2ZPYA

Crystal structure of the mouse radxin ferm domain complexed with the mouse cd44 cytoplasmic peptide
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis for CD44 recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 87
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2zpyA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2zpyA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zpyA01
3QX1A 4IM0A 3RD2A 1WJUA 5GMVA 4KDIC 2ABDA 3X0WA 3WANA 5KHOA 1Q0WB 1W1HA 2Y8GA 3HW2B 4WAAA 2ZEQA 1D3ZA 1YX6B 3H9DA 4A5KA 2JWZA 4BOZB 2N9XA 2VRWB 4IW0A 1WE7A 3WYFB 2LXAA 3PRPB 1PLSA 4GN1A 4KHAA 3DBRI 3ZKJC 5C23A 1XKEA 2W2XC 3C0RB 1NTIA 3L13A 3NHEB 2DX5B 2DYBA 4WWNA 1Z87A 1WX7A 1WXVA 5LLIA 2EKEC 2NR2A 2NBUA 1KZ7A 2ZJDA 3V5WA 3N3KB 4JLCA 3L10B 3ML8A 2ASQA 2FIFA 1NI2A 2KN5A 2GOWA 2KDEB 2L00B 1RFAA 3QC8B 2C7NB 1U27A 5TR5A 3PV1A 3HHMA 4RMAA 2UWQA 2UYZB 3QQ8B 4IWOA 4GOCA 2J0MA 4MGYE 2FDQA 1OMWA 4K81A 2D9YA 1J0GA 5KQ4A 3UZTA 1V6EA 1EF1A 2K1FA 4W9LA 1P5TA 1P98A 4G0NB 4NQLB 4PS3A 2LOXA 4DBGA 2PJHA 3U7DA 4AP4C 3DVNU 5D3YA 3ULBA 2JP2A 2Z0EB 4MJSA 2KFKB 5CTRC 3VVWB 3ZW3A 1P9DU 4B9KA 2O2VB 3AJ4A 3A1QA 1FHWA 5J18A 1BTKA 3PREA 2NS5A 2N0YA 3KRXA 4G3XB 3VH4B 2KVRA 4NJ7A 1ZC4B 2WDTB 1UEFA 2IO3B 1YIWA 1S1QB 2MP2A 2L05A 4LCDE 2DX1A 1R4MI 3PT2B 4F8CB 3FP5A 4FULA 1BTNA 1U5FA 1K8RB 1WH3A 2KUPA 1UELA 1TGZB 3Q3JA 1TJ6A 1PMSA 4HHVA 3ZDTA 5JHGA 2WX0A 3KZ1A 2P0FA 2R2OA 4HCPB 1OQNA 3RT3B 2J0JA 4HB3B 3L16A 1UNQA 3KYDD 5HKHA 1RLFA 3KY9A 2YRYA 2DA0A 4GDKA 2G4DB 4DX90 4MM3A 2DZKA 2Y8FA 4HVBA 2KDIA 4HB2B 3KUZA 4KDLB 3QBVB 1E8YA 1P1AA 4HPLB 2OOBB 2MCNB 2LRWA 4NY0A 4GSWA 3PHWB 3TJPA 5C5BA 1X11A 2IO2B 1E8ZA 2JZZA 3LJUX 3DVNV 1U5EA 4PS8A 2YSZA 4XWXA 3FLVA 2DAFA 2KWUB 2XK5B 4CYEA 2PPHA 4G50A 4GMVA 1EAZA 1XT9B 3M1IB 1SE9A 3AULA 1WJNA 1FHOA 5LOPB 5CHFA 3ZDMC 1ZSQA 2DKPA 3PRMB 3DBSA 4GU2A 4W9DA 2LULA 2QKLA 2J7QB 5J3TA 2P0DA 4W9FA 1J19A 2ADZA 3ZVRA 3DBHI 3K9PB 4BKTA 4ZDVA 2ELBA 2L76A 3ODWA 3OANA 1NDDA 2XEWA 1DROA 2CU1A 3SHQA 4KSLC 3SV1A 5LXIB 3ZTCA 2C7HA 4DDGD 1MAIA 2EMTA 2DLWA 2R2QA 3JSVB 2W2XD 1WX9A 2K00A 4BKGA 1BAKA 4W9GA 2BPSA 4PYUA 3QJZA 4EOYA 2A4ZA 4MEMA 1WXMA 2L8JA 2DYNA 4W9JA 4F7HA 3VIAA 2KMCA 1OY2A 5KQ1A 5D94A 1W1GA 2OQBA 3VXWA 4K17A 5LONB 3HM6X 1WZ0A 3GYOA 5C6RA 3HM3A 1M94A 4A6KA 5DHFB 1AWEA 2DZJA 1V49A 2UZSA 2YS1A 1XCGA 2MLBA 4XC2A 1WJ1A 1V5OA 1V81A 3KW5B 1V5UA 3AXCA 2L1CA 2KKCA 4YL8A 3TFMA 3VUYA 2RGNB 2K8HA 1X1GA 3PPAA 4B6WA 2RSUA 3PLVA 2FCQA 3PVUA 4RM9A 3TMPB 4DHZB 3UIOB 1P6SA 3NS8A 3DDCB 3A9KA 2GS0A 3EFUA 1NVLA 1DYNA 4Z2NA 2KTRB 4EJNA 2COPA 2ZCBA 2KJRA 1EVHA 3ODOA 3VDZA 4ICUA 2H7DA 2YS5A 2B3AA 4XZ4A 2GBRA 3QARA 2G4SA 1WMHB 3DVGY 1LXDA 3QIJA 1E8XA 3RCPA 4NAWB 2YF0A 3ML9A 4FHJA 1GJZA 3PG7A 2DZIA 3ML4A 5EFXA 3KUCB 4NPNA 1V89A 1E90A 1UBIA 4OVUA 3NSUA 3PVLA 2LZ6A 4X57B 4WQOB 1E7UA 5J17A 3ODXA 1UGMA 3L0WB 2K2UA 1EF5A 3OLMD 4GDLB 4II2B 2V4LA 2KWCA 3KH0A 1WZ3A 2IZVB 4HJKA 1OTRB 1I42A 1TXDA 2EMSA 4HATB 3O65B 3ZNID 5HE3A 2PE9A 3R7RA 2GBJA 1U29A 2D9ZA 1I2HA 3JVZX 2YVCA 4LJPB 2K8CA 1ST7A 4WVFB 4NNJB 5E6NA 4DBBA 3V60A 3V61A 4ZRJA 1UPQA 2H7EA 3L08A 2RGFA 3PRZA 2AL6A 4HAYB 3PLUA 2G35A 1NBFC 4AJYB 4ZRKA 2KGXB 2JVCA 4K1RB 3NY5A 4K7WA 2LG1A 4KVGB 2CQUA 1A5RA 4KZCA 3OJ3A 2MDXA 3WAOA 4EZJA 2KCJA 3N30A 4MELA 1OEYJ 4I6LB 2DX5A 3PZDA 4Z2MB 1XQQA 4FJZA 3KYCD 1MG8A 1V86A 3SDLC 3BY4B 2DFKA 3BJIA 1PFJA 4GPTB 3IFWB 4BVUC 5D7GA 2MSED 3KRWA 2L0FA 2KFJA 3TL5A 2N4FA 2CRFA 5DH9B 3IG3A 5CLQB 1XD4A 4DHZE 1MK7B 3ENEA 3UIPB 4B95A 2LVOA 2N1WA 1U5GA 4YONA 1ZKHA 1ISNA 1MPHA 2M1MA 4HCNB 2P8VA 2CY5A 4I6NB 2GCJA 2KC2A 1ZC3B 4PS7A 2IY0B 1WGDA 4BBNF 3WA0A 4HAVB 1ZGUB 2JRIB 1ZVRA 3H1UA 4GZUA 1XODA 2KNBA 2FAZA 2KFKA 2BWES 1KJTA 4HWIB 1V5MA 3P7ZA 5HE2A 2KZRA 3A8QA 4CHJA 2O2VA 3PP2A 1WM2A 5LXHA 2Y7BA 3DQVA 4JIOU 4F7UP 2D11A 1X05A 1QC6A 4ZRIA 3VQIA 2LWPA 1PQSA 4IUMB 4E3CA 3GYPA 2DHKA 2COFA 3NOBA 1MKEA 2GBNA 1HB6A 2CODA 4MSQB 2EC1A 2BGFA 1UNPA 2XQNM 4HDOA 3ZNZB 5DPRA 5JLJB 5JHBA 2NMBA 2UVMA 2FJLA 4K2PA 3TVVA 2RUKB 3ZUNA 3ZVVA 5D2MB 4KHOA 2CS4A 2CHWA 2M0XA 3V6EB 4IOYX 3A9JB 2GMIC 2AYOB 2YLMA 4W9EA 2KLGA 1BWNA 4KV2A 3I3TB 2DTCA 2DHZA 2CHZA 2C5LC 2DHIA 4W9CA 1LQBA 5DCNA 2Z59B 1Y8RC 1E7VA 4EZLA 5CX3A 2RLOA 1Q67A 5KCVA 2YT0A 4WSFA 3ONSA 1WI1A 3W1SA 2N7EA 5CHWA 3DBLI 2KHWB 2I1JA 2DYMA 1H10A 2XK5A 3FM8C 3A1QB 5JP4A 3D8EA 4FADA 2IYBA 2K2JA 1UBQA 2D3GA 2FCMA 3L17A 2KX3A 1WGHA 3FSSA 3H7PB 1YX5B 4II3B 2KTFA 5D3WA 1DDMA 4EEWA 1QQGA 3V6CB 4A3PA 2D9XA 4E71A 4EFOA 1OGWA 3VTVA 2WYQA 1WGRA 2OJRA 2K39A 2ZCCA 1KZGA 3QAQA 1J0WA 3JSVA 1U2BA 2V76A 1ZW7A 3PVWA 1WX8A 4HDQA 3FEHA 5BO4B 4WJQA 5E6OA 1DDVA 3L54A 4NSWA 3RUIB 1WFYA 2BYEA 4KZ0A 3QWMA 4BBNC 2NPTA 2CB8A 2A5UA 4FJYA 1HB8A 1FGYA 1C1YB 2GCLA 1MIZB 2J0KA 2LVPA 2V3SA 3KUDB 3QCAA 4W9IA 1MIXA 2UZRA 2BYVE 4N9F4 4WJOA 1JRUA 3SYXA 3WALA 3WAPA 2LVQA 2BYFA 4IM3A 1WR6E 3ALBA 3RYTA 1FXTB 2HTHB 3QWZB 2D9VA 2MBOA 1WIAA 5GOWB 1Z2MA 2IO0B 2FCSA 3EPYA 2LOZA 4L6EA 3R66C 3DOWA 2L2IA 2LGDA 4CO7A 1FAOA 4DXAB 5L95C 2KDFB 3AU4A 3CMMB 2NCNA 2KC1A 3JYUA 1Z5SB 3CXBB 2Z0PA 3CSTA 2COAA 1ACAA 4H8SA 1WJ4A 2LI5A 4HK2A 2MKRA 4C0AA 2M38A 4WJNA 4EMOA 1K5DB 1WMHA 2GJYA 2K6QA 2JXXA 5J3QA 3LDZE 4ANWA 2JPHA 4GIVA 2NBVB 1FB8A 1E5WA 4HB4B 2IFSA 4PNKA 1WG7A 4NAWA 1UD7A 1RAXA 3UGBB 2HD5B 3TBLD 2QHOA 1KM7A 2J59M 2QKMA 2REXA 4MGZE 4GB9A 2K8BA 3SD5A 2ROVA 5D3VA 1DDWA 4KSKC 2Z0OA 2RD0A 3RCZA 1WGUA 1GUAB 2MBEA 3MJWA 4GDLA 2IYDB 3CF6E 3EECA 2MWNB 1WRDB 1WGYA 2AL3A 1M7RA 2KWVB 4IM2A 5J3YA 2C60A 4ANXA 4TYZA 2WH5A 2ZPYA 5C1ZA 4TQ1A 3VFKA 2KJ6A 4A3OA 5EDSA 3DVGX 4IWPA 1RRBA 4MY6A 2DN6A 3R3MA 3PHXB 2K25A 4NQKE 4CHMA 4BKSD 4EKUA 3DPDA 1RRPB 5FR6A 2LGXA 3DXCA 1KOTA 2EJ8A 3RZFA 4FHKA 1V5PA 4A6FB 4W9HA 1UPRA 3HIZA 4GMXB 2BCJA 4HAWB 1V61A 3D8DA 4BBKA 2M8SA 4P7IA 2CAYA 4JGHB 1X1MA 1OQYA 2LYDA 2ZZPB 5CLLB 1UZXB 5JH5C 1QZEA 1T0YA 4WJPA 1XX0A 1L2NA 1GC6A 2ZPNA 3TO1A 4KIKB 3B1LX 2ROZB 2FJ9A 4XX5A 3CIKA 2YS3A 2KANA 2BWFA 2RR9A 2VRRB 2RNRB 4HAZB 3EC8A 2KQ7A 4MGIE 4KHBB 2G3QB 2JZ3B 2Z0DB 2PZ1A 1AARA 2KMAA 3APCA 1EGXA 1WJMA 4HB0B 2HJ8A 4PYZA 2D2QA 5KHQA 1HE8A 2K6DB 3QA8A 4EUTA 3NZUA 2RSGA 2O6VB 3ZIMA 2C7MB 3MTNB 2MFQA 4JL9A 3K9OB 2MRPA 3B0AA 4ICVA 5DIFB 4M0WB 3ULCA 3VTUA 1KI1B 2D9WA 2P0HA 1Q1OA 3SUZA 4RM8A 4IAPA 3U8ZA 1K5GB 2R09A 4ASWC 2COCA 5HE0A 3RZWC 2ELAA 4NJ6A 1WXAA 1S3SG 1EUVB 4CHKA 2KLCA 2FUHB 3V62A 3T8MA 2LJ5A 4AOFA 2LXCA 4D0NB 3CSFA 3N32A 4HXDA 1WI0A 2VKIA 2KDBA 3M3JA 3VUWA 3A9JA 3F0WA 2BKFA 4AWJA 4WWPA 4TQ0A 3ZLZA 5IA7A 1XD3B 1WGQA 1WY8A 4TV3A 3DXDA 3PEGA 3PGEA 1V5TA 4W9KA 5D3XA 4LJOB 3SU8X 3W1SC 1Q5WB 1F9JA 1WXSA 3Q3FA 3B08A 1YQBA 3AI5A 2OTXA 4MDKE 1IYFA 3UQBA 2PEAA 5D27A 2KK8A 5JHAA 3SO6A 3PS6A 2DAJA 5D6JB 1WE6A 2KX0A 3A8PA 1Y19B 1YJ1A 1SGHA 5AZGA 5CHVC 1WR1A 2MWSB 1RJ2A 4ZYNA 4K2OA 3H7PA 5G55A 1WF9A 4OVVA 3VTWA 4TKNA 2Y5BB 2LKOA 3W1YA 3MHSD 2LRUA 4MJSB 3A98B 4AUQC 2Q13A 3P2BA 2BKRB 3AU5A 1GC7A 3ZO5B 2O6VD 2I5FA 4MT7A 3PSEB 5IJMA 4IG7B 1IP9A 2FNJB 2KQSA 3ZTDA 2KOXA 2DENB 2CR5A 4IFSA 4HPMB 2LASA 2MBQA 2E2XA 2KO3A 2MP2B 2D10A 2MW5A 3LJ3A 3OAWA 4FN2A 3VHTC 3APFA 1N3HA 3APDA 3OJ4B 4GXBA 2XBBC 4DDID 1V88A 3TCAA 5L83A 4PQ0A 1TTNA 3ZNHB 3QHTA 3TIXA 5AZFA 1WYWB 1VCBA 2RPQA 2DHJA 2GBKA 3P6AA 2LBBA 3HK0A 3U30A 2W9NA 2LGYA 3GOEA 4GGQA 4URKA 3UQAA 5AZHA 4AJWA 2MQJA 1U5DA 2YT1A 5DPTA 4G11A 3ZRCA 1I35A 2C9WB 4GDKB 1X1FA 2R0DA 3PSCA 3MPXA 4BFRA 3PTFC 4FLHA 4DK5A 1TZ1A 4JQWC 1X86A 3BINA 2HE7A 2JY6A 3T06A 2ZVOA 1J8CA 5C5BB 5L81A 1CMXB 4BKSA 1XR0B 4A20A 3D8FA 2HTHA 3QK0A 1SHCA 3X23A 1IRSA 1TBEA 4HLEA 2DKQA 1C3TA 2DZMA 2VSZA 2HRJA 2MBBB 4F7ZA 2I5CA 5G2NA 2BF8B 3DXEA 1R4NI 2IY1B 3MDBC 3DCGA 2X18A 1YD8U 2MX2A 4MH0E 1H4RA 2N1VA 5C79A 2L0TA 5DPWA 4MK0A 2JUOA 3JW0X 2NPTB 3RULA 1GG3A 2M14A 1G6JA 1FGZA 4MSMB 2N9PC 2FIDA 4M8NA 1M7EA 4ANUA 2KTRA 5HE1A 2IBIB 2L3ZA 4LDTB 4HAUB 3VH3B 3TW1A 4DHJB 3M62B 2KJHB 4B6HA 1V80A 3KSYA 1L7YA 2ZVNA 2Z0QA 5C16A 2WX1A 1WVHA 4KAXB 4F7GA 4DX8A 2LD9A 3VUXA 1SIFA 5DPSA 1WGGA 4FBJB 1GNUA 4A6HA 5E6PA 1B55A 2D07B 3EHVA 2NVUI 4FA6A 4TUUA 3A4SC 3ECIA 3IHPC 1WJ6A 2N9EB 5JHHA 5DI9B 2JRHA 1OEYA 4M8MA 1UNRA 2L7RA 1AQCA 1UH6A 5JZEB 4FJVB 2N7DA 1Y5OA 2V1YA 1P0RA 3ZNGC 2AEHA 3R7QA 2IO1B 4F1SA 3GZNI 4I6PA 2ZNVC 1LB1A 4EZKA 4K7SA 1U4AA 1LFDA 2RVBB 2JF5A 2NBWB 3NZSA 2LUEA 1FOEA 1LM8B 2NZ8B 1V9JA 1P3QU 1HBKA 1WM3A 4HAXB 2RQ1A 3A9KB 4MGKE 4A6FA 2AWTA 5DHAB 2DYOA 3VOQA 2N23A 1NTVA 3G9WA 1LW3A 1H8CA 4J6IA 5FI1A 4WWOA 3UF8A 2KXJA 1ZM0A 2M17A 4Y94A 2MBHA 3O96A 1IPGA 3IVFA 2KD0A 1VD2A 2PE6B 3WAMA 3H7SA 5J2RA 4DWFA 1E8WA 3N7CA 4KIKA 4LDTD 1W1DA 2CKHB 5FI0A 4DHJD 1NU2A 1I7AA 4WJ7A 1FHXA 4K7UA 1BT0A 2FCNA 2JT4B 5IAAC 4IWQA 3S2AA 3F5RA 3A4RA 3IBEA 1P3RA 3WIMA 2W2WA 4E74A 1V2YA 2WWZA 2CHXA 2ZNVB 1TQZA 3M63B 2I1KA 1MK9B 2G45B 3H6NA 3T9LA 2DYQA 2M4NA 3UINB 4IC7B 3SNHA 1EO6A 3A33B 4ANVA 3D32A 2CY4A 1KLVA 4BOSC 3HQCA 2O6VA 3VAWA 1DBHA 2D4QA 1NTYA 2MA9B 3KVFB 3M95A 5AEKB 3ZRFA 2GBMA
chains in the Genus database with same CATH superfamily
3QX1A 4IM0A 3RD2A 2OHFA 1WJUA 2INDC 4M0WA 4ARCA 5GMVA 2FE8A 4KDIC 4XYCA 2Z13A 2ABDA 3FVCA 3X0WA 4IOIE 3WANA 5KHOA 1Q0WB 1W1HA 2Y8GA 3HW2B 1D5XC 4WAAA 3W5VB 4LTUA 2ZEQA 1D3ZA 1YX6B 3H9DA 1SE4A 4A5KA 2JWZA 4BOZB 3I5JC 1KBLA 5IKCM 3SFEB 2N9XA 3NRZA 1TS4A 2VRWB 4IW0A 2ZW0A 2BS2B 1ROEA 1N63A 2KUQA 1WE7A 3WYFB 2LXAA 2BB6A 2LFIA 3U2SC 3PRPB 1PLSA 4GN1A 4KHAA 3DBRI 4HEA1 4Q2JA 2YT2A 1V8CA 3ZKJC 5C23A 1XKEA 3PO0A 2W2XC 3C0RB 1NTIA 3L13A 3NHEB 2DX5B 2DYBA 4WWNA 4DIXA 1Z87A 1CQVA 1WX7A 1WXVA 5LLIA 1T5XD 3MJ5A 2EKEC 2NR2A 2NBUA 1KZ7A 2ZJDA 4ZHOA 3GS2A 1FRDA 1E9MA 5HFYA 2MJDA 3V5WA 3N3KB 2TSSA 4JLCA 3L10B 3NWAA 3ML8A 2ASQA 2FIFA 4GOUA 1NI2A 2KN5A 5BMGA 1PGBA 2GOWA 2KDEB 2L00B 1RFAA 3QC8B 2C7NB 1U27A 3HVDA 5TR5A 2M0AA 2JX5A 3PV1A 3U52E 3HHMA 4RMAA 2UWQA 4XWWA 2M19A 2UYZB 3QQ8B 2XN9C 4IWOA 4GOCA 2JU6X 2J0MA 4MGYE 1XO3A 2FDQA 1OMWA 4K81A 2D9YA 1J0GA 5KQ4A 3SFDB 3UZTA 4JKEA 1V6EA 2PW9A 1EF1A 1J7CA 2K1FA 4W9LA 1P5TA 1P98A 4G0NB 3EGRA 4M01A 4NQLB 4PS3A 1FRRA 2LOXA 2JQRB 3AE9B 4DBGA 2PJHA 4JWSC 2NTSA 1VZ7A 3U7DA 4AP4C 2KDMA 3DVNU 1YMHE 5D3YA 3ULBA 2JP2A 3FAHA 2Z0EB 1PUTA 1YQ4B 2WDVB 2WDRB 4MJSA 5G5HA 2KFKB 5CTRC 4LNNA 4HKQA 2WXQA 1FMAD 3VVWB 3ZW3A 3HVZA 2QIEB 1P9DU 5H92C 1ZE3D 4B9KA 5I2MA 2O2VB 3AJ4A 2KACA 5T8IA 3A1QA 1FHWA 3C19A 5J18A 1BTKA 3PREA 2NS5A 5D3DA 2N0YA 4YTMB 3KRXA 3P4QB 4G3XB 3VH4B 2KVRA 4NJ7A 1ZC4B 1I4QA 2WDTB 1UEFA 2IO3B 1YIWA 3DHIC 1S1QB 3RNEC 2MP2A 2L05A 4LCDE 4ZOHC 2DX1A 1R4MI 3PT2B 4F8CB 3FP5A 4FULA 1BTNA 1U5FA 1K8RB 1WH3A 2KUPA 4LNFA 1UELA 2IPKD 1TGZB 3Q3JA 3ZYYX 1TJ6A 1PMSA 1L6UA 4RF1A 4HHVA 3ZDTA 1C79A 1HTOA 5JHGA 2WX0A 3KZ1A 2P0FA 4A8XC 1TJEA 1QQRA 2WXIA 2R2OA 2ONQA 3NVWA 4HCPB 1OQNA 3RT3B 2J0JA 3N9YC 3B9JA 4L1RA 4HB3B 3BZDB 3P4RB 2BYTA 3L16A 1UNQA 3KYDD 3Q8AA 5HKHA 1RLFA 3KY9A 2SEBD 4HPPA 2IGDA 2YRYA 2DA0A 4GDKA 2G4DB 4DX90 1KFYB 4MM3A 1T0RC 2DZKA 2Y8FA 4HVBA 2KDIA 4HB2B 3KUZA 4KDLB 4S0RA 3QBVB 1E8YA 1AN8A 1P1AA 4HPLB 1UGJA 1ZDXA 1BMLC 2OOBB 1WGKA 2MCNB 2LRWA 4NY0A 4GSWA 3PHWB 2QDFA 3T3NA 3TJPA 5C5BA 1X11A 1JQ4A 2IO2B 2WXKA 1E8ZA 2JZZA 3LJUX 3E9SA 3DVNV 1XXGA 2WS3B 4OT1A 2PMVA 1U5EA 4PS8A 2YSZA 4XWXA 3FLVA 2DAFA 2KWUB 1DGJA 2XK5B 4CYEA 2PPHA 3TSSA 4G50A 4GMVA 2QCZA 2IJ0A 1FM0D 1EAZA 1XT9B 3M1IB 3RNCC 1SE9A 1TIFA 3AV8A 3AULA 1WJNA 3IT6B 1FHOA 5LOPB 3AECB 5CHFA 3ZDMC 1ZSQA 1SE3A 2DKPA 3PRMB 4JK9A 3HRDD 3DBSA 4GU2A 4W9DA 2LULA 1C78A 3J9CA 2QKLA 2J7QB 5J3TA 2P0DA 5E6JA 4W9FA 1J19A 2ADZA 3ZVRA 3DBHI 3K9PB 4BKTA 1FXIA 2Y5PA 4HJGE 4ZDVA 2KVZA 2ELBA 2L76A 1SJHD 3ODWA 3OANA 1GB1A 1NDDA 1KC7A 2XEWA 4QJ5B 1DROA 2CU1A 2W3SA 4WH4A 4QJ3B 3SHQA 4KSLC 3SV1A 3TUOA 5LXIB 3ZTCA 2C7HA 4DDGD 1MAIA 2EMTA 2DLWA 2R2QA 1QOBA 3JSVB 1QOFA 4ZRQA 2W2XD 3MFGA 1WX9A 1J7AA 2K00A 4BKGA 1BAKA 4W9GA 1BXTA 4JWUC 2RMMA 1KLUD 2BPSA 2GB1A 4PYUA 3QJZA 4EOYA 2A4ZA 4MEMA 1WXMA 2L8JA 2DYNA 4ACFA 4W9JA 3ZJVA 4F7HA 3VIAA 1JRPA 2KMCA 4JK7A 1OY2A 1MHHE 5KQ1A 5D94A 1SBBB 2R61A 3KWVA 4XE0A 1W1GA 2OQBA 3VXWA 4K17A 5LONB 3HM6X 1WZ0A 3GYOA 5C6RA 3GZNB 3HM3A 1M94A 2QILA 3CWIA 4ILHA 4A6KA 4CQNA 3VRAB 5DHFB 1ESFA 1FIQA 1AWEA 1DOXA 4P6VF 1ACCA 2DZJA 1V49A 2UZSA 3RFZB 4JKBA 2M56B 3N1XC 2YS1A 1XCGA 2MLBA 4XC2A 1WJ1A 1JWMD 1V5OA 1V81A 2LGSA 3KW5B 3V05A 3BVMA 1V5UA 3AXCA 1TS5A 2L1CA 2KKCA 3H8HA 3OG5A 4YL8A 3TFMA 3VUYA 2RGNB 2K8HA 1X1GA 3PPAA 5AUKA 4B6WA 4WAFA 2RSUA 3PLVA 1QOGA 2FCQA 3PVUA 2Q5WD 4RM9A 3TMPB 4DHZB 3UIOB 1P6SA 1ET6A 1QKZA 1N5XA 2Y5CA 3NS8A 3DDCB 3A9KA 2GS0A 3EFUA 1NVLA 1DYNA 1ET9A 4BZAA 4Z2NA 3RNAC 2KTRB 4EJNA 2COPA 1MJDA 2ZCBA 2KJRA 1EVHA 3ODOA 4LLGM 3VDZA 4ICUA 2H7DA 2YS5A 2B3AA 4XZ4A 2GBRA 3QARA 4B0EA 2G4SA 1T0QC 1WMHB 3LYYA 1Y56A 3NJTA 3DVGY 3VRBB 1LXDA 3UI3A 3ZJTA 3QIJA 1E8XA 3RCPA 4NAWB 2YF0A 3ML9A 4FHJA 1GJZA 1YNTE 3W9CB 1FPYA 4L1BA 3PG7A 2DZIA 3ML4A 5EFXA 3B2FA 5C2TB 3KUCB 1FNWA 1XCTL 2JZPA 4NPNA 2K0PA 4WIPA 2RRFA 2K3UA 1V89A 1E90A 1UBIA 2WXLA 1SSNA 4OVUA 3NSUA 3PVLA 2WNMA 2LZ6A 1D5MC 4X57B 1V1PA 1EU4A 2PVGC 4WQOB 1E7UA 5J17A 3ODXA 1UGMA 2G1EA 2BBCA 3L0WB 2K2UA 2K49A 1EF5A 5I2SA 3OLMD 4GDLB 1N5WA 2R2YA 4RGOS 4II2B 1UWMA 1N60A 2V4LA 2KWCA 3KH0A 1SEBD 1L4ZB 1WZ3A 2IZVB 1ZP0B 4HJKA 1YN4A 4S17A 4US8A 1OTRB 2YEPB 2XNAC 1I42A 1TXDA 3N1ZC 4C7YA 2EMSA 4HATB 3O65B 4OW0A 3ZNID 4JPSA 5HE3A 2PE9A 2DBYA 3R7RA 2GBJA 1U29A 2D9ZA 1I2HA 3JVZX 2N7JA 4C80A 2YVCA 4LJPB 3RPFC 1M4VA 2K8CA 1RM6C 3DBRB 1ST7A 4WVFB 4NNJB 5E6NA 4DBBA 3V60A 3Q8FA 3V61A 1MHXA 4ZRJA 1XLQA 3NWDA 1UPQA 2W3RA 2H7EA 5M4YB 2SAKA 2MHJA 5EE9A 3L08A 2RGFA 3PRZA 2AL6A 3BIID 4YT0B 4HAYB 1R7SA 3PLUA 2G35A 1IUEA 1NBFC 2J52A 2WXMA 4AJYB 4ZRKA 2KGXB 1F1HA 2H89B 2K8EA 2JVCA 4K1RB 3NY5A 4K7WA 2LG1A 1AWDA 4KVGB 2GUMA 3DHHC 2CQUA 2JYTA 1A5RA 1MPEA 5IP4D 4KZCA 1E7PB 1L5PA 3OJ3A 2MDXA 3WAOA 4EZJA 1BUIC 2KCJA 3N30A 4MELA 1OEYJ 4I6LB 4YXDB 2DX5A 3PZDA 1B1ZA 2RDGA 1T3QA 5FK9C 4Z2MB 1JMLA 2WDQB 5FR3A 2FUG1 1XQQA 5LNK1 4FJZA 3KYCD 4USAA 1MG8A 1V86A 3SDLC 4MACA 3BY4B 2DFKA 1N61A 3Q3NC 3BJIA 1PFJA 4GPTB 3IFWB 4BVUC 1ZOYB 1GOZA 3C8YA 5D7GA 2MSED 3KRWA 4KGSA 2L0FA 2KFJA 1I4PA 3TL5A 3P1MA 1D5ZC 2J42A 2N4FA 3URYA 2CRFA 5DH9B 2BS3B 3IG3A 5CLQB 1XD4A 3AE8B 4DHZE 1MK7B 1RYJA 3ENEA 2QC8A 3UIPB 4B95A 2LVOA 2N1WA 1U5GA 4YONA 5EE0A 1ZKHA 2D3CA 1ISNA 2BTEA 3W5UB 1PYWD 1MPHA 2M1MA 4HCNB 2P8VA 2CY5A 1D6EC 4HRSA 4I6NB 2GCJA 2UU7A 2KC2A 1ZC3B 4PS7A 2IY0B 1WGDA 2J4XA 4BBNF 4WURA 3WA0A 1KF6B 4HAVB 2L32A 1SJED 1ZGUB 3MC0B 4WWMA 2JRIB 1ZVRA 1P7FA 1SE2A 3H1UA 4GZUA 1XODA 3Q2AC 2INPE 2KNBA 2FAZA 2KFKA 1FNVA 2BWES 1KJTA 1R4MB 3HUIA 4HWIB 1V5MA 3P7ZA 2K9XA 5HE2A 2KZRA 2BT6A 3A8QA 4CHJA 2O2VA 3GB1A 3PP2A 4C7ZA 1WM2A 5LXHA 2Y7BA 1AW7A 3DQVA 1QT9A 3AM9A 4JIOU 4F7UP 2D11A 1X05A 1QC6A 4JKFA 4ZRIA 3VQIA 2LWPA 1PQSA 4IUMB 4TMAB 4E3CA 2LHEA 3GYPA 5IN7A 2DHKA 2COFA 1C4CA 3NOBA 2MEKA 1MKEA 2GBNA 1HB6A 1HZ6A 2CODA 2QEJC 3SR6A 1UWXA 4MSQB 2EC1A 2BGFA 3DWGC 1UNPA 2XQNM 4HDOA 4KKIA 3ZNZB 1VBGA 3P42A 5DPRA 4LK0M 4RF0A 4JKGA 5JLJB 3AEEB 5JHBA 2NMBA 2UVMA 2FJLA 2OEDA 4K2PA 1JDEA 3TVVA 2RUKB 3ZUNA 1TYGB 2INNE 2WXFA 2LJIA 3ZVVA 3NG0A 5D2MB 4KHOA 2CS4A 4M02A 2CHWA 5IOIA 2M0XA 3EA6A 3V6EB 4IOYX 3A9JB 2GMIC 1QF6A 2AYOB 1UF0A 3PZ8A 2X38A 2YLMA 3E66A 4W9EA 2KLGA 1BWNA 1HZ5A 3RNFC 4KV2A 3I3TB 2N9KA 2HTME 2DTCA 1RWSA 2DHZA 2CHZA 4D2KA 2C5LC 2DHIA 4W9CA 1LQBA 5DCNA 2Z59B 1Y8RC 1E7VA 4EZLA 2DNFA 5CX3A 1Q67A 2RLOA 5KCVA 2YT0A 4WSFA 3I63C 3ONSA 1WI1A 3W1SA 2N7EA 2KIEA 1XEEA 5CHWA 3DBLI 3HSAA 2KN4A 1TZOA 3DBHB 2KHWB 1TKYA 2I1JA 2DYMA 4RGTA 1H10A 1I4GA 2XK5A 2CJNA 3FM8C 2YEPF 3A1QB 5JP4A 3D8EA 1VDVA 4FADA 2IYBA 4GNKB 2K2JA 3AMZA 4HROA 4L2YA 4B0MA 1UBQA 2D3GA 3RN9C 4JKDA 2FCMA 3L17A 2KX3A 4N58A 1EU3A 1WGHA 3FSSA 3GP7A 1YX5B 3H7PB 4II3B 2KTFA 3GE3C 2LEKA 5D3WA 1DDMA 4M00A 2PIAA 4EEWA 3BK2A 1QQGA 3ZGZA 2DLBA 3V6CB 4K3CA 4PT5A 4WQMA 2WXPA 4A3PA 4JKCA 2BB5A 2D9XA 1NYQA 1GPXA 4E71A 4EFOA 4REZA 1OGWA 1ZXHA 3U7ZA 3VTVA 2WYQA 1WGRA 2OJRA 2K39A 2ZCCA 2NMQA 1KZGA 3I9V1 1PGXA 3TEYA 1FD6A 3QAQA 1J0WA 4OZAA 4YTNB 5JVLA 1TKEA 3JSVA 1U2BA 2V76A 1ZW7A 4NJCA 3PVWA 1WX8A 3P4SB 4HDQA 3BWUD 4LNIA 3FEHA 4YSZB 5BO4B 4WJQA 5E6OA 2HDEA 1L0VB 1DDVA 3L54A 4XWTA 4NSWA 1HXYD 2KAJA 3RUIB 1WFYA 3AEAB 2V3PA 3LB8C 2W54A 2BYEA 4YTPB 4KZ0A 3VR9B 3HIEA 1ZYIA 3QWMA 4BBNC 3NWFA 2NPTA 1CJEA 2CB8A 2WXNA 2A5UA 2L83A 4FJYA 1K51A 1HB8A 1FGYA 1L6VA 2J53A 1C1YB 2GCLA 1JWBD 3NUHB 1MIZB 2J0KA 3N20C 2LVPA 2W55A 3AB5A 4ZHPA 2V3SA 2LGIA 1DIKA 3KUDB 3DHGC 3QCAA 4EE2A 3AN1A 4W9IA 5I4DA 1MIXA 2UZRA 2BYVE 4N9F4 4WJOA 1JRUA 1YJJA 3SYXA 3WALA 3LXFA 1JROA 3WAPA 2LVQA 2BYFA 2WXOA 1WR6E 4IM3A 3AE3B 3ALBA 4KKJA 1JWSD 4A9AA 3RYTA 2KT7A 1ENFA 1FXTB 1T0SC 2HTHB 2Z14A 3QWZB 2D9VA 2WXJA 2MBOA 1WIAA 5GOWB 1Z2MA 2IO0B 2FCSA 3EPYA 2LOZA 4L6EA 1EWYC 3R66C 3DOWA 3NZ3A 3MP9A 2L2IA 2LGDA 1TT5B 4CO7A 4PK1A 1FAOA 1KH0A 3DWMA 4RGNA 4A55A 4DXAB 3R8BA 5L95C 2KDFB 2V3NA 2DWQA 3IT4B 3AU4A 3CMMB 2VZKB 2NCNA 1MVKA 2KC1A 4YWGG 4P16A 3JYUA 4XGAB 3SBGA 1Z5SB 3CXBB 2LMCA 4JKAA 4QAYA 1I4RA 4KGRA 3ENBA 2WP9B 2Z0PA 3CSTA 2COAA 1ACAA 4H8SA 1FFUA 1WJ4A 1KLGD 2LI5A 4HK2A 2MKRA 3ZXVA 4C0AA 2M38A 4WJNA 4EMOA 1K5DB 1WMHA 3NS1A 2GJYA 2K6QA 2JXXA 1TKGA 3PZ7A 5J3QA 3LDZE 4ANWA 2JPHA 3AE7B 4GIVA 2NBVB 1FB8A 1IGDA 1E5WA 5H8YE 4HB4B 2IFSA 4PNKA 1WG7A 4NAWA 1UD7A 1F2RC 1C4AA 2KWDA 1RAXA 3UGBB 2HD5B 3V3XA 3TEZA 3TBLD 2LUMA 1FEHA 2EELA 1I7HA 2QHOA 1NEKB 1FFVA 1KM7A 1C4PA 2J59M 2QKMA 2MH7A 4R3DA 2REXA 2FJUB 1VZ8A 4MGZE 4GB9A 2K8BA 3SD5A 3TEWA 2MJ3A 2NTTA 2ROVA 5D3VA 1DDWA 1VLBA 2V0GA 2CU3A 1UUPA 1VJKA 4KSKC 2Z0OA 2RD0A 3RCZA 1MI1A 1WGUA 1GUAB 3ABVB 2MBEA 3MJWA 4GDLA 2V9HA 1MI0A 1I4XA 1XLNA 2IYDB 4RCOA 3CF6E 2Z4DA 3NW8A 4N59A 3IAS1 3EECA 2MWNB 3P63A 1WRDB 1WGYA 2AL3A 1M7RA 4KGTA 2KWVB 4IM2A 5J3YA 2C60A 3NVVA 4ANXA 1UNSA 4ZYSA 4TYZA 1V1OA 2WH5A 2ZPYA 3B2GA 1PGAA 5C1ZA 4XDDA 2BW2A 1K50A 4TQ1A 2JSVX 1PFDA 1F77A 2KJ6A 3VFKA 4A3OA 5EDSA 3DVGX 4IWPA 1RRBA 1RFKA 4MY6A 5EE3A 2DN6A 2GLSA 2DIKA 3R3MA 3PHXB 2QMTA 3AEGB 2K25A 4NQKE 4CHMA 4TSSA 4BKSD 4EKUA 1NI3A 1QLBB 2QJLA 1YOVB 4RGMA 4OHJA 3DPDA 1RRPB 5FR6A 4GLSC 2LGXA 3DXCA 1VR9A 1WSPA 2WGSA 4QXAB 1EWCA 1KOTA 1F52A 2EJ8A 3RZFA 4FHKA 4KX6B 4C4VB 1ZDVA 1V5PA 2QSDA 4A6FB 2VZKD 2ACZB 4W9HA 1T6BX 1K53A 3P4PB 3RNGC 1UPRA 3HIZA 4GMXB 2BCJA 4HAWB 1V61A 3D8DA 4BBKA 1C76A 1YN3A 2M8SA 2L1AA 4P7IA 2BQQA 2CAYA 4JGHB 2D3BA 1X1MA 5LG4B 1OQYA 2JYEA 2LYDA 4AS1A 3U12A 2ZZPB 5D3IB 5CLLB 1V1PB 1UZXB 5JH5C 1QZEA 1T0YA 2WXRA 1FXAA 4WJPA 1XX0A 3U4EG 1L2NA 1GC6A 2ZPNA 4ZRPA 5TSSA 3TO1A 4KIKB 1XCQL 2V4IB 3B1LX 3I57A 5BYRA 2ROZB 2FJ9A 4D6WA 1WRIA 5HHDG 4XX5A 2X0SA 3CIKA 2YS3A 2KANA 2BWFA 2RR9A 2VRRB 3OWEB 2RNRB 3WCQA 3BYTB 4HAZB 2GRIA 3EC8A 2KQ7A 4MGIE 4KHBB 2JZ3B 1F2RI 2G3QB 1KRHA 2Z0DB 2PZ1A 1AARA 1MFWA 4LNOA 1F0ZA 2X8XX 2WHIA 2KMAA 2VH1A 2GI9A 1DYQA 3APCA 3FILB 1EGXA 3AE5B 1DOYA 1WJMA 4HB0B 1JCKB 2HJ8A 1LO5D 4PYZA 2D2QA 1E0ZA 5KHQA 4JK8A 1HE8A 5C3JB 3N1YC 5FKAC 3Q6BA 1HTQA 2K6DB 3QA8A 1OQRA 3EFCA 4EUTA 3NZUA 2RSGA 2O6VB 3ZIMA 1JWAD 3E9OA 1K52A 2C7MB 3MTNB 2MFQA 4JL9A 3BK1A 3K9OB 2MRPA 3B0AA 2JXTA 3SEBA 1IBXB 3IXSA 4ICVA 4US9A 5IO9A 5DIFB 2KYWA 3ULCA 2Z8LA 3Q8EA 4M0WB 2D3AA 2E6XA 3VTUA 1KI1B 1WYGA 4FXCA 2D9WA 2P0HA 4CSQA 1Q1OA 4MH8A 4ILJA 3SUZA 4RM8A 4IAPA 3U8ZA 1ZXIA 1K5GB 1L0YB 2R09A 4ASWC 2COCA 1TY0A 5HE0A 3RZWC 2ELAA 4NJ6A 1WXAA 2B76B 5AUIA 1S3SG 1EUVB 2WQYB 1J7BA 4CHKA 2KLCA 1IGCA 4ARIA 2FUHB 1DOIA 3V62A 3T8MA 2K22A 2LJ5A 4AOFA 2LXCA 1L0XB 2CJOA 4D0NB 3SBTA 3CSFA 3N32A 4HXDA 5BMIA 1WI0A 3AEFB 2VKIA 1AYFA 1N6ZA 1ZPSA 2KDBA 3Q8CA 3M3JA 3VUWA 3NVYA 3A9JA 3DBLB 3F0WA 2BKFA 4AWJA 2KIGA 1CZPA 1STEA 4WWPA 2RPVA 3OHMB 4TQ0A 3ZLZA 3L4PA 3MHZA 5IA7A 1XD3B 1TS2A 4DXGA 1WGQA 5BYQA 1WY8A 4P1CC 4JKHA 4TV3A 2Z59A 3DXDA 3PEGA 3PGEA 1V5TA 3GE8C 4W9KA 5D3XA 4LJOB 3SU8X 4ITKA 3W1SC 5BYSA 4A6QA 1Q5WB 4IKGA 1F9JA 1WXSA 3Q3FA 1ZUD2 2PLPA 3B08A 1YQBA 2OTXA 3AI5A 4MDKE 5JXVA 1IYFA 4JX1C 1C77A 3O13A 3UQBA 2PEAA 5D27A 2KK8A 5JHAA 3SO6A 3PS6A 2DAJA 5D6JB 2IGHA 1WE6A 2KX0A 1FO4A 2I2YA 2KR0A 3A8PA 1Y19B 1YJ1A 1SGHA 5AZGA 5CHVC 1WR1A 2MWSB 3AE2B 1RJ2A 4ZYNA 2ZW1A 4DXFA 4K2OA 3H7PA 5G55A 1WF9A 4OVVA 2MJEA 3VTWA 4TKNA 2Y5BB 3B77A 2LKOA 1Q10A 3W1YA 3MHSD 1WXQA 2LRUA 4MJSB 3A98B 4AUQC 2Q13A 2INCC 3P2BA 2BKRB 4JKGB 3E9LA 1KTKA 3AU5A 1GC7A 4A90A 3ZO5B 2O6VD 3KQ4A 2EKIA 2I5FA 2BS4B 4MT7A 2W82A 3PSEB 5IJMA 3FKYA 4IG7B 1IP9A 2FNJB 2KQSA 3ZTDA 2KOXA 1JWUD 2DENB 2CR5A 2ZKMX 4IFSA 4HPMB 2LASA 2MBQA 2E2XA 2KO3A 4J3OD 4C00A 4N6EB 2MP2B 2D10A 2MW5A 3AE4B 3LJ3A 3OAWA 1LGRA 4FN2A 3VHTC 3APFA 1N3HA 2WXGA 3APDA 3OJ4B 4GXBA 2XBBC 2RDHA 3RI7C 3Q3OC 4DDID 1V88A 3TCAA 5L83A 4PQ0A 1TTNA 2KQ4X 3BVZA 3QHTA 3ZNHB 3TIXA 5AZFA 1WYWB 1VCBA 2RPQA 2DHJA 2GBKA 4HSIA 3P6AA 2LBBA 3HK0A 2OJWA 2W9NA 3U30A 2LGYA 3GOEA 4GGQA 4URKA 1R4NB 3UQAA 5AZHA 4AJWA 2MQJA 1WWTA 2WU2B 1U5DA 2YT1A 1NENB 5DPTA 3CIRB 2LHDA 4G11A 3ZRCA 3BYYB 1I35A 2C9WB 5HI1A 4GDKB 1X1FA 4MM3B 4BAXA 1HQRD 3Q14C 2R0DA 3PSCA 3MPXA 4BFRA 3PTFC 4FLHA 4DK5A 1TZ1A 4JQWC 1X86A 3BINA 2HE7A 1I4HA 2JY6A 3T06A 2ZVOA 2IGGA 3AH7A 5GXGB 1D4BA 1HEZE 1J8CA 5C5BB 4RH6A 4XDCA 5L81A 1CMXB 4BKSA 1XR0B 2ON8A 2AQ2B 3Q3MC 4NZLB 4A20A 3D8FA 2HTHA 3ZJUA 3QK0A 1SHCA 1VZ6A 3X23A 1IRSA 1TBEA 3MC9A 4HLEA 1MG4A 2DKQA 1C3TA 2DZMA 2VSZA 2HRJA 2MBBB 4F7ZA 4YSXB 2I5CA 2VH2A 5HG2A 5G2NA 2BF8B 3DXEA 5EE1A 2FBWB 3BVGA 2G9HD 1EM7A 1R4NI 1GGOA 2IY1B 3MDBC 3FC4A 2E3TA 2ICIA 4ILGB 3DCGA 2PKOA 1FCCC 2X18A 1YD8U 2MX2A 4MH0E 1A70A 1H4RA 2N1VA 3Q69A 4JE3B 5C79A 2L0TA 4C56C 4MK0A 5DPWA 2I38A 2NBVA 2JUOA 2PVOD 3JW0X 1JALA 2NPTB 4LNKA 3RULA 1TY2A 1GB4A 1GG3A 2M14A 3A58A 1G6JA 1FGZA 3E56A 1TS3A 4MSMB 1NYRA 2N9PC 2FIDA 4M8NA 1M7EA 4ANUA 2KTRA 5HE1A 2IBIB 4K3BA 2L3ZA 4LDTB 4HAUB 3TEXA 3VH3B 3TW1A 4DHJB 3M62B 1GAQB 2KJHB 4B6HA 1V80A 1XLOA 3KSYA 1L7YA 2ZVNA 2Z0QA 5C16A 2WX1A 1WVHA 4KAXB 4F7GA 5BMHA 4DX8A 4O1NA 5MPOA 4NAMA 2LD9A 3VUXA 1SIFA 5DPSA 1WGGA 4QJ4B 4FBJB 1GNUA 3T3OA 2PTLA 4A6HA 5E6PA 3R2IA 1VRAB 1B55A 1OFFA 2D07B 2N0SB 3AEBB 3EHVA 2NVUI 4FA6A 2IDYA 4TUUA 3R2TA 2L52A 3A4SC 3ECIA 3IHPC 2AQ1B 1WJ6A 1YJIA 5JHHA 5DI9B 2N9EB 1YQ3B 1L4DB 2JRHA 1FNUA 1OEYA 4M8MA 1UNRA 2L7RA 2WLBA 1AQCA 1UH6A 5JZEB 3E9PA 4OZBA 4FJVB 3ETRA 2N7DA 1Y5OA 2V1YA 4YSYB 1P0RA 3ZNGC 2AEHA 3EUB2 1SIJA 2D5GA 3R7QA 2IO1B 2BVCA 4F1SA 3GZNI 4I6PA 4RFBA 2ZNVC 5IRSA 1LB1A 4EZKA 3AEDB 4K7SA 1U4AA 1LFDA 1T77A 2RVBB 2JF5A 2NBWB 3NZSA 2LUEA 1FOEA 1XLPA 1LM8B 1PDXA 3IAM1 2NZ8B 1V9JA 1N62A 1P3QU 3ZQ4A 1HBKA 1WM3A 1QOAA 4HAXB 4P1BC 1C9FA 4C4VA 2RQ1A 3A9KB 4MGKE 4A6FA 1NVID 2AWTA 5DHAB 2WU5B 3VR8B 2DYOA 3VOQA 2N23A 1SF0A 1CK1A 1NTVA 3G9WA 1LW3A 1YN5A 1H8CA 4J6IA 5FI1A 2Y3AA 4WWOA 2N9LA 1FCLA 1OQQA 3UF8A 3RNBC 2KXJA 4OVZA 3NVZA 1ZM0A 2M17A 4Y94A 2MBHA 2WXHA 3O96A 4H2AA 1IPGA 3IVFA 2KD0A 3ZXRA 4UDUC 1SXTA 1VD2A 2PE6B 3WAMA 3H7SA 5G5GA 5J2RA 4DWFA 1E8WA 3N7CA 3AE6B 4L23A 4KIKA 4LDTD 1W1DA 3KLSX 2CKHB 2R82A 2AX5A 5FI0A 1QILA 4DHJD 1E6EB 1NU2A 4OSNA 2JWUA 1V97A 1I7AA 4WJ7A 1FHXA 4K7UA 1VBHA 1BT0A 3RMKC 2FCNA 2JT4B 5IAAC 4DQOC 4OZCA 4IWQA 3AE1B 1XF5L 3F5RA 3S2AA 3A4RA 3IBEA 4KHBA 1P3RA 3WIMA 2W2WA 4E74A 3DCXA 1V2YA 2WWZA 2CHXA 2ZNVB 1TQZA 1JW9D 4RNAA 3M63B 3FILA 2I1KA 1MK9B 2G45B 3H6NA 1B9RA 1SB3C 2AQ3B 3T9LA 2DYQA 2M4NA 3UINB 4IDIA 4IC7B 3SNHA 2K5PA 2H88B 1EO6A 3A33B 4ANVA 4AQ7A 3D32A 2CY4A 1KLVA 3KWLA 2RDBC 4HKZE 3W2DA 1P7EA 4MT5A 2KMMA 4BOSC 1E10A 3MC8A 3HQCA 2O6VA 3VAWA 1DBHA 2D4QA 1NTYA 2MA9B 3KVFB 3M95A 3Q8BA 5AEKB 3ZRFA 2HJ1A 2GBMA 1IBXA 1HA5A
chains in the Genus database with same CATH topology
3QX1A 4IM0A 3RD2A 1WJUA 5GMVA 4KDIC 2ABDA 3X0WA 3WANA 5KHOA 1Q0WB 1W1HA 2Y8GA 3HW2B 4WAAA 2ZEQA 1D3ZA 1YX6B 3H9DA 4A5KA 2JWZA 4BOZB 1KBLA 2N9XA 2VRWB 4IW0A 1WE7A 3WYFB 2LXAA 3PRPB 1PLSA 4GN1A 4KHAA 3DBRI 3ZKJC 5C23A 1XKEA 2W2XC 3C0RB 1NTIA 3L13A 3NHEB 2DX5B 2DYBA 4WWNA 1Z87A 1WX7A 1WXVA 5LLIA 2EKEC 2NR2A 2NBUA 1KZ7A 2ZJDA 3V5WA 3N3KB 4JLCA 3L10B 3ML8A 2ASQA 2FIFA 1NI2A 2KN5A 2GOWA 2KDEB 2L00B 1RFAA 3QC8B 2C7NB 1U27A 5TR5A 3PV1A 3HHMA 4RMAA 2UWQA 2UYZB 3QQ8B 4IWOA 4GOCA 2J0MA 4MGYE 2FDQA 1OMWA 4K81A 2D9YA 1J0GA 5KQ4A 3UZTA 4JKEA 1V6EA 1EF1A 2K1FA 4W9LA 1P5TA 1P98A 4G0NB 4NQLB 4PS3A 2LOXA 4DBGA 2PJHA 3U7DA 4AP4C 3DVNU 5D3YA 3ULBA 2JP2A 2Z0EB 4MJSA 2KFKB 5CTRC 3VVWB 3ZW3A 1P9DU 4B9KA 2O2VB 3AJ4A 3A1QA 1FHWA 5J18A 1BTKA 3PREA 2NS5A 2N0YA 3KRXA 4G3XB 3VH4B 2KVRA 4NJ7A 1ZC4B 2WDTB 1UEFA 2IO3B 1YIWA 1S1QB 2MP2A 2L05A 4LCDE 2DX1A 1R4MI 3PT2B 4F8CB 3FP5A 4FULA 1BTNA 1U5FA 1K8RB 1WH3A 2KUPA 1UELA 1TGZB 3Q3JA 1TJ6A 1PMSA 4HHVA 3ZDTA 5JHGA 2WX0A 3KZ1A 2P0FA 2R2OA 4HCPB 1OQNA 3RT3B 2J0JA 4HB3B 3L16A 1UNQA 3KYDD 5HKHA 1RLFA 3KY9A 2YRYA 2DA0A 4GDKA 2G4DB 4DX90 4MM3A 2DZKA 2Y8FA 4HVBA 2KDIA 4HB2B 3KUZA 4KDLB 3QBVB 1E8YA 1P1AA 4HPLB 2OOBB 2MCNB 2LRWA 4NY0A 4GSWA 3PHWB 3TJPA 5C5BA 1X11A 2IO2B 1E8ZA 2JZZA 3LJUX 3DVNV 1U5EA 4PS8A 2YSZA 4XWXA 3FLVA 2DAFA 2KWUB 2XK5B 4CYEA 2PPHA 4G50A 4GMVA 1EAZA 1XT9B 3M1IB 1SE9A 3AULA 1WJNA 1FHOA 5LOPB 5CHFA 3ZDMC 1ZSQA 2DKPA 3PRMB 4JK9A 3DBSA 4GU2A 4W9DA 2LULA 2QKLA 2J7QB 5J3TA 2P0DA 4W9FA 1J19A 2ADZA 3ZVRA 3DBHI 3K9PB 4BKTA 4ZDVA 2ELBA 2L76A 3ODWA 3OANA 1NDDA 1KC7A 2XEWA 1DROA 2CU1A 3SHQA 4KSLC 3SV1A 5LXIB 3ZTCA 2C7HA 4DDGD 1MAIA 2EMTA 2DLWA 2R2QA 3JSVB 2W2XD 1WX9A 2K00A 4BKGA 1BAKA 4W9GA 2BPSA 4PYUA 3QJZA 4EOYA 2A4ZA 4MEMA 1WXMA 2L8JA 2DYNA 4W9JA 4F7HA 3VIAA 2KMCA 4JK7A 1OY2A 5KQ1A 5D94A 1W1GA 2OQBA 3VXWA 4K17A 5LONB 3HM6X 1WZ0A 3GYOA 5C6RA 3HM3A 1M94A 4ILHA 4A6KA 5DHFB 1AWEA 2DZJA 1V49A 2UZSA 4JKBA 2YS1A 1XCGA 2MLBA 4XC2A 1WJ1A 1V5OA 1V81A 3KW5B 1V5UA 3AXCA 2L1CA 2KKCA 4YL8A 3TFMA 3VUYA 2RGNB 2K8HA 1X1GA 3PPAA 4B6WA 2RSUA 3PLVA 2FCQA 3PVUA 4RM9A 3TMPB 4DHZB 3UIOB 1P6SA 3NS8A 3DDCB 3A9KA 2GS0A 3EFUA 1NVLA 1DYNA 4Z2NA 2KTRB 4EJNA 2COPA 2ZCBA 2KJRA 1EVHA 3ODOA 3VDZA 4ICUA 2H7DA 2YS5A 2B3AA 4XZ4A 2GBRA 3QARA 2G4SA 1WMHB 3DVGY 1LXDA 3QIJA 1E8XA 3RCPA 4NAWB 2YF0A 3ML9A 4FHJA 1GJZA 3PG7A 2DZIA 3ML4A 5EFXA 3KUCB 4NPNA 1V89A 1E90A 1UBIA 4OVUA 3NSUA 3PVLA 2LZ6A 4X57B 4WQOB 1E7UA 5J17A 3ODXA 1UGMA 3L0WB 2K2UA 1EF5A 3OLMD 4GDLB 4II2B 2V4LA 2KWCA 3KH0A 1WZ3A 2IZVB 4HJKA 1OTRB 1I42A 1TXDA 2EMSA 4HATB 3O65B 3ZNID 5HE3A 2PE9A 3R7RA 2GBJA 1U29A 2D9ZA 1I2HA 3JVZX 2YVCA 4LJPB 2K8CA 1ST7A 4WVFB 4NNJB 5E6NA 4DBBA 3V60A 3V61A 4ZRJA 1UPQA 2H7EA 3L08A 2RGFA 3PRZA 2AL6A 4HAYB 3PLUA 2G35A 1NBFC 4AJYB 4ZRKA 2KGXB 2JVCA 4K1RB 3NY5A 4K7WA 2LG1A 4KVGB 2CQUA 1A5RA 4KZCA 3OJ3A 2MDXA 3WAOA 4EZJA 2KCJA 3N30A 4MELA 1OEYJ 4I6LB 2DX5A 3PZDA 4Z2MB 1XQQA 4FJZA 3KYCD 1MG8A 1V86A 3SDLC 3BY4B 2DFKA 3BJIA 1PFJA 4GPTB 3IFWB 4BVUC 5D7GA 2MSED 3KRWA 2L0FA 2KFJA 3TL5A 2N4FA 2CRFA 5DH9B 3IG3A 5CLQB 1XD4A 4DHZE 1MK7B 3ENEA 3UIPB 4B95A 2LVOA 2N1WA 1U5GA 4YONA 1ZKHA 1ISNA 1MPHA 2M1MA 4HCNB 2P8VA 2CY5A 4I6NB 2GCJA 2KC2A 1ZC3B 4PS7A 2IY0B 1WGDA 4BBNF 3WA0A 4HAVB 1ZGUB 2JRIB 1ZVRA 3H1UA 4GZUA 1XODA 2KNBA 2FAZA 2KFKA 2BWES 1KJTA 4HWIB 1V5MA 3P7ZA 5HE2A 2KZRA 3A8QA 4CHJA 2O2VA 3PP2A 1WM2A 5LXHA 2Y7BA 3DQVA 4JIOU 4F7UP 2D11A 1X05A 1QC6A 4JKFA 4ZRIA 3VQIA 2LWPA 1PQSA 4IUMB 4E3CA 3GYPA 2DHKA 2COFA 3NOBA 1MKEA 2GBNA 1HB6A 2CODA 4MSQB 2EC1A 2BGFA 1UNPA 2XQNM 4HDOA 3ZNZB 1VBGA 5DPRA 4JKGA 5JLJB 5JHBA 2NMBA 2UVMA 2FJLA 4K2PA 1JDEA 3TVVA 2RUKB 3ZUNA 3ZVVA 5D2MB 4KHOA 2CS4A 2CHWA 2M0XA 3V6EB 4IOYX 3A9JB 2GMIC 2AYOB 2YLMA 3E66A 4W9EA 2KLGA 1BWNA 4KV2A 3I3TB 2DTCA 2DHZA 2CHZA 2C5LC 2DHIA 4W9CA 1LQBA 5DCNA 2Z59B 1Y8RC 1E7VA 4EZLA 5CX3A 2RLOA 1Q67A 5KCVA 2YT0A 4WSFA 3ONSA 1WI1A 3W1SA 2N7EA 5CHWA 3DBLI 2KHWB 2I1JA 2DYMA 1H10A 2XK5A 3FM8C 3A1QB 5JP4A 3D8EA 4FADA 2IYBA 2K2JA 1UBQA 2D3GA 4JKDA 2FCMA 3L17A 2KX3A 1WGHA 3FSSA 3H7PB 1YX5B 4II3B 2KTFA 5D3WA 1DDMA 4EEWA 1QQGA 3V6CB 4A3PA 4JKCA 2D9XA 4E71A 4EFOA 1OGWA 3VTVA 2WYQA 1WGRA 2OJRA 2K39A 2ZCCA 1KZGA 3QAQA 1J0WA 5JVLA 3JSVA 1U2BA 2V76A 1ZW7A 3PVWA 1WX8A 4HDQA 3FEHA 5BO4B 4WJQA 5E6OA 1DDVA 3L54A 4NSWA 3RUIB 1WFYA 2BYEA 4KZ0A 3QWMA 4BBNC 2NPTA 2CB8A 2A5UA 4FJYA 1HB8A 1FGYA 1C1YB 2GCLA 1MIZB 2J0KA 2LVPA 2V3SA 3KUDB 1DIKA 3QCAA 4W9IA 1MIXA 2UZRA 2BYVE 4N9F4 4WJOA 1JRUA 3SYXA 3WALA 3WAPA 2LVQA 2BYFA 4IM3A 1WR6E 3ALBA 3RYTA 1FXTB 2HTHB 3QWZB 2D9VA 2MBOA 1WIAA 5GOWB 1Z2MA 2IO0B 2FCSA 3EPYA 2LOZA 4L6EA 3R66C 3DOWA 2L2IA 2LGDA 4CO7A 1FAOA 4DXAB 5L95C 2KDFB 3AU4A 3CMMB 2NCNA 2KC1A 3JYUA 3SBGA 1Z5SB 3CXBB 4JKAA 3ENBA 2Z0PA 3CSTA 2COAA 1ACAA 4H8SA 1WJ4A 2LI5A 4HK2A 2MKRA 4C0AA 2M38A 4WJNA 4EMOA 1K5DB 1WMHA 2GJYA 2K6QA 2JXXA 5J3QA 3LDZE 4ANWA 2JPHA 4GIVA 2NBVB 1FB8A 1E5WA 4HB4B 2IFSA 4PNKA 1WG7A 4NAWA 1UD7A 1RAXA 3UGBB 2HD5B 3TBLD 2QHOA 1KM7A 2J59M 2QKMA 2REXA 4MGZE 4GB9A 2K8BA 3SD5A 2ROVA 5D3VA 1DDWA 4KSKC 2Z0OA 2RD0A 3RCZA 1WGUA 1GUAB 2MBEA 3MJWA 4GDLA 2IYDB 3CF6E 3EECA 2MWNB 1WRDB 1WGYA 2AL3A 1M7RA 2KWVB 4IM2A 5J3YA 2C60A 4ANXA 4TYZA 2WH5A 2ZPYA 5C1ZA 4TQ1A 3VFKA 2KJ6A 4A3OA 5EDSA 3DVGX 4IWPA 1RRBA 4MY6A 2DN6A 2DIKA 3R3MA 3PHXB 2K25A 4NQKE 4CHMA 4BKSD 4EKUA 3DPDA 1RRPB 5FR6A 2LGXA 3DXCA 1KOTA 2EJ8A 3RZFA 4FHKA 1V5PA 4A6FB 4W9HA 1UPRA 3HIZA 4GMXB 2BCJA 4HAWB 1V61A 3D8DA 4BBKA 2M8SA 4P7IA 2CAYA 4JGHB 1X1MA 1OQYA 2LYDA 2ZZPB 5CLLB 1UZXB 5JH5C 1QZEA 1T0YA 4WJPA 1XX0A 1L2NA 1GC6A 2ZPNA 3TO1A 4KIKB 3B1LX 2ROZB 2FJ9A 4XX5A 2X0SA 3CIKA 2YS3A 2KANA 2BWFA 2RR9A 2VRRB 2RNRB 4HAZB 3EC8A 2KQ7A 4MGIE 4KHBB 2G3QB 2JZ3B 2Z0DB 2PZ1A 1AARA 2KMAA 3APCA 1EGXA 1WJMA 4HB0B 2HJ8A 4PYZA 2D2QA 5KHQA 4JK8A 1HE8A 2K6DB 3QA8A 4EUTA 3NZUA 2RSGA 2O6VB 3ZIMA 3E9OA 2C7MB 3MTNB 2MFQA 4JL9A 3K9OB 2MRPA 3B0AA 4ICVA 5DIFB 4M0WB 3ULCA 3VTUA 1KI1B 2D9WA 2P0HA 1Q1OA 4ILJA 3SUZA 4RM8A 4IAPA 3U8ZA 1K5GB 2R09A 4ASWC 2COCA 5HE0A 3RZWC 2ELAA 4NJ6A 1WXAA 1S3SG 1EUVB 4CHKA 2KLCA 2FUHB 3V62A 3T8MA 2LJ5A 4AOFA 2LXCA 4D0NB 3SBTA 3CSFA 3N32A 4HXDA 1WI0A 2VKIA 2KDBA 3M3JA 3VUWA 3A9JA 3F0WA 2BKFA 4AWJA 4WWPA 4TQ0A 3ZLZA 5IA7A 1XD3B 1WGQA 1WY8A 4JKHA 4TV3A 3DXDA 3PEGA 3PGEA 1V5TA 4W9KA 5D3XA 4LJOB 3SU8X 3W1SC 1Q5WB 1F9JA 1WXSA 3Q3FA 3B08A 1YQBA 3AI5A 2OTXA 4MDKE 1IYFA 3UQBA 2PEAA 5D27A 2KK8A 5JHAA 3SO6A 3PS6A 2DAJA 5D6JB 1WE6A 2KX0A 3A8PA 1Y19B 1YJ1A 1SGHA 5AZGA 5CHVC 1WR1A 2MWSB 1RJ2A 4ZYNA 4K2OA 3H7PA 5G55A 1WF9A 4OVVA 3VTWA 4TKNA 2Y5BB 2LKOA 3W1YA 3MHSD 2LRUA 4MJSB 3A98B 4AUQC 2Q13A 3P2BA 2BKRB 4JKGB 3E9LA 3AU5A 1GC7A 3ZO5B 2O6VD 2I5FA 4MT7A 3PSEB 5IJMA 4IG7B 1IP9A 2FNJB 2KQSA 3ZTDA 2KOXA 2DENB 2CR5A 4IFSA 4HPMB 2LASA 2MBQA 2E2XA 2KO3A 2MP2B 2D10A 2MW5A 3LJ3A 3OAWA 4FN2A 3VHTC 3APFA 1N3HA 3APDA 3OJ4B 4GXBA 2XBBC 4DDID 1V88A 3TCAA 5L83A 4PQ0A 1TTNA 3ZNHB 3QHTA 3TIXA 5AZFA 1WYWB 1VCBA 2RPQA 2DHJA 2GBKA 3P6AA 2LBBA 3HK0A 3U30A 2W9NA 2LGYA 3GOEA 4GGQA 4URKA 3UQAA 5AZHA 4AJWA 2MQJA 1U5DA 2YT1A 5DPTA 4G11A 3ZRCA 1I35A 2C9WB 4GDKB 1X1FA 2R0DA 3PSCA 3MPXA 4BFRA 3PTFC 4FLHA 4DK5A 1TZ1A 4JQWC 1X86A 3BINA 2HE7A 2JY6A 3T06A 2ZVOA 1J8CA 5C5BB 5L81A 1CMXB 4BKSA 1XR0B 4A20A 3D8FA 2HTHA 3QK0A 1SHCA 3X23A 1IRSA 1TBEA 4HLEA 2DKQA 1C3TA 2DZMA 2VSZA 2HRJA 2MBBB 4F7ZA 2I5CA 5G2NA 2BF8B 3DXEA 1R4NI 1GGOA 2IY1B 3MDBC 4ILGB 3DCGA 2X18A 1YD8U 2MX2A 4MH0E 1H4RA 2N1VA 5C79A 2L0TA 5DPWA 4MK0A 2JUOA 3JW0X 2NPTB 3RULA 1GG3A 2M14A 1G6JA 1FGZA 4MSMB 2N9PC 2FIDA 4M8NA 1M7EA 4ANUA 2KTRA 5HE1A 2IBIB 2L3ZA 4LDTB 4HAUB 3VH3B 3TW1A 4DHJB 3M62B 2KJHB 4B6HA 1V80A 3KSYA 1L7YA 2ZVNA 2Z0QA 5C16A 2WX1A 1WVHA 4KAXB 4F7GA 4DX8A 2LD9A 3VUXA 1SIFA 5DPSA 1WGGA 4FBJB 1GNUA 4A6HA 5E6PA 1B55A 2D07B 3EHVA 2NVUI 4FA6A 4TUUA 3A4SC 3ECIA 3IHPC 1WJ6A 2N9EB 5JHHA 5DI9B 2JRHA 1OEYA 4M8MA 1UNRA 2L7RA 1AQCA 1UH6A 5JZEB 3E9PA 4FJVB 2N7DA 1Y5OA 2V1YA 1P0RA 3ZNGC 2AEHA 3R7QA 2IO1B 4F1SA 3GZNI 4I6PA 2ZNVC 1LB1A 4EZKA 4K7SA 1U4AA 1LFDA 2RVBB 2JF5A 2NBWB 3NZSA 2LUEA 1FOEA 1LM8B 2NZ8B 1V9JA 1P3QU 1HBKA 1WM3A 4HAXB 2RQ1A 3A9KB 4MGKE 4A6FA 2AWTA 5DHAB 2DYOA 3VOQA 2N23A 1NTVA 3G9WA 1LW3A 1H8CA 4J6IA 5FI1A 4WWOA 3UF8A 2KXJA 1ZM0A 2M17A 4Y94A 2MBHA 3O96A 1IPGA 3IVFA 2KD0A 1VD2A 2PE6B 3WAMA 3H7SA 5J2RA 4DWFA 1E8WA 3N7CA 4KIKA 4LDTD 1W1DA 2CKHB 2R82A 5FI0A 4DHJD 1NU2A 1I7AA 4WJ7A 1FHXA 4K7UA 1VBHA 1BT0A 2FCNA 2JT4B 5IAAC 4IWQA 3S2AA 3F5RA 3A4RA 3IBEA 1P3RA 3WIMA 2W2WA 4E74A 1V2YA 2WWZA 2CHXA 2ZNVB 1TQZA 3M63B 2I1KA 1MK9B 2G45B 3H6NA 3T9LA 2DYQA 2M4NA 3UINB 4IC7B 3SNHA 1EO6A 3A33B 4ANVA 3D32A 2CY4A 1KLVA 4BOSC 3HQCA 2O6VA 3VAWA 1DBHA 2D4QA 1NTYA 2MA9B 3KVFB 3M95A 5AEKB 3ZRFA 2GBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QX1 A;  4IM0 A;  3RD2 A;  1WJU A;  5GMV A;  4KDI C;  2ABD A;  3X0W A;  3WAN A;  5KHO A;  1Q0W B;  1W1H A;  2Y8G A;  3HW2 B;  4WAA A;  2ZEQ A;  1D3Z A;  1YX6 B;  3H9D A;  4A5K A;  2JWZ A;  4BOZ B;  2N9X A;  2VRW B;  4IW0 A;  1WE7 A;  3WYF B;  2LXA A;  3PRP B;  1PLS A;  4GN1 A;  4KHA A;  3DBR I;  3ZKJ C;  5C23 A;  1XKE A;  2W2X C;  3C0R B;  1NTI A;  3L13 A;  3NHE B;  2DX5 B;  2DYB A;  4WWN A;  1Z87 A;  1WX7 A;  1WXV A;  5LLI A;  2EKE C;  2NR2 A;  2NBU A;  1KZ7 A;  2ZJD A;  3V5W A;  3N3K B;  4JLC A;  3L10 B;  3ML8 A;  2ASQ A;  2FIF A;  1NI2 A;  2KN5 A;  2GOW A;  2KDE B;  2L00 B;  1RFA A;  3QC8 B;  2C7N B;  1U27 A;  5TR5 A;  3PV1 A;  3HHM A;  4RMA A;  2UWQ A;  2UYZ B;  3QQ8 B;  4IWO A;  4GOC A;  2J0M A;  4MGY E;  2FDQ A;  1OMW A;  4K81 A;  2D9Y A;  1J0G A;  5KQ4 A;  3UZT A;  1V6E A;  1EF1 A;  2K1F A;  4W9L A;  1P5T A;  1P98 A;  4G0N B;  4NQL B;  4PS3 A;  2LOX A;  4DBG A;  2PJH A;  3U7D A;  4AP4 C;  3DVN U;  5D3Y A;  3ULB A;  2JP2 A;  2Z0E B;  4MJS A;  2KFK B;  5CTR C;  3VVW B;  3ZW3 A;  1P9D U;  4B9K A;  2O2V B;  3AJ4 A;  3A1Q A;  1FHW A;  5J18 A;  1BTK A;  3PRE A;  2NS5 A;  2N0Y A;  3KRX A;  4G3X B;  3VH4 B;  2KVR A;  4NJ7 A;  1ZC4 B;  2WDT B;  1UEF A;  2IO3 B;  1YIW A;  1S1Q B;  2MP2 A;  2L05 A;  4LCD E;  2DX1 A;  1R4M I;  3PT2 B;  4F8C B;  3FP5 A;  4FUL A;  1BTN A;  1U5F A;  1K8R B;  1WH3 A;  2KUP A;  1UEL A;  1TGZ B;  3Q3J A;  1TJ6 A;  1PMS A;  4HHV A;  3ZDT A;  5JHG A;  2WX0 A;  3KZ1 A;  2P0F A;  2R2O A;  4HCP B;  1OQN A;  3RT3 B;  2J0J A;  4HB3 B;  3L16 A;  1UNQ A;  3KYD D;  5HKH A;  1RLF A;  3KY9 A;  2YRY A;  2DA0 A;  4GDK A;  2G4D B;  4DX9 0;  4MM3 A;  2DZK A;  2Y8F A;  4HVB A;  2KDI A;  4HB2 B;  3KUZ A;  4KDL B;  3QBV B;  1E8Y A;  1P1A A;  4HPL B;  2OOB B;  2MCN B;  2LRW A;  4NY0 A;  4GSW A;  3PHW B;  3TJP A;  5C5B A;  1X11 A;  2IO2 B;  1E8Z A;  2JZZ A;  3LJU X;  3DVN V;  1U5E A;  4PS8 A;  2YSZ A;  4XWX A;  3FLV A;  2DAF A;  2KWU B;  2XK5 B;  4CYE A;  2PPH A;  4G50 A;  4GMV A;  1EAZ A;  1XT9 B;  3M1I B;  1SE9 A;  3AUL A;  1WJN A;  1FHO A;  5LOP B;  5CHF A;  3ZDM C;  1ZSQ A;  2DKP A;  3PRM B;  3DBS A;  4GU2 A;  4W9D A;  2LUL A;  2QKL A;  2J7Q B;  5J3T A;  2P0D A;  4W9F A;  1J19 A;  2ADZ A;  3ZVR A;  3DBH I;  3K9P B;  4BKT A;  4ZDV A;  2ELB A;  2L76 A;  3ODW A;  3OAN A;  1NDD A;  2XEW A;  1DRO A;  2CU1 A;  3SHQ A;  4KSL C;  3SV1 A;  5LXI B;  3ZTC A;  2C7H A;  4DDG D;  1MAI A;  2EMT A;  2DLW A;  2R2Q A;  3JSV B;  2W2X D;  1WX9 A;  2K00 A;  4BKG A;  1BAK A;  4W9G A;  2BPS A;  4PYU A;  3QJZ A;  4EOY A;  2A4Z A;  4MEM A;  1WXM A;  2L8J A;  2DYN A;  4W9J A;  4F7H A;  3VIA A;  2KMC A;  1OY2 A;  5KQ1 A;  5D94 A;  1W1G A;  2OQB A;  3VXW A;  4K17 A;  5LON B;  3HM6 X;  1WZ0 A;  3GYO A;  5C6R A;  3HM3 A;  1M94 A;  4A6K A;  5DHF B;  1AWE A;  2DZJ A;  1V49 A;  2UZS A;  2YS1 A;  1XCG A;  2MLB A;  4XC2 A;  1WJ1 A;  1V5O A;  1V81 A;  3KW5 B;  1V5U A;  3AXC A;  2L1C A;  2KKC A;  4YL8 A;  3TFM A;  3VUY A;  2RGN B;  2K8H A;  1X1G A;  3PPA A;  4B6W A;  2RSU A;  3PLV A;  2FCQ A;  3PVU A;  4RM9 A;  3TMP B;  4DHZ B;  3UIO B;  1P6S A;  3NS8 A;  3DDC B;  3A9K A;  2GS0 A;  3EFU A;  1NVL A;  1DYN A;  4Z2N A;  2KTR B;  4EJN A;  2COP A;  2ZCB A;  2KJR A;  1EVH A;  3ODO A;  3VDZ A;  4ICU A;  2H7D A;  2YS5 A;  2B3A A;  4XZ4 A;  2GBR A;  3QAR A;  2G4S A;  1WMH B;  3DVG Y;  1LXD A;  3QIJ A;  1E8X A;  3RCP A;  4NAW B;  2YF0 A;  3ML9 A;  4FHJ A;  1GJZ A;  3PG7 A;  2DZI A;  3ML4 A;  5EFX A;  3KUC B;  4NPN A;  1V89 A;  1E90 A;  1UBI A;  4OVU A;  3NSU A;  3PVL A;  2LZ6 A;  4X57 B;  4WQO B;  1E7U A;  5J17 A;  3ODX A;  1UGM A;  3L0W B;  2K2U A;  1EF5 A;  3OLM D;  4GDL B;  4II2 B;  2V4L A;  2KWC A;  3KH0 A;  1WZ3 A;  2IZV B;  4HJK A;  1OTR B;  1I42 A;  1TXD A;  2EMS A;  4HAT B;  3O65 B;  3ZNI D;  5HE3 A;  2PE9 A;  3R7R A;  2GBJ A;  1U29 A;  2D9Z A;  1I2H A;  3JVZ X;  2YVC A;  4LJP B;  2K8C A;  1ST7 A;  4WVF B;  4NNJ B;  5E6N A;  4DBB A;  3V60 A;  3V61 A;  4ZRJ A;  1UPQ A;  2H7E A;  3L08 A;  2RGF A;  3PRZ A;  2AL6 A;  4HAY B;  3PLU A;  2G35 A;  1NBF C;  4AJY B;  4ZRK A;  2KGX B;  2JVC A;  4K1R B;  3NY5 A;  4K7W A;  2LG1 A;  4KVG B;  2CQU A;  1A5R A;  4KZC A;  3OJ3 A;  2MDX A;  3WAO A;  4EZJ A;  2KCJ A;  3N30 A;  4MEL A;  1OEY J;  4I6L B;  2DX5 A;  3PZD A;  4Z2M B;  1XQQ A;  4FJZ A;  3KYC D;  1MG8 A;  1V86 A;  3SDL C;  3BY4 B;  2DFK A;  3BJI A;  1PFJ A;  4GPT B;  3IFW B;  4BVU C;  5D7G A;  2MSE D;  3KRW A;  2L0F A;  2KFJ A;  3TL5 A;  2N4F A;  2CRF A;  5DH9 B;  3IG3 A;  5CLQ B;  1XD4 A;  4DHZ E;  1MK7 B;  3ENE A;  3UIP B;  4B95 A;  2LVO A;  2N1W A;  1U5G A;  4YON A;  1ZKH A;  1ISN A;  1MPH A;  2M1M A;  4HCN B;  2P8V A;  2CY5 A;  4I6N B;  2GCJ A;  2KC2 A;  1ZC3 B;  4PS7 A;  2IY0 B;  1WGD A;  4BBN F;  3WA0 A;  4HAV B;  1ZGU B;  2JRI B;  1ZVR A;  3H1U A;  4GZU A;  1XOD A;  2KNB A;  2FAZ A;  2KFK A;  2BWE S;  1KJT A;  4HWI B;  1V5M A;  3P7Z A;  5HE2 A;  2KZR A;  3A8Q A;  4CHJ A;  2O2V A;  3PP2 A;  1WM2 A;  5LXH A;  2Y7B A;  3DQV A;  4JIO U;  4F7U P;  2D11 A;  1X05 A;  1QC6 A;  4ZRI A;  3VQI A;  2LWP A;  1PQS A;  4IUM B;  4E3C A;  3GYP A;  2DHK A;  2COF A;  3NOB A;  1MKE A;  2GBN A;  1HB6 A;  2COD A;  4MSQ B;  2EC1 A;  2BGF A;  1UNP A;  2XQN M;  4HDO A;  3ZNZ B;  5DPR A;  5JLJ B;  5JHB A;  2NMB A;  2UVM A;  2FJL A;  4K2P A;  3TVV A;  2RUK B;  3ZUN A;  3ZVV A;  5D2M B;  4KHO A;  2CS4 A;  2CHW A;  2M0X A;  3V6E B;  4IOY X;  3A9J B;  2GMI C;  2AYO B;  2YLM A;  4W9E A;  2KLG A;  1BWN A;  4KV2 A;  3I3T B;  2DTC A;  2DHZ A;  2CHZ A;  2C5L C;  2DHI A;  4W9C A;  1LQB A;  5DCN A;  2Z59 B;  1Y8R C;  1E7V A;  4EZL A;  5CX3 A;  2RLO A;  1Q67 A;  5KCV A;  2YT0 A;  4WSF A;  3ONS A;  1WI1 A;  3W1S A;  2N7E A;  5CHW A;  3DBL I;  2KHW B;  2I1J A;  2DYM A;  1H10 A;  2XK5 A;  3FM8 C;  3A1Q B;  5JP4 A;  3D8E A;  4FAD A;  2IYB A;  2K2J A;  1UBQ A;  2D3G A;  2FCM A;  3L17 A;  2KX3 A;  1WGH A;  3FSS A;  3H7P B;  1YX5 B;  4II3 B;  2KTF A;  5D3W A;  1DDM A;  4EEW A;  1QQG A;  3V6C B;  4A3P A;  2D9X A;  4E71 A;  4EFO A;  1OGW A;  3VTV A;  2WYQ A;  1WGR A;  2OJR A;  2K39 A;  2ZCC A;  1KZG A;  3QAQ A;  1J0W A;  3JSV A;  1U2B A;  2V76 A;  1ZW7 A;  3PVW A;  1WX8 A;  4HDQ A;  3FEH A;  5BO4 B;  4WJQ A;  5E6O A;  1DDV A;  3L54 A;  4NSW A;  3RUI B;  1WFY A;  2BYE A;  4KZ0 A;  3QWM A;  4BBN C;  2NPT A;  2CB8 A;  2A5U A;  4FJY A;  1HB8 A;  1FGY A;  1C1Y B;  2GCL A;  1MIZ B;  2J0K A;  2LVP A;  2V3S A;  3KUD B;  3QCA A;  4W9I A;  1MIX A;  2UZR A;  2BYV E;  4N9F 4;  4WJO A;  1JRU A;  3SYX A;  3WAL A;  3WAP A;  2LVQ A;  2BYF A;  4IM3 A;  1WR6 E;  3ALB A;  3RYT A;  1FXT B;  2HTH B;  3QWZ B;  2D9V A;  2MBO A;  1WIA A;  5GOW B;  1Z2M A;  2IO0 B;  2FCS A;  3EPY A;  2LOZ A;  4L6E A;  3R66 C;  3DOW A;  2L2I A;  2LGD A;  4CO7 A;  1FAO A;  4DXA B;  5L95 C;  2KDF B;  3AU4 A;  3CMM B;  2NCN A;  2KC1 A;  3JYU A;  1Z5S B;  3CXB B;  2Z0P A;  3CST A;  2COA A;  1ACA A;  4H8S A;  1WJ4 A;  2LI5 A;  4HK2 A;  2MKR A;  4C0A A;  2M38 A;  4WJN A;  4EMO A;  1K5D B;  1WMH A;  2GJY A;  2K6Q A;  2JXX A;  5J3Q A;  3LDZ E;  4ANW A;  2JPH A;  4GIV A;  2NBV B;  1FB8 A;  1E5W A;  4HB4 B;  2IFS A;  4PNK A;  1WG7 A;  4NAW A;  1UD7 A;  1RAX A;  3UGB B;  2HD5 B;  3TBL D;  2QHO A;  1KM7 A;  2J59 M;  2QKM A;  2REX A;  4MGZ E;  4GB9 A;  2K8B A;  3SD5 A;  2ROV A;  5D3V A;  1DDW A;  4KSK C;  2Z0O A;  2RD0 A;  3RCZ A;  1WGU A;  1GUA B;  2MBE A;  3MJW A;  4GDL A;  2IYD B;  3CF6 E;  3EEC A;  2MWN B;  1WRD B;  1WGY A;  2AL3 A;  1M7R A;  2KWV B;  4IM2 A;  5J3Y A;  2C60 A;  4ANX A;  4TYZ A;  2WH5 A;  2ZPY A;  5C1Z A;  4TQ1 A;  3VFK A;  2KJ6 A;  4A3O A;  5EDS A;  3DVG X;  4IWP A;  1RRB A;  4MY6 A;  2DN6 A;  3R3M A;  3PHX B;  2K25 A;  4NQK E;  4CHM A;  4BKS D;  4EKU A;  3DPD A;  1RRP B;  5FR6 A;  2LGX A;  3DXC A;  1KOT A;  2EJ8 A;  3RZF A;  4FHK A;  1V5P A;  4A6F B;  4W9H A;  1UPR A;  3HIZ A;  4GMX B;  2BCJ A;  4HAW B;  1V61 A;  3D8D A;  4BBK A;  2M8S A;  4P7I A;  2CAY A;  4JGH B;  1X1M A;  1OQY A;  2LYD A;  2ZZP B;  5CLL B;  1UZX B;  5JH5 C;  1QZE A;  1T0Y A;  4WJP A;  1XX0 A;  1L2N A;  1GC6 A;  2ZPN A;  3TO1 A;  4KIK B;  3B1L X;  2ROZ B;  2FJ9 A;  4XX5 A;  3CIK A;  2YS3 A;  2KAN A;  2BWF A;  2RR9 A;  2VRR B;  2RNR B;  4HAZ B;  3EC8 A;  2KQ7 A;  4MGI E;  4KHB B;  2G3Q B;  2JZ3 B;  2Z0D B;  2PZ1 A;  1AAR A;  2KMA A;  3APC A;  1EGX A;  1WJM A;  4HB0 B;  2HJ8 A;  4PYZ A;  2D2Q A;  5KHQ A;  1HE8 A;  2K6D B;  3QA8 A;  4EUT A;  3NZU A;  2RSG A;  2O6V B;  3ZIM A;  2C7M B;  3MTN B;  2MFQ A;  4JL9 A;  3K9O B;  2MRP A;  3B0A A;  4ICV A;  5DIF B;  4M0W B;  3ULC A;  3VTU A;  1KI1 B;  2D9W A;  2P0H A;  1Q1O A;  3SUZ A;  4RM8 A;  4IAP A;  3U8Z A;  1K5G B;  2R09 A;  4ASW C;  2COC A;  5HE0 A;  3RZW C;  2ELA A;  4NJ6 A;  1WXA A;  1S3S G;  1EUV B;  4CHK A;  2KLC A;  2FUH B;  3V62 A;  3T8M A;  2LJ5 A;  4AOF A;  2LXC A;  4D0N B;  3CSF A;  3N32 A;  4HXD A;  1WI0 A;  2VKI A;  2KDB A;  3M3J A;  3VUW A;  3A9J A;  3F0W A;  2BKF A;  4AWJ A;  4WWP A;  4TQ0 A;  3ZLZ A;  5IA7 A;  1XD3 B;  1WGQ A;  1WY8 A;  4TV3 A;  3DXD A;  3PEG A;  3PGE A;  1V5T A;  4W9K A;  5D3X A;  4LJO B;  3SU8 X;  3W1S C;  1Q5W B;  1F9J A;  1WXS A;  3Q3F A;  3B08 A;  1YQB A;  3AI5 A;  2OTX A;  4MDK E;  1IYF A;  3UQB A;  2PEA A;  5D27 A;  2KK8 A;  5JHA A;  3SO6 A;  3PS6 A;  2DAJ A;  5D6J B;  1WE6 A;  2KX0 A;  3A8P A;  1Y19 B;  1YJ1 A;  1SGH A;  5AZG A;  5CHV C;  1WR1 A;  2MWS B;  1RJ2 A;  4ZYN A;  4K2O A;  3H7P A;  5G55 A;  1WF9 A;  4OVV A;  3VTW A;  4TKN A;  2Y5B B;  2LKO A;  3W1Y A;  3MHS D;  2LRU A;  4MJS B;  3A98 B;  4AUQ C;  2Q13 A;  3P2B A;  2BKR B;  3AU5 A;  1GC7 A;  3ZO5 B;  2O6V D;  2I5F A;  4MT7 A;  3PSE B;  5IJM A;  4IG7 B;  1IP9 A;  2FNJ B;  2KQS A;  3ZTD A;  2KOX A;  2DEN B;  2CR5 A;  4IFS A;  4HPM B;  2LAS A;  2MBQ A;  2E2X A;  2KO3 A;  2MP2 B;  2D10 A;  2MW5 A;  3LJ3 A;  3OAW A;  4FN2 A;  3VHT C;  3APF A;  1N3H A;  3APD A;  3OJ4 B;  4GXB A;  2XBB C;  4DDI D;  1V88 A;  3TCA A;  5L83 A;  4PQ0 A;  1TTN A;  3ZNH B;  3QHT A;  3TIX A;  5AZF A;  1WYW B;  1VCB A;  2RPQ A;  2DHJ A;  2GBK A;  3P6A A;  2LBB A;  3HK0 A;  3U30 A;  2W9N A;  2LGY A;  3GOE A;  4GGQ A;  4URK A;  3UQA A;  5AZH A;  4AJW A;  2MQJ A;  1U5D A;  2YT1 A;  5DPT A;  4G11 A;  3ZRC A;  1I35 A;  2C9W B;  4GDK B;  1X1F A;  2R0D A;  3PSC A;  3MPX A;  4BFR A;  3PTF C;  4FLH A;  4DK5 A;  1TZ1 A;  4JQW C;  1X86 A;  3BIN A;  2HE7 A;  2JY6 A;  3T06 A;  2ZVO A;  1J8C A;  5C5B B;  5L81 A;  1CMX B;  4BKS A;  1XR0 B;  4A20 A;  3D8F A;  2HTH A;  3QK0 A;  1SHC A;  3X23 A;  1IRS A;  1TBE A;  4HLE A;  2DKQ A;  1C3T A;  2DZM A;  2VSZ A;  2HRJ A;  2MBB B;  4F7Z A;  2I5C A;  5G2N A;  2BF8 B;  3DXE A;  1R4N I;  2IY1 B;  3MDB C;  3DCG A;  2X18 A;  1YD8 U;  2MX2 A;  4MH0 E;  1H4R A;  2N1V A;  5C79 A;  2L0T A;  5DPW A;  4MK0 A;  2JUO A;  3JW0 X;  2NPT B;  3RUL A;  1GG3 A;  2M14 A;  1G6J A;  1FGZ A;  4MSM B;  2N9P C;  2FID A;  4M8N A;  1M7E A;  4ANU A;  2KTR A;  5HE1 A;  2IBI B;  2L3Z A;  4LDT B;  4HAU B;  3VH3 B;  3TW1 A;  4DHJ B;  3M62 B;  2KJH B;  4B6H A;  1V80 A;  3KSY A;  1L7Y A;  2ZVN A;  2Z0Q A;  5C16 A;  2WX1 A;  1WVH A;  4KAX B;  4F7G A;  4DX8 A;  2LD9 A;  3VUX A;  1SIF A;  5DPS A;  1WGG A;  4FBJ B;  1GNU A;  4A6H A;  5E6P A;  1B55 A;  2D07 B;  3EHV A;  2NVU I;  4FA6 A;  4TUU A;  3A4S C;  3ECI A;  3IHP C;  1WJ6 A;  2N9E B;  5JHH A;  5DI9 B;  2JRH A;  1OEY A;  4M8M A;  1UNR A;  2L7R A;  1AQC A;  1UH6 A;  5JZE B;  4FJV B;  2N7D A;  1Y5O A;  2V1Y A;  1P0R A;  3ZNG C;  2AEH A;  3R7Q A;  2IO1 B;  4F1S A;  3GZN I;  4I6P A;  2ZNV C;  1LB1 A;  4EZK A;  4K7S A;  1U4A A;  1LFD A;  2RVB B;  2JF5 A;  2NBW B;  3NZS A;  2LUE A;  1FOE A;  1LM8 B;  2NZ8 B;  1V9J A;  1P3Q U;  1HBK A;  1WM3 A;  4HAX B;  2RQ1 A;  3A9K B;  4MGK E;  4A6F A;  2AWT A;  5DHA B;  2DYO A;  3VOQ A;  2N23 A;  1NTV A;  3G9W A;  1LW3 A;  1H8C A;  4J6I A;  5FI1 A;  4WWO A;  3UF8 A;  2KXJ A;  1ZM0 A;  2M17 A;  4Y94 A;  2MBH A;  3O96 A;  1IPG A;  3IVF A;  2KD0 A;  1VD2 A;  2PE6 B;  3WAM A;  3H7S A;  5J2R A;  4DWF A;  1E8W A;  3N7C A;  4KIK A;  4LDT D;  1W1D A;  2CKH B;  5FI0 A;  4DHJ D;  1NU2 A;  1I7A A;  4WJ7 A;  1FHX A;  4K7U A;  1BT0 A;  2FCN A;  2JT4 B;  5IAA C;  4IWQ A;  3S2A A;  3F5R A;  3A4R A;  3IBE A;  1P3R A;  3WIM A;  2W2W A;  4E74 A;  1V2Y A;  2WWZ A;  2CHX A;  2ZNV B;  1TQZ A;  3M63 B;  2I1K A;  1MK9 B;  2G45 B;  3H6N A;  3T9L A;  2DYQ A;  2M4N A;  3UIN B;  4IC7 B;  3SNH A;  1EO6 A;  3A33 B;  4ANV A;  3D32 A;  2CY4 A;  1KLV A;  4BOS C;  3HQC A;  2O6V A;  3VAW A;  1DBH A;  2D4Q A;  1NTY A;  2MA9 B;  3KVF B;  3M95 A;  5AEK B;  3ZRF A;  2GBM A; 
#chains in the Genus database with same CATH topology
 3QX1 A;  4IM0 A;  3RD2 A;  2OHF A;  1WJU A;  2IND C;  4M0W A;  4ARC A;  5GMV A;  2FE8 A;  4KDI C;  4XYC A;  2Z13 A;  2ABD A;  3FVC A;  3X0W A;  4IOI E;  3WAN A;  5KHO A;  1Q0W B;  1W1H A;  2Y8G A;  3HW2 B;  1D5X C;  4WAA A;  3W5V B;  4LTU A;  2ZEQ A;  1D3Z A;  1YX6 B;  3H9D A;  1SE4 A;  4A5K A;  2JWZ A;  4BOZ B;  3I5J C;  1KBL A;  5IKC M;  3SFE B;  2N9X A;  3NRZ A;  1TS4 A;  2VRW B;  4IW0 A;  2ZW0 A;  2BS2 B;  1ROE A;  1N63 A;  2KUQ A;  1WE7 A;  3WYF B;  2LXA A;  2BB6 A;  2LFI A;  3U2S C;  3PRP B;  1PLS A;  4GN1 A;  4KHA A;  3DBR I;  4HEA 1;  4Q2J A;  2YT2 A;  1V8C A;  3ZKJ C;  5C23 A;  1XKE A;  3PO0 A;  2W2X C;  3C0R B;  1NTI A;  3L13 A;  3NHE B;  2DX5 B;  2DYB A;  4WWN A;  4DIX A;  1Z87 A;  1CQV A;  1WX7 A;  1WXV A;  5LLI A;  1T5X D;  3MJ5 A;  2EKE C;  2NR2 A;  2NBU A;  1KZ7 A;  2ZJD A;  4ZHO A;  3GS2 A;  1FRD A;  1E9M A;  5HFY A;  2MJD A;  3V5W A;  3N3K B;  2TSS A;  4JLC A;  3L10 B;  3NWA A;  3ML8 A;  2ASQ A;  2FIF A;  4GOU A;  1NI2 A;  2KN5 A;  5BMG A;  1PGB A;  2GOW A;  2KDE B;  2L00 B;  1RFA A;  3QC8 B;  2C7N B;  1U27 A;  3HVD A;  5TR5 A;  2M0A A;  2JX5 A;  3PV1 A;  3U52 E;  3HHM A;  4RMA A;  2UWQ A;  4XWW A;  2M19 A;  2UYZ B;  3QQ8 B;  2XN9 C;  4IWO A;  4GOC A;  2JU6 X;  2J0M A;  4MGY E;  1XO3 A;  2FDQ A;  1OMW A;  4K81 A;  2D9Y A;  1J0G A;  5KQ4 A;  3SFD B;  3UZT A;  4JKE A;  1V6E A;  2PW9 A;  1EF1 A;  1J7C A;  2K1F A;  4W9L A;  1P5T A;  1P98 A;  4G0N B;  3EGR A;  4M01 A;  4NQL B;  4PS3 A;  1FRR A;  2LOX A;  2JQR B;  3AE9 B;  4DBG A;  2PJH A;  4JWS C;  2NTS A;  1VZ7 A;  3U7D A;  4AP4 C;  2KDM A;  3DVN U;  1YMH E;  5D3Y A;  3ULB A;  2JP2 A;  3FAH A;  2Z0E B;  1PUT A;  1YQ4 B;  2WDV B;  2WDR B;  4MJS A;  5G5H A;  2KFK B;  5CTR C;  4LNN A;  4HKQ A;  2WXQ A;  1FMA D;  3VVW B;  3ZW3 A;  3HVZ A;  2QIE B;  1P9D U;  5H92 C;  1ZE3 D;  4B9K A;  5I2M A;  2O2V B;  3AJ4 A;  2KAC A;  5T8I A;  3A1Q A;  1FHW A;  3C19 A;  5J18 A;  1BTK A;  3PRE A;  2NS5 A;  5D3D A;  2N0Y A;  4YTM B;  3KRX A;  3P4Q B;  4G3X B;  3VH4 B;  2KVR A;  4NJ7 A;  1ZC4 B;  1I4Q A;  2WDT B;  1UEF A;  2IO3 B;  1YIW A;  3DHI C;  1S1Q B;  3RNE C;  2MP2 A;  2L05 A;  4LCD E;  4ZOH C;  2DX1 A;  1R4M I;  3PT2 B;  4F8C B;  3FP5 A;  4FUL A;  1BTN A;  1U5F A;  1K8R B;  1WH3 A;  2KUP A;  4LNF A;  1UEL A;  2IPK D;  1TGZ B;  3Q3J A;  3ZYY X;  1TJ6 A;  1PMS A;  1L6U A;  4RF1 A;  4HHV A;  3ZDT A;  1C79 A;  1HTO A;  5JHG A;  2WX0 A;  3KZ1 A;  2P0F A;  4A8X C;  1TJE A;  1QQR A;  2WXI A;  2R2O A;  2ONQ A;  3NVW A;  4HCP B;  1OQN A;  3RT3 B;  2J0J A;  3N9Y C;  3B9J A;  4L1R A;  4HB3 B;  3BZD B;  3P4R B;  2BYT A;  3L16 A;  1UNQ A;  3KYD D;  3Q8A A;  5HKH A;  1RLF A;  3KY9 A;  2SEB D;  4HPP A;  2IGD A;  2YRY A;  2DA0 A;  4GDK A;  2G4D B;  4DX9 0;  1KFY B;  4MM3 A;  1T0R C;  2DZK A;  2Y8F A;  4HVB A;  2KDI A;  4HB2 B;  3KUZ A;  4KDL B;  4S0R A;  3QBV B;  1E8Y A;  1AN8 A;  1P1A A;  4HPL B;  1UGJ A;  1ZDX A;  1BML C;  2OOB B;  1WGK A;  2MCN B;  2LRW A;  4NY0 A;  4GSW A;  3PHW B;  2QDF A;  3T3N A;  3TJP A;  5C5B A;  1X11 A;  1JQ4 A;  2IO2 B;  2WXK A;  1E8Z A;  2JZZ A;  3LJU X;  3E9S A;  3DVN V;  1XXG A;  2WS3 B;  4OT1 A;  2PMV A;  1U5E A;  4PS8 A;  2YSZ A;  4XWX A;  3FLV A;  2DAF A;  2KWU B;  1DGJ A;  2XK5 B;  4CYE A;  2PPH A;  3TSS A;  4G50 A;  4GMV A;  2QCZ A;  2IJ0 A;  1FM0 D;  1EAZ A;  1XT9 B;  3M1I B;  3RNC C;  1SE9 A;  1TIF A;  3AV8 A;  3AUL A;  1WJN A;  3IT6 B;  1FHO A;  5LOP B;  3AEC B;  5CHF A;  3ZDM C;  1ZSQ A;  1SE3 A;  2DKP A;  3PRM B;  4JK9 A;  3HRD D;  3DBS A;  4GU2 A;  4W9D A;  2LUL A;  1C78 A;  3J9C A;  2QKL A;  2J7Q B;  5J3T A;  2P0D A;  5E6J A;  4W9F A;  1J19 A;  2ADZ A;  3ZVR A;  3DBH I;  3K9P B;  4BKT A;  1FXI A;  2Y5P A;  4HJG E;  4ZDV A;  2KVZ A;  2ELB A;  2L76 A;  1SJH D;  3ODW A;  3OAN A;  1GB1 A;  1NDD A;  1KC7 A;  2XEW A;  4QJ5 B;  1DRO A;  2CU1 A;  2W3S A;  4WH4 A;  4QJ3 B;  3SHQ A;  4KSL C;  3SV1 A;  3TUO A;  5LXI B;  3ZTC A;  2C7H A;  4DDG D;  1MAI A;  2EMT A;  2DLW A;  2R2Q A;  1QOB A;  3JSV B;  1QOF A;  4ZRQ A;  2W2X D;  3MFG A;  1WX9 A;  1J7A A;  2K00 A;  4BKG A;  1BAK A;  4W9G A;  1BXT A;  4JWU C;  2RMM A;  1KLU D;  2BPS A;  2GB1 A;  4PYU A;  3QJZ A;  4EOY A;  2A4Z A;  4MEM A;  1WXM A;  2L8J A;  2DYN A;  4ACF A;  4W9J A;  3ZJV A;  4F7H A;  3VIA A;  1JRP A;  2KMC A;  4JK7 A;  1OY2 A;  1MHH E;  5KQ1 A;  5D94 A;  1SBB B;  2R61 A;  3KWV A;  4XE0 A;  1W1G A;  2OQB A;  3VXW A;  4K17 A;  5LON B;  3HM6 X;  1WZ0 A;  3GYO A;  5C6R A;  3GZN B;  3HM3 A;  1M94 A;  2QIL A;  3CWI A;  4ILH A;  4A6K A;  4CQN A;  3VRA B;  5DHF B;  1ESF A;  1FIQ A;  1AWE A;  1DOX A;  4P6V F;  1ACC A;  2DZJ A;  1V49 A;  2UZS A;  3RFZ B;  4JKB A;  2M56 B;  3N1X C;  2YS1 A;  1XCG A;  2MLB A;  4XC2 A;  1WJ1 A;  1JWM D;  1V5O A;  1V81 A;  2LGS A;  3KW5 B;  3V05 A;  3BVM A;  1V5U A;  3AXC A;  1TS5 A;  2L1C A;  2KKC A;  3H8H A;  3OG5 A;  4YL8 A;  3TFM A;  3VUY A;  2RGN B;  2K8H A;  1X1G A;  3PPA A;  5AUK A;  4B6W A;  4WAF A;  2RSU A;  3PLV A;  1QOG A;  2FCQ A;  3PVU A;  2Q5W D;  4RM9 A;  3TMP B;  4DHZ B;  3UIO B;  1P6S A;  1ET6 A;  1QKZ A;  1N5X A;  2Y5C A;  3NS8 A;  3DDC B;  3A9K A;  2GS0 A;  3EFU A;  1NVL A;  1DYN A;  1ET9 A;  4BZA A;  4Z2N A;  3RNA C;  2KTR B;  4EJN A;  2COP A;  1MJD A;  2ZCB A;  2KJR A;  1EVH A;  3ODO A;  4LLG M;  3VDZ A;  4ICU A;  2H7D A;  2YS5 A;  2B3A A;  4XZ4 A;  2GBR A;  3QAR A;  4B0E A;  2G4S A;  1T0Q C;  1WMH B;  3LYY A;  1Y56 A;  3NJT A;  3DVG Y;  3VRB B;  1LXD A;  3UI3 A;  3ZJT A;  3QIJ A;  1E8X A;  3RCP A;  4NAW B;  2YF0 A;  3ML9 A;  4FHJ A;  1GJZ A;  1YNT E;  3W9C B;  1FPY A;  4L1B A;  3PG7 A;  2DZI A;  3ML4 A;  5EFX A;  3B2F A;  5C2T B;  3KUC B;  1FNW A;  1XCT L;  2JZP A;  4NPN A;  2K0P A;  4WIP A;  2RRF A;  2K3U A;  1V89 A;  1E90 A;  1UBI A;  2WXL A;  1SSN A;  4OVU A;  3NSU A;  3PVL A;  2WNM A;  2LZ6 A;  1D5M C;  4X57 B;  1V1P A;  1EU4 A;  2PVG C;  4WQO B;  1E7U A;  5J17 A;  3ODX A;  1UGM A;  2G1E A;  2BBC A;  3L0W B;  2K2U A;  2K49 A;  1EF5 A;  5I2S A;  3OLM D;  4GDL B;  1N5W A;  2R2Y A;  4RGO S;  4II2 B;  1UWM A;  1N60 A;  2V4L A;  2KWC A;  3KH0 A;  1SEB D;  1L4Z B;  1WZ3 A;  2IZV B;  1ZP0 B;  4HJK A;  1YN4 A;  4S17 A;  4US8 A;  1OTR B;  2YEP B;  2XNA C;  1I42 A;  1TXD A;  3N1Z C;  4C7Y A;  2EMS A;  4HAT B;  3O65 B;  4OW0 A;  3ZNI D;  4JPS A;  5HE3 A;  2PE9 A;  2DBY A;  3R7R A;  2GBJ A;  1U29 A;  2D9Z A;  1I2H A;  3JVZ X;  2N7J A;  4C80 A;  2YVC A;  4LJP B;  3RPF C;  1M4V A;  2K8C A;  1RM6 C;  3DBR B;  1ST7 A;  4WVF B;  4NNJ B;  5E6N A;  4DBB A;  3V60 A;  3Q8F A;  3V61 A;  1MHX A;  4ZRJ A;  1XLQ A;  3NWD A;  1UPQ A;  2W3R A;  2H7E A;  5M4Y B;  2SAK A;  2MHJ A;  5EE9 A;  3L08 A;  2RGF A;  3PRZ A;  2AL6 A;  3BII D;  4YT0 B;  4HAY B;  1R7S A;  3PLU A;  2G35 A;  1IUE A;  1NBF C;  2J52 A;  2WXM A;  4AJY B;  4ZRK A;  2KGX B;  1F1H A;  2H89 B;  2K8E A;  2JVC A;  4K1R B;  3NY5 A;  4K7W A;  2LG1 A;  1AWD A;  4KVG B;  2GUM A;  3DHH C;  2CQU A;  2JYT A;  1A5R A;  1MPE A;  5IP4 D;  4KZC A;  1E7P B;  1L5P A;  3OJ3 A;  2MDX A;  3WAO A;  4EZJ A;  1BUI C;  2KCJ A;  3N30 A;  4MEL A;  1OEY J;  4I6L B;  4YXD B;  2DX5 A;  3PZD A;  1B1Z A;  2RDG A;  1T3Q A;  5FK9 C;  4Z2M B;  1JML A;  2WDQ B;  5FR3 A;  2FUG 1;  1XQQ A;  5LNK 1;  4FJZ A;  3KYC D;  4USA A;  1MG8 A;  1V86 A;  3SDL C;  4MAC A;  3BY4 B;  2DFK A;  1N61 A;  3Q3N C;  3BJI A;  1PFJ A;  4GPT B;  3IFW B;  4BVU C;  1ZOY B;  1GOZ A;  3C8Y A;  5D7G A;  2MSE D;  3KRW A;  4KGS A;  2L0F A;  2KFJ A;  1I4P A;  3TL5 A;  3P1M A;  1D5Z C;  2J42 A;  2N4F A;  3URY A;  2CRF A;  5DH9 B;  2BS3 B;  3IG3 A;  5CLQ B;  1XD4 A;  3AE8 B;  4DHZ E;  1MK7 B;  1RYJ A;  3ENE A;  2QC8 A;  3UIP B;  4B95 A;  2LVO A;  2N1W A;  1U5G A;  4YON A;  5EE0 A;  1ZKH A;  2D3C A;  1ISN A;  2BTE A;  3W5U B;  1PYW D;  1MPH A;  2M1M A;  4HCN B;  2P8V A;  2CY5 A;  1D6E C;  4HRS A;  4I6N B;  2GCJ A;  2UU7 A;  2KC2 A;  1ZC3 B;  4PS7 A;  2IY0 B;  1WGD A;  2J4X A;  4BBN F;  4WUR A;  3WA0 A;  1KF6 B;  4HAV B;  2L32 A;  1SJE D;  1ZGU B;  3MC0 B;  4WWM A;  2JRI B;  1ZVR A;  1P7F A;  1SE2 A;  3H1U A;  4GZU A;  1XOD A;  3Q2A C;  2INP E;  2KNB A;  2FAZ A;  2KFK A;  1FNV A;  2BWE S;  1KJT A;  1R4M B;  3HUI A;  4HWI B;  1V5M A;  3P7Z A;  2K9X A;  5HE2 A;  2KZR A;  2BT6 A;  3A8Q A;  4CHJ A;  2O2V A;  3GB1 A;  3PP2 A;  4C7Z A;  1WM2 A;  5LXH A;  2Y7B A;  1AW7 A;  3DQV A;  1QT9 A;  3AM9 A;  4JIO U;  4F7U P;  2D11 A;  1X05 A;  1QC6 A;  4JKF A;  4ZRI A;  3VQI A;  2LWP A;  1PQS A;  4IUM B;  4TMA B;  4E3C A;  2LHE A;  3GYP A;  5IN7 A;  2DHK A;  2COF A;  1C4C A;  3NOB A;  2MEK A;  1MKE A;  2GBN A;  1HB6 A;  1HZ6 A;  2COD A;  2QEJ C;  3SR6 A;  1UWX A;  4MSQ B;  2EC1 A;  2BGF A;  3DWG C;  1UNP A;  2XQN M;  4HDO A;  4KKI A;  3ZNZ B;  1VBG A;  3P42 A;  5DPR A;  4LK0 M;  4RF0 A;  4JKG A;  5JLJ B;  3AEE B;  5JHB A;  2NMB A;  2UVM A;  2FJL A;  2OED A;  4K2P A;  1JDE A;  3TVV A;  2RUK B;  3ZUN A;  1TYG B;  2INN E;  2WXF A;  2LJI A;  3ZVV A;  3NG0 A;  5D2M B;  4KHO A;  2CS4 A;  4M02 A;  2CHW A;  5IOI A;  2M0X A;  3EA6 A;  3V6E B;  4IOY X;  3A9J B;  2GMI C;  1QF6 A;  2AYO B;  1UF0 A;  3PZ8 A;  2X38 A;  2YLM A;  3E66 A;  4W9E A;  2KLG A;  1BWN A;  1HZ5 A;  3RNF C;  4KV2 A;  3I3T B;  2N9K A;  2HTM E;  2DTC A;  1RWS A;  2DHZ A;  2CHZ A;  4D2K A;  2C5L C;  2DHI A;  4W9C A;  1LQB A;  5DCN A;  2Z59 B;  1Y8R C;  1E7V A;  4EZL A;  2DNF A;  5CX3 A;  1Q67 A;  2RLO A;  5KCV A;  2YT0 A;  4WSF A;  3I63 C;  3ONS A;  1WI1 A;  3W1S A;  2N7E A;  2KIE A;  1XEE A;  5CHW A;  3DBL I;  3HSA A;  2KN4 A;  1TZO A;  3DBH B;  2KHW B;  1TKY A;  2I1J A;  2DYM A;  4RGT A;  1H10 A;  1I4G A;  2XK5 A;  2CJN A;  3FM8 C;  2YEP F;  3A1Q B;  5JP4 A;  3D8E A;  1VDV A;  4FAD A;  2IYB A;  4GNK B;  2K2J A;  3AMZ A;  4HRO A;  4L2Y A;  4B0M A;  1UBQ A;  2D3G A;  3RN9 C;  4JKD A;  2FCM A;  3L17 A;  2KX3 A;  4N58 A;  1EU3 A;  1WGH A;  3FSS A;  3GP7 A;  1YX5 B;  3H7P B;  4II3 B;  2KTF A;  3GE3 C;  2LEK A;  5D3W A;  1DDM A;  4M00 A;  2PIA A;  4EEW A;  3BK2 A;  1QQG A;  3ZGZ A;  2DLB A;  3V6C B;  4K3C A;  4PT5 A;  4WQM A;  2WXP A;  4A3P A;  4JKC A;  2BB5 A;  2D9X A;  1NYQ A;  1GPX A;  4E71 A;  4EFO A;  4REZ A;  1OGW A;  1ZXH A;  3U7Z A;  3VTV A;  2WYQ A;  1WGR A;  2OJR A;  2K39 A;  2ZCC A;  2NMQ A;  1KZG A;  3I9V 1;  1PGX A;  3TEY A;  1FD6 A;  3QAQ A;  1J0W A;  4OZA A;  4YTN B;  5JVL A;  1TKE A;  3JSV A;  1U2B A;  2V76 A;  1ZW7 A;  4NJC A;  3PVW A;  1WX8 A;  3P4S B;  4HDQ A;  3BWU D;  4LNI A;  3FEH A;  4YSZ B;  5BO4 B;  4WJQ A;  5E6O A;  2HDE A;  1L0V B;  1DDV A;  3L54 A;  4XWT A;  4NSW A;  1HXY D;  2KAJ A;  3RUI B;  1WFY A;  3AEA B;  2V3P A;  3LB8 C;  2W54 A;  2BYE A;  4YTP B;  4KZ0 A;  3VR9 B;  3HIE A;  1ZYI A;  3QWM A;  4BBN C;  3NWF A;  2NPT A;  1CJE A;  2CB8 A;  2WXN A;  2A5U A;  2L83 A;  4FJY A;  1K51 A;  1HB8 A;  1FGY A;  1L6V A;  2J53 A;  1C1Y B;  2GCL A;  1JWB D;  3NUH B;  1MIZ B;  2J0K A;  3N20 C;  2LVP A;  2W55 A;  3AB5 A;  4ZHP A;  2V3S A;  2LGI A;  1DIK A;  3KUD B;  3DHG C;  3QCA A;  4EE2 A;  3AN1 A;  4W9I A;  5I4D A;  1MIX A;  2UZR A;  2BYV E;  4N9F 4;  4WJO A;  1JRU A;  1YJJ A;  3SYX A;  3WAL A;  3LXF A;  1JRO A;  3WAP A;  2LVQ A;  2BYF A;  2WXO A;  1WR6 E;  4IM3 A;  3AE3 B;  3ALB A;  4KKJ A;  1JWS D;  4A9A A;  3RYT A;  2KT7 A;  1ENF A;  1FXT B;  1T0S C;  2HTH B;  2Z14 A;  3QWZ B;  2D9V A;  2WXJ A;  2MBO A;  1WIA A;  5GOW B;  1Z2M A;  2IO0 B;  2FCS A;  3EPY A;  2LOZ A;  4L6E A;  1EWY C;  3R66 C;  3DOW A;  3NZ3 A;  3MP9 A;  2L2I A;  2LGD A;  1TT5 B;  4CO7 A;  4PK1 A;  1FAO A;  1KH0 A;  3DWM A;  4RGN A;  4A55 A;  4DXA B;  3R8B A;  5L95 C;  2KDF B;  2V3N A;  2DWQ A;  3IT4 B;  3AU4 A;  3CMM B;  2VZK B;  2NCN A;  1MVK A;  2KC1 A;  4YWG G;  4P16 A;  3JYU A;  4XGA B;  3SBG A;  1Z5S B;  3CXB B;  2LMC A;  4JKA A;  4QAY A;  1I4R A;  4KGR A;  3ENB A;  2WP9 B;  2Z0P A;  3CST A;  2COA A;  1ACA A;  4H8S A;  1FFU A;  1WJ4 A;  1KLG D;  2LI5 A;  4HK2 A;  2MKR A;  3ZXV A;  4C0A A;  2M38 A;  4WJN A;  4EMO A;  1K5D B;  1WMH A;  3NS1 A;  2GJY A;  2K6Q A;  2JXX A;  1TKG A;  3PZ7 A;  5J3Q A;  3LDZ E;  4ANW A;  2JPH A;  3AE7 B;  4GIV A;  2NBV B;  1FB8 A;  1IGD A;  1E5W A;  5H8Y E;  4HB4 B;  2IFS A;  4PNK A;  1WG7 A;  4NAW A;  1UD7 A;  1F2R C;  1C4A A;  2KWD A;  1RAX A;  3UGB B;  2HD5 B;  3V3X A;  3TEZ A;  3TBL D;  2LUM A;  1FEH A;  2EEL A;  1I7H A;  2QHO A;  1NEK B;  1FFV A;  1KM7 A;  1C4P A;  2J59 M;  2QKM A;  2MH7 A;  4R3D A;  2REX A;  2FJU B;  1VZ8 A;  4MGZ E;  4GB9 A;  2K8B A;  3SD5 A;  3TEW A;  2MJ3 A;  2NTT A;  2ROV A;  5D3V A;  1DDW A;  1VLB A;  2V0G A;  2CU3 A;  1UUP A;  1VJK A;  4KSK C;  2Z0O A;  2RD0 A;  3RCZ A;  1MI1 A;  1WGU A;  1GUA B;  3ABV B;  2MBE A;  3MJW A;  4GDL A;  2V9H A;  1MI0 A;  1I4X A;  1XLN A;  2IYD B;  4RCO A;  3CF6 E;  2Z4D A;  3NW8 A;  4N59 A;  3IAS 1;  3EEC A;  2MWN B;  3P63 A;  1WRD B;  1WGY A;  2AL3 A;  1M7R A;  4KGT A;  2KWV B;  4IM2 A;  5J3Y A;  2C60 A;  3NVV A;  4ANX A;  1UNS A;  4ZYS A;  4TYZ A;  1V1O A;  2WH5 A;  2ZPY A;  3B2G A;  1PGA A;  5C1Z A;  4XDD A;  2BW2 A;  1K50 A;  4TQ1 A;  2JSV X;  1PFD A;  1F77 A;  2KJ6 A;  3VFK A;  4A3O A;  5EDS A;  3DVG X;  4IWP A;  1RRB A;  1RFK A;  4MY6 A;  5EE3 A;  2DN6 A;  2GLS A;  2DIK A;  3R3M A;  3PHX B;  2QMT A;  3AEG B;  2K25 A;  4NQK E;  4CHM A;  4TSS A;  4BKS D;  4EKU A;  1NI3 A;  1QLB B;  2QJL A;  1YOV B;  4RGM A;  4OHJ A;  3DPD A;  1RRP B;  5FR6 A;  4GLS C;  2LGX A;  3DXC A;  1VR9 A;  1WSP A;  2WGS A;  4QXA B;  1EWC A;  1KOT A;  1F52 A;  2EJ8 A;  3RZF A;  4FHK A;  4KX6 B;  4C4V B;  1ZDV A;  1V5P A;  2QSD A;  4A6F B;  2VZK D;  2ACZ B;  4W9H A;  1T6B X;  1K53 A;  3P4P B;  3RNG C;  1UPR A;  3HIZ A;  4GMX B;  2BCJ A;  4HAW B;  1V61 A;  3D8D A;  4BBK A;  1C76 A;  1YN3 A;  2M8S A;  2L1A A;  4P7I A;  2BQQ A;  2CAY A;  4JGH B;  2D3B A;  1X1M A;  5LG4 B;  1OQY A;  2JYE A;  2LYD A;  4AS1 A;  3U12 A;  2ZZP B;  5D3I B;  5CLL B;  1V1P B;  1UZX B;  5JH5 C;  1QZE A;  1T0Y A;  2WXR A;  1FXA A;  4WJP A;  1XX0 A;  3U4E G;  1L2N A;  1GC6 A;  2ZPN A;  4ZRP A;  5TSS A;  3TO1 A;  4KIK B;  1XCQ L;  2V4I B;  3B1L X;  3I57 A;  5BYR A;  2ROZ B;  2FJ9 A;  4D6W A;  1WRI A;  5HHD G;  4XX5 A;  2X0S A;  3CIK A;  2YS3 A;  2KAN A;  2BWF A;  2RR9 A;  2VRR B;  3OWE B;  2RNR B;  3WCQ A;  3BYT B;  4HAZ B;  2GRI A;  3EC8 A;  2KQ7 A;  4MGI E;  4KHB B;  2JZ3 B;  1F2R I;  2G3Q B;  1KRH A;  2Z0D B;  2PZ1 A;  1AAR A;  1MFW A;  4LNO A;  1F0Z A;  2X8X X;  2WHI A;  2KMA A;  2VH1 A;  2GI9 A;  1DYQ A;  3APC A;  3FIL B;  1EGX A;  3AE5 B;  1DOY A;  1WJM A;  4HB0 B;  1JCK B;  2HJ8 A;  1LO5 D;  4PYZ A;  2D2Q A;  1E0Z A;  5KHQ A;  4JK8 A;  1HE8 A;  5C3J B;  3N1Y C;  5FKA C;  3Q6B A;  1HTQ A;  2K6D B;  3QA8 A;  1OQR A;  3EFC A;  4EUT A;  3NZU A;  2RSG A;  2O6V B;  3ZIM A;  1JWA D;  3E9O A;  1K52 A;  2C7M B;  3MTN B;  2MFQ A;  4JL9 A;  3BK1 A;  3K9O B;  2MRP A;  3B0A A;  2JXT A;  3SEB A;  1IBX B;  3IXS A;  4ICV A;  4US9 A;  5IO9 A;  5DIF B;  2KYW A;  3ULC A;  2Z8L A;  3Q8E A;  4M0W B;  2D3A A;  2E6X A;  3VTU A;  1KI1 B;  1WYG A;  4FXC A;  2D9W A;  2P0H A;  4CSQ A;  1Q1O A;  4MH8 A;  4ILJ A;  3SUZ A;  4RM8 A;  4IAP A;  3U8Z A;  1ZXI A;  1K5G B;  1L0Y B;  2R09 A;  4ASW C;  2COC A;  1TY0 A;  5HE0 A;  3RZW C;  2ELA A;  4NJ6 A;  1WXA A;  2B76 B;  5AUI A;  1S3S G;  1EUV B;  2WQY B;  1J7B A;  4CHK A;  2KLC A;  1IGC A;  4ARI A;  2FUH B;  1DOI A;  3V62 A;  3T8M A;  2K22 A;  2LJ5 A;  4AOF A;  2LXC A;  1L0X B;  2CJO A;  4D0N B;  3SBT A;  3CSF A;  3N32 A;  4HXD A;  5BMI A;  1WI0 A;  3AEF B;  2VKI A;  1AYF A;  1N6Z A;  1ZPS A;  2KDB A;  3Q8C A;  3M3J A;  3VUW A;  3NVY A;  3A9J A;  3DBL B;  3F0W A;  2BKF A;  4AWJ A;  2KIG A;  1CZP A;  1STE A;  4WWP A;  2RPV A;  3OHM B;  4TQ0 A;  3ZLZ A;  3L4P A;  3MHZ A;  5IA7 A;  1XD3 B;  1TS2 A;  4DXG A;  1WGQ A;  5BYQ A;  1WY8 A;  4P1C C;  4JKH A;  4TV3 A;  2Z59 A;  3DXD A;  3PEG A;  3PGE A;  1V5T A;  3GE8 C;  4W9K A;  5D3X A;  4LJO B;  3SU8 X;  4ITK A;  3W1S C;  5BYS A;  4A6Q A;  1Q5W B;  4IKG A;  1F9J A;  1WXS A;  3Q3F A;  1ZUD 2;  2PLP A;  3B08 A;  1YQB A;  2OTX A;  3AI5 A;  4MDK E;  5JXV A;  1IYF A;  4JX1 C;  1C77 A;  3O13 A;  3UQB A;  2PEA A;  5D27 A;  2KK8 A;  5JHA A;  3SO6 A;  3PS6 A;  2DAJ A;  5D6J B;  2IGH A;  1WE6 A;  2KX0 A;  1FO4 A;  2I2Y A;  2KR0 A;  3A8P A;  1Y19 B;  1YJ1 A;  1SGH A;  5AZG A;  5CHV C;  1WR1 A;  2MWS B;  3AE2 B;  1RJ2 A;  4ZYN A;  2ZW1 A;  4DXF A;  4K2O A;  3H7P A;  5G55 A;  1WF9 A;  4OVV A;  2MJE A;  3VTW A;  4TKN A;  2Y5B B;  3B77 A;  2LKO A;  1Q10 A;  3W1Y A;  3MHS D;  1WXQ A;  2LRU A;  4MJS B;  3A98 B;  4AUQ C;  2Q13 A;  2INC C;  3P2B A;  2BKR B;  4JKG B;  3E9L A;  1KTK A;  3AU5 A;  1GC7 A;  4A90 A;  3ZO5 B;  2O6V D;  3KQ4 A;  2EKI A;  2I5F A;  2BS4 B;  4MT7 A;  2W82 A;  3PSE B;  5IJM A;  3FKY A;  4IG7 B;  1IP9 A;  2FNJ B;  2KQS A;  3ZTD A;  2KOX A;  1JWU D;  2DEN B;  2CR5 A;  2ZKM X;  4IFS A;  4HPM B;  2LAS A;  2MBQ A;  2E2X A;  2KO3 A;  4J3O D;  4C00 A;  4N6E B;  2MP2 B;  2D10 A;  2MW5 A;  3AE4 B;  3LJ3 A;  3OAW A;  1LGR A;  4FN2 A;  3VHT C;  3APF A;  1N3H A;  2WXG A;  3APD A;  3OJ4 B;  4GXB A;  2XBB C;  2RDH A;  3RI7 C;  3Q3O C;  4DDI D;  1V88 A;  3TCA A;  5L83 A;  4PQ0 A;  1TTN A;  2KQ4 X;  3BVZ A;  3QHT A;  3ZNH B;  3TIX A;  5AZF A;  1WYW B;  1VCB A;  2RPQ A;  2DHJ A;  2GBK A;  4HSI A;  3P6A A;  2LBB A;  3HK0 A;  2OJW A;  2W9N A;  3U30 A;  2LGY A;  3GOE A;  4GGQ A;  4URK A;  1R4N B;  3UQA A;  5AZH A;  4AJW A;  2MQJ A;  1WWT A;  2WU2 B;  1U5D A;  2YT1 A;  1NEN B;  5DPT A;  3CIR B;  2LHD A;  4G11 A;  3ZRC A;  3BYY B;  1I35 A;  2C9W B;  5HI1 A;  4GDK B;  1X1F A;  4MM3 B;  4BAX A;  1HQR D;  3Q14 C;  2R0D A;  3PSC A;  3MPX A;  4BFR A;  3PTF C;  4FLH A;  4DK5 A;  1TZ1 A;  4JQW C;  1X86 A;  3BIN A;  2HE7 A;  1I4H A;  2JY6 A;  3T06 A;  2ZVO A;  2IGG A;  3AH7 A;  5GXG B;  1D4B A;  1HEZ E;  1J8C A;  5C5B B;  4RH6 A;  4XDC A;  5L81 A;  1CMX B;  4BKS A;  1XR0 B;  2ON8 A;  2AQ2 B;  3Q3M C;  4NZL B;  4A20 A;  3D8F A;  2HTH A;  3ZJU A;  3QK0 A;  1SHC A;  1VZ6 A;  3X23 A;  1IRS A;  1TBE A;  3MC9 A;  4HLE A;  1MG4 A;  2DKQ A;  1C3T A;  2DZM A;  2VSZ A;  2HRJ A;  2MBB B;  4F7Z A;  4YSX B;  2I5C A;  2VH2 A;  5HG2 A;  5G2N A;  2BF8 B;  3DXE A;  5EE1 A;  2FBW B;  3BVG A;  2G9H D;  1EM7 A;  1R4N I;  1GGO A;  2IY1 B;  3MDB C;  3FC4 A;  2E3T A;  2ICI A;  4ILG B;  3DCG A;  2PKO A;  1FCC C;  2X18 A;  1YD8 U;  2MX2 A;  4MH0 E;  1A70 A;  1H4R A;  2N1V A;  3Q69 A;  4JE3 B;  5C79 A;  2L0T A;  4C56 C;  4MK0 A;  5DPW A;  2I38 A;  2NBV A;  2JUO A;  2PVO D;  3JW0 X;  1JAL A;  2NPT B;  4LNK A;  3RUL A;  1TY2 A;  1GB4 A;  1GG3 A;  2M14 A;  3A58 A;  1G6J A;  1FGZ A;  3E56 A;  1TS3 A;  4MSM B;  1NYR A;  2N9P C;  2FID A;  4M8N A;  1M7E A;  4ANU A;  2KTR A;  5HE1 A;  2IBI B;  4K3B A;  2L3Z A;  4LDT B;  4HAU B;  3TEX A;  3VH3 B;  3TW1 A;  4DHJ B;  3M62 B;  1GAQ B;  2KJH B;  4B6H A;  1V80 A;  1XLO A;  3KSY A;  1L7Y A;  2ZVN A;  2Z0Q A;  5C16 A;  2WX1 A;  1WVH A;  4KAX B;  4F7G A;  5BMH A;  4DX8 A;  4O1N A;  5MPO A;  4NAM A;  2LD9 A;  3VUX A;  1SIF A;  5DPS A;  1WGG A;  4QJ4 B;  4FBJ B;  1GNU A;  3T3O A;  2PTL A;  4A6H A;  5E6P A;  3R2I A;  1VRA B;  1B55 A;  1OFF A;  2D07 B;  2N0S B;  3AEB B;  3EHV A;  2NVU I;  4FA6 A;  2IDY A;  4TUU A;  3R2T A;  2L52 A;  3A4S C;  3ECI A;  3IHP C;  2AQ1 B;  1WJ6 A;  1YJI A;  5JHH A;  5DI9 B;  2N9E B;  1YQ3 B;  1L4D B;  2JRH A;  1FNU A;  1OEY A;  4M8M A;  1UNR A;  2L7R A;  2WLB A;  1AQC A;  1UH6 A;  5JZE B;  3E9P A;  4OZB A;  4FJV B;  3ETR A;  2N7D A;  1Y5O A;  2V1Y A;  4YSY B;  1P0R A;  3ZNG C;  2AEH A;  3EUB 2;  1SIJ A;  2D5G A;  3R7Q A;  2IO1 B;  2BVC A;  4F1S A;  3GZN I;  4I6P A;  4RFB A;  2ZNV C;  5IRS A;  1LB1 A;  4EZK A;  3AED B;  4K7S A;  1U4A A;  1LFD A;  1T77 A;  2RVB B;  2JF5 A;  2NBW B;  3NZS A;  2LUE A;  1FOE A;  1XLP A;  1LM8 B;  1PDX A;  3IAM 1;  2NZ8 B;  1V9J A;  1N62 A;  1P3Q U;  3ZQ4 A;  1HBK A;  1WM3 A;  1QOA A;  4HAX B;  4P1B C;  1C9F A;  4C4V A;  2RQ1 A;  3A9K B;  4MGK E;  4A6F A;  1NVI D;  2AWT A;  5DHA B;  2WU5 B;  3VR8 B;  2DYO A;  3VOQ A;  2N23 A;  1SF0 A;  1CK1 A;  1NTV A;  3G9W A;  1LW3 A;  1YN5 A;  1H8C A;  4J6I A;  5FI1 A;  2Y3A A;  4WWO A;  2N9L A;  1FCL A;  1OQQ A;  3UF8 A;  3RNB C;  2KXJ A;  4OVZ A;  3NVZ A;  1ZM0 A;  2M17 A;  4Y94 A;  2MBH A;  2WXH A;  3O96 A;  4H2A A;  1IPG A;  3IVF A;  2KD0 A;  3ZXR A;  4UDU C;  1SXT A;  1VD2 A;  2PE6 B;  3WAM A;  3H7S A;  5G5G A;  5J2R A;  4DWF A;  1E8W A;  3N7C A;  3AE6 B;  4L23 A;  4KIK A;  4LDT D;  1W1D A;  3KLS X;  2CKH B;  2R82 A;  2AX5 A;  5FI0 A;  1QIL A;  4DHJ D;  1E6E B;  1NU2 A;  4OSN A;  2JWU A;  1V97 A;  1I7A A;  4WJ7 A;  1FHX A;  4K7U A;  1VBH A;  1BT0 A;  3RMK C;  2FCN A;  2JT4 B;  5IAA C;  4DQO C;  4OZC A;  4IWQ A;  3AE1 B;  1XF5 L;  3F5R A;  3S2A A;  3A4R A;  3IBE A;  4KHB A;  1P3R A;  3WIM A;  2W2W A;  4E74 A;  3DCX A;  1V2Y A;  2WWZ A;  2CHX A;  2ZNV B;  1TQZ A;  1JW9 D;  4RNA A;  3M63 B;  3FIL A;  2I1K A;  1MK9 B;  2G45 B;  3H6N A;  1B9R A;  1SB3 C;  2AQ3 B;  3T9L A;  2DYQ A;  2M4N A;  3UIN B;  4IDI A;  4IC7 B;  3SNH A;  2K5P A;  2H88 B;  1EO6 A;  3A33 B;  4ANV A;  4AQ7 A;  3D32 A;  2CY4 A;  1KLV A;  3KWL A;  2RDB C;  4HKZ E;  3W2D A;  1P7E A;  4MT5 A;  2KMM A;  4BOS C;  1E10 A;  3MC8 A;  3HQC A;  2O6V A;  3VAW A;  1DBH A;  2D4Q A;  1NTY A;  2MA9 B;  3KVF B;  3M95 A;  3Q8B A;  5AEK B;  3ZRF A;  2HJ1 A;  2GBM A;  1IBX A;  1HA5 A; 
#chains in the Genus database with same CATH homology
 3QX1 A;  4IM0 A;  3RD2 A;  1WJU A;  5GMV A;  4KDI C;  2ABD A;  3X0W A;  3WAN A;  5KHO A;  1Q0W B;  1W1H A;  2Y8G A;  3HW2 B;  4WAA A;  2ZEQ A;  1D3Z A;  1YX6 B;  3H9D A;  4A5K A;  2JWZ A;  4BOZ B;  1KBL A;  2N9X A;  2VRW B;  4IW0 A;  1WE7 A;  3WYF B;  2LXA A;  3PRP B;  1PLS A;  4GN1 A;  4KHA A;  3DBR I;  3ZKJ C;  5C23 A;  1XKE A;  2W2X C;  3C0R B;  1NTI A;  3L13 A;  3NHE B;  2DX5 B;  2DYB A;  4WWN A;  1Z87 A;  1WX7 A;  1WXV A;  5LLI A;  2EKE C;  2NR2 A;  2NBU A;  1KZ7 A;  2ZJD A;  3V5W A;  3N3K B;  4JLC A;  3L10 B;  3ML8 A;  2ASQ A;  2FIF A;  1NI2 A;  2KN5 A;  2GOW A;  2KDE B;  2L00 B;  1RFA A;  3QC8 B;  2C7N B;  1U27 A;  5TR5 A;  3PV1 A;  3HHM A;  4RMA A;  2UWQ A;  2UYZ B;  3QQ8 B;  4IWO A;  4GOC A;  2J0M A;  4MGY E;  2FDQ A;  1OMW A;  4K81 A;  2D9Y A;  1J0G A;  5KQ4 A;  3UZT A;  4JKE A;  1V6E A;  1EF1 A;  2K1F A;  4W9L A;  1P5T A;  1P98 A;  4G0N B;  4NQL B;  4PS3 A;  2LOX A;  4DBG A;  2PJH A;  3U7D A;  4AP4 C;  3DVN U;  5D3Y A;  3ULB A;  2JP2 A;  2Z0E B;  4MJS A;  2KFK B;  5CTR C;  3VVW B;  3ZW3 A;  1P9D U;  4B9K A;  2O2V B;  3AJ4 A;  3A1Q A;  1FHW A;  5J18 A;  1BTK A;  3PRE A;  2NS5 A;  2N0Y A;  3KRX A;  4G3X B;  3VH4 B;  2KVR A;  4NJ7 A;  1ZC4 B;  2WDT B;  1UEF A;  2IO3 B;  1YIW A;  1S1Q B;  2MP2 A;  2L05 A;  4LCD E;  2DX1 A;  1R4M I;  3PT2 B;  4F8C B;  3FP5 A;  4FUL A;  1BTN A;  1U5F A;  1K8R B;  1WH3 A;  2KUP A;  1UEL A;  1TGZ B;  3Q3J A;  1TJ6 A;  1PMS A;  4HHV A;  3ZDT A;  5JHG A;  2WX0 A;  3KZ1 A;  2P0F A;  2R2O A;  4HCP B;  1OQN A;  3RT3 B;  2J0J A;  4HB3 B;  3L16 A;  1UNQ A;  3KYD D;  5HKH A;  1RLF A;  3KY9 A;  2YRY A;  2DA0 A;  4GDK A;  2G4D B;  4DX9 0;  4MM3 A;  2DZK A;  2Y8F A;  4HVB A;  2KDI A;  4HB2 B;  3KUZ A;  4KDL B;  3QBV B;  1E8Y A;  1P1A A;  4HPL B;  2OOB B;  2MCN B;  2LRW A;  4NY0 A;  4GSW A;  3PHW B;  3TJP A;  5C5B A;  1X11 A;  2IO2 B;  1E8Z A;  2JZZ A;  3LJU X;  3DVN V;  1U5E A;  4PS8 A;  2YSZ A;  4XWX A;  3FLV A;  2DAF A;  2KWU B;  2XK5 B;  4CYE A;  2PPH A;  4G50 A;  4GMV A;  1EAZ A;  1XT9 B;  3M1I B;  1SE9 A;  3AUL A;  1WJN A;  1FHO A;  5LOP B;  5CHF A;  3ZDM C;  1ZSQ A;  2DKP A;  3PRM B;  4JK9 A;  3DBS A;  4GU2 A;  4W9D A;  2LUL A;  2QKL A;  2J7Q B;  5J3T A;  2P0D A;  4W9F A;  1J19 A;  2ADZ A;  3ZVR A;  3DBH I;  3K9P B;  4BKT A;  4ZDV A;  2ELB A;  2L76 A;  3ODW A;  3OAN A;  1NDD A;  1KC7 A;  2XEW A;  1DRO A;  2CU1 A;  3SHQ A;  4KSL C;  3SV1 A;  5LXI B;  3ZTC A;  2C7H A;  4DDG D;  1MAI A;  2EMT A;  2DLW A;  2R2Q A;  3JSV B;  2W2X D;  1WX9 A;  2K00 A;  4BKG A;  1BAK A;  4W9G A;  2BPS A;  4PYU A;  3QJZ A;  4EOY A;  2A4Z A;  4MEM A;  1WXM A;  2L8J A;  2DYN A;  4W9J A;  4F7H A;  3VIA A;  2KMC A;  4JK7 A;  1OY2 A;  5KQ1 A;  5D94 A;  1W1G A;  2OQB A;  3VXW A;  4K17 A;  5LON B;  3HM6 X;  1WZ0 A;  3GYO A;  5C6R A;  3HM3 A;  1M94 A;  4ILH A;  4A6K A;  5DHF B;  1AWE A;  2DZJ A;  1V49 A;  2UZS A;  4JKB A;  2YS1 A;  1XCG A;  2MLB A;  4XC2 A;  1WJ1 A;  1V5O A;  1V81 A;  3KW5 B;  1V5U A;  3AXC A;  2L1C A;  2KKC A;  4YL8 A;  3TFM A;  3VUY A;  2RGN B;  2K8H A;  1X1G A;  3PPA A;  4B6W A;  2RSU A;  3PLV A;  2FCQ A;  3PVU A;  4RM9 A;  3TMP B;  4DHZ B;  3UIO B;  1P6S A;  3NS8 A;  3DDC B;  3A9K A;  2GS0 A;  3EFU A;  1NVL A;  1DYN A;  4Z2N A;  2KTR B;  4EJN A;  2COP A;  2ZCB A;  2KJR A;  1EVH A;  3ODO A;  3VDZ A;  4ICU A;  2H7D A;  2YS5 A;  2B3A A;  4XZ4 A;  2GBR A;  3QAR A;  2G4S A;  1WMH B;  3DVG Y;  1LXD A;  3QIJ A;  1E8X A;  3RCP A;  4NAW B;  2YF0 A;  3ML9 A;  4FHJ A;  1GJZ A;  3PG7 A;  2DZI A;  3ML4 A;  5EFX A;  3KUC B;  4NPN A;  1V89 A;  1E90 A;  1UBI A;  4OVU A;  3NSU A;  3PVL A;  2LZ6 A;  4X57 B;  4WQO B;  1E7U A;  5J17 A;  3ODX A;  1UGM A;  3L0W B;  2K2U A;  1EF5 A;  3OLM D;  4GDL B;  4II2 B;  2V4L A;  2KWC A;  3KH0 A;  1WZ3 A;  2IZV B;  4HJK A;  1OTR B;  1I42 A;  1TXD A;  2EMS A;  4HAT B;  3O65 B;  3ZNI D;  5HE3 A;  2PE9 A;  3R7R A;  2GBJ A;  1U29 A;  2D9Z A;  1I2H A;  3JVZ X;  2YVC A;  4LJP B;  2K8C A;  1ST7 A;  4WVF B;  4NNJ B;  5E6N A;  4DBB A;  3V60 A;  3V61 A;  4ZRJ A;  1UPQ A;  2H7E A;  3L08 A;  2RGF A;  3PRZ A;  2AL6 A;  4HAY B;  3PLU A;  2G35 A;  1NBF C;  4AJY B;  4ZRK A;  2KGX B;  2JVC A;  4K1R B;  3NY5 A;  4K7W A;  2LG1 A;  4KVG B;  2CQU A;  1A5R A;  4KZC A;  3OJ3 A;  2MDX A;  3WAO A;  4EZJ A;  2KCJ A;  3N30 A;  4MEL A;  1OEY J;  4I6L B;  2DX5 A;  3PZD A;  4Z2M B;  1XQQ A;  4FJZ A;  3KYC D;  1MG8 A;  1V86 A;  3SDL C;  3BY4 B;  2DFK A;  3BJI A;  1PFJ A;  4GPT B;  3IFW B;  4BVU C;  5D7G A;  2MSE D;  3KRW A;  2L0F A;  2KFJ A;  3TL5 A;  2N4F A;  2CRF A;  5DH9 B;  3IG3 A;  5CLQ B;  1XD4 A;  4DHZ E;  1MK7 B;  3ENE A;  3UIP B;  4B95 A;  2LVO A;  2N1W A;  1U5G A;  4YON A;  1ZKH A;  1ISN A;  1MPH A;  2M1M A;  4HCN B;  2P8V A;  2CY5 A;  4I6N B;  2GCJ A;  2KC2 A;  1ZC3 B;  4PS7 A;  2IY0 B;  1WGD A;  4BBN F;  3WA0 A;  4HAV B;  1ZGU B;  2JRI B;  1ZVR A;  3H1U A;  4GZU A;  1XOD A;  2KNB A;  2FAZ A;  2KFK A;  2BWE S;  1KJT A;  4HWI B;  1V5M A;  3P7Z A;  5HE2 A;  2KZR A;  3A8Q A;  4CHJ A;  2O2V A;  3PP2 A;  1WM2 A;  5LXH A;  2Y7B A;  3DQV A;  4JIO U;  4F7U P;  2D11 A;  1X05 A;  1QC6 A;  4JKF A;  4ZRI A;  3VQI A;  2LWP A;  1PQS A;  4IUM B;  4E3C A;  3GYP A;  2DHK A;  2COF A;  3NOB A;  1MKE A;  2GBN A;  1HB6 A;  2COD A;  4MSQ B;  2EC1 A;  2BGF A;  1UNP A;  2XQN M;  4HDO A;  3ZNZ B;  1VBG A;  5DPR A;  4JKG A;  5JLJ B;  5JHB A;  2NMB A;  2UVM A;  2FJL A;  4K2P A;  1JDE A;  3TVV A;  2RUK B;  3ZUN A;  3ZVV A;  5D2M B;  4KHO A;  2CS4 A;  2CHW A;  2M0X A;  3V6E B;  4IOY X;  3A9J B;  2GMI C;  2AYO B;  2YLM A;  3E66 A;  4W9E A;  2KLG A;  1BWN A;  4KV2 A;  3I3T B;  2DTC A;  2DHZ A;  2CHZ A;  2C5L C;  2DHI A;  4W9C A;  1LQB A;  5DCN A;  2Z59 B;  1Y8R C;  1E7V A;  4EZL A;  5CX3 A;  2RLO A;  1Q67 A;  5KCV A;  2YT0 A;  4WSF A;  3ONS A;  1WI1 A;  3W1S A;  2N7E A;  5CHW A;  3DBL I;  2KHW B;  2I1J A;  2DYM A;  1H10 A;  2XK5 A;  3FM8 C;  3A1Q B;  5JP4 A;  3D8E A;  4FAD A;  2IYB A;  2K2J A;  1UBQ A;  2D3G A;  4JKD A;  2FCM A;  3L17 A;  2KX3 A;  1WGH A;  3FSS A;  3H7P B;  1YX5 B;  4II3 B;  2KTF A;  5D3W A;  1DDM A;  4EEW A;  1QQG A;  3V6C B;  4A3P A;  4JKC A;  2D9X A;  4E71 A;  4EFO A;  1OGW A;  3VTV A;  2WYQ A;  1WGR A;  2OJR A;  2K39 A;  2ZCC A;  1KZG A;  3QAQ A;  1J0W A;  5JVL A;  3JSV A;  1U2B A;  2V76 A;  1ZW7 A;  3PVW A;  1WX8 A;  4HDQ A;  3FEH A;  5BO4 B;  4WJQ A;  5E6O A;  1DDV A;  3L54 A;  4NSW A;  3RUI B;  1WFY A;  2BYE A;  4KZ0 A;  3QWM A;  4BBN C;  2NPT A;  2CB8 A;  2A5U A;  4FJY A;  1HB8 A;  1FGY A;  1C1Y B;  2GCL A;  1MIZ B;  2J0K A;  2LVP A;  2V3S A;  3KUD B;  1DIK A;  3QCA A;  4W9I A;  1MIX A;  2UZR A;  2BYV E;  4N9F 4;  4WJO A;  1JRU A;  3SYX A;  3WAL A;  3WAP A;  2LVQ A;  2BYF A;  4IM3 A;  1WR6 E;  3ALB A;  3RYT A;  1FXT B;  2HTH B;  3QWZ B;  2D9V A;  2MBO A;  1WIA A;  5GOW B;  1Z2M A;  2IO0 B;  2FCS A;  3EPY A;  2LOZ A;  4L6E A;  3R66 C;  3DOW A;  2L2I A;  2LGD A;  4CO7 A;  1FAO A;  4DXA B;  5L95 C;  2KDF B;  3AU4 A;  3CMM B;  2NCN A;  2KC1 A;  3JYU A;  3SBG A;  1Z5S B;  3CXB B;  4JKA A;  3ENB A;  2Z0P A;  3CST A;  2COA A;  1ACA A;  4H8S A;  1WJ4 A;  2LI5 A;  4HK2 A;  2MKR A;  4C0A A;  2M38 A;  4WJN A;  4EMO A;  1K5D B;  1WMH A;  2GJY A;  2K6Q A;  2JXX A;  5J3Q A;  3LDZ E;  4ANW A;  2JPH A;  4GIV A;  2NBV B;  1FB8 A;  1E5W A;  4HB4 B;  2IFS A;  4PNK A;  1WG7 A;  4NAW A;  1UD7 A;  1RAX A;  3UGB B;  2HD5 B;  3TBL D;  2QHO A;  1KM7 A;  2J59 M;  2QKM A;  2REX A;  4MGZ E;  4GB9 A;  2K8B A;  3SD5 A;  2ROV A;  5D3V A;  1DDW A;  4KSK C;  2Z0O A;  2RD0 A;  3RCZ A;  1WGU A;  1GUA B;  2MBE A;  3MJW A;  4GDL A;  2IYD B;  3CF6 E;  3EEC A;  2MWN B;  1WRD B;  1WGY A;  2AL3 A;  1M7R A;  2KWV B;  4IM2 A;  5J3Y A;  2C60 A;  4ANX A;  4TYZ A;  2WH5 A;  2ZPY A;  5C1Z A;  4TQ1 A;  3VFK A;  2KJ6 A;  4A3O A;  5EDS A;  3DVG X;  4IWP A;  1RRB A;  4MY6 A;  2DN6 A;  2DIK A;  3R3M A;  3PHX B;  2K25 A;  4NQK E;  4CHM A;  4BKS D;  4EKU A;  3DPD A;  1RRP B;  5FR6 A;  2LGX A;  3DXC A;  1KOT A;  2EJ8 A;  3RZF A;  4FHK A;  1V5P A;  4A6F B;  4W9H A;  1UPR A;  3HIZ A;  4GMX B;  2BCJ A;  4HAW B;  1V61 A;  3D8D A;  4BBK A;  2M8S A;  4P7I A;  2CAY A;  4JGH B;  1X1M A;  1OQY A;  2LYD A;  2ZZP B;  5CLL B;  1UZX B;  5JH5 C;  1QZE A;  1T0Y A;  4WJP A;  1XX0 A;  1L2N A;  1GC6 A;  2ZPN A;  3TO1 A;  4KIK B;  3B1L X;  2ROZ B;  2FJ9 A;  4XX5 A;  2X0S A;  3CIK A;  2YS3 A;  2KAN A;  2BWF A;  2RR9 A;  2VRR B;  2RNR B;  4HAZ B;  3EC8 A;  2KQ7 A;  4MGI E;  4KHB B;  2G3Q B;  2JZ3 B;  2Z0D B;  2PZ1 A;  1AAR A;  2KMA A;  3APC A;  1EGX A;  1WJM A;  4HB0 B;  2HJ8 A;  4PYZ A;  2D2Q A;  5KHQ A;  4JK8 A;  1HE8 A;  2K6D B;  3QA8 A;  4EUT A;  3NZU A;  2RSG A;  2O6V B;  3ZIM A;  3E9O A;  2C7M B;  3MTN B;  2MFQ A;  4JL9 A;  3K9O B;  2MRP A;  3B0A A;  4ICV A;  5DIF B;  4M0W B;  3ULC A;  3VTU A;  1KI1 B;  2D9W A;  2P0H A;  1Q1O A;  4ILJ A;  3SUZ A;  4RM8 A;  4IAP A;  3U8Z A;  1K5G B;  2R09 A;  4ASW C;  2COC A;  5HE0 A;  3RZW C;  2ELA A;  4NJ6 A;  1WXA A;  1S3S G;  1EUV B;  4CHK A;  2KLC A;  2FUH B;  3V62 A;  3T8M A;  2LJ5 A;  4AOF A;  2LXC A;  4D0N B;  3SBT A;  3CSF A;  3N32 A;  4HXD A;  1WI0 A;  2VKI A;  2KDB A;  3M3J A;  3VUW A;  3A9J A;  3F0W A;  2BKF A;  4AWJ A;  4WWP A;  4TQ0 A;  3ZLZ A;  5IA7 A;  1XD3 B;  1WGQ A;  1WY8 A;  4JKH A;  4TV3 A;  3DXD A;  3PEG A;  3PGE A;  1V5T A;  4W9K A;  5D3X A;  4LJO B;  3SU8 X;  3W1S C;  1Q5W B;  1F9J A;  1WXS A;  3Q3F A;  3B08 A;  1YQB A;  3AI5 A;  2OTX A;  4MDK E;  1IYF A;  3UQB A;  2PEA A;  5D27 A;  2KK8 A;  5JHA A;  3SO6 A;  3PS6 A;  2DAJ A;  5D6J B;  1WE6 A;  2KX0 A;  3A8P A;  1Y19 B;  1YJ1 A;  1SGH A;  5AZG A;  5CHV C;  1WR1 A;  2MWS B;  1RJ2 A;  4ZYN A;  4K2O A;  3H7P A;  5G55 A;  1WF9 A;  4OVV A;  3VTW A;  4TKN A;  2Y5B B;  2LKO A;  3W1Y A;  3MHS D;  2LRU A;  4MJS B;  3A98 B;  4AUQ C;  2Q13 A;  3P2B A;  2BKR B;  4JKG B;  3E9L A;  3AU5 A;  1GC7 A;  3ZO5 B;  2O6V D;  2I5F A;  4MT7 A;  3PSE B;  5IJM A;  4IG7 B;  1IP9 A;  2FNJ B;  2KQS A;  3ZTD A;  2KOX A;  2DEN B;  2CR5 A;  4IFS A;  4HPM B;  2LAS A;  2MBQ A;  2E2X A;  2KO3 A;  2MP2 B;  2D10 A;  2MW5 A;  3LJ3 A;  3OAW A;  4FN2 A;  3VHT C;  3APF A;  1N3H A;  3APD A;  3OJ4 B;  4GXB A;  2XBB C;  4DDI D;  1V88 A;  3TCA A;  5L83 A;  4PQ0 A;  1TTN A;  3ZNH B;  3QHT A;  3TIX A;  5AZF A;  1WYW B;  1VCB A;  2RPQ A;  2DHJ A;  2GBK A;  3P6A A;  2LBB A;  3HK0 A;  3U30 A;  2W9N A;  2LGY A;  3GOE A;  4GGQ A;  4URK A;  3UQA A;  5AZH A;  4AJW A;  2MQJ A;  1U5D A;  2YT1 A;  5DPT A;  4G11 A;  3ZRC A;  1I35 A;  2C9W B;  4GDK B;  1X1F A;  2R0D A;  3PSC A;  3MPX A;  4BFR A;  3PTF C;  4FLH A;  4DK5 A;  1TZ1 A;  4JQW C;  1X86 A;  3BIN A;  2HE7 A;  2JY6 A;  3T06 A;  2ZVO A;  1J8C A;  5C5B B;  5L81 A;  1CMX B;  4BKS A;  1XR0 B;  4A20 A;  3D8F A;  2HTH A;  3QK0 A;  1SHC A;  3X23 A;  1IRS A;  1TBE A;  4HLE A;  2DKQ A;  1C3T A;  2DZM A;  2VSZ A;  2HRJ A;  2MBB B;  4F7Z A;  2I5C A;  5G2N A;  2BF8 B;  3DXE A;  1R4N I;  1GGO A;  2IY1 B;  3MDB C;  4ILG B;  3DCG A;  2X18 A;  1YD8 U;  2MX2 A;  4MH0 E;  1H4R A;  2N1V A;  5C79 A;  2L0T A;  5DPW A;  4MK0 A;  2JUO A;  3JW0 X;  2NPT B;  3RUL A;  1GG3 A;  2M14 A;  1G6J A;  1FGZ A;  4MSM B;  2N9P C;  2FID A;  4M8N A;  1M7E A;  4ANU A;  2KTR A;  5HE1 A;  2IBI B;  2L3Z A;  4LDT B;  4HAU B;  3VH3 B;  3TW1 A;  4DHJ B;  3M62 B;  2KJH B;  4B6H A;  1V80 A;  3KSY A;  1L7Y A;  2ZVN A;  2Z0Q A;  5C16 A;  2WX1 A;  1WVH A;  4KAX B;  4F7G A;  4DX8 A;  2LD9 A;  3VUX A;  1SIF A;  5DPS A;  1WGG A;  4FBJ B;  1GNU A;  4A6H A;  5E6P A;  1B55 A;  2D07 B;  3EHV A;  2NVU I;  4FA6 A;  4TUU A;  3A4S C;  3ECI A;  3IHP C;  1WJ6 A;  2N9E B;  5JHH A;  5DI9 B;  2JRH A;  1OEY A;  4M8M A;  1UNR A;  2L7R A;  1AQC A;  1UH6 A;  5JZE B;  3E9P A;  4FJV B;  2N7D A;  1Y5O A;  2V1Y A;  1P0R A;  3ZNG C;  2AEH A;  3R7Q A;  2IO1 B;  4F1S A;  3GZN I;  4I6P A;  2ZNV C;  1LB1 A;  4EZK A;  4K7S A;  1U4A A;  1LFD A;  2RVB B;  2JF5 A;  2NBW B;  3NZS A;  2LUE A;  1FOE A;  1LM8 B;  2NZ8 B;  1V9J A;  1P3Q U;  1HBK A;  1WM3 A;  4HAX B;  2RQ1 A;  3A9K B;  4MGK E;  4A6F A;  2AWT A;  5DHA B;  2DYO A;  3VOQ A;  2N23 A;  1NTV A;  3G9W A;  1LW3 A;  1H8C A;  4J6I A;  5FI1 A;  4WWO A;  3UF8 A;  2KXJ A;  1ZM0 A;  2M17 A;  4Y94 A;  2MBH A;  3O96 A;  1IPG A;  3IVF A;  2KD0 A;  1VD2 A;  2PE6 B;  3WAM A;  3H7S A;  5J2R A;  4DWF A;  1E8W A;  3N7C A;  4KIK A;  4LDT D;  1W1D A;  2CKH B;  2R82 A;  5FI0 A;  4DHJ D;  1NU2 A;  1I7A A;  4WJ7 A;  1FHX A;  4K7U A;  1VBH A;  1BT0 A;  2FCN A;  2JT4 B;  5IAA C;  4IWQ A;  3S2A A;  3F5R A;  3A4R A;  3IBE A;  1P3R A;  3WIM A;  2W2W A;  4E74 A;  1V2Y A;  2WWZ A;  2CHX A;  2ZNV B;  1TQZ A;  3M63 B;  2I1K A;  1MK9 B;  2G45 B;  3H6N A;  3T9L A;  2DYQ A;  2M4N A;  3UIN B;  4IC7 B;  3SNH A;  1EO6 A;  3A33 B;  4ANV A;  3D32 A;  2CY4 A;  1KLV A;  4BOS C;  3HQC A;  2O6V A;  3VAW A;  1DBH A;  2D4Q A;  1NTY A;  2MA9 B;  3KVF B;  3M95 A;  5AEK B;  3ZRF A;  2GBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...