 2R82A 1OTRB 3V62A 3DBRI 4BOZB 4MGKE 3WAMA 3QWZB 2ABDA 5CLQB 4FJVB 1DDVA 4W9JA 1WE7A 3OAWA 4W9IA 2GMIC 2MQJA 5D94A 4DHZB 4Y94A 4XX5A 4FBJB 1WGRA 2J59M 3ML9A 1WG7A 4F7GA 1CMXB 2ZJDA 1J0WA 1X11A 3K9OB 2IZVB 2J0MA 3B0AA 4AOFA 1WE6A 2RSGA 4M8MA 3SDLC 5JP4A 1XKEA 1Q5WB 4FJZA 4DXAB 1K5DB 2DIKA 3PGEA 2ZEQA 2LVPA 4GIVA 2CODA 3ML8A 4JLCA 3DDCB 1R4MI 1V6EA 4TV3A 2K2UA 2PEAA 2COFA 1WJ6A 5EFXA 3TW1A 2K6QA 2Z0DB 2MLBA 1LFDA 2IO0B 4LCDE 3A9KA 4IOYX 4YL8A 4FADA 3PS6A 4MSQB 2K8CA 4EZLA 2PJHA 3RD2A 4ILGB 3DPDA 4DDID 3B08A 1R4NI 2N7EA 1P5TA 4PYZA 4BKSA 4DHJD 3BY4B 1E8WA 5LXHA 3FP5A 2LI5A 5FI1A 5C79A 1W1DA 2BPSA 4HCNB 2GBRA 4HB0B 2Y7BA 4DK5A 2D2QA 5KHQA 5J3YA 3ZUNA 3EFUA 1WH3A 2EJ8A 1X1MA 3HM3A 4XZ4A 5D3YA 3A1QB 2DYBA 1UBIA 3VFKA 1NVLA 4P7IA 2K25A 2RGFA 3RCZA 1ISNA 3E9OA 3Q3FA 2HRJA 2MBBB 2GBNA 4G3XB 1XX0A 3ZDTA 3W1YA 3MDBC 1MK7B 4KIKA 2D9XA 1E7UA 4HB3B 3M1IB 4HATB 2N7DA 4PS8A 5AEKB 3MTNB 2KDBA 4MH0E 1FHOA 4W9FA 1NI2A 2RQ1A 4DBGA 2JP2A 4IM0A 5DPWA 2WX1A 3PZDA 4EOYA 5D3WA 4BBNC 2N1VA 1NU2A 1RJ2A 4A3OA 4WJ7A 2DX5A 4BOSC 1UH6A 1QZEA 2NMBA 3R7QA 2BYEA 2DKPA 4PQ0A 5LXIB 1KZGA 3L08A 3FM8C 1V86A 1FHXA 3E66A 3PVUA 1WX8A 2NPTA 4EUTA 2MCNB 1XD3B 1PLSA 1FXTB 4K7UA 2UWQA 2KC2A 4X57B 3OANA 2KANA 3ZRFA 4JKAA 3KYCD 1E8XA 1MG8A 3VXWA 2D11A 1UNPA 4GDKB 2ZZPB 3H1UA 5GOWB 3EC8A 3PSEB 1WXVA 3PP2A 3ODOA 3T8MA 3VUXA 3EPYA 2GBJA 4EJNA 3P2BA 3CF6E 5DHAB 4NNJB 3ZW3A 3TJPA 2KX0A 3OJ3A 2KVRA 2K8BA 3ALBA 2MRPA 1WR1A 4MGIE 4B95A 3VTVA 2RD0A 4HPLB 1RLFA 1Q67A 2ADZA 2VRWB 1WXMA 3WAOA 1ST7A 4HK2A 1BT0A 1WZ0A 3KSYA 4GMVA 3RCPA 2KC1A 2LJ5A 2BKFA 4M0WB 4GSWA 1I42A 5IAAC 4LJPB 1W1GA 2D9YA 1N3HA 1KI1B 3A1QA 5CX3A 1HB8A 3TFMA 2W2WA 1B55A 1WJ1A 3ENEA 1XR0B 3KUCB 4HAVB 2L00B 4JKHA 3VVWB 3UGBB 2COPA 1TXDA 4ZYNA 3HM6X 2OQBA 2GBKA 4ILJA 1WVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R09 A;  1FAO A;  2LOZ A;  2N9P C;  5DPR A;  2ZCC A;  1WX9 A;  1KZ7 A;  3I3T B;  1H8C A;  3RYT A;  3ZNI D;  5FR6 A;  2DHJ A;  2IY0 B;  3R3M A;  3RUL A;  1UNQ A;  4KZ0 A;  1NTI A;  3CSF A;  3CIK A;  4HLE A;  1BTN A;  1EUV B;  4CO7 A;  1V5U A;  2KN5 A;  3X0W A;  2RVB B;  3A8Q A;  1UD7 A;  1GC7 A;  3KH0 A;  1PQS A;  1WYW B;  4II3 B;  5D3V A;  3QK0 A;  3SUZ A;  2KWV B;  3SD5 A;  2EMS A;  2LAS A;  3QCA A;  1WY8 A;  3U8Z A;  2LBB A;  2M38 A;  2KWC A;  2YSZ A;  2UYZ B;  3N3K B;  4FA6 A;  3SV1 A;  1RFA A;  3S2A A;  4ICU A;  4K2P A;  4MGY E;  5LON B;  1V2Y A;  2KQ7 A;  1GUA B;  2V76 A;  2LKO A;  1WM3 A;  2KMC A;  2UVM A;  4TUU A;  4GDK A;  2AEH A;  3D8F A;  3LJU X;  1XQQ A;  1LM8 B;  2AWT A;  4B6W A;  2PPH A;  1EF1 A;  1V5T A;  1Y19 B;  1YIW A;  1WZ3 A;  1WGU A;  2RLO A;  4H8S A;  2MBQ A;  3PHW B;  4IG7 B;  2MWN B;  4PNK A;  3DXE A;  3X23 A;  1P9D U;  2BCJ A;  4J6I A;  3QX1 A;  2A5U A;  4FHJ A;  2M1M A;  4TYZ A;  2IO2 B;  1M94 A;  2DTC A;  2DYM A;  3UIN B;  2FCS A;  1WJU A;  2KK8 A;  3TO1 A;  3IHP C;  4A20 A;  3V61 A;  4PS3 A;  1XOD A;  2CHW A;  3H9D A;  3UQB A;  3ZO5 B;  1LW3 A;  2NBW B;  1WFY A;  3NOB A;  2C9W B;  4MT7 A;  3M62 B;  2D10 A;  3TVV A;  4KIK B;  2KFK A;  3VAW A;  3NHE B;  3VOQ A;  2NZ8 B;  1EF5 A;  5DPS A;  5J3Q A;  3BJI A;  4K81 A;  2DA0 A;  2KTR B;  2Z0E B;  1WI1 A;  2DHI A;  2VRR B;  3C0R B;  2CU1 A;  3HK0 A;  4GXB A;  3VUW A;  2G3Q B;  1S1Q B;  5JHB A;  3DVG X;  1T0Y A;  4IW0 A;  2MFQ A;  4A5K A;  2YS3 A;  2P0F A;  3ZVR A;  2DX5 B;  3ZNH B;  2QKM A;  2D9W A;  4AWJ A;  2JY6 A;  3PG7 A;  2B3A A;  5JZE B;  2BGF A;  1E5W A;  1HE8 A;  2I5F A;  2KXJ A;  4KZC A;  4AP4 C;  1QC6 A;  4MDK E;  1P6S A;  2N9E B;  3IFW B;  4GGQ A;  2LUL A;  4WWP A;  2CKH B;  2RPQ A;  3JYU A;  2VSZ A;  2O2V A;  3FSS A;  4XWX A;  4CHK A;  2NPT B;  3KYD D;  1TGZ B;  3QA8 A;  2LOX A;  2V1Y A;  3DXC A;  4CHM A;  2KLC A;  1I35 A;  1AQC A;  2JVC A;  4M8N A;  2N9X A;  1WIA A;  3A33 B;  2L2I A;  2ASQ A;  1V61 A;  4IM2 A;  1PFJ A;  3QBV B;  5HKH A;  2FCN A;  5E6P A;  2L0F A;  2Q13 A;  4RM8 A;  2CAY A;  2M4N A;  2BYV E;  3KW5 B;  2KDF B;  4NAW B;  4KV2 A;  5J18 A;  1YQB A;  2KX3 A;  2YVC A;  2P8V A;  2WX0 A;  1X05 A;  2ELA A;  1NDD A;  1PMS A;  2G45 B;  3KUD B;  3HW2 B;  3SU8 X;  3RZF A;  2D9Z A;  4FUL A;  2L3Z A;  5TR5 A;  4BVU C;  3PT2 B;  5JHA A;  4OVU A;  3Q3J A;  1UZX B;  2DZJ A;  1WGQ A;  3SYX A;  3U30 A;  4FLH A;  4IWQ A;  2QKL A;  2FCQ A;  3AUL A;  2C60 A;  1H10 A;  2W2X D;  1ZKH A;  4K7W A;  3PVL A;  2XBB C;  2L7R A;  1MAI A;  2JWZ A;  2JXX A;  3A9J B;  4YON A;  1RRP B;  2Z0P A;  2CS4 A;  3PTF C;  2ROV A;  2NBV B;  2AL3 A;  4ANU A;  4W9L A;  2R0D A;  3ODX A;  4WAA A;  2LGX A;  2KTR A;  1TBE A;  3VH4 B;  3WAL A;  2IY1 B;  4ANX A;  1WJM A;  2MWS B;  4K7S A;  3QIJ A;  3OJ4 B;  4F7Z A;  1UBQ A;  1U4A A;  5CHF A;  2KFJ A;  5HE3 A;  2UZS A;  4HJK A;  1U5G A;  2Y8F A;  1IRS A;  3A98 B;  1P98 A;  2EC1 A;  2KOX A;  1V5M A;  2R2O A;  2K1F A;  5G55 A;  3FEH A;  4A6F A;  3EHV A;  2KDI A;  1WGY A;  4F7H A;  3O65 B;  2IO3 B;  1NBF C;  1ZC3 B;  4EEW A;  4BBN F;  3R7R A;  4HDO A;  3AU5 A;  4A6K A;  5AZH A;  2KUP A;  4KHB B;  2MBH A;  1WGG A;  2XQN M;  2CR5 A;  2ZNV C;  1WXS A;  2IFS A;  3H7P B;  4NJ6 A;  4OVV A;  1UEF A;  5BO4 B;  2BKR B;  2IBI B;  1J8C A;  1P3Q U;  3GOE A;  3LJ3 A;  3RZW C;  3APF A;  4ZRK A;  4NAW A;  2WYQ A;  4W9K A;  4KSL C;  2LG1 A;  2KCJ A;  3SNH A;  1UEL A;  2FCM A;  2ZVN A;  1KLV A;  2DN6 A;  3A4R A;  3A8P A;  4MGZ E;  3MHS D;  1GNU A;  4CHJ A;  1U2B A;  2H7D A;  2D07 B;  2IYD B;  3QC8 B;  2WH5 A;  2PE9 A;  3L13 A;  5E6O A;  4HAU B;  1SIF A;  2ZVO A;  1VD2 A;  5HE0 A;  2V3S A;  1E90 A;  1OGW A;  2GJY A;  3H6N A;  2NCN A;  4WJP A;  3TCA A;  2DHK A;  1MK9 B;  5DI9 B;  3G9W A;  3NS8 A;  2KFK B;  2WDT B;  3A9J A;  3MJW A;  1TTN A;  4MK0 A;  4FJY A;  2GS0 A;  2KJ6 A;  3T06 A;  4CYE A;  4JL9 A;  2WWZ A;  4EMO A;  1XD4 A;  4AJY B;  2D3G A;  2JZZ A;  2KLG A;  1A5R A;  5C5B B;  3L10 B;  5DCN A;  3UIO B;  5JHH A;  2MP2 B;  3AI5 A;  4GZU A;  3NY5 A;  1EVH A;  2LGD A;  4WJO A;  3V5W A;  1IPG A;  3ZNZ B;  2AL6 A;  2P0H A;  4JQW C;  4N9F 4;  2JF5 A;  4WQO B;  3F5R A;  2DLW A;  2HD5 B;  1V49 A;  2REX A;  3KVF B;  2JPH A;  3IG3 A;  3M63 B;  4C0A A;  3N32 A;  4G11 A;  3PEG A;  5L81 A;  2O2V B;  3MPX A;  1FGY A;  1UGM A;  2YS1 A;  1ZW7 A;  1K5G B;  4JGH B;  1ZSQ A;  2KQS A;  4E3C A;  1FB8 A;  2LXC A;  3QWM A;  2YF0 A;  5IA7 A;  4K17 A;  2C5L C;  1P1A A;  1VCB A;  2CHX A;  3L17 A;  1GC6 A;  1L2N A;  2DYO A;  1OY2 A;  1LXD A;  2MDX A;  2ROZ B;  4IFS A;  4MJS A;  4KDL B;  3H7P A;  2LYD A;  2LGY A;  2RGN B;  2MSE D;  5D2M B;  2KZR A;  1DRO A;  2O6V B;  5DH9 B;  2N4F A;  3QAR A;  4I6P A;  1WMH A;  3CXB B;  3ZTD A;  1NTV A;  5C6R A;  1J0G A;  4E74 A;  4LDT B;  1EO6 A;  5AZG A;  2FIF A;  2FDQ A;  5KHO A;  5JH5 C;  4WVF B;  2CRF A;  2RSU A;  4AJW A;  5G2N A;  1WX7 A;  2COC A;  4W9E A;  5GMV A;  4KDI C;  2C7M B;  4NY0 A;  1LB1 A;  4EKU A;  4B6H A;  1SGH A;  5CTR C;  3TL5 A;  3AXC A;  1M7E A;  3ULC A;  2YLM A;  1EAZ A;  3DQV A;  2I1J A;  4WWN A;  4EZJ A;  1QQG A;  4TKN A;  4IC7 B;  4GN1 A;  3P6A A;  4HWI B;  5J17 A;  2HJ8 A;  4HXD A;  3PRE A;  1YX5 B;  4DX8 A;  2GOW A;  4KHA A;  1E7V A;  3DBH I;  1EGX A;  2KMA A;  2FJ9 A;  1M7R A;  3VHT C;  3KRW A;  4BKS D;  2KO3 A;  4TQ1 A;  2N1W A;  1P0R A;  2GBM A;  2L05 A;  2G35 A;  1W1H A;  1L7Y A;  2KWU B;  3V60 A;  4BKT A;  1TZ1 A;  1XT9 B;  2EMT A;  1HBK A;  3T9L A;  5C5B A;  2K00 A;  3KRX A;  1D3Z A;  4HAZ B;  1DDW A;  2MP2 A;  2FUH B;  4DBB A;  5J3T A;  1UPR A;  4ANW A;  3ZVV A;  4MEM A;  1YD8 U;  3DXD A;  1XCG A;  2JT4 B;  5KQ4 A;  1V5O A;  1BTK A;  5J2R A;  2LD9 A;  4IM3 A;  3R66 C;  2FAZ A;  3ZIM A;  4HDQ A;  2H7E A;  3QAQ A;  1Q1O A;  2YRY A;  1V81 A;  2J7Q B;  4W9H A;  5HE1 A;  3DBS A;  2RNR B;  3WAP A;  4A6F B;  2DZK A;  4L6E A;  4KSK C;  4ZDV A;  1SE9 A;  4G50 A;  2E2X A;  1F9J A;  3APC A;  1GG3 A;  2K8H A;  3PRM B;  1WRD B;  1IP9 A;  2V4L A;  1U5E A;  1MKE A;  3ZDM C;  2LRU A;  1S3S G;  2K39 A;  1ZC4 B;  2L8J A;  2JRH A;  2KTF A;  2ELB A;  1FGZ A;  4DHJ B;  1UNR A;  2W9N A;  2LWP A;  4MSM B;  2PE6 B;  4IWO A;  1KM7 A;  3CST A;  1MPH A;  4HAY B;  4K2O A;  2O6V A;  5D3X A;  4F8C B;  3ML4 A;  3VTU A;  2ZCB A;  1V89 A;  1DYN A;  4GOC A;  3ONS A;  3UQA A;  1NTY A;  1MIZ B;  3WIM A;  3VQI A;  2D9V A;  3LDZ E;  1WXA A;  3HIZ A;  5DIF B;  3UZT A;  1I2H A;  4URK A;  3EEC A;  4GMX B;  4W9D A;  1YX6 B;  4MM3 A;  1OEY A;  2AYO B;  4WJN A;  4A3P A;  2DYQ A;  1V88 A;  2BWF A;  2Y5B B;  1J19 A;  4GPT B;  3ZKJ C;  2KNB A;  5CHW A;  3W1S C;  4G0N B;  4PYU A;  2J0J A;  2W2X C;  3HQC A;  2CQU A;  4WSF A;  4GB9 A;  3NZS A;  2IYB A;  3VH3 B;  4BFR A;  3ULB A;  2FNJ B;  2UZR A;  3JVZ X;  2ZPN A;  3DOW A;  2ZPY A;  4GDL B;  2I5C A;  3QJZ A;  1H4R A;  2Z0Q A;  5D7G A;  4HPM B;  4KVG B;  2K2J A;  2MX2 A;  5C16 A;  3DVG Y;  1OMW A;  3H7S A;  2YS5 A;  2DAJ A;  1WR6 E;  2VKI A;  4KAX B;  1UPQ A;  2LRW A;  2M17 A;  1K8R B;  2CY5 A;  3DCG A;  2G4D B;  2JZ3 B;  3VUY A;  2L1C A;  4ZRJ A;  4FHK A;  4EFO A;  2N0Y A;  2C7H A;  2XEW A;  4RM9 A;  4IWP A;  1WJN A;  2MA9 B;  2KGX B;  2KDE B;  3JSV B;  3GYO A;  1X86 A;  4DHZ E;  5C1Z A;  2HE7 A;  1ZVR A;  5L95 C;  2NBU A;  1YJ1 A;  3UF8 A;  2LVO A;  2MW5 A;  4AUQ C;  4I6L B;  5LLI A;  5D6J B;  3PLV A;  4JIO U;  1U5F A;  1ZM0 A;  3RT3 B;  2HTH B;  2D4Q A;  3V6E B;  2ZNV B;  5DHF B;  3TBL D;  3CMM B;  2CY4 A;  4MJS B;  5DPT A;  1OQY A;  2CHZ A;  3JW0 X;  2KJR A;  1TQZ A;  5CLL B;  3P7Z A;  3PV1 A;  1X1F A;  3DBL I;  4MEL A;  2M0X A;  1SHC A;  1V9J A;  3VTW A;  1WMH B;  3L54 A;  3D8D A;  2LZ6 A;  4WWO A;  2KJH B;  4ICV A;  2LUE A;  1Z87 A;  3NZU A;  2KKC A;  2I1K A;  1ACA A;  1JRU A;  4NPN A;  2Z0O A;  3FLV A;  4Z2N A;  1WI0 A;  4ANV A;  3DVN U;  3PLU A;  1FOE A;  1X1G A;  4F7U P;  2NR2 A;  3W1S A;  3D32 A;  2Z59 B;  3O96 A;  3L0W B;  2LVQ A;  2RUK B;  3DVN V;  2L76 A;  2KHW B;  1MIX A;  2GCJ A;  5E6N A;  1Y5O A;  2K6D B;  4D0N B;  3TIX A;  3GYP A;  2DX1 A;  4DX9 0;  2DYN A;  3KZ1 A;  3WA0 A;  2EKE C;  3WAN A;  3UIP B;  4ZRI A;  1OQN A;  1FHW A;  2PZ1 A;  3ZTC A;  1DDM A;  2LXA A;  3M95 A;  4GDL A;  1G6J A;  3PRZ A;  2BYF A;  2JUO A;  1KOT A;  2XK5 B;  1Z5S B;  2FJL A;  2C7N B;  4II2 B;  1BWN A;  3PPA A;  2NVU I;  4NSW A;  1OEY J;  1DBH A;  2NS5 A;  5JHG A;  3ZNG C;  2QHO A;  5FI0 A;  1IYF A;  4E71 A;  1RRB A;  4HB2 B;  1WM2 A;  1LQB A;  3WYF B;  2DHZ A;  2GCL A;  2P0D A;  3JSV A;  4IAP A;  2X18 A;  2MBE A;  3AJ4 A;  1C3T A;  2KD0 A;  3ECI A;  1RAX A;  4TQ0 A;  2OJR A;  2COA A;  3L16 A;  2CB8 A;  3D8E A;  1AWE A;  4HAX B;  3ZRC A;  4Z2M B;  1V80 A;  3IBE A;  3GZN I;  2OTX A;  4W9G A;  2YT0 A;  3OLM D;  4HHV A;  3SHQ A;  4HCP B;  2G4S A;  1TJ6 A;  4HB4 B;  2HTH A;  3PHX B;  3VIA A;  2M8S A;  3K9P B;  2A4Z A;  3KUZ A;  4LJO B;  4BKG A;  3HHM A;  1U5D A;  4RMA A;  1P3R A;  3VDZ A;  2FID A;  2Y8G A;  1V5P A;  2OOB B;  5IJM A;  3PRP B;  5D27 A;  4DDG D;  2DFK A;  3BIN A;  4I6N B;  4NQL B;  4B9K A;  1E8Y A;  2BF8 B;  3PVW A;  5AZF A;  3APD A;  1HB6 A;  3A9K B;  1C1Y B;  1U27 A;  3QQ8 B;  3M3J A;  1BAK A;  4NQK E;  5HE2 A;  4FN2 A;  5EDS A;  3U7D A;  4GU2 A;  2J0K A;  1WGH A;  4HVB A;  4K1R B;  2DZM A;  1WJ4 A;  2L0T A;  1E8Z A;  5C23 A;  3RUI B;  2R2Q A;  2DKQ A;  2DAF A;  2BWE S;  4A6H A;  3KY9 A;  1WF9 A;  2DZI A;  4DWF A;  4MY6 A;  2JRI B;  3SO6 A;  3TMP B;  4HAW B;  2O6V D;  4KHO A;  4XC2 A;  3AU4 A;  1Q0W B;  3NSU A;  3ZLZ A;  1Z2M A;  1AAR A;  2DEN B;  4LDT D;  4IUM B;  4W9C A;  2RR9 A;  5L83 A;  2XK5 A;  3B1L X;  2IO1 B;  2MKR A;  1ZGU B;  3IVF A;  3PSC A;  3V6C B;  3F0W A;  5KCV A;  1Y8R C;  3QHT A;  5CHV C;  1I7A A;  4WJQ A;  3ODW A;  5JLJ B;  1GJZ A;  4ASW C;  2MBO A;  3N30 A;  1KJT A;  4BBK A;  4EZK A;  2YT1 A;  4NJ7 A;  1WGD A;  2M14 A;  4PS7 A;  3A4S C;  3N7C A;  5LOP B;  2N23 A;  1U29 A;  5KQ1 A;  4F1S A;  1OTR B;  3V62 A;  3DBR I;  4BOZ B;  4MGK E;  3WAM A;  3QWZ B;  2ABD A;  5CLQ B;  4FJV B;  1DDV A;  4W9J A;  1WE7 A;  3OAW A;  4W9I A;  2GMI C;  2MQJ A;  5D94 A;  4DHZ B;  4Y94 A;  4XX5 A;  4FBJ B;  1WGR A;  2J59 M;  3ML9 A;  1WG7 A;  4F7G A;  1CMX B;  2ZJD A;  1J0W A;  1X11 A;  3K9O B;  2IZV B;  2J0M A;  3B0A A;  4AOF A;  1WE6 A;  2RSG A;  4M8M A;  3SDL C;  5JP4 A;  1XKE A;  1Q5W B;  4FJZ A;  4DXA B;  1K5D B;  3PGE A;  2ZEQ A;  2LVP A;  4GIV A;  2COD A;  3ML8 A;  4JLC A;  3DDC B;  1R4M I;  1V6E A;  4TV3 A;  2K2U A;  2PEA A;  2COF A;  1WJ6 A;  5EFX A;  3TW1 A;  2K6Q A;  2Z0D B;  2MLB A;  1LFD A;  2IO0 B;  4LCD E;  3A9K A;  4IOY X;  4YL8 A;  4FAD A;  3PS6 A;  4MSQ B;  2K8C A;  4EZL A;  2PJH A;  3RD2 A;  3DPD A;  4DDI D;  3B08 A;  1R4N I;  2N7E A;  1P5T A;  4PYZ A;  4BKS A;  4DHJ D;  3BY4 B;  1E8W A;  5LXH A;  3FP5 A;  2LI5 A;  5FI1 A;  5C79 A;  1W1D A;  2BPS A;  4HCN B;  2GBR A;  4HB0 B;  2Y7B A;  4DK5 A;  2D2Q A;  5KHQ A;  5J3Y A;  3ZUN A;  3EFU A;  1WH3 A;  2EJ8 A;  1X1M A;  3HM3 A;  4XZ4 A;  5D3Y A;  3A1Q B;  2DYB A;  1UBI A;  3VFK A;  1NVL A;  4P7I A;  2K25 A;  2RGF A;  3RCZ A;  1ISN A;  3Q3F A;  2HRJ A;  2MBB B;  2GBN A;  4G3X B;  1XX0 A;  3ZDT A;  3W1Y A;  3MDB C;  1MK7 B;  4KIK A;  2D9X A;  1E7U A;  4HB3 B;  3M1I B;  4HAT B;  2N7D A;  4PS8 A;  5AEK B;  3MTN B;  2KDB A;  4MH0 E;  1FHO A;  4W9F A;  1NI2 A;  2RQ1 A;  4DBG A;  2JP2 A;  4IM0 A;  5DPW A;  2WX1 A;  3PZD A;  4EOY A;  5D3W A;  4BBN C;  2N1V A;  1NU2 A;  1RJ2 A;  4A3O A;  4WJ7 A;  2DX5 A;  4BOS C;  1UH6 A;  1QZE A;  2NMB A;  3R7Q A;  2BYE A;  2DKP A;  4PQ0 A;  5LXI B;  1KZG A;  3L08 A;  3FM8 C;  1V86 A;  1FHX A;  3PVU A;  1WX8 A;  2NPT A;  4EUT A;  2MCN B;  1XD3 B;  1PLS A;  1FXT B;  4K7U A;  2UWQ A;  2KC2 A;  4X57 B;  3OAN A;  2KAN A;  3ZRF A;  3KYC D;  1E8X A;  1MG8 A;  3VXW A;  2D11 A;  1UNP A;  4GDK B;  2ZZP B;  3H1U A;  5GOW B;  3EC8 A;  3PSE B;  1WXV A;  3PP2 A;  3ODO A;  3T8M A;  3VUX A;  3EPY A;  2GBJ A;  4EJN A;  3P2B A;  3CF6 E;  5DHA B;  4NNJ B;  3ZW3 A;  3TJP A;  2KX0 A;  3OJ3 A;  2KVR A;  2K8B A;  3ALB A;  2MRP A;  1WR1 A;  4MGI E;  4B95 A;  3VTV A;  2RD0 A;  4HPL B;  1RLF A;  1Q67 A;  2ADZ A;  2VRW B;  1WXM A;  3WAO A;  1ST7 A;  4HK2 A;  1BT0 A;  1WZ0 A;  3KSY A;  4GMV A;  3RCP A;  2KC1 A;  2LJ5 A;  2BKF A;  4M0W B;  4GSW A;  1I42 A;  5IAA C;  4LJP B;  1W1G A;  2D9Y A;  1N3H A;  1KI1 B;  3A1Q A;  5CX3 A;  1HB8 A;  3TFM A;  2W2W A;  1B55 A;  1WJ1 A;  3ENE A;  1XR0 B;  3KUC B;  4HAV B;  2L00 B;  3VVW B;  3UGB B;  2COP A;  1TXD A;  4ZYN A;  3HM6 X;  2OQB A;  2GBK A;  1WVH A; 
#chains in the Genus database with same CATH topology
 2R09 A;  1FAO A;  2XN9 C;  3U52 E;  4MAC A;  2LOZ A;  3HIE A;  1DYQ A;  2N9P C;  5DPR A;  2ZCC A;  3SFD B;  1Y56 A;  2G9H D;  1WX9 A;  1KZ7 A;  3I3T B;  1H8C A;  3RYT A;  3ZNI D;  5FR6 A;  2DHJ A;  2IY0 B;  3R3M A;  5TSS A;  3RUL A;  1UNQ A;  4L23 A;  2LHE A;  4KZ0 A;  4JPS A;  1NTI A;  2V3P A;  4RCO A;  3CSF A;  5IN7 A;  3CIK A;  4HLE A;  1BTN A;  5JVL A;  1EUV B;  3I9V 1;  4CO7 A;  1T6B X;  1V5U A;  2B76 B;  2KN5 A;  3AB5 A;  3X0W A;  2BBC A;  1QF6 A;  2RVB B;  3LYY A;  1D6E C;  2M56 B;  3A8Q A;  3NVY A;  1UD7 A;  4LK0 M;  1GC7 A;  3KH0 A;  1PQS A;  1WYW B;  5EE1 A;  1RFK A;  5HFY A;  4II3 B;  3C8Y A;  5D3V A;  2G1E A;  2EKI A;  3QK0 A;  1TY0 A;  3ETR A;  4DXG A;  3SUZ A;  2KWV B;  4L1R A;  3SD5 A;  2EMS A;  3NG0 A;  2LAS A;  3QCA A;  1WY8 A;  3U8Z A;  2LBB A;  2M38 A;  2KWC A;  1XLQ A;  2YSZ A;  2UYZ B;  3N3K B;  4FA6 A;  3SV1 A;  2KQ4 X;  1RFA A;  3S2A A;  4ICU A;  2L32 A;  4K2P A;  4MGY E;  1F2R I;  5LON B;  2MHJ A;  3N1Z C;  4D6W A;  1V2Y A;  2KQ7 A;  4KHB A;  1GUA B;  2V76 A;  2Q5W D;  2LKO A;  1XF5 L;  1WM3 A;  2KMC A;  2UVM A;  4TUU A;  1D5X C;  4GDK A;  2AEH A;  2BYT A;  3D8F A;  3LJU X;  4RFB A;  1FRD A;  1XQQ A;  1LM8 B;  2AWT A;  4B6W A;  2QDF A;  1DOI A;  1ZXH A;  4A9A A;  2PPH A;  2FUG 1;  1EF1 A;  1YMH E;  1V5T A;  1Y19 B;  1YIW A;  1WZ3 A;  1WGU A;  2RLO A;  4H8S A;  2MBQ A;  3PHW B;  2AQ1 B;  4IG7 B;  2MWN B;  4PNK A;  4R3D A;  2W3R A;  1FCL A;  2D3B A;  3DXE A;  1UF0 A;  3X23 A;  1P9D U;  5LNK 1;  2K0P A;  3GP7 A;  2BCJ A;  4CSQ A;  2NTS A;  3DCX A;  4J6I A;  1JDE A;  3QX1 A;  2A5U A;  4FHJ A;  4M0W A;  2M1M A;  1KFY B;  2INN E;  4TYZ A;  4JX1 C;  2VH2 A;  2V9H A;  1VR9 A;  2IO2 B;  1M94 A;  2DTC A;  2DYM A;  1IGC A;  2DBY A;  4US8 A;  2WXF A;  3UIN B;  2FCS A;  1WJU A;  2KK8 A;  3TO1 A;  4YT0 B;  3IHP C;  4A20 A;  3V61 A;  4PS3 A;  1XOD A;  2CHW A;  3H9D A;  3UQB A;  3ZO5 B;  1LW3 A;  2NBW B;  1WFY A;  3NOB A;  2C9W B;  4MT7 A;  3M62 B;  1F77 A;  5EE0 A;  2D10 A;  3DBH B;  1HA5 A;  3TVV A;  1HTQ A;  4KIK B;  2KFK A;  3VAW A;  4JWU C;  3NHE B;  3VOQ A;  2Y5C A;  2NZ8 B;  1EF5 A;  4XDD A;  5DPS A;  5J3Q A;  3BJI A;  5BMH A;  4K81 A;  4GLS C;  2N7J A;  2DA0 A;  2KTR B;  2Z0E B;  3KWL A;  1WI1 A;  2DHI A;  2I38 A;  2VRR B;  3C0R B;  2CU1 A;  1GB4 A;  1EU3 A;  4JKG A;  3HK0 A;  3MC9 A;  4MH8 A;  4GXB A;  1M4V A;  3VUW A;  2G3Q B;  1S1Q B;  5JHB A;  2QMT A;  1FFU A;  3DVG X;  1T0Y A;  1JW9 D;  4IW0 A;  2MFQ A;  1OFF A;  1UWM A;  4A5K A;  1T0Q C;  4JKD A;  5I2S A;  2W82 A;  2YS3 A;  2P0F A;  3T3N A;  4N59 A;  3ZVR A;  2DX5 B;  3ZNH B;  2M0A A;  3P63 A;  2QKM A;  2D9W A;  4AWJ A;  2JY6 A;  3PG7 A;  2B3A A;  5JZE B;  2BGF A;  2WXR A;  1E5W A;  1HE8 A;  2I5F A;  2KXJ A;  4KZC A;  2QCZ A;  1KRH A;  2E3T A;  4AP4 C;  1N63 A;  1QC6 A;  1I4R A;  5G5G A;  4MDK E;  1P6S A;  2N9E B;  3IFW B;  2WXL A;  1EWC A;  2IPK D;  4GGQ A;  3TEY A;  2LUL A;  2RRF A;  2BB6 A;  4WWP A;  3BYT B;  2KYW A;  2CKH B;  2WDV B;  3E9P A;  2RPQ A;  3JYU A;  2VSZ A;  2O2V A;  2VZK B;  3FSS A;  4XWX A;  1BUI C;  3CWI A;  3MC8 A;  4CHK A;  5H92 C;  2NPT B;  3KYD D;  1TGZ B;  3QA8 A;  3AEF B;  2LOX A;  2V1Y A;  3U12 A;  3DXC A;  4CHM A;  2KLC A;  1I35 A;  3NS1 A;  2KUQ A;  1AQC A;  2JVC A;  4M8N A;  4JK9 A;  3R8B A;  2N9X A;  1WIA A;  3A33 B;  2L2I A;  2ASQ A;  1V61 A;  2WS3 B;  1ZXI A;  4IM2 A;  1WSP A;  2LUM A;  1PFJ A;  4WAF A;  3QBV B;  4OZB A;  4ZHP A;  5HKH A;  2FCN A;  5E6P A;  2L0F A;  2Q13 A;  4RM8 A;  2QJL A;  2CAY A;  2M4N A;  2BYV E;  3KW5 B;  2KDF B;  4NAW B;  4TMA B;  4KV2 A;  4ILH A;  1YQ4 B;  5J18 A;  4OZA A;  1YQB A;  2KX3 A;  2YVC A;  2P8V A;  5HG2 A;  2WX0 A;  2WHI A;  1X05 A;  1MHH E;  2ELA A;  1NDD A;  4JWS C;  1DIK A;  4DIX A;  1PMS A;  1C77 A;  2ACZ B;  2G45 B;  3RNA C;  3KUD B;  3HW2 B;  3SU8 X;  3RZF A;  2D9Z A;  3AE3 B;  4RF0 A;  4FUL A;  2L3Z A;  2DWQ A;  4LNF A;  2WXQ A;  5TR5 A;  1L5P A;  3NRZ A;  1TYG B;  1I7H A;  4BVU C;  3KQ4 A;  3PT2 B;  5JHA A;  2RPV A;  4OVU A;  3VRA B;  1WXQ A;  1KC7 A;  3Q3J A;  1XO3 A;  1UZX B;  2DZJ A;  2YEP B;  1WGQ A;  4C7Z A;  3SYX A;  1FPY A;  3U30 A;  4FLH A;  2X8X X;  4IWQ A;  5AUK A;  5BYS A;  2QKL A;  2FCQ A;  3AUL A;  2C60 A;  1GGO A;  1H10 A;  2W2X D;  3AE6 B;  1ZKH A;  4K7W A;  3PVL A;  2XBB C;  3AMZ A;  2L7R A;  1HTO A;  2WXJ A;  1MAI A;  2JWZ A;  2JXX A;  2SEB D;  3URY A;  3A9J B;  4YON A;  1JRO A;  3E9L A;  1RRP B;  4JKF A;  4K3B A;  2Z0P A;  1L0Y B;  1KLG D;  2CS4 A;  3PTF C;  2ROV A;  2NBV B;  2AL3 A;  1MHX A;  4ANU A;  4JK7 A;  1JWU D;  4W9L A;  2R0D A;  1N62 A;  3ODX A;  4WAA A;  2LGX A;  5G5H A;  2KTR A;  1TBE A;  3VH4 B;  3WAL A;  1KF6 B;  2IY1 B;  5BMI A;  4ANX A;  1JAL A;  3EUB 2;  1BXT A;  1WJM A;  4OW0 A;  3KWV A;  2MWS B;  2YEP F;  4HEA 1;  3B9J A;  4K7S A;  3HUI A;  3QIJ A;  1KBL A;  3OJ4 B;  4F7Z A;  1UBQ A;  3E9S A;  1U4A A;  1FEH A;  1FMA D;  3BVM A;  5CHF A;  4A55 A;  1QQR A;  3KLS X;  2KFJ A;  2WXN A;  5HE3 A;  2UZS A;  3P42 A;  3W5U B;  4HJK A;  1U5G A;  4Q2J A;  2Y8F A;  4P6V F;  1IRS A;  3A98 B;  2KIE A;  1P98 A;  2EC1 A;  1FXA A;  1L4D B;  2KOX A;  3UI3 A;  1XLP A;  1V5M A;  3RN9 C;  2R2O A;  3GS2 A;  5C2T B;  2LGI A;  2K1F A;  5G55 A;  3FEH A;  3NUH B;  3ENB A;  4A6F A;  3EHV A;  1JRP A;  2KDI A;  1WGY A;  2CU3 A;  4F7H A;  3O65 B;  2HJ1 A;  2IO3 B;  1E0Z A;  2WXM A;  1NBF C;  1ZC3 B;  4EEW A;  4BBN F;  3DHI C;  3R7R A;  1RWS A;  1SE3 A;  4HDO A;  3AU5 A;  4A6K A;  5AZH A;  2KUP A;  4KHB B;  2MBH A;  2PVG C;  1WGG A;  2XQN M;  2CR5 A;  2ZNV C;  1WXS A;  5IRS A;  5GXG B;  2IFS A;  3H7P B;  3ZYY X;  4NJ6 A;  4OVV A;  1UEF A;  5BO4 B;  1MJD A;  2BKR B;  2QSD A;  2WDQ B;  2IBI B;  1J8C A;  4HKZ E;  1P3Q U;  3AV8 A;  3GOE A;  1C78 A;  3DBL B;  3LJ3 A;  3RZW C;  1V97 A;  3APF A;  4ZRK A;  2J42 A;  4NAW A;  2BT6 A;  2WYQ A;  4W9K A;  4YWG G;  4KSL C;  3OHM B;  2LG1 A;  2JYT A;  3RNF C;  2KCJ A;  3SNH A;  1UEL A;  1FXI A;  2FCM A;  2ZVN A;  1KLV A;  3R2I A;  1K51 A;  1I4H A;  3FAH A;  4L1B A;  2DN6 A;  3A4R A;  3A8P A;  4MGZ E;  3MHS D;  1GNU A;  5IKC M;  3Q3O C;  4CHJ A;  1U2B A;  2FBW B;  2H7D A;  4P16 A;  2D07 B;  2JXT A;  3RNC C;  4ZRQ A;  2WLB A;  3NVW A;  2IYD B;  1FNW A;  3QC8 B;  1ACC A;  2WH5 A;  2PE9 A;  3L13 A;  5E6O A;  2OED A;  4HAU B;  1SIF A;  2PKO A;  1PYW D;  2ZVO A;  2MH7 A;  1JCK B;  1TKY A;  1VD2 A;  5HE0 A;  2V3S A;  1E90 A;  1OGW A;  2WXP A;  3E56 A;  2GJY A;  3H6N A;  1ZYI A;  3TSS A;  2K22 A;  2W54 A;  2JYE A;  2NCN A;  4WJP A;  3TCA A;  2DHK A;  2IJ0 A;  1MK9 B;  5DI9 B;  1IGD A;  3G9W A;  4IOI E;  1QKZ A;  2HDE A;  3NS8 A;  4HRS A;  2KFK B;  2WDT B;  1TT5 B;  3A9J A;  3FKY A;  3MJW A;  4REZ A;  1TTN A;  5IOI A;  4MK0 A;  4FJY A;  4UDU C;  2GS0 A;  2KJ6 A;  3T06 A;  1N6Z A;  4RH6 A;  2NBV A;  3FC4 A;  2WGS A;  4CYE A;  4JL9 A;  4C80 A;  2WWZ A;  1KH0 A;  4M02 A;  4JKG B;  4EMO A;  1XD4 A;  4AJY B;  1C4P A;  2D3G A;  2JZZ A;  3LXF A;  3SBT A;  2KLG A;  1A5R A;  5C5B B;  5EE9 A;  5IO9 A;  3L10 B;  5DCN A;  3UIO B;  3BYY B;  3B2F A;  5JHH A;  1JML A;  2MP2 B;  3AI5 A;  4GZU A;  3NY5 A;  1EVH A;  2LGD A;  4WJO A;  1F0Z A;  3V5W A;  3W9C B;  1IPG A;  4US9 A;  3ZNZ B;  1SEB D;  2AL6 A;  2P0H A;  3R2T A;  4JQW C;  4N9F 4;  2JF5 A;  4WQO B;  2ON8 A;  3F5R A;  2X38 A;  2DLW A;  2HD5 B;  1V49 A;  1T77 A;  2REX A;  3HVZ A;  2D3C A;  3KVF B;  2IGD A;  2GUM A;  2JPH A;  3IG3 A;  3M63 B;  2PTL A;  3AN1 A;  4C0A A;  3N32 A;  4G11 A;  1CQV A;  3AED B;  1TJE A;  3PEG A;  1SF0 A;  5L81 A;  2O2V B;  3MPX A;  1FGY A;  3GZN B;  1UGM A;  2YS1 A;  1ZW7 A;  3L4P A;  1HZ5 A;  1K5G B;  2K9X A;  1F52 A;  4JGH B;  1ZSQ A;  2KQS A;  4E3C A;  1FB8 A;  1ZE3 D;  2LXC A;  3NZ3 A;  3QWM A;  2YF0 A;  5IA7 A;  4K17 A;  2C5L C;  1P1A A;  5AUI A;  1VCB A;  2CHX A;  3L17 A;  1GC6 A;  3RNG C;  2DYO A;  1L2N A;  1OY2 A;  1F1H A;  1LXD A;  2MDX A;  2ROZ B;  4IFS A;  1V8C A;  4MJS A;  2BW2 A;  4C56 C;  4KDL B;  3H7P A;  2LYD A;  1VZ6 A;  4RF1 A;  2LGY A;  2RGN B;  2MSE D;  4JKC A;  1SJH D;  5D2M B;  2KZR A;  1DRO A;  2O6V B;  5DH9 B;  2N4F A;  3Q6B A;  3QAR A;  4I6P A;  1WMH A;  3CXB B;  4LNI A;  1XLN A;  3ZTD A;  2IGG A;  1NTV A;  3BK2 A;  5C6R A;  1J0G A;  1F2R C;  4E74 A;  3RMK C;  4LDT B;  1EO6 A;  5AZG A;  2FIF A;  2FDQ A;  4WQM A;  5KHO A;  4WVF B;  2CRF A;  5JH5 C;  4RGM A;  2RSU A;  4AJW A;  2GRI A;  5G2N A;  1WX7 A;  2INC C;  3V05 A;  2COC A;  4W9E A;  5GMV A;  1L6V A;  4KGT A;  4KDI C;  2C7M B;  1TZO A;  1T3Q A;  4NY0 A;  1LB1 A;  2IND C;  4EKU A;  4B6H A;  1SGH A;  5CTR C;  3TL5 A;  3AXC A;  1M7E A;  1WGK A;  2EEL A;  3ULC A;  2YLM A;  4HJG E;  3N1Y C;  4XE0 A;  1FRR A;  1EAZ A;  3DQV A;  5I2M A;  2I1J A;  4WWN A;  4EZJ A;  2INP E;  5BYQ A;  1QQG A;  4TKN A;  4IC7 B;  4GN1 A;  1NYQ A;  1UGJ A;  3P6A A;  4HWI B;  4JK8 A;  3MJ5 A;  5J17 A;  1TS3 A;  2HJ8 A;  4HXD A;  1FCC C;  3PRE A;  1TKG A;  1YX5 B;  1SJE D;  1SBB B;  4WUR A;  2ICI A;  4DX8 A;  1V1P B;  4KHA A;  2GOW A;  2V3N A;  2PVO D;  1E7V A;  4TSS A;  4S0R A;  1R7S A;  3DBH I;  3ZXV A;  3DHH C;  1EGX A;  2KMA A;  2FJ9 A;  1M7R A;  3VHT C;  3KRW A;  4BKS D;  2KO3 A;  4TQ1 A;  1VZ7 A;  2H89 B;  4C7Y A;  2N1W A;  1P0R A;  2GBM A;  2L05 A;  2RDB C;  2G35 A;  1W1H A;  1L7Y A;  1P7F A;  1A70 A;  1QOG A;  2KWU B;  4XDC A;  3V60 A;  2MJ3 A;  4BKT A;  1TZ1 A;  1E6E B;  1XT9 B;  1C4A A;  1XCT L;  2EMT A;  1HBK A;  3BII D;  3T9L A;  5C5B A;  4RGO S;  2K00 A;  3KRX A;  4RNA A;  3GB1 A;  1C9F A;  1D3Z A;  4HAZ B;  4A6Q A;  1DDW A;  2MP2 A;  3CIR B;  2FUH B;  3IT4 B;  4DBB A;  5J3T A;  2AQ2 B;  1UPR A;  4QAY A;  2KWD A;  3Q14 C;  4ANW A;  4GOU A;  1HZ6 A;  3ZVV A;  1MPE A;  4MEM A;  3U4E G;  2QIE B;  1YD8 U;  3DXD A;  1XCG A;  2JT4 B;  5KQ4 A;  4P1C C;  1V5O A;  1YN4 A;  4OZC A;  1BTK A;  1BML C;  2RDG A;  5J2R A;  2LD9 A;  5BYR A;  3DBR B;  2L83 A;  4IM3 A;  3R66 C;  2D5G A;  2FAZ A;  3Q8C A;  3ZIM A;  4HDQ A;  4K3C A;  2H7E A;  4JKE A;  3QAQ A;  1Q1O A;  2YRY A;  1V81 A;  2J7Q B;  4W9H A;  5HE1 A;  2KR0 A;  2WQY B;  3DBS A;  2RNR B;  4HRO A;  3AEC B;  2L1A A;  3WAP A;  4A6F B;  2DZK A;  4L6E A;  4KSK C;  3AEG B;  4ZDV A;  1SE9 A;  4G50 A;  2E2X A;  1ENF A;  1F9J A;  3APC A;  4NJC A;  3AE4 B;  1GG3 A;  2K8H A;  3PRM B;  1WRD B;  1IP9 A;  2V4L A;  1U5E A;  3TUO A;  1MKE A;  3ZDM C;  3RPF C;  1CZP A;  2LRU A;  1IBX A;  4JKB A;  4L2Y A;  1S3S G;  2K39 A;  1ZC4 B;  2L8J A;  2JRH A;  1XXG A;  5EE3 A;  2KTF A;  4LLG M;  4XWT A;  4B0E A;  2ELB A;  4DXF A;  1FGZ A;  4DHJ B;  1UNR A;  2W9N A;  2DNF A;  2LWP A;  4MSM B;  2PE6 B;  4IWO A;  1KM7 A;  1ZPS A;  3CST A;  2WP9 B;  3AE8 B;  1MPH A;  4HAY B;  4K2O A;  2WXO A;  2O6V A;  2K8E A;  5D3X A;  4NZL B;  4F8C B;  3ML4 A;  3VTU A;  1FM0 D;  1L0V B;  2ZCB A;  1V89 A;  1DYN A;  2LFI A;  4GOC A;  3ONS A;  3UQA A;  1NTY A;  4ZRP A;  1MIZ B;  3WIM A;  3VQI A;  2D9V A;  3LDZ E;  2I2Y A;  2R61 A;  1WXA A;  4PT5 A;  2VZK D;  3HIZ A;  5DIF B;  3UZT A;  2H88 B;  1I2H A;  4URK A;  3EEC A;  4GMX B;  4W9D A;  1YX6 B;  1GB1 A;  4MM3 A;  1OEY A;  1N61 A;  2AYO B;  4WJN A;  4A3P A;  2DYQ A;  1V88 A;  2BWF A;  2Y5B B;  1J19 A;  4GPT B;  1ROE A;  3ZKJ C;  2KNB A;  5D3D A;  5CHW A;  1R4N B;  1E7P B;  1CK1 A;  3W1S C;  4G0N B;  4PYU A;  2J0J A;  4N6E B;  2W2X C;  3HQC A;  2CQU A;  4WSF A;  4GB9 A;  3NZS A;  2IYB A;  4USA A;  2JZP A;  3VH3 B;  4BFR A;  3ULB A;  3EA6 A;  2FNJ B;  2UZR A;  3JVZ X;  2WU5 B;  2ZPN A;  3DOW A;  2ZPY A;  4GDL B;  1NEK B;  2I5C A;  2NTT A;  3QJZ A;  1H4R A;  1V1P A;  2Z0Q A;  4CQN A;  5D7G A;  4HPM B;  3TEW A;  4KVG B;  2K2J A;  2MX2 A;  1DGJ A;  2VH1 A;  2DLB A;  2PLP A;  5C16 A;  3DVG Y;  1OMW A;  1JWA D;  3H7S A;  2YS5 A;  2DAJ A;  1WR6 E;  2JWU A;  5E6J A;  1HXY D;  3NVZ A;  2VKI A;  1XLO A;  2BTE A;  1RM6 C;  3DHG C;  4KAX B;  1KTK A;  1UPQ A;  2LRW A;  2M17 A;  3VR8 B;  1K8R B;  2CY5 A;  1NEN B;  3DCG A;  2G4D B;  2JZ3 B;  1WWT A;  4YSZ B;  3VUY A;  2L1C A;  5BMG A;  4ZRJ A;  3OG5 A;  1HEZ E;  4FHK A;  4EFO A;  2N0Y A;  2C7H A;  2XEW A;  4RM9 A;  4IWP A;  1VBH A;  1AWD A;  1WJN A;  2MA9 B;  2KGX B;  2KDE B;  4ARC A;  2BVC A;  2X0S A;  2LHD A;  3JSV B;  3EFC A;  3BWU D;  3GYO A;  1X86 A;  4OVZ A;  2JQR B;  4DHZ E;  5C1Z A;  2HE7 A;  1ZVR A;  5L95 C;  1HQR D;  1PGB A;  2NBU A;  1NI3 A;  1E9M A;  3Q8B A;  4LNO A;  1K50 A;  1YJ1 A;  3UF8 A;  2LVO A;  2OJW A;  2MW5 A;  4AUQ C;  4I6L B;  4KKJ A;  5LLI A;  2L52 A;  3Q8A A;  5D6J B;  1GPX A;  2NMQ A;  1ESF A;  3PLV A;  1MFW A;  1I4Q A;  4JIO U;  1YJI A;  1U5F A;  1J7A A;  1ZM0 A;  4HKQ A;  3RT3 B;  2HTH B;  1PDX A;  2D4Q A;  1D5M C;  3NW8 A;  3V6E B;  2ZNV B;  1ZDX A;  5DHF B;  1K53 A;  3TBL D;  4A8X C;  1CJE A;  3CMM B;  4YTP B;  1VDV A;  2CY4 A;  2J53 A;  4MJS B;  5DPT A;  1STE A;  1OQY A;  2CHZ A;  4QJ3 B;  3JW0 X;  2KJR A;  1TQZ A;  5CLL B;  3P7Z A;  3PV1 A;  1X1F A;  3DBL I;  4MEL A;  2M0X A;  1SHC A;  4B0M A;  1TS5 A;  1V9J A;  3N1X C;  1J7C A;  3VTW A;  1WMH B;  3L54 A;  1GAQ B;  3D8D A;  1LO5 D;  1C76 A;  2LZ6 A;  1QOB A;  4IKG A;  4WWO A;  2KJH B;  4ICV A;  1JWS D;  2LUE A;  5C3J B;  1Z87 A;  3NZU A;  2KKC A;  3U7Z A;  2I1K A;  1ACA A;  1JRU A;  4NPN A;  2Z0O A;  3FLV A;  2LJI A;  2IDY A;  1YNT E;  4Z2N A;  1WI0 A;  2K49 A;  4A90 A;  4ANV A;  3DVN U;  3PLU A;  1FOE A;  1X1G A;  4F7U P;  2NR2 A;  3W1S A;  3D32 A;  2Z59 B;  5FK9 C;  3O96 A;  3L0W B;  2LVQ A;  2M19 A;  2V0G A;  2RUK B;  3DVN V;  2L76 A;  4BZA A;  2KDM A;  1FNU A;  2KHW B;  1MIX A;  2GCJ A;  3AEB B;  5E6N A;  4AQ7 A;  1Y5O A;  2LGS A;  2K6D B;  4D0N B;  2QEJ C;  3TIX A;  3GYP A;  1SIJ A;  2DX1 A;  4DX9 0;  1SE4 A;  2DYN A;  1B9R A;  3KZ1 A;  3WA0 A;  2EKE C;  3WAN A;  1PGX A;  3UIP B;  2WU2 B;  3NJT A;  4ZRI A;  1OQN A;  1FHW A;  2PZ1 A;  4MT5 A;  3ZTC A;  1DDM A;  2LXA A;  1D5Z C;  1MG4 A;  3M95 A;  1MI1 A;  4GDL A;  1G6J A;  3PRZ A;  3HRD D;  3RNE C;  2BYF A;  3ZGZ A;  1GOZ A;  2JUO A;  1KOT A;  3Q2A C;  2XK5 B;  1Z5S B;  2FJL A;  2C7N B;  1L0X B;  3I5J C;  4II2 B;  1BWN A;  3PPA A;  4C00 A;  2WDR B;  2NVU I;  4NSW A;  1OEY J;  4QJ5 B;  1DBH A;  2NS5 A;  4HPP A;  4KKI A;  5JHG A;  3T3O A;  3ZNG C;  2QHO A;  1QIL A;  5FI0 A;  1IYF A;  2SAK A;  4E71 A;  2N0S B;  1RRB A;  4HB2 B;  1WM2 A;  4ITK A;  2MJE A;  1LQB A;  3WYF B;  1TKE A;  2IGH A;  2DHZ A;  1K52 A;  3Q69 A;  2GCL A;  2P0D A;  3B77 A;  3JSV A;  1DOX A;  4IAP A;  2X18 A;  3SFE B;  2MBE A;  2LMC A;  3AJ4 A;  1QLB B;  1C3T A;  1SE2 A;  2KD0 A;  3ECI A;  1RAX A;  4TQ0 A;  2OJR A;  2COA A;  3BZD B;  3L16 A;  2CB8 A;  2N9K A;  3D8E A;  1AWE A;  4HAX B;  1L4Z B;  3ZRC A;  4Z2M B;  3J9C A;  1V80 A;  3IBE A;  3BK1 A;  3GZN I;  2OTX A;  4W9G A;  2YT0 A;  2QIL A;  3OLM D;  4HHV A;  3SHQ A;  4HCP B;  2WXG A;  2G4S A;  1TJ6 A;  1Q10 A;  4HB4 B;  1C79 A;  2HTH A;  3VIA A;  3PHX B;  1TS4 A;  2M8S A;  3K9P B;  2A4Z A;  3KUZ A;  4LJO B;  1IBX B;  3V3X A;  4BKG A;  3HHM A;  3W5V B;  3C19 A;  5H8Y E;  2KT7 A;  1U5D A;  4RMA A;  1C4C A;  1P3R A;  3VDZ A;  3IXS A;  4OT1 A;  2FID A;  3FIL B;  2ZKM X;  2Y8G A;  1V5P A;  2OOB B;  5IJM A;  4H2A A;  3PRP B;  3O13 A;  1WYG A;  5D27 A;  2BS3 B;  4DDG D;  2DFK A;  3BIN A;  4I6N B;  5M4Y B;  4NQL B;  4B9K A;  1E8Y A;  2BF8 B;  3PVW A;  1YN5 A;  5AZF A;  3IAM 1;  2Z13 A;  3APD A;  3AE5 B;  1HB6 A;  3A9K B;  1C1Y B;  1U27 A;  3GE8 C;  3QQ8 B;  4LTU A;  2KMM A;  3TEX A;  3M3J A;  1JQ4 A;  1BAK A;  1FFV A;  4NQK E;  5HE2 A;  4OHJ A;  4DQO C;  3N9Y C;  3OWE B;  4FN2 A;  4MM3 B;  3U7D A;  1SXT A;  4GU2 A;  5EDS A;  2J0K A;  1EU4 A;  3NWA A;  3ZJT A;  3AE9 B;  2KIG A;  1WGH A;  1PFD A;  2Z59 A;  1QT9 A;  4K1R B;  4C4V B;  4HVB A;  1OQQ A;  4WIP A;  4JE3 B;  2DZM A;  1WJ4 A;  2L0T A;  1E8Z A;  4XGA B;  3B2G A;  5C23 A;  3RUI B;  2R2Q A;  2DKQ A;  2DAF A;  4AS1 A;  4YTM B;  2BWE S;  4A6H A;  2HTM E;  3KY9 A;  1WF9 A;  1T0R C;  2DZI A;  1VBG A;  4DWF A;  4MY6 A;  2JRI B;  3SO6 A;  3MFG A;  3TMP B;  4HAW B;  1VZ8 A;  2O6V D;  4KHO A;  4ZYS A;  3ZJV A;  1UUP A;  2OHF A;  4XC2 A;  3AU4 A;  1Q0W B;  3DWG C;  3NSU A;  1JWB D;  3ABV B;  3ZLZ A;  1Z2M A;  1AAR A;  2DEN B;  4LDT D;  4IUM B;  4W9C A;  2JX5 A;  2RR9 A;  4RGN A;  1J7B A;  5L83 A;  2XK5 A;  3B1L X;  2Z8L A;  1TIF A;  2IO1 B;  2MKR A;  1ZGU B;  3IVF A;  4QJ4 B;  3PSC A;  3V6C B;  3F0W A;  5KCV A;  1Y8R C;  3QHT A;  1VJK A;  5CHV C;  1KLU D;  1I7A A;  2WXH A;  4WJQ A;  3ODW A;  1XCQ L;  5JLJ B;  1GJZ A;  4ASW C;  2MBO A;  3N30 A;  1LGR A;  1DOY A;  1KJT A;  4BBK A;  4EZK A;  2YT1 A;  1YN3 A;  5FKA C;  3SR6 A;  4FXC A;  4NJ7 A;  1WGD A;  2GI9 A;  2M14 A;  4PS7 A;  3U2S C;  3A4S C;  3N7C A;  2UU7 A;  5LOP B;  3ZXR A;  2N23 A;  1U29 A;  5KQ1 A;  4F1S A;  3SBG A;  2R82 A;  1OTR B;  2PMV A;  2RMM A;  2W3S A;  2LEK A;  3V62 A;  4BAX A;  1IUE A;  3DBR I;  4BOZ B;  3TEZ A;  2AQ3 B;  4MGK E;  3WAM A;  1NVI D;  2V4I B;  3QWZ B;  2ABD A;  5HI1 A;  5CLQ B;  2WXK A;  1DDV A;  2YT2 A;  1QOF A;  4FJV B;  4W9J A;  1WE7 A;  4J3O D;  3OAW A;  4W9I A;  2GMI C;  2MQJ A;  2Y3A A;  5D94 A;  4DHZ B;  3VRB B;  1D4B A;  4Y94 A;  4XX5 A;  4FBJ B;  1WGR A;  2J59 M;  3AE1 B;  3ML9 A;  1MVK A;  1WG7 A;  2KN4 A;  4YSY B;  1E10 A;  4F7G A;  1CMX B;  3BVZ A;  2ZJD A;  1J0W A;  4ARI A;  1X11 A;  3K9O B;  2IZV B;  3SEB A;  2WXI A;  2J0M A;  2KAC A;  3B0A A;  4AOF A;  1WE6 A;  2RSG A;  4M8M A;  3SDL C;  4WH4 A;  5JP4 A;  3AEA B;  3RNB C;  1XKE A;  3FVC A;  1SB3 C;  1Q5W B;  3VR9 B;  3MC0 B;  4FJZ A;  4DXA B;  1K5D B;  2DIK A;  2KVZ A;  3AM9 A;  3FIL A;  3PGE A;  3Q3M C;  1FNV A;  2ZEQ A;  2LVP A;  4GIV A;  2COD A;  3ML8 A;  4JLC A;  3DDC B;  1R4M I;  1V6E A;  4TV3 A;  2K2U A;  2PEA A;  1R4M B;  2XNA C;  1T5X D;  1PGA A;  3I57 A;  1AN8 A;  2COF A;  1WJ6 A;  5EFX A;  3TW1 A;  4YTN B;  4KX6 B;  5D3I B;  1TY2 A;  2K6Q A;  2Z0D B;  2MLB A;  4RGT A;  1LFD A;  2IO0 B;  1ZOY B;  4LCD E;  3A9K A;  4YXD B;  2K5P A;  2QC8 A;  4IOY X;  1UNS A;  5IP4 D;  4YL8 A;  4FAD A;  3PS6 A;  4MSQ B;  4WWM A;  2K8C A;  5LG4 B;  4EZL A;  2PJH A;  3RD2 A;  5T8I A;  4ILG B;  2GB1 A;  3DPD A;  4DDI D;  3B08 A;  1R4N I;  4IDI A;  2N7E A;  4C4V A;  2PIA A;  1P5T A;  2N9L A;  4PYZ A;  4BKS A;  1ZDV A;  5HHD G;  4DHJ D;  3H8H A;  2E6X A;  3BY4 B;  4O1N A;  1E8W A;  5LXH A;  3FP5 A;  2JSV X;  5FI1 A;  2LI5 A;  5C79 A;  1W1D A;  1ET6 A;  2BPS A;  4HCN B;  4PK1 A;  2GBR A;  4HB0 B;  2Y7B A;  4DK5 A;  2W55 A;  2D2Q A;  5KHQ A;  5J3Y A;  3ZUN A;  3EFU A;  1EWY C;  5MPO A;  1ET9 A;  1WH3 A;  2EJ8 A;  1X1M A;  3Q8F A;  3HM3 A;  4ZOH C;  2JU6 X;  4XZ4 A;  5D3Y A;  3A1Q B;  2DYB A;  1UBI A;  4P1B C;  1N60 A;  3VFK A;  1NVL A;  4P7I A;  1YOV B;  2J52 A;  2K25 A;  3A58 A;  1MI0 A;  2RGF A;  1T0S C;  1EM7 A;  3RCZ A;  1ISN A;  3E9O A;  3DWM A;  3Q3F A;  3ZJU A;  2HRJ A;  2MBB B;  2GBN A;  4G3X B;  3PZ7 A;  1XX0 A;  3ZDT A;  3W1Y A;  3MDB C;  1MK7 B;  1QOA A;  1JWM D;  4KIK A;  3NWF A;  2D9X A;  1RYJ A;  2R2Y A;  1E7U A;  4D2K A;  4HB3 B;  3M1I B;  3W2D A;  3IT6 B;  1I4G A;  4HAT B;  1SSN A;  2N7D A;  4PS8 A;  5I4D A;  5AEK B;  3MTN B;  2KDB A;  4MH0 E;  3RFZ B;  1FHO A;  4W9F A;  1WRI A;  2BS2 B;  2FJU B;  1NI2 A;  2RQ1 A;  2ONQ A;  2RDH A;  4DBG A;  1N5W A;  2JP2 A;  4IM0 A;  3MHZ A;  5DPW A;  2WX1 A;  3PZD A;  4EOY A;  2ZW0 A;  5D3W A;  2Y5P A;  4BBN C;  2N1V A;  1NU2 A;  3AH7 A;  1RJ2 A;  4A3O A;  2FE8 A;  4WJ7 A;  2DX5 A;  4BOS C;  1UH6 A;  4M00 A;  1QZE A;  3AE2 B;  2PW9 A;  2NMB A;  4LNN A;  1L6U A;  3R7Q A;  2BYE A;  4S17 A;  2DKP A;  1VLB A;  2WNM A;  3AE7 B;  4PQ0 A;  5LXI B;  1KZG A;  3MP9 A;  1VRA B;  2J4X A;  3L08 A;  3FM8 C;  4YSX B;  2CJO A;  2CJN A;  1FD6 A;  1FIQ A;  2Z14 A;  2BQQ A;  1V86 A;  1FHX A;  4HSI A;  3E66 A;  3PVU A;  1N5X A;  1WX8 A;  2NPT A;  4EUT A;  2MCN B;  1XD3 B;  1P7E A;  1FO4 A;  1PLS A;  1FXT B;  2K3U A;  3P4Q B;  4K7U A;  2UWQ A;  2KC2 A;  3NWD A;  4X57 B;  3OAN A;  3ZQ4 A;  2KAN A;  3EGR A;  3ZRF A;  4JKA A;  3KYC D;  1E8X A;  1MG8 A;  3VXW A;  2D11 A;  1YJJ A;  3RI7 C;  2AX5 A;  5JXV A;  1UNP A;  1XEE A;  4KGR A;  1NYR A;  4GDK B;  2ZZP B;  3P4S B;  3H1U A;  5GOW B;  1I4P A;  3EC8 A;  3PSE B;  4N58 A;  2ZW1 A;  1WXV A;  4OSN A;  3PP2 A;  3ODO A;  4XWW A;  3T8M A;  3VUX A;  3I63 C;  3EPY A;  3N20 C;  2GBJ A;  4EJN A;  3P2B A;  3CF6 E;  5DHA B;  2Z4D A;  4NNJ B;  3ZW3 A;  3HSA A;  3TJP A;  2KX0 A;  3AEE B;  3PZ8 A;  3OJ3 A;  4KGS A;  3PO0 A;  2KVR A;  2K8B A;  3ALB A;  2MRP A;  1WR1 A;  2BB5 A;  1OQR A;  4MGI E;  3HVD A;  3P1M A;  4B95 A;  3VTV A;  2RD0 A;  2GLS A;  4HPL B;  1RLF A;  1Q67 A;  3LB8 C;  2ADZ A;  2VRW B;  1WXM A;  2TSS A;  3WAO A;  1ST7 A;  4HK2 A;  1BT0 A;  1V1O A;  1WZ0 A;  1ZP0 B;  3KSY A;  4GMV A;  4ZHO A;  3RCP A;  3IAS 1;  2MEK A;  2MJD A;  1I4X A;  1B1Z A;  2KC1 A;  2LJ5 A;  2BKF A;  4M0W B;  4NAM A;  1AYF A;  4GSW A;  2BS4 B;  1I42 A;  5IAA C;  4LJP B;  1TS2 A;  4QXA B;  1W1G A;  1UWX A;  2D9Y A;  4EE2 A;  4M01 A;  1N3H A;  1KI1 B;  2KAJ A;  3A1Q A;  5CX3 A;  1PUT A;  1HB8 A;  3TFM A;  2W2W A;  3NVV A;  3Q3N C;  1B55 A;  1ZUD 2;  1WJ1 A;  1YQ3 B;  3ENE A;  1XR0 B;  3KUC B;  4HAV B;  2L00 B;  4JKH A;  3BVG A;  3VVW B;  4ACF A;  3Q8E A;  2D3A A;  3UGB B;  2COP A;  1TXD A;  5FR3 A;  4ZYN A;  3HM6 X;  4XYC A;  2OQB A;  3P4P B;  1AW7 A;  2GBK A;  3GE3 C;  4GNK B;  3P4R B;  3WCQ A;  4LNK A;  4ILJ A;  1WVH A; 
#chains in the Genus database with same CATH homology
 2R09 A;  1FAO A;  2LOZ A;  2N9P C;  5DPR A;  2ZCC A;  1WX9 A;  1KZ7 A;  3I3T B;  1H8C A;  3RYT A;  3ZNI D;  5FR6 A;  2DHJ A;  2IY0 B;  3R3M A;  3RUL A;  1UNQ A;  4KZ0 A;  1NTI A;  3CSF A;  3CIK A;  4HLE A;  1BTN A;  5JVL A;  1EUV B;  4CO7 A;  1V5U A;  2KN5 A;  3X0W A;  2RVB B;  3A8Q A;  1UD7 A;  1GC7 A;  3KH0 A;  1PQS A;  1WYW B;  4II3 B;  5D3V A;  3QK0 A;  3SUZ A;  2KWV B;  3SD5 A;  2EMS A;  2LAS A;  3QCA A;  1WY8 A;  3U8Z A;  2LBB A;  2M38 A;  2KWC A;  2YSZ A;  2UYZ B;  3N3K B;  4FA6 A;  3SV1 A;  1RFA A;  3S2A A;  4ICU A;  4K2P A;  4MGY E;  5LON B;  1V2Y A;  2KQ7 A;  1GUA B;  2V76 A;  2LKO A;  1WM3 A;  2KMC A;  2UVM A;  4TUU A;  4GDK A;  2AEH A;  3D8F A;  3LJU X;  1XQQ A;  1LM8 B;  2AWT A;  4B6W A;  2PPH A;  1EF1 A;  1V5T A;  1Y19 B;  1YIW A;  1WZ3 A;  1WGU A;  2RLO A;  4H8S A;  2MBQ A;  3PHW B;  4IG7 B;  2MWN B;  4PNK A;  3DXE A;  3X23 A;  1P9D U;  2BCJ A;  4J6I A;  1JDE A;  3QX1 A;  2A5U A;  4FHJ A;  2M1M A;  4TYZ A;  2IO2 B;  1M94 A;  2DTC A;  2DYM A;  3UIN B;  2FCS A;  1WJU A;  2KK8 A;  3TO1 A;  3IHP C;  4A20 A;  3V61 A;  4PS3 A;  1XOD A;  2CHW A;  3H9D A;  3UQB A;  3ZO5 B;  1LW3 A;  2NBW B;  1WFY A;  3NOB A;  2C9W B;  4MT7 A;  3M62 B;  2D10 A;  3TVV A;  4KIK B;  2KFK A;  3VAW A;  3NHE B;  3VOQ A;  2NZ8 B;  1EF5 A;  5DPS A;  5J3Q A;  3BJI A;  4K81 A;  2DA0 A;  2KTR B;  2Z0E B;  1WI1 A;  2DHI A;  2VRR B;  3C0R B;  2CU1 A;  4JKG A;  3HK0 A;  4GXB A;  3VUW A;  2G3Q B;  1S1Q B;  5JHB A;  3DVG X;  1T0Y A;  4IW0 A;  2MFQ A;  4A5K A;  4JKD A;  2YS3 A;  2P0F A;  3ZVR A;  2DX5 B;  3ZNH B;  2QKM A;  2D9W A;  4AWJ A;  2JY6 A;  3PG7 A;  2B3A A;  5JZE B;  2BGF A;  1E5W A;  1HE8 A;  2I5F A;  2KXJ A;  4KZC A;  4AP4 C;  1QC6 A;  4MDK E;  1P6S A;  2N9E B;  3IFW B;  4GGQ A;  2LUL A;  4WWP A;  2CKH B;  3E9P A;  2RPQ A;  3JYU A;  2VSZ A;  2O2V A;  3FSS A;  4XWX A;  4CHK A;  2NPT B;  3KYD D;  1TGZ B;  3QA8 A;  2LOX A;  2V1Y A;  3DXC A;  4CHM A;  2KLC A;  1I35 A;  1AQC A;  4M8N A;  2JVC A;  4JK9 A;  2N9X A;  1WIA A;  3A33 B;  2L2I A;  2ASQ A;  1V61 A;  4IM2 A;  1PFJ A;  3QBV B;  5HKH A;  2FCN A;  5E6P A;  2L0F A;  2Q13 A;  4RM8 A;  2CAY A;  2M4N A;  2BYV E;  3KW5 B;  2KDF B;  4NAW B;  4KV2 A;  4ILH A;  5J18 A;  1YQB A;  2KX3 A;  2YVC A;  2P8V A;  2WX0 A;  1X05 A;  2ELA A;  1NDD A;  1DIK A;  1PMS A;  2G45 B;  3KUD B;  3HW2 B;  3SU8 X;  3RZF A;  2D9Z A;  4FUL A;  2L3Z A;  5TR5 A;  4BVU C;  3PT2 B;  5JHA A;  4OVU A;  1KC7 A;  3Q3J A;  1UZX B;  2DZJ A;  1WGQ A;  3SYX A;  3U30 A;  4FLH A;  4IWQ A;  2QKL A;  2FCQ A;  3AUL A;  2C60 A;  1GGO A;  1H10 A;  2W2X D;  1ZKH A;  4K7W A;  3PVL A;  2XBB C;  2L7R A;  1MAI A;  2JWZ A;  2JXX A;  3A9J B;  4YON A;  3E9L A;  1RRP B;  4JKF A;  2Z0P A;  2CS4 A;  3PTF C;  2ROV A;  2NBV B;  2AL3 A;  4ANU A;  4JK7 A;  4W9L A;  2R0D A;  3ODX A;  4WAA A;  2LGX A;  2KTR A;  1TBE A;  3VH4 B;  3WAL A;  2IY1 B;  4ANX A;  1WJM A;  2MWS B;  4K7S A;  3QIJ A;  1KBL A;  3OJ4 B;  4F7Z A;  1UBQ A;  1U4A A;  5CHF A;  2KFJ A;  5HE3 A;  2UZS A;  4HJK A;  1U5G A;  2Y8F A;  1IRS A;  3A98 B;  1P98 A;  2EC1 A;  2KOX A;  1V5M A;  2R2O A;  2K1F A;  5G55 A;  3FEH A;  3ENB A;  4A6F A;  3EHV A;  2KDI A;  1WGY A;  4F7H A;  3O65 B;  2IO3 B;  1NBF C;  1ZC3 B;  4EEW A;  4BBN F;  3R7R A;  4HDO A;  3AU5 A;  4A6K A;  5AZH A;  2KUP A;  4KHB B;  2MBH A;  1WGG A;  2XQN M;  2CR5 A;  2ZNV C;  1WXS A;  2IFS A;  3H7P B;  4NJ6 A;  4OVV A;  1UEF A;  5BO4 B;  2BKR B;  2IBI B;  1J8C A;  1P3Q U;  3GOE A;  3LJ3 A;  3RZW C;  3APF A;  4ZRK A;  4NAW A;  2WYQ A;  4W9K A;  4KSL C;  2LG1 A;  2KCJ A;  3SNH A;  1UEL A;  2FCM A;  2ZVN A;  1KLV A;  2DN6 A;  3A4R A;  3A8P A;  4MGZ E;  3MHS D;  1GNU A;  4CHJ A;  1U2B A;  2H7D A;  2D07 B;  2IYD B;  3QC8 B;  2WH5 A;  2PE9 A;  3L13 A;  5E6O A;  4HAU B;  1SIF A;  2ZVO A;  1VD2 A;  5HE0 A;  2V3S A;  1E90 A;  1OGW A;  2GJY A;  3H6N A;  2NCN A;  4WJP A;  3TCA A;  2DHK A;  1MK9 B;  5DI9 B;  3G9W A;  3NS8 A;  2KFK B;  2WDT B;  3A9J A;  3MJW A;  1TTN A;  4MK0 A;  4FJY A;  2GS0 A;  2KJ6 A;  3T06 A;  4CYE A;  4JL9 A;  2WWZ A;  4JKG B;  4EMO A;  1XD4 A;  4AJY B;  2D3G A;  2JZZ A;  3SBT A;  2KLG A;  1A5R A;  5C5B B;  3L10 B;  5DCN A;  3UIO B;  5JHH A;  2MP2 B;  3AI5 A;  4GZU A;  3NY5 A;  1EVH A;  2LGD A;  4WJO A;  3V5W A;  1IPG A;  3ZNZ B;  2AL6 A;  2P0H A;  4JQW C;  4N9F 4;  2JF5 A;  4WQO B;  3F5R A;  2DLW A;  2HD5 B;  1V49 A;  2REX A;  3KVF B;  2JPH A;  3IG3 A;  3M63 B;  4C0A A;  3N32 A;  4G11 A;  3PEG A;  5L81 A;  2O2V B;  3MPX A;  1FGY A;  1UGM A;  2YS1 A;  1ZW7 A;  1K5G B;  4JGH B;  1ZSQ A;  2KQS A;  4E3C A;  1FB8 A;  2LXC A;  3QWM A;  2YF0 A;  5IA7 A;  4K17 A;  2C5L C;  1P1A A;  1VCB A;  2CHX A;  3L17 A;  1GC6 A;  1L2N A;  2DYO A;  1OY2 A;  1LXD A;  2MDX A;  2ROZ B;  4IFS A;  4MJS A;  4KDL B;  3H7P A;  2LYD A;  2LGY A;  2RGN B;  2MSE D;  4JKC A;  5D2M B;  2KZR A;  1DRO A;  2O6V B;  5DH9 B;  2N4F A;  3QAR A;  4I6P A;  1WMH A;  3CXB B;  3ZTD A;  1NTV A;  5C6R A;  1J0G A;  4E74 A;  4LDT B;  1EO6 A;  5AZG A;  2FIF A;  2FDQ A;  5KHO A;  5JH5 C;  4WVF B;  2CRF A;  2RSU A;  4AJW A;  5G2N A;  1WX7 A;  2COC A;  4W9E A;  5GMV A;  4KDI C;  2C7M B;  4NY0 A;  1LB1 A;  4EKU A;  4B6H A;  1SGH A;  5CTR C;  3TL5 A;  3AXC A;  1M7E A;  3ULC A;  2YLM A;  1EAZ A;  3DQV A;  2I1J A;  4WWN A;  4EZJ A;  1QQG A;  4TKN A;  4IC7 B;  4GN1 A;  3P6A A;  4HWI B;  4JK8 A;  5J17 A;  2HJ8 A;  4HXD A;  3PRE A;  1YX5 B;  4DX8 A;  2GOW A;  4KHA A;  1E7V A;  3DBH I;  1EGX A;  2KMA A;  2FJ9 A;  1M7R A;  3VHT C;  3KRW A;  4BKS D;  2KO3 A;  4TQ1 A;  2N1W A;  1P0R A;  2GBM A;  2L05 A;  2G35 A;  1W1H A;  1L7Y A;  2KWU B;  3V60 A;  4BKT A;  1TZ1 A;  1XT9 B;  2EMT A;  1HBK A;  3T9L A;  5C5B A;  2K00 A;  3KRX A;  1D3Z A;  4HAZ B;  1DDW A;  2MP2 A;  2FUH B;  4DBB A;  5J3T A;  1UPR A;  4ANW A;  3ZVV A;  4MEM A;  1YD8 U;  3DXD A;  1XCG A;  2JT4 B;  5KQ4 A;  1V5O A;  1BTK A;  5J2R A;  2LD9 A;  4IM3 A;  3R66 C;  2FAZ A;  3ZIM A;  4HDQ A;  2H7E A;  4JKE A;  3QAQ A;  1Q1O A;  2YRY A;  1V81 A;  2J7Q B;  4W9H A;  5HE1 A;  3DBS A;  2RNR B;  3WAP A;  4A6F B;  2DZK A;  4L6E A;  4KSK C;  4ZDV A;  1SE9 A;  4G50 A;  2E2X A;  1F9J A;  3APC A;  1GG3 A;  2K8H A;  3PRM B;  1WRD B;  1IP9 A;  2V4L A;  1U5E A;  1MKE A;  3ZDM C;  2LRU A;  4JKB A;  1S3S G;  2K39 A;  1ZC4 B;  2L8J A;  2JRH A;  2KTF A;  2ELB A;  1FGZ A;  4DHJ B;  1UNR A;  2W9N A;  2LWP A;  4MSM B;  2PE6 B;  4IWO A;  1KM7 A;  3CST A;  1MPH A;  4HAY B;  4K2O A;  2O6V A;  5D3X A;  4F8C B;  3ML4 A;  3VTU A;  2ZCB A;  1V89 A;  1DYN A;  4GOC A;  3ONS A;  3UQA A;  1NTY A;  1MIZ B;  3WIM A;  3VQI A;  2D9V A;  3LDZ E;  1WXA A;  3HIZ A;  5DIF B;  3UZT A;  1I2H A;  4URK A;  3EEC A;  4GMX B;  4W9D A;  1YX6 B;  4MM3 A;  1OEY A;  2AYO B;  4WJN A;  4A3P A;  2DYQ A;  1V88 A;  2BWF A;  2Y5B B;  1J19 A;  4GPT B;  3ZKJ C;  2KNB A;  5CHW A;  3W1S C;  4G0N B;  4PYU A;  2J0J A;  2W2X C;  3HQC A;  2CQU A;  4WSF A;  4GB9 A;  3NZS A;  2IYB A;  3VH3 B;  4BFR A;  3ULB A;  2FNJ B;  2UZR A;  3JVZ X;  2ZPN A;  3DOW A;  2ZPY A;  4GDL B;  2I5C A;  3QJZ A;  1H4R A;  2Z0Q A;  5D7G A;  4HPM B;  4KVG B;  2K2J A;  2MX2 A;  5C16 A;  3DVG Y;  1OMW A;  3H7S A;  2YS5 A;  2DAJ A;  1WR6 E;  2VKI A;  4KAX B;  1UPQ A;  2LRW A;  2M17 A;  1K8R B;  2CY5 A;  3DCG A;  2G4D B;  2JZ3 B;  3VUY A;  2L1C A;  4ZRJ A;  4FHK A;  4EFO A;  2N0Y A;  2C7H A;  2XEW A;  4RM9 A;  4IWP A;  1VBH A;  1WJN A;  2MA9 B;  2KGX B;  2KDE B;  2X0S A;  3JSV B;  3GYO A;  1X86 A;  4DHZ E;  5C1Z A;  2HE7 A;  1ZVR A;  5L95 C;  2NBU A;  1YJ1 A;  3UF8 A;  2LVO A;  2MW5 A;  4AUQ C;  4I6L B;  5LLI A;  5D6J B;  3PLV A;  4JIO U;  1U5F A;  1ZM0 A;  3RT3 B;  2HTH B;  2D4Q A;  3V6E B;  2ZNV B;  5DHF B;  3TBL D;  3CMM B;  2CY4 A;  4MJS B;  5DPT A;  1OQY A;  2CHZ A;  3JW0 X;  2KJR A;  1TQZ A;  5CLL B;  3P7Z A;  3PV1 A;  1X1F A;  3DBL I;  4MEL A;  2M0X A;  1SHC A;  1V9J A;  3VTW A;  1WMH B;  3L54 A;  3D8D A;  2LZ6 A;  4WWO A;  2KJH B;  4ICV A;  2LUE A;  1Z87 A;  3NZU A;  2KKC A;  2I1K A;  1ACA A;  1JRU A;  4NPN A;  2Z0O A;  3FLV A;  4Z2N A;  1WI0 A;  4ANV A;  3DVN U;  3PLU A;  1FOE A;  1X1G A;  4F7U P;  2NR2 A;  3W1S A;  3D32 A;  2Z59 B;  3O96 A;  3L0W B;  2LVQ A;  2RUK B;  3DVN V;  2L76 A;  2KHW B;  1MIX A;  2GCJ A;  5E6N A;  1Y5O A;  2K6D B;  4D0N B;  3TIX A;  3GYP A;  2DX1 A;  4DX9 0;  2DYN A;  3KZ1 A;  3WA0 A;  2EKE C;  3WAN A;  3UIP B;  4ZRI A;  1OQN A;  1FHW A;  2PZ1 A;  3ZTC A;  1DDM A;  2LXA A;  3M95 A;  4GDL A;  1G6J A;  3PRZ A;  2BYF A;  2JUO A;  1KOT A;  2XK5 B;  1Z5S B;  2FJL A;  2C7N B;  4II2 B;  1BWN A;  3PPA A;  2NVU I;  4NSW A;  1OEY J;  1DBH A;  2NS5 A;  5JHG A;  3ZNG C;  2QHO A;  5FI0 A;  1IYF A;  4E71 A;  1RRB A;  4HB2 B;  1WM2 A;  1LQB A;  3WYF B;  2DHZ A;  2GCL A;  2P0D A;  3JSV A;  4IAP A;  2X18 A;  2MBE A;  3AJ4 A;  1C3T A;  2KD0 A;  3ECI A;  1RAX A;  4TQ0 A;  2OJR A;  2COA A;  3L16 A;  2CB8 A;  3D8E A;  1AWE A;  4HAX B;  3ZRC A;  4Z2M B;  1V80 A;  3IBE A;  3GZN I;  2OTX A;  4W9G A;  2YT0 A;  3OLM D;  4HHV A;  3SHQ A;  4HCP B;  2G4S A;  1TJ6 A;  4HB4 B;  2HTH A;  3PHX B;  3VIA A;  2M8S A;  3K9P B;  2A4Z A;  3KUZ A;  4LJO B;  4BKG A;  3HHM A;  1U5D A;  4RMA A;  1P3R A;  3VDZ A;  2FID A;  2Y8G A;  1V5P A;  2OOB B;  5IJM A;  3PRP B;  5D27 A;  4DDG D;  2DFK A;  3BIN A;  4I6N B;  4NQL B;  4B9K A;  1E8Y A;  2BF8 B;  3PVW A;  5AZF A;  3APD A;  1HB6 A;  3A9K B;  1C1Y B;  1U27 A;  3QQ8 B;  3M3J A;  1BAK A;  4NQK E;  5HE2 A;  4FN2 A;  5EDS A;  3U7D A;  4GU2 A;  2J0K A;  1WGH A;  4HVB A;  4K1R B;  2DZM A;  1WJ4 A;  2L0T A;  1E8Z A;  5C23 A;  3RUI B;  2R2Q A;  2DKQ A;  2DAF A;  2BWE S;  4A6H A;  3KY9 A;  1WF9 A;  2DZI A;  1VBG A;  4DWF A;  4MY6 A;  2JRI B;  3SO6 A;  3TMP B;  4HAW B;  2O6V D;  4KHO A;  4XC2 A;  3AU4 A;  1Q0W B;  3NSU A;  3ZLZ A;  1Z2M A;  1AAR A;  2DEN B;  4LDT D;  4IUM B;  4W9C A;  2RR9 A;  5L83 A;  2XK5 A;  3B1L X;  2IO1 B;  2MKR A;  1ZGU B;  3IVF A;  3PSC A;  3V6C B;  3F0W A;  5KCV A;  1Y8R C;  3QHT A;  5CHV C;  1I7A A;  4WJQ A;  3ODW A;  5JLJ B;  1GJZ A;  4ASW C;  2MBO A;  3N30 A;  1KJT A;  4BBK A;  4EZK A;  2YT1 A;  4NJ7 A;  1WGD A;  2M14 A;  4PS7 A;  3A4S C;  3N7C A;  5LOP B;  2N23 A;  1U29 A;  5KQ1 A;  4F1S A;  3SBG A;  2R82 A;  1OTR B;  3V62 A;  3DBR I;  4BOZ B;  4MGK E;  3WAM A;  3QWZ B;  2ABD A;  5CLQ B;  4FJV B;  1DDV A;  4W9J A;  1WE7 A;  3OAW A;  4W9I A;  2GMI C;  2MQJ A;  5D94 A;  4DHZ B;  4Y94 A;  4XX5 A;  4FBJ B;  1WGR A;  2J59 M;  3ML9 A;  1WG7 A;  4F7G A;  1CMX B;  2ZJD A;  1J0W A;  1X11 A;  3K9O B;  2IZV B;  2J0M A;  3B0A A;  4AOF A;  1WE6 A;  2RSG A;  4M8M A;  3SDL C;  5JP4 A;  1XKE A;  1Q5W B;  4FJZ A;  4DXA B;  1K5D B;  2DIK A;  3PGE A;  2ZEQ A;  2LVP A;  4GIV A;  2COD A;  3ML8 A;  4JLC A;  3DDC B;  1R4M I;  1V6E A;  4TV3 A;  2K2U A;  2PEA A;  2COF A;  1WJ6 A;  5EFX A;  3TW1 A;  2K6Q A;  2Z0D B;  2MLB A;  1LFD A;  2IO0 B;  4LCD E;  3A9K A;  4IOY X;  4YL8 A;  4FAD A;  3PS6 A;  4MSQ B;  2K8C A;  4EZL A;  2PJH A;  3RD2 A;  4ILG B;  3DPD A;  4DDI D;  3B08 A;  1R4N I;  2N7E A;  1P5T A;  4PYZ A;  4BKS A;  4DHJ D;  3BY4 B;  1E8W A;  5LXH A;  3FP5 A;  2LI5 A;  5FI1 A;  5C79 A;  1W1D A;  2BPS A;  4HCN B;  2GBR A;  4HB0 B;  2Y7B A;  4DK5 A;  2D2Q A;  5KHQ A;  5J3Y A;  3ZUN A;  3EFU A;  1WH3 A;  2EJ8 A;  1X1M A;  3HM3 A;  4XZ4 A;  5D3Y A;  3A1Q B;  2DYB A;  1UBI A;  3VFK A;  1NVL A;  4P7I A;  2K25 A;  2RGF A;  3RCZ A;  1ISN A;  3E9O A;  3Q3F A;  2HRJ A;  2MBB B;  2GBN A;  4G3X B;  1XX0 A;  3ZDT A;  3W1Y A;  3MDB C;  1MK7 B;  4KIK A;  2D9X A;  1E7U A;  4HB3 B;  3M1I B;  4HAT B;  2N7D A;  4PS8 A;  5AEK B;  3MTN B;  2KDB A;  4MH0 E;  1FHO A;  4W9F A;  1NI2 A;  2RQ1 A;  4DBG A;  2JP2 A;  4IM0 A;  5DPW A;  2WX1 A;  3PZD A;  4EOY A;  5D3W A;  4BBN C;  2N1V A;  1NU2 A;  1RJ2 A;  4A3O A;  4WJ7 A;  2DX5 A;  4BOS C;  1UH6 A;  1QZE A;  2NMB A;  3R7Q A;  2BYE A;  2DKP A;  4PQ0 A;  5LXI B;  1KZG A;  3L08 A;  3FM8 C;  1V86 A;  1FHX A;  3E66 A;  3PVU A;  1WX8 A;  2NPT A;  4EUT A;  2MCN B;  1XD3 B;  1PLS A;  1FXT B;  4K7U A;  2UWQ A;  2KC2 A;  4X57 B;  3OAN A;  2KAN A;  3ZRF A;  4JKA A;  3KYC D;  1E8X A;  1MG8 A;  3VXW A;  2D11 A;  1UNP A;  4GDK B;  2ZZP B;  3H1U A;  5GOW B;  3EC8 A;  3PSE B;  1WXV A;  3PP2 A;  3ODO A;  3T8M A;  3VUX A;  3EPY A;  2GBJ A;  4EJN A;  3P2B A;  3CF6 E;  5DHA B;  4NNJ B;  3ZW3 A;  3TJP A;  2KX0 A;  3OJ3 A;  2KVR A;  2K8B A;  3ALB A;  2MRP A;  1WR1 A;  4MGI E;  4B95 A;  3VTV A;  2RD0 A;  4HPL B;  1RLF A;  1Q67 A;  2ADZ A;  2VRW B;  1WXM A;  3WAO A;  1ST7 A;  4HK2 A;  1BT0 A;  1WZ0 A;  3KSY A;  4GMV A;  3RCP A;  2KC1 A;  2LJ5 A;  2BKF A;  4M0W B;  4GSW A;  1I42 A;  5IAA C;  4LJP B;  1W1G A;  2D9Y A;  1N3H A;  1KI1 B;  3A1Q A;  5CX3 A;  1HB8 A;  3TFM A;  2W2W A;  1B55 A;  1WJ1 A;  3ENE A;  1XR0 B;  3KUC B;  4HAV B;  2L00 B;  4JKH A;  3VVW B;  3UGB B;  2COP A;  1TXD A;  4ZYN A;  3HM6 X;  2OQB A;  2GBK A;  4ILJ A;  1WVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...