2ZPYA

Crystal structure of the mouse radxin ferm domain complexed with the mouse cd44 cytoplasmic peptide
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for CD44 recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 87
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2zpyA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2zpyA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zpyA01
2PZ1A 3P7ZA 3ULCA 2CB8A 2D9WA 3ZTDA 3UF8A 4JL9A 5EFXA 4DX8A 4W9KA 4LJOB 2FIFA 1X11A 3H7PB 3M62B 3G9WA 1XX0A 2JPHA 5L95C 2WX0A 3PT2B 2MBEA 1UNPA 2I5CA 2KHWB 2R2OA 3ODWA 2XBBC 3RT3B 2MCNB 2O6VD 3DVGX 2YLMA 1XT9B 5C5BA 2D07B 2COCA 5L81A 4A6FB 2KJ6A 2KX3A 4NJ6A 5JHAA 4AWJA 4F7HA 1KZGA 5HKHA 4WWNA 1IYFA 4MT7A 2RQ1A 1U2BA 2LKOA 5CLLB 3F0WA 1Z87A 4B6HA 2C7NB 3ULBA 4KHOA 4WVFB 1TGZB 4AOFA 3APDA 2KTRA 5CHFA 2R2QA 2GBJA 2LULA 2C7HA 2IYDB 1FOEA 2FNJB 4HAZB 1AQCA 1BT0A 2WYQA 2VKIA 3I3TB 3JYUA 4W9GA 2DAJA 1Y5OA 2OJRA 1LM8B 1XD4A 1WRDB 3CSFA 3VIAA 2DFKA 3ML4A 1WR1A 3H7SA 4HCPB 4MDKE 3QHTA 4ASWC 2FDQA 2O6VB 3PPAA 3QK0A 5J3QA 1WZ3A 3ODXA 1Z5SB 2BYVE 2MWSB 1L7YA 1SIFA 3WAOA 5JHBA 3TMPB 2ZPYA 2V76A 4W9JA 3T8MA 3PVUA 3K9PB 4ANVA 2DKPA 2D4QA 3ZO5B 2J7QB 4WAAA 5C6RA 3GYPA 2ZCBA 3VUXA 4DWFA 3NZUA 4WJQA 2CKHB 4XZ4A 4N9F4 2K1FA 3SU8X 5DHAB 3PGEA 3ZLZA 4CO7A 1A5RA 3ODOA 4Z2MB 2JY6A 2DX1A 3DVGY 1WJUA 3PV1A 3V61A 2NVUI 3TJPA 3SO6A 2K25A 1U29A 1UBQA 2YS1A 4PS3A 1V6EA 1MAIA 3OANA 1WXMA 2DAFA 1AARA 1R4MI 5JHGA 2VSZA 2W2WA 1U5EA 5KQ4A 1YQBA 2UZRA 4HB4B 5LXHA 4W9FA 2JRHA 3PREA 1WGDA 2WWZA 4ICVA 3GOEA 3R7QA 2ZJDA 3ZDTA 1XR0B 2CQUA 3KZ1A 1J19A 2GCLA 1V5PA 1NTYA 4K2PA 4JGHB 4MELA 1WMHA 4LCDE 3ZNID 4EOYA 3V5WA 3B0AA 3EPYA 3FP5A 2LOZA 1FAOA 1WM2A 2YSZA 1P5TA 5TR5A 3ZRFA 2G45B 1DBHA 2XEWA 1PLSA 2AL6A 4FA6A 1RAXA 5G55A 2L05A 4ZYNA 4HAUB 1WXSA 2K8HA 2L76A 2IO2B 3HHMA 4IG7B 4KV2A 3MDBC 4NNJB 5GMVA 1WI1A 3HM6X 3JW0X 5KHOA 1ST7A 4A3PA 4KAXB 3DDCB 1MK9B 2EMSA 2LOXA 3PEGA 4GZUA 4TV3A 1U5DA 5LOPB 4G0NB 4MGKE 2XK5B 1KLVA 2J0KA 5FI1A 5HE2A 1V5UA 2LASA 2K2UA 4HXDA 3U8ZA 1Q67A 5CLQB 2OQBA 2JVCA 4WJNA 4BOSC 4BKGA 2WDTB 2ZVNA 2KN5A 4WSFA 5D27A 3WA0A 1W1DA 1WGRA 3CSTA 4WQOB 4NSWA 1E7UA 1UNRA 1WX8A 2MBOA 1OQYA 3OAWA 2Z0OA 3PTFC 2R0DA 4EKUA 4EMOA 4MM3A 2HRJA 2MP2B 4CHJA 1UNQA 1M94A 2C60A 3L54A 5CX3A 4AUQC 1UPQA 3A33B 5CHVC 3FM8C 2IZVB 3D8EA 4HHVA 4P7IA 1R4NI 3P6AA 2M4NA 5DPRA 4A3OA 1RRPB 1V9JA 4CYEA 4JQWC 2KDBA 1Q5WB 4BKTA 1ZKHA 3PRMB 3Q3JA 2L00B 4HB3B 3VTUA 4DHJD 2K8CA 4GDLA 1UD7A 2CS4A 2VRWB 3DBRI 4KSLC 3UIOB 1WF9A 2BCJA 2KGXB 4KIKA 3X0WA 1WGUA 2YT1A 1BAKA 2O2VA 4TUUA 1OY2A 1WI0A 1UELA 3V6EB 3KYCD 2KVRA 2VRRB 2J0JA 4W9EA 3W1YA 1K8RB 5DIFB 5C1ZA 4GDLB 2Y8FA 5JP4A 1EVHA 4HB2B 1P1AA 5DHFB 5E6OA 1P9DU 4GN1A 1WM3A 4EUTA 2KQ7A 2BKFA 1WGYA 2CR5A 2LWPA 3AU5A 1WE7A 2FUHB 3KUDB 4HPMB 1MKEA 3IVFA 3L17A 4PS7A 4DHZE 2NZ8B 4KSKC 1NBFC 2MRPA 4LDTB 2DYOA 1LB1A 3L0WB 4E71A 2O6VA 2ABDA 2FCQA 2KD0A 3DVNU 4RM8A 2KANA 1N3HA 2AL3A 2ZPNA 2DX5A 1K5GB 4FHJA 1ZVRA 5DCNA 4MK0A 5DPWA 5KQ1A 3M95A 3KUZA 2KUPA 3ZVRA 1WJ6A 3LJUX 4HAYB 2IO0B 3M63B 1LQBA 2KTFA 3K9OB 4NAWB 5D2MB 3RYTA 1SE9A 2ZNVB 4PYZA 1V88A 4GDKB 4XWXA 4KZCA 5DPTA 4RMAA 4DX90 5AZHA 3QJZA 3NHEB 2GS0A 5J3YA 2FCMA 4FULA 5LXIB 4EEWA 4TYZA 1WY8A 2L0TA 2QKLA 2M17A 3BJIA 3A9JB 3DOWA 3KH0A 5LLIA 1RFAA 1WXAA 2CAYA 3L13A 2YF0A 2IY0B 1FXTB 2K6DB 1OQNA 1H4RA 2IFSA 2HD5B 2BF8B 2AEHA 3KRWA 2WX1A 3DQVA 4X57B 3ZRCA 1UH6A 3BINA 2G3QB 3A4SC 2ADZA 2NMBA 3EHVA 4PS8A 1ISNA 3DXDA 2ASQA 3RULA 4BVUC 4HDQA 2C9WB 1WJNA 2CHZA 4K81A 4F1SA 3IHPC 4AJWA 4IM2A 2V4LA 3ZNHB 2DLWA 2DYMA 1Y19B 2HJ8A 2MBBB 2D9ZA 2A4ZA 1WGQA 3WALA 4BKSD 4GMVA 1OEYJ 2MBQA 3LJ3A 3NZSA 4I6PA 1LW3A 1EF1A 1WJ1A 2H7DA 4H8SA 2BPSA 2LVPA 2N9EB 2ZNVC 1K5DB 2V1YA 4I6LB 4DDID 4DHZB 5DI9B 2MFQA 4HAXB 1V89A 3SD5A 2KDEB 3L10B 2GJYA 1PQSA 1FB8A 5AZFA 2RNRB 3ALBA 3S2AA 4DXAB 1NVLA 2KKCA 2K39A 1XQQA 3PRZA 1HBKA 2KWUB 1X1MA 3ZIMA 3NY5A 1PFJA 3HW2B 2D2QA 4IUMB 2XQNM 2MP2A 3UZTA 3TBLD 2LYDA 2ROVA 2DZMA 3UINB 4DBBA 3RCPA 3Q3FA 2MW5A 2P0DA 1TZ1A 1TQZA 2KWCA 3VXWA 4OVUA 4DHJB 2ZCCA 3ECIA 3ML8A 5L83A 2YRYA 2IYBA 1XCGA 1QZEA 1X1FA 1WGHA 2K6QA 2RSUA 4K2OA 2Y7BA 1C1YB 2D11A 2D9YA 3VAWA 1GC7A 1RJ2A 4MY6A 4CHMA 2L2IA 1GNUA 1BTNA 4K17A 5HE0A 2DYQA 3N3KB 3W1SA 2OOBB 3IG3A 2QHOA 2BGFA 1W1HA 4IOYX 5C5BB 4IC7B 1HB8A 3QIJA 1LXDA 1V61A 4K7SA 5D3XA 2MQJA 2ZEQA 4BKSA 2W9NA 5IA7A 2UWQA 1Y8RC 2LRUA 1TJ6A 2YT0A 3UIPB 4KDLB 3EFUA 1C3TA 4NY0A 4GIVA 4EZJA 5G2NA 4MSMB 1L2NA 4RM9A 3VUYA 4PQ0A 2KQSA 1DDMA 4EFOA 3H7PA 2PE9A 2COAA 5CHWA 2RPQA 2PEAA 1E7VA 3RZWC 1WG7A 1P98A 1OGWA 1J0WA 4FJVB 4ANUA 5HE1A 1V49A 3MJWA 3DVNV 2EC1A 3T06A 5D94A 2HTHB 3PLVA 1MIXA 2N7DA 2RLOA 4FN2A 2R09A 5D3YA 4Y94A 4A5KA 1XKEA 3CMMB 5KCVA 3D8FA 1WGGA 1U27A 3FEHA 1YD8U 2COPA 2KDFB 2KFJA 2CU1A 5IJMA 2P8VA 2JF5A 3EC8A 2CY5A 3A8PA 1V81A 3PHWB 3QX1A 2KTRB 3N32A 4HK2A 4II3B 4BBNC 5C23A 3M3JA 3SYXA 2LGDA 4BBKA 1E90A 1HE8A 3N30A 3KW5B 3R7RA 2W2XD 3A9KA 3VTWA 1LFDA 1X86A 4BFRA 4EZLA 1WMHB 4E74A 2KK8A 1J0GA 1WE6A 2A5UA 1FGZA 2CRFA 2I1KA 1WX7A 4YL8A 2JUOA 3U30A 2J0MA 2YS5A 4Z2NA 2UVMA 3A8QA 5D3VA 5LONB 4GGQA 2M1MA 1W1GA 1V5TA 3QWZB 4WWPA 4F8CB 4FADA 2L8JA 3FSSA 3A9KB 4EZKA 4JIOU 4XC2A 2JZ3B 1I2HA 4L6EA 4PNKA 2LUEA 1QQGA 2DENB 4M8MA 4B9KA 3VH3B 1H8CA 2DTCA 1BWNA 5D7GA 3VFKA 2KLCA 2L1CA 2AYOB 1YIWA 1EAZA 1V5MA 1SHCA 3SHQA 2DHZA 2JWZA 4M8NA 1MIZB 1H10A 2DKQA 3JSVB 4IW0A 4MSQB 4OVVA 2MSED 5E6NA 3EECA 2NCNA 3QBVB 4FLHA 2E2XA 3ZVVA 2CODA 1MPHA 3QARA 2MKRA 3KSYA 2JZZA 3KRXA 4MGYE 1VD2A 2D10A 2N9XA 3OJ4B 2M8SA 3RD2A 1WVHA 2Z0PA 2UYZB 4W9CA 2JP2A 4HATB 2I1JA 1TBEA 1OMWA 4K7WA 4KIKB 4LDTD 1G6JA 3HM3A 1WJ4A 3PP2A 2L0FA 2LGYA 3GZNI 1WXVA 4NQKE 3V60A 3VTVA 1ZW7A 1GJZA 5KHQA 2DA0A 4MGZE 3UQAA 5AZGA 2GBKA 1KM7A 2C5LC 1I7AA 3F5RA 2DYBA 3D32A 2Z0DB 1NDDA 2KNBA 3O65B 3WAPA 2KZRA 2N9PC 1UBIA 2KDIA 2LXAA 4WJOA 1EF5A 3TIXA 4A6FA 3AJ4A 2LZ6A 3VOQA 2JRIB 4DK5A 2DZKA 1B55A 1V5OA 1I35A 4M0WB 3NSUA 2Y8GA 2KJRA 1J8CA 2BWFA 4GPTB 2RGFA 1I42A 2OTXA 2RGNB 2ROZB 2GBRA 5FI0A 1ZSQA 2DX5B 2HTHA 2Z59B 3DBLI 3ZTCA 1YJ1A 4HWIB 1U5GA 2FIDA 3SNHA 5C16A 5J18A 2PE6B 1IPGA 2IY1B 3W1SC 3SV1A 2DN6A 2M14A 4CHKA 3A4RA 2CY4A 5HE3A 2B3AA 3ML9A 1KJTA 4IWOA 1P6SA 3OLMD 2KXJA 3WYFB 3DBHI 4A6KA 2CHWA 4URKA 4YONA 4LJPB 4ZRIA 3TVVA 3VH4B 2DHIA 4FJZA 4HLEA 3NOBA 2GBNA 2EMTA 4HAWB 3TW1A 4WJ7A 3TL5A 3WIMA 4D0NB 1D3ZA 4MH0E 2MLBA 1P3RA 4G3XB 4BBNF 2LGXA 4I6NB 3PVWA 1WYWB 2KOXA 2YS3A 2NBVB 1Q0WB 2RUKB 2KX0A 3MTNB 4PYUA 2RVBB 1F9JA 5CTRC 2IBIB 4HDOA 3TO1A 2G4DB 1ZC3B 2MDXA 2L3ZA 2REXA 1KI1B 1UEFA 3PSCA 1WR6E 3C0RB 2M0XA 4IWPA 5E6PA 3RCZA 3WANA 3R66C 4ZRJA 4FJYA 3KYDD 2DZJA 2EJ8A 3CXBB 1WZ0A 2FJLA 2IO3B 1TXDA 2N1VA 2NPTB 4K7UA 4NPNA 2W2XC 3UGBB 3TCAA 3CIKA 1P3QU 3NS8A 3ZNGC 4IWQA 4HCNB 3JVZX 1KZ7A 2Z0EB 1GC6A 3LDZE 5BO4B 1E8ZA 2LVQA 3PZDA 4ZRKA 2X18A 1WH3A 3DXCA 4G11A 2JT4B 1OEYA 4IM0A 2LG1A 3DPDA 4W9LA 2BWES 3PSEB 1XODA 4GMXB 1BTKA 3A1QA 2FCNA 3QWMA 4B95A 2KC2A 3SDLC 2KO3A 1FGYA 3KVFB 2WH5A 2FCSA 1DDWA 2LXCA 3APFA 4XX5A 1M7RA 4FBJB 2M38A 1M7EA 1EUVB 1GG3A 2N0YA 2NS5A 2O2VB 2KFKA 3MHSD 1PMSA 2RD0A 1ZC4B 4HVBA 4B6WA 2GOWA 2BYEA 1FHXA 2LJ5A 2KLGA 3PLUA 2NBUA 2FAZA 3QAQA 2PJHA 3MPXA 4GU2A 4ZDVA 4KVGB 3BY4B 3JSVA 1V2YA 1Z2MA 1CMXB 1QC6A 5EDSA 4HAVB 2RR9A 2K8BA 3PS6A 1E5WA 3IFWB 4DDGD 4KHBB 3FLVA 2H7EA 3B08A 1OTRB 1WFYA 4AP4C 3X23A 3DXEA 3GYOA 4KHAA 1UZXB 2D9VA 2N4FA 1S3SG 4EJNA 3HIZA 4TQ0A 3UQBA 4E3CA 3AU4A 4TKNA 3VDZA 3WAMA 1ZM0A 4FHKA 5IAAC 3ZUNA 3HK0A 3KY9A 1FHOA 3ZNZB 4F7ZA 2MWNB 5J17A 3O96A 1DROA 2BKRB 3RZFA 1AWEA 1DYNA 2KWVB 3AULA 2K00A 3ZW3A 3PVLA 3VHTC 1P0RA 4W9IA 1EGXA 3B1LX 4GDKA 2ELAA 3U7DA 2IO1B 2DHKA 3N7CA 3PHXB 3QCAA 4HPLB 2GBMA 4K1RB 4MEMA 4KZ0A 1UGMA 1ZGUB 4MGIE 2UZSA 5D3WA 1T0YA 3PG7A 1WX9A 3AI5A 3A9JA 4NQLB 1IRSA 2ZVOA 3APCA 2JXXA 3QC8B 4IAPA 1E8XA 4II2B 1NU2A 3QA8A 3ZKJC 1NTVA 3R3MA 2KJHB 3ZDMC 4BOZB 1S1QB 1IP9A 1TTNA 3DBSA 4MJSA 3CF6E 3ENEA 1E8YA 1JRUA 3DCGA 4KDIC 2DHJA 2MBHA 1WJMA 2EKEC 4HJKA 5AEKB 1X05A 2AWTA 4DBGA 4GOCA 2NR2A 5J2RA 2LRWA 3L16A 5JZEB 2RSGA 1GUAB 2Q13A 2Z0QA 1MG8A 4GXBA 2QKMA 3D8DA 4IFSA 5DPSA 3QQ8B 4W9HA 4MJSB 1NTIA 4AJYB 3M1IB 5J3TA 1V80A 4ANWA 2ZZPB 2I5FA 4ICUA 2G35A 3IBEA 3VQIA 4A6HA 2GCJA 2YVCA 1HB6A 2KCJA 2NBWB 2V3SA 4GB9A 4IM3A 4ANXA 3T9LA 2NPTA 4W9DA 1DDVA 1E8WA 4F7GA 1NI2A 2J59M 2P0FA 1X1GA 2C7MB 1SGHA 2KMCA 3H6NA 4J6IA 2COFA 1XD3B 4NAWA 5D6JB 2FJ9A 5FR6A 4A20A 4HB0B 1EO6A 2HE7A 2N23A 3HQCA 5JLJB 2D3GA 3OJ3A 2KMAA 3PRPB 4JLCA 2KC1A 2KFKB 4C0AA 2CHXA 2G4SA 1U5FA 2P0HA 1Q1OA 1V86A 3H1UA 3H9DA 3KUCB 4TQ1A 4WWOA 3VVWB 3RUIB 1VCBA 4F7UP 1UPRA 2K2JA 2N1WA 1KOTA 2LVOA 2PPHA 3SUZA 1MK7B 3A1QB 3L08A 2DZIA 2L7RA 2DYNA 1U4AA 1ACAA 2XK5A 4WJPA 5C79A 2MA9B 2LBBA 1YX5B 3AXCA 1WIAA 3P2BA 2D9XA 3A98B 5DH9B 2BYFA 4G50A 4GSWA 3VUWA 3V6CB 1FHWA 2LD9A 1RRBA 5JHHA 2GMIC 3V62A 5GOWB 4NJ7A 5JH5C 3TFMA 1RLFA 2ELBA 2N7EA 2Y5BB 1YX6B 3ONSA 2MX2A 2LI5A
chains in the Genus database with same CATH superfamily
3P7ZA 3ULCA 2D9WA 2WXJA 3ZTDA 4LNFA 5EFXA 3NWDA 2IGGA 2FIFA 2WS3B 5L95C 3G9WA 2WX0A 3PT2B 2XBBC 1HEZE 3RT3B 2KHWB 3KWLA 2N9KA 2YT2A 2O6VD 3DVGX 2L1AA 5L81A 2KX3A 4L23A 2CJOA 1OFFA 1L0VB 1MG4A 2WLBA 3GZNB 4KHOA 3DWGC 4WVFB 4JK8A 2YEPB 2LULA 1PGBA 2C7HA 2IYDB 2FNJB 1BT0A 1AQCA 3I3TB 1T0SC 2VKIA 3FILA 2DAJA 1WR1A 2LJIA 2AQ1B 1HZ6A 1KTKA 4ASWC 5LXIB 5J3QA 3T8MA 3PVUA 2J7QB 4WAAA 2ZCBA 4N9F4 3SEBA 2K1FA 3SU8X 2KDMA 1A5RA 4Z2MB 1WJUA 1L5PA 3MHZA 4A20A 1MAIA 3OANA 1R4MI 5LXHA 5KQ4A 4HB4B 4W9FA 4JK7A 3GOEA 1XR0B 1DOIA 4RF1A 4JE3B 1NTYA 4K2PA 2DLBA 4MELA 3TUOA 2GI9A 1TS5A 2XEWA 2AL6A 3I57A 5G55A 4HAUB 1WXSA 2K8HA 4KV2A 2IO2B 1NEKB 2KIEA 1WI1A 3JW0X 5KHOA 1EM7A 2KYWA 5D3DA 3U52E 2Z13A 3DDCB 1MK9B 3B2GA 4ZYSA 1U5DA 1KLVA 2J0KA 1HXYD 1B1ZA 2OQBA 4LTUA 3WA0A 4ITKA 1UNRA 4XGAB 1OQYA 2KWDA 2WQYB 5CX3A 2C60A 1JMLA 3L54A 4FBJB 4P7IA 1R4NI 1GB4A 2KDBA 4N59A 2KR0A 4GDLA 3UIOB 1YQ3B 2KGXB 3X0WA 3N1ZC 1WGUA 2UU7A 2KT7A 2KVRA 2J0JA 1J7CA 5C1ZA 3AB5A 3AEFB 1DIKA 2Y8FA 1RYJA 3N20C 4HB2B 1P1AA 1P9DU 4N58A 2LWPA 2K3UA 2FUHB 4ACFA 3P4QB 4P1CC 4LDTB 1VZ8A 4RM8A 2FCQA 1EU3A 2KANA 2KVZA 2ZPNA 4MK0A 3M95A 5EE9A 3M63B 3LJUX 4HAYB 4NAWB 4D6WA 1LQBA 2X8XX 5DPTA 4RMAA 4DX90 3QJZA 2GS0A 2OHFA 4EEWA 2GUMA 1N5WA 2M17A 1SE4A 3A9JB 2M0AA 4RCOA 1H4RA 4X57B 3LXFA 2G3QB 1C77A 3TEZA 2BYTA 3DXDA 2XNAC 3RULA 1XXGA 4BVUC 3NWFA 4IM2A 4JX1C 1F77A 3ZNHB 1F52A 2RMMA 4LDTD 3NZSA 1EF1A 1WJ1A 1FD6A 5DI9B 2MFQA 2KDEB 3L10B 3GE3C 2I2YA 1FB8A 3NRZA 3PRZA 3BZDB 1RFKA 2LYDA 3AE5B 1TZ1A 3ZJVA 2KWCA 5L83A 1D5ZC 1QZEA 1WGHA 2K6QA 2Y3AA 3VAWA 1GC7A 4K17A 5HE0A 1JQ4A 2BGFA 1JWSD 1LXDA 1V61A 5D3XA 2MQJA 3AEGB 2W9NA 1TJ6A 1C3TA 4EZJA 5G2NA 1V8CA 2WHIA 2KQSA 2PE9A 1HQRD 1YJIA 1ZDXA 2PEAA 1OGWA 3DVNV 2EC1A 1XLOA 3PLVA 2R09A 1L4ZB 5KCVA 1YD8U 3FEHA 2CU1A 5IJMA 2P8VA 2JF5A 4BBNC 3QX1A 4II3B 2KTRB 1NVID 1BXTA 2D5GA 3BYYB 3N30A 3RNAC 2W2XD 1X86A 1WMHB 1YNTE 1ET6A 1WE6A 2LGIA 2A5UA 2CRFA 3NVZA 4MH8A 4YL8A 3U30A 1N5XA 2MEKA 3RPFC 1V5TA 4WWPA 3SR6A 3A9KB 2LGSA 4JIOU 2JZ3B 1Q10A 2GRIA 4M8MA 2W54A 1BWNA 1ET9A 5D7GA 2AYOB 1YIWA 2L32A 1V5MA 1SHCA 3SHQA 2DHZA 4M8NA 4OVVA 4OZBA 3SBTA 5E6NA 1UWXA 2CODA 3HSAA 3KRXA 1XLPA 2M8SA 3RD2A 4HKQA 1OMWA 3GP7A 4ARIA 1G6JA 1K51A 3P4RB 1WXVA 5M4YB 1NYRA 1ZW7A 1GJZA 3UQAA 4MGZE 2GBKA 3OAWA 2VH2A 3BWUD 1NDDA 3WAPA 2KDIA 3TIXA 1EF5A 3AJ4A 3VOQA 2DZKA 2QCZA 1I35A 5AUIA 3NSUA 5IO9A 2Y8GA 2HJ1A 4L1BA 1YOVB 1P7FA 3MC8A 2Z59B 1V1OA 2DX5B 2HTHA 5EE0A 1U5GA 4GOUA 3BYTB 5C16A 5FKAC 3BK1A 4IWOA 4A6KA 4BAXA 1OQQA 4URKA 4LJPB 3TVVA 2DHIA 3FC4A 4HAWB 1XF5L 3ZGZA 1D3ZA 2FJUB 2H88B 4I6NB 3PVWA 5IOIA 4XDDA 3TEYA 3IAM1 2RVBB 4C7ZA 1ZC3B 2MDXA 4OVUA 5G5HA 1UEFA 5E6PA 3Q3OC 1GAQB 4ZRJA 2D3CA 4FJYA 3KYDD 2IO3B 4K7UA 4NPNA 3UGBB 2K8EA 1YQ4B 3TCAA 3CIKA 1PUTA 4IWQA 1WYGA 2Y5CA 2LVQA 3P63A 2LHEA 1OEYA 2LG1A 3DPDA 4W9LA 4H2AA 3RMKC 3SDLC 4UDUC 3APFA 3KQ4A 2N0YA 3OWEB 4B6WA 3ZO5B 5C2TB 3I9V1 3Q8BA 4LK0M 4HAVB 3PS6A 1E5WA 2WNMA 4KHBB 3X23A 3DXEA 4KHAA 2N4FA 2D9VA 2PVGC 1VZ7A 1HZ5A 4O1NA 3WAMA 1CQVA 4WH4A 2JQRB 2PIAA 3ZNZB 5J17A 1DROA 2WXLA 2BKRB 2DIKA 3RZFA 3FVCA 3NW8A 1CZPA 2KWVB 2LEKA 1P0RA 3SBGA 3B1LX 2J52A 3N7CA 1I4XA 3ETRA 1ZGUB 2UZSA 3PG7A 4NQLB 3A9JA 4II2B 4IAPA 1NTVA 3ZDMC 2KJHB 1DOYA 2FUG1 2HDEA 4BOZB 1IP9A 2WXKA 4MJSA 3CF6E 3ENEA 1E8YA 1JRUA 2R2YA 5AEKB 2PTLA 2NR2A 4C4VB 2LRWA 1UWMA 2JXTA 2Z0QA 2QKMA 4IFSA 4AJYB 3QQ8B 3M1IB 2N7JA 4JKHA 2ZZPB 2I5FA 4ICUA 4A6HA 2NBWB 3B9JA 3ZYYX 1KBLA 1E8WA 4F7GA 2J59M 2SAKA 1X1GA 1XD3B 1EO6A 2N23A 1EWYC 2KC1A 3H9DA 2P0HA 1V86A 3H1UA 3KUCB 4LNKA 4JWSC 3RUIB 4F7UP 4KGSA 4QAYA 2WXPA 3L08A 1L6VA 4C00A 2DYNA 5HFYA 3P2BA 3VUWA 1SEBD 1FHWA 2LD9A 2W82A 1RRBA 3FAHA 3V62A 5GOWB 1RLFA 1YN4A 2W3RA 2BS3B 2CB8A 1QKZA 4HSIA 4NAMA 4DX8A 4W9KA 1X11A 1XX0A 3DBHB 2R2OA 2I5CA 3ODWA 3RNFC 4ZHPA 1XT9B 1J7AA 2KJ6A 4NJ6A 3Q8EA 1KZGA 4WWNA 5CLLB 3ULBA 2V9HA 2KTRA 2R2QA 4HAZB 2WYQA 1FMAD 3JYUA 5D94A 1Y5OA 3E9SA 1LM8B 1WRDB 4MDKE 3VIAA 4HCPB 2NTSA 2FDQA 2O6VB 3PPAA 1WZ3A 2WP9B 3ODXA 2BYVE 1L7YA 2RDBC 2V76A 4W9JA 1ZDVA 1TS4A 4WJQA 4XZ4A 5DHAB 4CO7A 4C4VA 1ZYIA 2K25A 1UBQA 2YS1A 1AARA 2VSZA 1U5EA 4TSSA 5BMIA 2WWZA 4ICVA 3R7QA 2DNFA 2R82A 2CQUA 1J19A 2GCLA 1VBGA 3MJ5A 3V5WA 3B0AA 3EPYA 3IT6B 2LOZA 1FAOA 1I7HA 3ZRFA 2BBCA 2G45B 1AN8A 1DBHA 4FA6A 4AS1A 1NENB 2JYTA 3MDBC 3W2DA 3VR8B 1ST7A 2LOXA 4GZUA 4G0NB 1ROEA 2LASA 1Q67A 5CLQB 1VLBA 2ZVNA 1WX8A 4WWMA 3ZQ4A 3PTFC 2Z0OA 2QMTA 2I38A 4JWUC 4CHJA 1TIFA 4RF0A 3A33B 4MT5A 5CHVC 4JKEA 3D8EA 4HHVA 1IGCA 3EFCA 4JQWC 2QILA 2L00B 2INDC 2BCJA 4KIKA 2YT1A 2O2VA 3V6EB 3DBRB 1WI0A 1VZ6A 4W9EA 4GDLB 1AYFA 5E6OA 5FR3A 2BKFA 4J3OD 3P4PB 3AU5A 4YTMB 1MKEA 3L17A 1FXIA 2MRPA 3L0WB 4E71A 2O6VA 2KD0A 3DVNU 1N3HA 4US9A 1ZVRA 5KQ1A 3KUZA 3ZVRA 3VR9B 3K9OB 1SIJA 4GDKB 4XWXA 1RM6C 4PT5A 5AZHA 4S17A 3BK2A 3LB8C 2L0TA 1XEEA 1RFAA 1WXAA 1FXTB 2K6DB 3ZRCA 3DQVA 5KHQA 1UH6A 3BINA 2ADZA 1ESFA 2WDRB 2ASQA 2C9WB 2CHZA 1IBXB 4K81A 3IHPC 1A70A 2DLWA 2MBBB 2ZW1A 1LGRA 4BKSD 2MBQA 1QOBA 3LJ3A 4B95A 2H7DA 2LVPA 2N9EB 4I6LB 1DOXA 2NTTA 2V1YA 4DDID 3P1MA 2GJYA 5AZFA 3ALBA 4ILJA 4DXAB 2JX5A 3N1YC 3SFEB 5BMHA 2WDQB 3ZIMA 1HA5A 3HW2B 5EDSA 3UZTA 2DZMA 2MW5A 3RNEC 4WQMA 4DHJB 2YRYA 2IYBA 2D9YA 2INNE 2IDYA 5T8IA 3U4EG 4DQOC 1GNUA 1BTNA 2R61A 3W1SA 4CQNA 2OOBB 4IC7B 1W1HA 4E74A 2ZEQA 1Y8RC 2YT0A 3UIPB 4NY0A 4GIVA 4JKAA 1L2NA 4YSXB 4EFOA 1DDMA 3ENBA 2COAA 4P1BC 1EWCA 1DYQA 3RZWC 4FJVB 5HE1A 2KUQA 3MJWA 1UNSA 1MIXA 1FFVA 2K49A 1JCKB 4FN2A 5D3YA 1XKEA 3CMMB 3D8FA 3N32A 5C23A 2LGDA 1CK1A 3R7RA 3VTWA 3AECB 2W3SA 1J0GA 2PKOA 1FGZA 1JWMD 1ZOYB 4Z2NA 1KFYB 3A8QA 4F8CB 1I2HA 4B9KA 1FM0D 3AE9B 2JWZA 1AW7A 2NCNA 2Z8LA 4FLHA 3ZVVA 1MPHA 2FBWB 2MKRA 2LHDA 1VD2A 2N9XA 3OJ4B 4B0MA 2PLPA 2JP2A 4HATB 3PP2A 2LGYA 3GZNI 4USAA 1TZOA 1KM7A 2C5LC 2DYBA 2KNBA 2N9PC 4QJ3B 3I63C 1MI0A 1TY0A 4A6FA 1V5OA 4M0WB 3A58A 2TSSA 3MFGA 2GBRA 1WGKA 3HVZA 5FK9C 1XLNA 1YJ1A 1ZUD2 5E6JA 3SNHA 4OT1A 4KGRA 2W55A 3W1SC 2DN6A 3A4RA 2CY4A 3ML9A 1R4NB 3OLMD 2KXJA 2IGDA 4HLEA 1JROA 2GBNA 1VDVA 4LNOA 4WJ7A 3WIMA 1P3RA 4G3XB 4P16A 2LGXA 1TJEA 4AQ7A 2KOXA 4HEA1 2NBVB 2RUKB 4PYUA 5CTRC 2IBIB 4HDOA 1QQRA 4TMAB 3C0RB 1STEA 5IRSA 1FXAA 2WXMA 1JWUD 2EJ8A 2Q5WD 3CXBB 1WZ0A 1TXDA 2YEPF 4C7YA 1P3QU 3NS8A 1DGJA 3E9PA 3JVZX 1KZ7A 2Z0EB 3LDZE 5BO4B 1YN3A 3DXCA 2BT6A 4YTPB 4OZAA 1XODA 3U2SC 2KC2A 1PYWD 2KO3A 3KVFB 1DDWA 4M02A 1M7RA 2M38A 3MHSD 2O2VB 4R3DA 2WU2B 2RD0A 4HVBA 1ZC4B 2BYEA 1FHXA 2KLGA 2V3NA 3QAQA 4ZDVA 4GU2A 2PJHA 4KVGB 3JSVA 1V2YA 1N60A 1CMXB 1BMLC 3IFWB 3FLVA 2D3BA 2H7EA 1WFYA 4AP4C 3GYOA 4EJNA 3ZXRA 3VDZA 4FHKA 4ZOHC 1RWSA 2VZKB 2Y5PA 3O96A 5BYSA 2OEDA 2K0PA 1AWEA 1DYNA 2RPVA 4B0EA 4GDKA 3U7DA 2IO1B 3QCAA 4KZ0A 1T0YA 1IRSA 2ZVOA 1GPXA 1D4BA 3B77A 4N6EB 3DBSA 3R8BA 1WJMA 2KMMA 4HJKA 4GOCA 1JRPA 5J2RA 3L16A 1FPYA 2Q13A 4GXBA 3T3NA 4W9HA 4MJSB 2WXRA 4P6VF 2MJ3A 3IBEA 4GB9A 1HB6A 2HTME 2WXOA 4DXFA 2D3AA 1DDVA 1NI2A 4BKTA 4NAWA 1C4CA 4J6IA 2COFA 1IUEA 4GLSC 4HB0B 2HE7A 5JLJB 3PRPB 2KMAA 4C0AA 2CHXA 2E6XA 1U5FA 4LNNA 1HTOA 1L0YB 2PW9A 2J4XA 1KOTA 2PPHA 1T3QA 4JKGB 2DZIA 2L7RA 1ACAA 2PMVA 5C79A 1JDEA 1YX5B 5HI1A 5DH9B 2X0SA 1E7PB 2WXIA 3V6CB 3RNGC 4NJ7A 4LLGM 5JH5C 2N7EA 1KC7A 1QOAA 3ONSA 3AE7B 5I4DA 4JL9A 1FIQA 4LJOB 3M62B 3Q8CA 2JPHA 4REZA 5C5BA 2D07B 2COCA 3Q3MC 4A90A 4A6FB 1JALA 1C9FA 5JHAA 4AWJA 4F7HA 4MT7A 2LKOA 3F0WA 1Z87A 1MPEA 4AOFA 3CIRB 4S0RA 2OJRA 1XD4A 3H7SA 4ILGB 1K50A 1J7BA 1Z5SB 4QXAB 1SIFA 3TMPB 2ZPYA 4ANVA 2D4QA 3VUXA 4DWFA 5C6RA 2H89B 4JK9A 3NZ3A 2CKHB 2WDVB 1PDXA 1VJKA 3PGEA 4LNIA 3ODOA 3AMZA 1SB3C 3DVGY 2NVUI 3SO6A 2DAFA 5JHGA 3RNBC 3ABVB 2JRHA 3PREA 1GGOA 3ZDTA 1V5PA 1K53A 4JGHB 4EOYA 1WMHA 4LCDE 2N9LA 3ZNID 5LNK1 1QILA 1RAXA 2L05A 4ZYNA 3HHMA 4IG7B 5TSSA 4JKDA 3DHGC 3DHHC 4A3PA 1TT5B 3O13A 3PEGA 5LOPB 4HRSA 4MGKE 5FI1A 1V5UA 4HXDA 1UGJA 2JVCA 4BKGA 2WDTB 4WSFA 2BW2A 4WQOB 3E66A 1QF6A 4JKCA 4NSWA 1ZXHA 2MBOA 1GB1A 2R0DA 4EKUA 4ILHA 2DBYA 3V3XA 2BB5A 2MP2B 1UNQA 2MHJA 4AUQC 1YJJA 2IZVB 1KF6B 4A3OA 3P6AA 4CYEA 3AM9A 4JKFA 1ZKHA 3VTUA 2K8CA 2CS4A 3DBRI 2VRWB 1WF9A 2G9HD 3DBLB 1E10A 1QT9A 3PO0A 4TUUA 3KYCD 4D2KA 4ARCA 5HHDG 2ZKMX 1K8RB 5DIFB 1JWAD 4FXCA 3T3OA 3EA6A 5JP4A 1EVHA 4GN1A 4EUTA 2KQ7A 1WGYA 2BS4B 5JVLA 1L4DB 3BIID 3IVFA 4PS7A 4DHZE 2NZ8B 4KSKC 2DYOA 2B76B 1SE2A 2WXFA 2AL3A 2DX5A 5DCNA 3FILB 2VH1A 2IO0B 2KTFA 3RYTA 1V88A 3W5VB 1WY8A 3KH0A 5LLIA 3BJIA 2AQ3B 5GXGB 1P7EA 2VZKD 3L13A 2YF0A 2IY0B 2HD5B 2BF8B 3KRWA 2WX1A 4RGMA 2KAJA 5HG2A 2NMBA 2CU3A 1R4MB 2M56B 1MHXA 1WJNA 4F1SA 1T77A 2J42A 1C4PA 2HJ8A 1VRAB 1WGQA 3WALA 4GMVA 4I6PA 2ZNVC 1ACCA 2SEBD 2E3TA 1IBXA 1V89A 3SD5A 4JKGA 5EE3A 3CWIA 2RNRB 4K3CA 2OJWA 3S2AA 2KKCA 2EKIA 2INPE 2K39A 1HBKA 2KQ4X 2KWUB 2D2QA 2XQNM 2MP2A 3UINB 3U12A 4DBBA 3RCPA 3GB1A 3Q3FA 1TQZA 3ML8A 3DWMA 1XCGA 2Z59A 4BZAA 2RSUA 4K2OA 2Y7BA 1ZP0B 1BUIC 2D11A 4CHMA 3TSSA 3NS1A 3N3KB 3RFZB 1SBBB 1ZPSA 5C5BB 4IOYX 1HB8A 3QIJA 4L1RA 1TKGA 1QOFA 2LFIA 2LMCA 4GNKB 1FCLA 4MSMB 4PQ0A 1NYQA 3H7PA 2AX5A 2RPQA 3PZ8A 5I2MA 1MFWA 1P98A 5BMGA 1J0WA 4ANUA 3W5UB 3AH7A 3T06A 2N7DA 1LO5D 4Y94A 4A5KA 4MH0E 1WGGA 4HJGE 1U27A 2KDFB 2COPA 2KIGA 1SXTA 3PHWB 2CY5A 3A8PA 2JZPA 2PVOD 4YXDB 1E90A 1HE8A 3KW5B 1LFDA 4EZLA 1XCTL 2KK8A 1V1PA 2MH7A 1R7SA 1KLGD 2I1KA 1WX7A 2JUOA 3NUHB 1QOGA 2J0MA 1AWDA 3IXSA 5LONB 1W1GA 4FADA 4XWWA 3KLSX 4L6EA 4PNKA 1SE3A 2LUEA 1QQGA 3H8HA 3VFKA 2KLCA 2L1CA 2V4IB 2DKQA 1H10A 4IW0A 4MSQB 3SFDB 3QBVB 3QARA 2JZZA 4MGYE 2Z0PA 1FCCC 1TBEA 2WXGA 3HM3A 1WJ4A 5AZGA 1I7AA 3O65B 3URYA 2KZRA 1UBIA 2EELA 2JRIB 3VRAB 1B55A 3AEBB 4ZRPA 3E9OA 1J8CA 2BWFA 2RGFA 1I42A 2OTXA 2ROZB 5FI0A 1ZSQA 3AE8B 4YTNB 2RDGA 2FIDA 3HIEA 3NJTA 1B9RA 2PE6B 2M14A 1XLQA 4CHKA 5HE3A 1YMHE 2B3AA 3BVMA 1KJTA 1P6SA 3WYFB 1MVKA 2CHWA 4YONA 4FJZA 3PZ7A 3TW1A 2WXNA 3TL5A 1SJED 2YS3A 1Q0WB 2KX0A 3MTNB 1D5XC 2REXA 3PSCA 3RCZA 1WR6E 4IWPA 2M0XA 3WANA 2WXHA 1ZE3D 4KKIA 3P4SB 4WIPA 2NPTB 1V1PB 3PZDA 4ZRKA 1WH3A 4G11A 4IM0A 2BWES 3PSEB 1D6EC 2RDHA 1FGYA 5G5GA 2LXCA 3TEWA 1EUVB 2NS5A 2KFKA 1PMSA 5IP4D 2GOWA 2LJ5A 2NBUA 2FAZA 2QC8A 3AE2B 3MPXA 3BY4B 5I2SA 1SJHD 1C79A 3NVWA 1QC6A 1N63A 2RR9A 2K8BA 4DIXA 4DDGD 3B08A 1OTRB 1UZXB 1S3SG 3HIZA 1CJEA 3HUIA 4E3CA 3AU4A 4TKNA 1ZM0A 3AE1B 1L6UA 3ZUNA 5IKCM 1FHOA 4F7ZA 2MWNB 3R2IA 3E9LA 1FNUA 2JYEA 3AV8A 2K00A 1TS2A 3PVLA 3VHTC 4W9IA 4IKGA 3PHXB 4MEMA 2GBMA 3WCQA 2NBVA 4RGTA 1WX9A 3AI5A 2JXXA 3P42A 1NU2A 3ZKJC 1N61A 1KH0A 1S1QB 2BQQA 2DHJA 3E56A 2EKEC 1X05A 5JZEB 5DPSA 2BTEA 1NTIA 2LUMA 1OQRA 3T9LA 2NPTA 2C7MB 1C78A 2KMCA 2N0SB 3H6NA 4RFBA 5D6JB 4KX6B 4JPSA 1L0XB 2G4SA 3OHMB 3VVWB 4TQ1A 4WWOA 1VCBA 1UPRA 2K2JA 1V97A 2LVOA 4ZRQA 4WJPA 2XK5A 1T6BX 4IOIE 1WIAA 2D9XA 3RNCC 1I4QA 3AE3B 5JHHA 3TFMA 2ELBA 1YX6B 3EFUA 2LI5A 3GE8C 2PZ1A 2M19A 3UF8A 3H7PB 2V0GA 1I4PA 2MBEA 1UNPA 2WU5B 2FE8A 3TEXA 2MCNB 4NZLB 2YLMA 5H92C 3HVDA 2MJEA 1QLBB 5HKHA 1M4VA 2RQ1A 1U2BA 4B6HA 2C7NB 2X38A 4HPPA 1TGZB 1F1HA 1MJDA 3APDA 5CHFA 2GBJA 1FOEA 4W9GA 1VBHA 1IYFA 3CSFA 2DFKA 3ML4A 3QHTA 4KGTA 3QK0A 3WAOA 2MWSB 5JHBA 3Q3NC 4WAFA 3K9PB 2DKPA 3GYPA 2K22A 3NZUA 1E0ZA 3ZLZA 2JY6A 2DX1A 3PV1A 5D3IB 3V61A 4RGNA 3TJPA 1U29A 4OW0A 4PS3A 1V6EA 3ZJUA 1WXMA 2W2WA 1YQBA 2UZRA 4KKJA 1WGDA 2ZJDA 3KZ1A 5JXVA 1PGXA 3FP5A 1WM2A 1Y56A 2YSZA 1P5TA 3NVVA 5TR5A 1PLSA 3ZNGC 2L76A 5GMVA 4NNJB 3HM6X 3RI7C 1TS3A 3ZXVA 4KAXB 1KRHA 2EMSA 4OSNA 4TV3A 2XK5B 2Z14A 5HE2A 2K2UA 3U8ZA 4BOSC 4WJNA 2KN5A 2MJDA 5D27A 3CSTA 1W1DA 1WGRA 1E7UA 4RH6A 1T0QC 4M01A 4EMOA 4MM3A 3BVZA 2HRJA 5LG4B 2ICIA 1M94A 1UPQA 3FM8C 2M4NA 4HROA 5DPRA 1RRPB 1V9JA 3BVGA 1Q5WB 3PRMB 3Q3JA 4HB3B 2BS2B 4DHJD 1UF0A 1UD7A 1JW9D 4KSLC 1BAKA 3N1XC 1OY2A 1UELA 3HRDD 2VRRB 3W1YA 2NMQA 2JSVX 1E9MA 4WURA 2K5PA 5DHFB 1WM3A 1F0ZA 2CR5A 1WE7A 3KUDB 4HPMB 2Z4DA 2QEJC 1XCQL 3R2TA 1NBFC 1LB1A 1PFDA 2ABDA 1K5GB 4FHJA 5DPWA 2KUPA 1WJ6A 2QSDA 5D2MB 1NI3A 1SE9A 2ZNVB 3FKYA 3N9YC 4PYZA 4KZCA 1FNWA 1TY2A 2JU6X 3NHEB 2GLSA 4IDIA 5J3YA 2FCMA 4FULA 3W9CB 1I4GA 4TYZA 2RRFA 2QKLA 4CSQA 3DOWA 3KWVA 2CAYA 1YN5A 3ZTCA 1OQNA 2IFSA 2AEHA 3A4SC 3EHVA 4PS8A 1FRRA 1ISNA 1T0RC 4HDQA 1ZXIA 2ONQA 4AJWA 4XWTA 2V4LA 1N6ZA 2DYMA 1Y19B 2D9ZA 2A4ZA 1OEYJ 3NVYA 4PK1A 1LW3A 4H8SA 3MC0B 2BPSA 4DHZB 1K5DB 4HAXB 1PQSA 1WXQA 5AUKA 1NVLA 5MPOA 1XQQA 4ZHOA 3RN9C 3L4PA 1X1MA 3NY5A 1PFJA 4IUMB 2ROVA 4M0WA 3Q14C 2P0DA 3VXWA 2ZCCA 3ECIA 1X1FA 2QIEB 1C1YB 1XO3A 4MY6A 1RJ2A 1UUPA 2L2IA 2DYQA 3IG3A 1HTQA 2QHOA 2XN9C 4K7SA 4YSZB 5IA7A 2UWQA 2LRUA 4KDLB 3EGRA 4YSYB 4RM9A 1EU4A 3VUYA 3MC9A 1WRIA 3NG0A 5CHWA 2L83A 1E7VA 1WG7A 2AQ2B 1V49A 2HTHB 5BYRA 4C80A 2RLOA 1SF0A 1ENFA 2KFJA 2IGHA 3EC8A 1V81A 4HK2A 3M3JA 3SYXA 4BBKA 3A9KA 4JKBA 2YS5A 2WXQA 2UVMA 2ON8A 5D3VA 4GGQA 2M1MA 3QWZB 2ZW0A 2L8JA 3C8YA 3FSSA 4EZKA 4XC2A 1MHHE 5H8YE 1H8CA 1PGAA 2DENB 1D5MC 3AEEB 2V3PA 3VH3B 2DTCA 2GB1A 3AEDB 1C4AA 1EAZA 1F2RI 1MIZB 3JSVB 5IN7A 2MSED 3EECA 2E2XA 5C3JB 3KSYA 2D10A 1WVHA 2UYZB 4W9CA 2I1JA 4KIKB 4K7WA 3LYYA 2L0FA 4NQKE 3V60A 3VTVA 1FO4A 2DA0A 1I4RA 4MM3B 3F5RA 3D32A 2Z0DB 3V05A 4WJOA 2LXAA 2LZ6A 4DK5A 3DCXA 1FFUA 2KJRA 4GPTB 3Q8AA 2RGNB 3J9CA 1WWTA 3DBLI 1C76A 4HWIB 5J18A 1IPGA 2IY1B 3SV1A 1FRDA 2J53A 4OVZA 3IAS1 1JWBD 4OZCA 1FNVA 4YWGG 2BVCA 3DBHI 3AE4B 4ZRIA 3VH4B 3IT4B 3GS2A 3NOBA 2EMTA 1VR9A 2BB6A 4US8A 5BYQA 4D0NB 1E6EB 2MLBA 4RNAA 4BBNF 1N62A 1WYWB 1F9JA 3U7ZA 1WSPA 2G1EA 2G4DB 3TO1A 1GOZA 4QJ4B 2INCC 2L3ZA 1KI1B 4NJCA 3UI3A 4XDCA 3R66C 4L2YA 4YT0B 4A55A 2DZJA 3B2FA 3EUB2 2KACA 3AN1A 2FJLA 2N1VA 2W2XC 3AE6B 4HCNB 1GC6A 4EE2A 3DHIC 1E8ZA 2X18A 3NWAA 2JT4B 3OG5A 4OHJA 4RGOS 5EE1A 4K3BA 4DXGA 4MACA 4GMXB 1BTKA 3A1QA 2FCNA 3QWMA 1F2RC 1MI1A 2WH5A 2FCSA 4Q2JA 4XX5A 2DWQA 4KHBA 1M7EA 3I5JC 1GG3A 4XYCA 3PLUA 3MP9A 1T5XD 1Z2MA 3UQBA 4TQ0A 3VRBB 5IAAC 3Q2AC 3HK0A 3KY9A 1K52A 4C56C 3AULA 3ZW3A 4A8XC 1KLUD 1EGXA 2ELAA 1I4HA 2DHKA 4HPLB 4K1RB 1SSNA 3Q69A 1UGMA 2JWUA 4MGIE 5D3WA 3Q6BA 3APCA 3QC8B 1TYGB 1E8XA 3QA8A 2QJLA 4XE0A 3R3MA 3Q8FA 1TTNA 3DCGA 4KDIC 2MBHA 2AWTA 4DBGA 4M00A 1TKYA 2RSGA 1GUAB 4QJ5B 2K9XA 1MG8A 4A6QA 3D8DA 2CJNA 2WGSA 5J3TA 1V80A 4ANWA 1FEHA 2G35A 3VQIA 2IPKD 2GCJA 2YVCA 2V3SA 2KCJA 2QDFA 4IM3A 4ANXA 4W9DA 4BFRA 2P0FA 3TBLD 3ZJTA 1SGHA 5FR6A 2FJ9A 4BKSA 3OJ3A 3HQCA 2D3GA 4JLCA 4HKZE 2KFKB 1TKEA 2IJ0A 2KN4A 1Q1OA 2N1WA 3AEAB 2L52A 2ACZB 3SUZA 1MK7B 3A1QB 1U4AA 2MA9B 2LBBA 3AXCA 4GSWA 4G50A 3A98B 2BYFA 1IGDA 3C19A 2GMIC 4A9AA 2Y5BB 2MX2A
chains in the Genus database with same CATH topology
3P7ZA 3ULCA 2D9WA 3ZTDA 5EFXA 2FIFA 5L95C 3G9WA 2WX0A 3PT2B 2XBBC 3RT3B 2KHWB 2O6VD 3DVGX 5L81A 2KX3A 4KHOA 4WVFB 4JK8A 2LULA 2C7HA 2IYDB 2FNJB 1BT0A 1AQCA 3I3TB 2VKIA 2DAJA 1WR1A 4ASWC 5LXIB 5J3QA 3T8MA 3PVUA 2J7QB 4WAAA 2ZCBA 4N9F4 2K1FA 3SU8X 1A5RA 4Z2MB 1WJUA 4A20A 1MAIA 3OANA 1R4MI 5LXHA 5KQ4A 4HB4B 4W9FA 4JK7A 3GOEA 1XR0B 1NTYA 4K2PA 4MELA 2XEWA 2AL6A 5G55A 4HAUB 1WXSA 2K8HA 4KV2A 2IO2B 1WI1A 3JW0X 5KHOA 3DDCB 1MK9B 1U5DA 1KLVA 2J0KA 2OQBA 3WA0A 1UNRA 1OQYA 5CX3A 2C60A 3L54A 4FBJB 4P7IA 1R4NI 2KDBA 4GDLA 3UIOB 2KGXB 3X0WA 1WGUA 2KVRA 2J0JA 5C1ZA 1DIKA 2Y8FA 4HB2B 1P1AA 1P9DU 2LWPA 2FUHB 4LDTB 4RM8A 2FCQA 2KANA 2ZPNA 4MK0A 3M95A 3M63B 3LJUX 4HAYB 4NAWB 1LQBA 5DPTA 4RMAA 4DX90 3QJZA 2GS0A 4EEWA 2M17A 3A9JB 1H4RA 4X57B 2G3QB 3DXDA 3RULA 4BVUC 4IM2A 3ZNHB 4LDTD 3NZSA 1EF1A 1WJ1A 5DI9B 2MFQA 2KDEB 3L10B 1FB8A 3PRZA 2LYDA 1TZ1A 2KWCA 5L83A 1QZEA 1WGHA 2K6QA 3VAWA 1GC7A 4K17A 5HE0A 2BGFA 1LXDA 1V61A 5D3XA 2MQJA 2W9NA 1TJ6A 1C3TA 4EZJA 5G2NA 2KQSA 2PE9A 2PEAA 1OGWA 3DVNV 2EC1A 3PLVA 2R09A 5KCVA 1YD8U 3FEHA 2CU1A 5IJMA 2P8VA 2JF5A 4BBNC 3QX1A 4II3B 2KTRB 3N30A 2W2XD 1X86A 1WMHB 1WE6A 2A5UA 2CRFA 4YL8A 3U30A 1V5TA 4WWPA 3A9KB 4JIOU 2JZ3B 4M8MA 1BWNA 5D7GA 2AYOB 1YIWA 1V5MA 1SHCA 3SHQA 2DHZA 4M8NA 4OVVA 3SBTA 5E6NA 2CODA 3KRXA 2M8SA 3RD2A 1OMWA 1G6JA 1WXVA 1ZW7A 1GJZA 3UQAA 4MGZE 3OAWA 2GBKA 1NDDA 3WAPA 2KDIA 3TIXA 1EF5A 3AJ4A 3VOQA 2DZKA 1I35A 3NSUA 2Y8GA 2Z59B 2DX5B 2HTHA 1U5GA 5C16A 4IWOA 4A6KA 4URKA 4LJPB 3TVVA 2DHIA 4HAWB 1D3ZA 4I6NB 3PVWA 2RVBB 1ZC3B 4OVUA 2MDXA 1UEFA 5E6PA 4ZRJA 4FJYA 3KYDD 2IO3B 4K7UA 4NPNA 3UGBB 3TCAA 3CIKA 4IWQA 2LVQA 1OEYA 2LG1A 3DPDA 4W9LA 3SDLC 3APFA 2N0YA 4B6WA 3ZO5B 4HAVB 3PS6A 1E5WA 4KHBB 3X23A 3DXEA 4KHAA 2N4FA 2D9VA 3WAMA 3ZNZB 5J17A 1DROA 2BKRB 2DIKA 3RZFA 2KWVB 1P0RA 3SBGA 3B1LX 3N7CA 1ZGUB 2UZSA 3PG7A 4NQLB 3A9JA 4II2B 4IAPA 1NTVA 3ZDMC 2KJHB 4BOZB 1IP9A 4MJSA 3CF6E 3ENEA 1E8YA 1JRUA 5AEKB 2NR2A 2LRWA 2Z0QA 2QKMA 4IFSA 4AJYB 3QQ8B 3M1IB 4JKHA 2ZZPB 2I5FA 4ICUA 4A6HA 2NBWB 1KBLA 1E8WA 4F7GA 2J59M 1X1GA 1XD3B 1EO6A 2N23A 2KC1A 3H9DA 2P0HA 1V86A 3H1UA 3KUCB 3RUIB 4F7UP 3L08A 2DYNA 3P2BA 3VUWA 1FHWA 2LD9A 1RRBA 3V62A 5GOWB 1RLFA 2CB8A 4DX8A 4W9KA 1X11A 1XX0A 2R2OA 2I5CA 3ODWA 1XT9B 2KJ6A 4NJ6A 1KZGA 4WWNA 5CLLB 3ULBA 2KTRA 2R2QA 4HAZB 2WYQA 3JYUA 5D94A 1Y5OA 1LM8B 1WRDB 4MDKE 3VIAA 4HCPB 2FDQA 2O6VB 3PPAA 1WZ3A 3ODXA 2BYVE 1L7YA 2V76A 4W9JA 4WJQA 4XZ4A 5DHAB 4CO7A 2K25A 1UBQA 2YS1A 1AARA 2VSZA 1U5EA 2WWZA 4ICVA 3R7QA 2R82A 2CQUA 1J19A 2GCLA 1VBGA 3V5WA 3B0AA 3EPYA 2LOZA 1FAOA 3ZRFA 2G45B 1DBHA 4FA6A 3MDBC 1ST7A 2LOXA 4GZUA 4G0NB 2LASA 1Q67A 5CLQB 2ZVNA 1WX8A 3PTFC 2Z0OA 4CHJA 3A33B 5CHVC 4JKEA 3D8EA 4HHVA 4JQWC 2L00B 2BCJA 4KIKA 2YT1A 2O2VA 3V6EB 1WI0A 4W9EA 4GDLB 5E6OA 2BKFA 3AU5A 1MKEA 3L17A 2MRPA 3L0WB 4E71A 2O6VA 2KD0A 3DVNU 1N3HA 1ZVRA 5KQ1A 3KUZA 3ZVRA 3K9OB 4GDKB 4XWXA 5AZHA 2L0TA 1RFAA 1WXAA 1FXTB 2K6DB 3ZRCA 3DQVA 5KHQA 1UH6A 3BINA 2ADZA 2ASQA 2C9WB 2CHZA 4K81A 3IHPC 2DLWA 2MBBB 4BKSD 2MBQA 3LJ3A 4B95A 2H7DA 2LVPA 2N9EB 4I6LB 2V1YA 4DDID 2GJYA 5AZFA 3ALBA 4ILJA 4DXAB 3ZIMA 3HW2B 5EDSA 3UZTA 2DZMA 2MW5A 4DHJB 2YRYA 2IYBA 2D9YA 1GNUA 1BTNA 3W1SA 2OOBB 4IC7B 1W1HA 4E74A 2ZEQA 1Y8RC 2YT0A 3UIPB 4NY0A 4GIVA 4JKAA 1L2NA 4EFOA 1DDMA 3ENBA 2COAA 3RZWC 4FJVB 5HE1A 3MJWA 1MIXA 4FN2A 5D3YA 1XKEA 3CMMB 3D8FA 3N32A 5C23A 2LGDA 3R7RA 3VTWA 1J0GA 1FGZA 4Z2NA 3A8QA 4F8CB 1I2HA 4B9KA 2JWZA 2NCNA 4FLHA 3ZVVA 1MPHA 2MKRA 1VD2A 2N9XA 3OJ4B 2JP2A 4HATB 3PP2A 2LGYA 3GZNI 1KM7A 2C5LC 2DYBA 2KNBA 2N9PC 4A6FA 1V5OA 4M0WB 2GBRA 1YJ1A 3SNHA 3W1SC 2DN6A 3A4RA 2CY4A 3ML9A 3OLMD 2KXJA 4HLEA 2GBNA 4WJ7A 3WIMA 1P3RA 4G3XB 2LGXA 2KOXA 2NBVB 2RUKB 4PYUA 5CTRC 2IBIB 4HDOA 3C0RB 2EJ8A 3CXBB 1WZ0A 1TXDA 1P3QU 3NS8A 3E9PA 3JVZX 1KZ7A 2Z0EB 3LDZE 5BO4B 3DXCA 1XODA 2KC2A 2KO3A 3KVFB 1DDWA 1M7RA 2M38A 3MHSD 2O2VB 2RD0A 4HVBA 1ZC4B 2BYEA 1FHXA 2KLGA 3QAQA 4ZDVA 4GU2A 2PJHA 4KVGB 3JSVA 1V2YA 1CMXB 3IFWB 3FLVA 2H7EA 1WFYA 4AP4C 3GYOA 4EJNA 3VDZA 4FHKA 3O96A 1AWEA 1DYNA 4GDKA 3U7DA 2IO1B 3QCAA 4KZ0A 1T0YA 1IRSA 2ZVOA 3DBSA 1WJMA 4HJKA 4GOCA 5J2RA 3L16A 2Q13A 4GXBA 4W9HA 4MJSB 3IBEA 4GB9A 1HB6A 1DDVA 1NI2A 4BKTA 4NAWA 4J6IA 2COFA 4HB0B 2HE7A 5JLJB 3PRPB 2KMAA 4C0AA 2CHXA 1U5FA 1KOTA 2PPHA 2DZIA 4JKGB 2L7RA 1ACAA 5C79A 1JDEA 1YX5B 5DH9B 2X0SA 3V6CB 4NJ7A 5JH5C 2N7EA 1KC7A 3ONSA 4JL9A 4LJOB 3M62B 2JPHA 5C5BA 2D07B 2COCA 4A6FB 5JHAA 4AWJA 4F7HA 4MT7A 2LKOA 3F0WA 1Z87A 4AOFA 2OJRA 1XD4A 3H7SA 4ILGB 1Z5SB 1SIFA 3TMPB 2ZPYA 4ANVA 2D4QA 3VUXA 4DWFA 5C6RA 4JK9A 2CKHB 3PGEA 3ODOA 3DVGY 2NVUI 3SO6A 2DAFA 5JHGA 2JRHA 3PREA 1GGOA 3ZDTA 1V5PA 4JGHB 4EOYA 1WMHA 4LCDE 3ZNID 1RAXA 2L05A 4ZYNA 3HHMA 4IG7B 4JKDA 4A3PA 3PEGA 5LOPB 4MGKE 5FI1A 1V5UA 4HXDA 2JVCA 4BKGA 2WDTB 4WSFA 4WQOB 3E66A 4JKCA 4NSWA 2MBOA 2R0DA 4EKUA 4ILHA 2MP2B 1UNQA 4AUQC 2IZVB 4A3OA 3P6AA 4CYEA 4JKFA 1ZKHA 3VTUA 2K8CA 2CS4A 3DBRI 2VRWB 1WF9A 4TUUA 3KYCD 1K8RB 5DIFB 5JP4A 1EVHA 4GN1A 4EUTA 2KQ7A 1WGYA 5JVLA 3IVFA 4PS7A 4DHZE 2NZ8B 4KSKC 2DYOA 2AL3A 2DX5A 5DCNA 2IO0B 2KTFA 3RYTA 1V88A 1WY8A 3KH0A 5LLIA 3BJIA 3L13A 2YF0A 2IY0B 2HD5B 2BF8B 3KRWA 2WX1A 2NMBA 1WJNA 4F1SA 2HJ8A 1WGQA 3WALA 4GMVA 4I6PA 2ZNVC 1V89A 3SD5A 4JKGA 2RNRB 3S2AA 2KKCA 2K39A 1HBKA 2KWUB 2D2QA 2XQNM 2MP2A 3UINB 4DBBA 3RCPA 3Q3FA 1TQZA 3ML8A 1XCGA 2RSUA 4K2OA 2Y7BA 2D11A 4CHMA 3N3KB 5C5BB 4IOYX 1HB8A 3QIJA 4MSMB 4PQ0A 3H7PA 2RPQA 1P98A 1J0WA 4ANUA 3T06A 2N7DA 4Y94A 4A5KA 4MH0E 1WGGA 1U27A 2KDFB 2COPA 3PHWB 2CY5A 3A8PA 1E90A 1HE8A 3KW5B 1LFDA 4EZLA 2KK8A 2I1KA 1WX7A 2JUOA 2J0MA 5LONB 1W1GA 4FADA 4L6EA 4PNKA 2LUEA 1QQGA 3VFKA 2KLCA 2L1CA 2DKQA 1H10A 4IW0A 4MSQB 3QBVB 3QARA 2JZZA 4MGYE 2Z0PA 1TBEA 3HM3A 1WJ4A 5AZGA 1I7AA 3O65B 2KZRA 1UBIA 2JRIB 1B55A 3E9OA 1J8CA 2BWFA 2RGFA 1I42A 2OTXA 2ROZB 5FI0A 1ZSQA 2FIDA 2PE6B 2M14A 4CHKA 5HE3A 2B3AA 1KJTA 1P6SA 3WYFB 2CHWA 4YONA 4FJZA 3TW1A 3TL5A 2YS3A 1Q0WB 2KX0A 3MTNB 2REXA 3PSCA 3RCZA 1WR6E 4IWPA 2M0XA 3WANA 2NPTB 3PZDA 4ZRKA 1WH3A 4G11A 4IM0A 2BWES 3PSEB 1FGYA 2LXCA 1EUVB 2NS5A 2KFKA 1PMSA 2GOWA 2LJ5A 2NBUA 2FAZA 3MPXA 3BY4B 1QC6A 2RR9A 2K8BA 4DDGD 3B08A 1OTRB 1UZXB 1S3SG 3HIZA 4E3CA 3AU4A 4TKNA 1ZM0A 3ZUNA 1FHOA 4F7ZA 2MWNB 3E9LA 2K00A 3PVLA 3VHTC 4W9IA 3PHXB 4MEMA 2GBMA 1WX9A 3AI5A 2JXXA 1NU2A 3ZKJC 1S1QB 2DHJA 2EKEC 1X05A 5JZEB 5DPSA 1NTIA 3T9LA 2NPTA 2C7MB 2KMCA 5D6JB 3H6NA 2G4SA 3VVWB 4TQ1A 4WWOA 1VCBA 1UPRA 2K2JA 2LVOA 4WJPA 2XK5A 1WIAA 2D9XA 5JHHA 3TFMA 2ELBA 1YX6B 3EFUA 2LI5A 2PZ1A 3UF8A 3H7PB 2MBEA 1UNPA 2MCNB 2YLMA 5HKHA 2RQ1A 1U2BA 4B6HA 2C7NB 1TGZB 3APDA 5CHFA 2GBJA 1FOEA 4W9GA 1VBHA 1IYFA 3CSFA 2DFKA 3ML4A 3QHTA 3QK0A 3WAOA 2MWSB 5JHBA 3K9PB 2DKPA 3GYPA 3NZUA 3ZLZA 2JY6A 2DX1A 3PV1A 3V61A 3TJPA 1U29A 4PS3A 1V6EA 1WXMA 2W2WA 1YQBA 2UZRA 1WGDA 2ZJDA 3KZ1A 3FP5A 1WM2A 2YSZA 1P5TA 5TR5A 1PLSA 3ZNGC 2L76A 5GMVA 4NNJB 3HM6X 4KAXB 2EMSA 4TV3A 2XK5B 5HE2A 2K2UA 3U8ZA 4BOSC 4WJNA 2KN5A 5D27A 3CSTA 1W1DA 1WGRA 1E7UA 4EMOA 4MM3A 2HRJA 1M94A 1UPQA 3FM8C 2M4NA 5DPRA 1RRPB 1V9JA 1Q5WB 3PRMB 3Q3JA 4HB3B 4DHJD 1UD7A 4KSLC 1BAKA 1OY2A 1UELA 2VRRB 3W1YA 5DHFB 1WM3A 2CR5A 1WE7A 3KUDB 4HPMB 1NBFC 1LB1A 2ABDA 1K5GB 4FHJA 5DPWA 2KUPA 1WJ6A 5D2MB 1SE9A 2ZNVB 4PYZA 4KZCA 3NHEB 5J3YA 2FCMA 4FULA 4TYZA 2QKLA 3DOWA 2CAYA 3ZTCA 1OQNA 2IFSA 2AEHA 3A4SC 3EHVA 4PS8A 1ISNA 4HDQA 4AJWA 2V4LA 2DYMA 1Y19B 2D9ZA 2A4ZA 1OEYJ 1LW3A 4H8SA 2BPSA 4DHZB 1K5DB 4HAXB 1PQSA 1NVLA 1XQQA 1X1MA 3NY5A 1PFJA 4IUMB 2ROVA 2P0DA 3VXWA 2ZCCA 3ECIA 1X1FA 1C1YB 4MY6A 1RJ2A 2L2IA 2DYQA 3IG3A 2QHOA 4K7SA 5IA7A 2UWQA 2LRUA 4KDLB 4RM9A 3VUYA 5CHWA 1E7VA 1WG7A 1V49A 2HTHB 2RLOA 2KFJA 3EC8A 1V81A 4HK2A 3M3JA 3SYXA 4BBKA 3A9KA 4JKBA 2YS5A 2UVMA 5D3VA 4GGQA 2M1MA 3QWZB 2L8JA 3FSSA 4EZKA 4XC2A 1H8CA 2DENB 3VH3B 2DTCA 1EAZA 1MIZB 3JSVB 2MSED 3EECA 2E2XA 3KSYA 2D10A 1WVHA 2UYZB 4W9CA 2I1JA 4KIKB 4K7WA 2L0FA 4NQKE 3V60A 3VTVA 2DA0A 3F5RA 3D32A 2Z0DB 4WJOA 2LXAA 2LZ6A 4DK5A 2KJRA 4GPTB 2RGNB 3DBLI 4HWIB 5J18A 1IPGA 2IY1B 3SV1A 3DBHI 4ZRIA 3VH4B 3NOBA 2EMTA 4D0NB 2MLBA 4BBNF 1WYWB 1F9JA 3TO1A 2G4DB 2L3ZA 1KI1B 3R66C 2DZJA 2FJLA 2N1VA 2W2XC 4HCNB 1GC6A 1E8ZA 2X18A 2JT4B 4GMXB 1BTKA 3A1QA 2FCNA 3QWMA 2WH5A 2FCSA 4XX5A 1M7EA 1GG3A 3PLUA 1Z2MA 3UQBA 4TQ0A 5IAAC 3HK0A 3KY9A 3AULA 3ZW3A 1EGXA 2ELAA 2DHKA 4HPLB 4K1RB 1UGMA 4MGIE 5D3WA 3APCA 3QC8B 1E8XA 3QA8A 3R3MA 1TTNA 3DCGA 4KDIC 2MBHA 2AWTA 4DBGA 2RSGA 1GUAB 1MG8A 3D8DA 5J3TA 1V80A 4ANWA 2G35A 3VQIA 2GCJA 2YVCA 2V3SA 2KCJA 4IM3A 4ANXA 4W9DA 4BFRA 3TBLD 2P0FA 1SGHA 5FR6A 2FJ9A 4BKSA 3OJ3A 3HQCA 2D3GA 4JLCA 2KFKB 1Q1OA 2N1WA 3SUZA 1MK7B 3A1QB 1U4AA 2MA9B 2LBBA 3AXCA 4GSWA 4G50A 3A98B 2BYFA 2GMIC 2Y5BB 2MX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZ1 A;  3P7Z A;  3ULC A;  2CB8 A;  2D9W A;  3ZTD A;  3UF8 A;  4JL9 A;  5EFX A;  4DX8 A;  4W9K A;  4LJO B;  2FIF A;  1X11 A;  3H7P B;  3M62 B;  3G9W A;  1XX0 A;  2JPH A;  5L95 C;  2WX0 A;  3PT2 B;  2MBE A;  1UNP A;  2I5C A;  2KHW B;  2R2O A;  3ODW A;  2XBB C;  3RT3 B;  2MCN B;  2O6V D;  3DVG X;  2YLM A;  1XT9 B;  5C5B A;  2D07 B;  2COC A;  5L81 A;  4A6F B;  2KJ6 A;  2KX3 A;  4NJ6 A;  5JHA A;  4AWJ A;  4F7H A;  1KZG A;  5HKH A;  4WWN A;  1IYF A;  4MT7 A;  2RQ1 A;  1U2B A;  2LKO A;  5CLL B;  3F0W A;  1Z87 A;  4B6H A;  2C7N B;  3ULB A;  4KHO A;  4WVF B;  1TGZ B;  4AOF A;  3APD A;  2KTR A;  5CHF A;  2R2Q A;  2GBJ A;  2LUL A;  2C7H A;  2IYD B;  1FOE A;  2FNJ B;  4HAZ B;  1AQC A;  1BT0 A;  2WYQ A;  2VKI A;  3I3T B;  3JYU A;  4W9G A;  2DAJ A;  1Y5O A;  2OJR A;  1LM8 B;  1XD4 A;  1WRD B;  3CSF A;  3VIA A;  2DFK A;  3ML4 A;  1WR1 A;  3H7S A;  4HCP B;  4MDK E;  3QHT A;  4ASW C;  2FDQ A;  2O6V B;  3PPA A;  3QK0 A;  5J3Q A;  1WZ3 A;  3ODX A;  1Z5S B;  2BYV E;  2MWS B;  1L7Y A;  1SIF A;  3WAO A;  5JHB A;  3TMP B;  2ZPY A;  2V76 A;  4W9J A;  3T8M A;  3PVU A;  3K9P B;  4ANV A;  2DKP A;  2D4Q A;  3ZO5 B;  2J7Q B;  4WAA A;  5C6R A;  3GYP A;  2ZCB A;  3VUX A;  4DWF A;  3NZU A;  4WJQ A;  2CKH B;  4XZ4 A;  4N9F 4;  2K1F A;  3SU8 X;  5DHA B;  3PGE A;  3ZLZ A;  4CO7 A;  1A5R A;  3ODO A;  4Z2M B;  2JY6 A;  2DX1 A;  3DVG Y;  1WJU A;  3PV1 A;  3V61 A;  2NVU I;  3TJP A;  3SO6 A;  2K25 A;  1U29 A;  1UBQ A;  2YS1 A;  4PS3 A;  1V6E A;  1MAI A;  3OAN A;  1WXM A;  2DAF A;  1AAR A;  1R4M I;  5JHG A;  2VSZ A;  2W2W A;  1U5E A;  5KQ4 A;  1YQB A;  2UZR A;  4HB4 B;  5LXH A;  4W9F A;  2JRH A;  3PRE A;  1WGD A;  2WWZ A;  4ICV A;  3GOE A;  3R7Q A;  2ZJD A;  3ZDT A;  1XR0 B;  2CQU A;  3KZ1 A;  1J19 A;  2GCL A;  1V5P A;  1NTY A;  4K2P A;  4JGH B;  4MEL A;  1WMH A;  4LCD E;  3ZNI D;  4EOY A;  3V5W A;  3B0A A;  3EPY A;  3FP5 A;  2LOZ A;  1FAO A;  1WM2 A;  2YSZ A;  1P5T A;  5TR5 A;  3ZRF A;  2G45 B;  1DBH A;  2XEW A;  1PLS A;  2AL6 A;  4FA6 A;  1RAX A;  5G55 A;  2L05 A;  4ZYN A;  4HAU B;  1WXS A;  2K8H A;  2L76 A;  2IO2 B;  3HHM A;  4IG7 B;  4KV2 A;  3MDB C;  4NNJ B;  5GMV A;  1WI1 A;  3HM6 X;  3JW0 X;  5KHO A;  1ST7 A;  4A3P A;  4KAX B;  3DDC B;  1MK9 B;  2EMS A;  2LOX A;  3PEG A;  4GZU A;  4TV3 A;  1U5D A;  5LOP B;  4G0N B;  4MGK E;  2XK5 B;  1KLV A;  2J0K A;  5FI1 A;  5HE2 A;  1V5U A;  2LAS A;  2K2U A;  4HXD A;  3U8Z A;  1Q67 A;  5CLQ B;  2OQB A;  2JVC A;  4WJN A;  4BOS C;  4BKG A;  2WDT B;  2ZVN A;  2KN5 A;  4WSF A;  5D27 A;  3WA0 A;  1W1D A;  1WGR A;  3CST A;  4WQO B;  4NSW A;  1E7U A;  1UNR A;  1WX8 A;  2MBO A;  1OQY A;  3OAW A;  2Z0O A;  3PTF C;  2R0D A;  4EKU A;  4EMO A;  4MM3 A;  2HRJ A;  2MP2 B;  4CHJ A;  1UNQ A;  1M94 A;  2C60 A;  3L54 A;  5CX3 A;  4AUQ C;  1UPQ A;  3A33 B;  5CHV C;  3FM8 C;  2IZV B;  3D8E A;  4HHV A;  4P7I A;  1R4N I;  3P6A A;  2M4N A;  5DPR A;  4A3O A;  1RRP B;  1V9J A;  4CYE A;  4JQW C;  2KDB A;  1Q5W B;  4BKT A;  1ZKH A;  3PRM B;  3Q3J A;  2L00 B;  4HB3 B;  3VTU A;  4DHJ D;  2K8C A;  4GDL A;  1UD7 A;  2CS4 A;  2VRW B;  3DBR I;  4KSL C;  3UIO B;  1WF9 A;  2BCJ A;  2KGX B;  4KIK A;  3X0W A;  1WGU A;  2YT1 A;  1BAK A;  2O2V A;  4TUU A;  1OY2 A;  1WI0 A;  1UEL A;  3V6E B;  3KYC D;  2KVR A;  2VRR B;  2J0J A;  4W9E A;  3W1Y A;  1K8R B;  5DIF B;  5C1Z A;  4GDL B;  2Y8F A;  5JP4 A;  1EVH A;  4HB2 B;  1P1A A;  5DHF B;  5E6O A;  1P9D U;  4GN1 A;  1WM3 A;  4EUT A;  2KQ7 A;  2BKF A;  1WGY A;  2CR5 A;  2LWP A;  3AU5 A;  1WE7 A;  2FUH B;  3KUD B;  4HPM B;  1MKE A;  3IVF A;  3L17 A;  4PS7 A;  4DHZ E;  2NZ8 B;  4KSK C;  1NBF C;  2MRP A;  4LDT B;  2DYO A;  1LB1 A;  3L0W B;  4E71 A;  2O6V A;  2ABD A;  2FCQ A;  2KD0 A;  3DVN U;  4RM8 A;  2KAN A;  1N3H A;  2AL3 A;  2ZPN A;  2DX5 A;  1K5G B;  4FHJ A;  1ZVR A;  5DCN A;  4MK0 A;  5DPW A;  5KQ1 A;  3M95 A;  3KUZ A;  2KUP A;  3ZVR A;  1WJ6 A;  3LJU X;  4HAY B;  2IO0 B;  3M63 B;  1LQB A;  2KTF A;  3K9O B;  4NAW B;  5D2M B;  3RYT A;  1SE9 A;  2ZNV B;  4PYZ A;  1V88 A;  4GDK B;  4XWX A;  4KZC A;  5DPT A;  4RMA A;  4DX9 0;  5AZH A;  3QJZ A;  3NHE B;  2GS0 A;  5J3Y A;  2FCM A;  4FUL A;  5LXI B;  4EEW A;  4TYZ A;  1WY8 A;  2L0T A;  2QKL A;  2M17 A;  3BJI A;  3A9J B;  3DOW A;  3KH0 A;  5LLI A;  1RFA A;  1WXA A;  2CAY A;  3L13 A;  2YF0 A;  2IY0 B;  1FXT B;  2K6D B;  1OQN A;  1H4R A;  2IFS A;  2HD5 B;  2BF8 B;  2AEH A;  3KRW A;  2WX1 A;  3DQV A;  4X57 B;  3ZRC A;  1UH6 A;  3BIN A;  2G3Q B;  3A4S C;  2ADZ A;  2NMB A;  3EHV A;  4PS8 A;  1ISN A;  3DXD A;  2ASQ A;  3RUL A;  4BVU C;  4HDQ A;  2C9W B;  1WJN A;  2CHZ A;  4K81 A;  4F1S A;  3IHP C;  4AJW A;  4IM2 A;  2V4L A;  3ZNH B;  2DLW A;  2DYM A;  1Y19 B;  2HJ8 A;  2MBB B;  2D9Z A;  2A4Z A;  1WGQ A;  3WAL A;  4BKS D;  4GMV A;  1OEY J;  2MBQ A;  3LJ3 A;  3NZS A;  4I6P A;  1LW3 A;  1EF1 A;  1WJ1 A;  2H7D A;  4H8S A;  2BPS A;  2LVP A;  2N9E B;  2ZNV C;  1K5D B;  2V1Y A;  4I6L B;  4DDI D;  4DHZ B;  5DI9 B;  2MFQ A;  4HAX B;  1V89 A;  3SD5 A;  2KDE B;  3L10 B;  2GJY A;  1PQS A;  1FB8 A;  5AZF A;  2RNR B;  3ALB A;  3S2A A;  4DXA B;  1NVL A;  2KKC A;  2K39 A;  1XQQ A;  3PRZ A;  1HBK A;  2KWU B;  1X1M A;  3ZIM A;  3NY5 A;  1PFJ A;  3HW2 B;  2D2Q A;  4IUM B;  2XQN M;  2MP2 A;  3UZT A;  3TBL D;  2LYD A;  2ROV A;  2DZM A;  3UIN B;  4DBB A;  3RCP A;  3Q3F A;  2MW5 A;  2P0D A;  1TZ1 A;  1TQZ A;  2KWC A;  3VXW A;  4OVU A;  4DHJ B;  2ZCC A;  3ECI A;  3ML8 A;  5L83 A;  2YRY A;  2IYB A;  1XCG A;  1QZE A;  1X1F A;  1WGH A;  2K6Q A;  2RSU A;  4K2O A;  2Y7B A;  1C1Y B;  2D11 A;  2D9Y A;  3VAW A;  1GC7 A;  1RJ2 A;  4MY6 A;  4CHM A;  2L2I A;  1GNU A;  1BTN A;  4K17 A;  5HE0 A;  2DYQ A;  3N3K B;  3W1S A;  2OOB B;  3IG3 A;  2QHO A;  2BGF A;  1W1H A;  4IOY X;  5C5B B;  4IC7 B;  1HB8 A;  3QIJ A;  1LXD A;  1V61 A;  4K7S A;  5D3X A;  2MQJ A;  2ZEQ A;  4BKS A;  2W9N A;  5IA7 A;  2UWQ A;  1Y8R C;  2LRU A;  1TJ6 A;  2YT0 A;  3UIP B;  4KDL B;  3EFU A;  1C3T A;  4NY0 A;  4GIV A;  4EZJ A;  5G2N A;  4MSM B;  1L2N A;  4RM9 A;  3VUY A;  4PQ0 A;  2KQS A;  1DDM A;  4EFO A;  3H7P A;  2PE9 A;  2COA A;  5CHW A;  2RPQ A;  2PEA A;  1E7V A;  3RZW C;  1WG7 A;  1P98 A;  1OGW A;  1J0W A;  4FJV B;  4ANU A;  5HE1 A;  1V49 A;  3MJW A;  3DVN V;  2EC1 A;  3T06 A;  5D94 A;  2HTH B;  3PLV A;  1MIX A;  2N7D A;  2RLO A;  4FN2 A;  2R09 A;  5D3Y A;  4Y94 A;  4A5K A;  1XKE A;  3CMM B;  5KCV A;  3D8F A;  1WGG A;  1U27 A;  3FEH A;  1YD8 U;  2COP A;  2KDF B;  2KFJ A;  2CU1 A;  5IJM A;  2P8V A;  2JF5 A;  3EC8 A;  2CY5 A;  3A8P A;  1V81 A;  3PHW B;  3QX1 A;  2KTR B;  3N32 A;  4HK2 A;  4II3 B;  4BBN C;  5C23 A;  3M3J A;  3SYX A;  2LGD A;  4BBK A;  1E90 A;  1HE8 A;  3N30 A;  3KW5 B;  3R7R A;  2W2X D;  3A9K A;  3VTW A;  1LFD A;  1X86 A;  4BFR A;  4EZL A;  1WMH B;  4E74 A;  2KK8 A;  1J0G A;  1WE6 A;  2A5U A;  1FGZ A;  2CRF A;  2I1K A;  1WX7 A;  4YL8 A;  2JUO A;  3U30 A;  2J0M A;  2YS5 A;  4Z2N A;  2UVM A;  3A8Q A;  5D3V A;  5LON B;  4GGQ A;  2M1M A;  1W1G A;  1V5T A;  3QWZ B;  4WWP A;  4F8C B;  4FAD A;  2L8J A;  3FSS A;  3A9K B;  4EZK A;  4JIO U;  4XC2 A;  2JZ3 B;  1I2H A;  4L6E A;  4PNK A;  2LUE A;  1QQG A;  2DEN B;  4M8M A;  4B9K A;  3VH3 B;  1H8C A;  2DTC A;  1BWN A;  5D7G A;  3VFK A;  2KLC A;  2L1C A;  2AYO B;  1YIW A;  1EAZ A;  1V5M A;  1SHC A;  3SHQ A;  2DHZ A;  2JWZ A;  4M8N A;  1MIZ B;  1H10 A;  2DKQ A;  3JSV B;  4IW0 A;  4MSQ B;  4OVV A;  2MSE D;  5E6N A;  3EEC A;  2NCN A;  3QBV B;  4FLH A;  2E2X A;  3ZVV A;  2COD A;  1MPH A;  3QAR A;  2MKR A;  3KSY A;  2JZZ A;  3KRX A;  4MGY E;  1VD2 A;  2D10 A;  2N9X A;  3OJ4 B;  2M8S A;  3RD2 A;  1WVH A;  2Z0P A;  2UYZ B;  4W9C A;  2JP2 A;  4HAT B;  2I1J A;  1TBE A;  1OMW A;  4K7W A;  4KIK B;  4LDT D;  1G6J A;  3HM3 A;  1WJ4 A;  3PP2 A;  2L0F A;  2LGY A;  3GZN I;  1WXV A;  4NQK E;  3V60 A;  3VTV A;  1ZW7 A;  1GJZ A;  5KHQ A;  2DA0 A;  4MGZ E;  3UQA A;  5AZG A;  2GBK A;  1KM7 A;  2C5L C;  1I7A A;  3F5R A;  2DYB A;  3D32 A;  2Z0D B;  1NDD A;  2KNB A;  3O65 B;  3WAP A;  2KZR A;  2N9P C;  1UBI A;  2KDI A;  2LXA A;  4WJO A;  1EF5 A;  3TIX A;  4A6F A;  3AJ4 A;  2LZ6 A;  3VOQ A;  2JRI B;  4DK5 A;  2DZK A;  1B55 A;  1V5O A;  1I35 A;  4M0W B;  3NSU A;  2Y8G A;  2KJR A;  1J8C A;  2BWF A;  4GPT B;  2RGF A;  1I42 A;  2OTX A;  2RGN B;  2ROZ B;  2GBR A;  5FI0 A;  1ZSQ A;  2DX5 B;  2HTH A;  2Z59 B;  3DBL I;  3ZTC A;  1YJ1 A;  4HWI B;  1U5G A;  2FID A;  3SNH A;  5C16 A;  5J18 A;  2PE6 B;  1IPG A;  2IY1 B;  3W1S C;  3SV1 A;  2DN6 A;  2M14 A;  4CHK A;  3A4R A;  2CY4 A;  5HE3 A;  2B3A A;  3ML9 A;  1KJT A;  4IWO A;  1P6S A;  3OLM D;  2KXJ A;  3WYF B;  3DBH I;  4A6K A;  2CHW A;  4URK A;  4YON A;  4LJP B;  4ZRI A;  3TVV A;  3VH4 B;  2DHI A;  4FJZ A;  4HLE A;  3NOB A;  2GBN A;  2EMT A;  4HAW B;  3TW1 A;  4WJ7 A;  3TL5 A;  3WIM A;  4D0N B;  1D3Z A;  4MH0 E;  2MLB A;  1P3R A;  4G3X B;  4BBN F;  2LGX A;  4I6N B;  3PVW A;  1WYW B;  2KOX A;  2YS3 A;  2NBV B;  1Q0W B;  2RUK B;  2KX0 A;  3MTN B;  4PYU A;  2RVB B;  1F9J A;  5CTR C;  2IBI B;  4HDO A;  3TO1 A;  2G4D B;  1ZC3 B;  2MDX A;  2L3Z A;  2REX A;  1KI1 B;  1UEF A;  3PSC A;  1WR6 E;  3C0R B;  2M0X A;  4IWP A;  5E6P A;  3RCZ A;  3WAN A;  3R66 C;  4ZRJ A;  4FJY A;  3KYD D;  2DZJ A;  2EJ8 A;  3CXB B;  1WZ0 A;  2FJL A;  2IO3 B;  1TXD A;  2N1V A;  2NPT B;  4K7U A;  4NPN A;  2W2X C;  3UGB B;  3TCA A;  3CIK A;  1P3Q U;  3NS8 A;  3ZNG C;  4IWQ A;  4HCN B;  3JVZ X;  1KZ7 A;  2Z0E B;  1GC6 A;  3LDZ E;  5BO4 B;  1E8Z A;  2LVQ A;  3PZD A;  4ZRK A;  2X18 A;  1WH3 A;  3DXC A;  4G11 A;  2JT4 B;  1OEY A;  4IM0 A;  2LG1 A;  3DPD A;  4W9L A;  2BWE S;  3PSE B;  1XOD A;  4GMX B;  1BTK A;  3A1Q A;  2FCN A;  3QWM A;  4B95 A;  2KC2 A;  3SDL C;  2KO3 A;  1FGY A;  3KVF B;  2WH5 A;  2FCS A;  1DDW A;  2LXC A;  3APF A;  4XX5 A;  1M7R A;  4FBJ B;  2M38 A;  1M7E A;  1EUV B;  1GG3 A;  2N0Y A;  2NS5 A;  2O2V B;  2KFK A;  3MHS D;  1PMS A;  2RD0 A;  1ZC4 B;  4HVB A;  4B6W A;  2GOW A;  2BYE A;  1FHX A;  2LJ5 A;  2KLG A;  3PLU A;  2NBU A;  2FAZ A;  3QAQ A;  2PJH A;  3MPX A;  4GU2 A;  4ZDV A;  4KVG B;  3BY4 B;  3JSV A;  1V2Y A;  1Z2M A;  1CMX B;  1QC6 A;  5EDS A;  4HAV B;  2RR9 A;  2K8B A;  3PS6 A;  1E5W A;  3IFW B;  4DDG D;  4KHB B;  3FLV A;  2H7E A;  3B08 A;  1OTR B;  1WFY A;  4AP4 C;  3X23 A;  3DXE A;  3GYO A;  4KHA A;  1UZX B;  2D9V A;  2N4F A;  1S3S G;  4EJN A;  3HIZ A;  4TQ0 A;  3UQB A;  4E3C A;  3AU4 A;  4TKN A;  3VDZ A;  3WAM A;  1ZM0 A;  4FHK A;  5IAA C;  3ZUN A;  3HK0 A;  3KY9 A;  1FHO A;  3ZNZ B;  4F7Z A;  2MWN B;  5J17 A;  3O96 A;  1DRO A;  2BKR B;  3RZF A;  1AWE A;  1DYN A;  2KWV B;  3AUL A;  2K00 A;  3ZW3 A;  3PVL A;  3VHT C;  1P0R A;  4W9I A;  1EGX A;  3B1L X;  4GDK A;  2ELA A;  3U7D A;  2IO1 B;  2DHK A;  3N7C A;  3PHX B;  3QCA A;  4HPL B;  2GBM A;  4K1R B;  4MEM A;  4KZ0 A;  1UGM A;  1ZGU B;  4MGI E;  2UZS A;  5D3W A;  1T0Y A;  3PG7 A;  1WX9 A;  3AI5 A;  3A9J A;  4NQL B;  1IRS A;  2ZVO A;  3APC A;  2JXX A;  3QC8 B;  4IAP A;  1E8X A;  4II2 B;  1NU2 A;  3QA8 A;  3ZKJ C;  1NTV A;  3R3M A;  2KJH B;  3ZDM C;  4BOZ B;  1S1Q B;  1IP9 A;  1TTN A;  3DBS A;  4MJS A;  3CF6 E;  3ENE A;  1E8Y A;  1JRU A;  3DCG A;  4KDI C;  2DHJ A;  2MBH A;  1WJM A;  2EKE C;  4HJK A;  5AEK B;  1X05 A;  2AWT A;  4DBG A;  4GOC A;  2NR2 A;  5J2R A;  2LRW A;  3L16 A;  5JZE B;  2RSG A;  1GUA B;  2Q13 A;  2Z0Q A;  1MG8 A;  4GXB A;  2QKM A;  3D8D A;  4IFS A;  5DPS A;  3QQ8 B;  4W9H A;  4MJS B;  1NTI A;  4AJY B;  3M1I B;  5J3T A;  1V80 A;  4ANW A;  2ZZP B;  2I5F A;  4ICU A;  2G35 A;  3IBE A;  3VQI A;  4A6H A;  2GCJ A;  2YVC A;  1HB6 A;  2KCJ A;  2NBW B;  2V3S A;  4GB9 A;  4IM3 A;  4ANX A;  3T9L A;  2NPT A;  4W9D A;  1DDV A;  1E8W A;  4F7G A;  1NI2 A;  2J59 M;  2P0F A;  1X1G A;  2C7M B;  1SGH A;  2KMC A;  3H6N A;  4J6I A;  2COF A;  1XD3 B;  4NAW A;  5D6J B;  2FJ9 A;  5FR6 A;  4A20 A;  4HB0 B;  1EO6 A;  2HE7 A;  2N23 A;  3HQC A;  5JLJ B;  2D3G A;  3OJ3 A;  2KMA A;  3PRP B;  4JLC A;  2KC1 A;  2KFK B;  4C0A A;  2CHX A;  2G4S A;  1U5F A;  2P0H A;  1Q1O A;  1V86 A;  3H1U A;  3H9D A;  3KUC B;  4TQ1 A;  4WWO A;  3VVW B;  3RUI B;  1VCB A;  4F7U P;  1UPR A;  2K2J A;  2N1W A;  1KOT A;  2LVO A;  2PPH A;  3SUZ A;  1MK7 B;  3A1Q B;  3L08 A;  2DZI A;  2L7R A;  2DYN A;  1U4A A;  1ACA A;  2XK5 A;  4WJP A;  5C79 A;  2MA9 B;  2LBB A;  1YX5 B;  3AXC A;  1WIA A;  3P2B A;  2D9X A;  3A98 B;  5DH9 B;  2BYF A;  4G50 A;  4GSW A;  3VUW A;  3V6C B;  1FHW A;  2LD9 A;  1RRB A;  5JHH A;  2GMI C;  3V62 A;  5GOW B;  4NJ7 A;  5JH5 C;  3TFM A;  1RLF A;  2ELB A;  2N7E A;  2Y5B B;  1YX6 B;  3ONS A;  2MX2 A;  2LI5 A; 
#chains in the Genus database with same CATH topology
 3P7Z A;  3ULC A;  2D9W A;  2WXJ A;  3ZTD A;  4LNF A;  5EFX A;  3NWD A;  2IGG A;  2FIF A;  2WS3 B;  5L95 C;  3G9W A;  2WX0 A;  3PT2 B;  2XBB C;  1HEZ E;  3RT3 B;  2KHW B;  3KWL A;  2N9K A;  2YT2 A;  2O6V D;  3DVG X;  2L1A A;  5L81 A;  2KX3 A;  4L23 A;  2CJO A;  1OFF A;  1L0V B;  1MG4 A;  2WLB A;  3GZN B;  4KHO A;  3DWG C;  4WVF B;  4JK8 A;  2YEP B;  2LUL A;  1PGB A;  2C7H A;  2IYD B;  2FNJ B;  1BT0 A;  1AQC A;  3I3T B;  1T0S C;  2VKI A;  3FIL A;  2DAJ A;  1WR1 A;  2LJI A;  2AQ1 B;  1HZ6 A;  1KTK A;  4ASW C;  5LXI B;  5J3Q A;  3T8M A;  3PVU A;  2J7Q B;  4WAA A;  2ZCB A;  4N9F 4;  3SEB A;  2K1F A;  3SU8 X;  2KDM A;  1A5R A;  4Z2M B;  1WJU A;  1L5P A;  3MHZ A;  4A20 A;  1MAI A;  3OAN A;  1R4M I;  5LXH A;  5KQ4 A;  4HB4 B;  4W9F A;  4JK7 A;  3GOE A;  1XR0 B;  1DOI A;  4RF1 A;  4JE3 B;  1NTY A;  4K2P A;  2DLB A;  4MEL A;  3TUO A;  2GI9 A;  1TS5 A;  2XEW A;  2AL6 A;  3I57 A;  5G55 A;  4HAU B;  1WXS A;  2K8H A;  4KV2 A;  2IO2 B;  1NEK B;  2KIE A;  1WI1 A;  3JW0 X;  5KHO A;  1EM7 A;  2KYW A;  5D3D A;  3U52 E;  2Z13 A;  3DDC B;  1MK9 B;  3B2G A;  4ZYS A;  1U5D A;  1KLV A;  2J0K A;  1HXY D;  1B1Z A;  2OQB A;  4LTU A;  3WA0 A;  4ITK A;  1UNR A;  4XGA B;  1OQY A;  2KWD A;  2WQY B;  5CX3 A;  2C60 A;  1JML A;  3L54 A;  4FBJ B;  4P7I A;  1R4N I;  1GB4 A;  2KDB A;  4N59 A;  2KR0 A;  4GDL A;  3UIO B;  1YQ3 B;  2KGX B;  3X0W A;  3N1Z C;  1WGU A;  2UU7 A;  2KT7 A;  2KVR A;  2J0J A;  1J7C A;  5C1Z A;  3AB5 A;  3AEF B;  1DIK A;  2Y8F A;  1RYJ A;  3N20 C;  4HB2 B;  1P1A A;  1P9D U;  4N58 A;  2LWP A;  2K3U A;  2FUH B;  4ACF A;  3P4Q B;  4P1C C;  4LDT B;  1VZ8 A;  4RM8 A;  2FCQ A;  1EU3 A;  2KAN A;  2KVZ A;  2ZPN A;  4MK0 A;  3M95 A;  5EE9 A;  3M63 B;  3LJU X;  4HAY B;  4NAW B;  4D6W A;  1LQB A;  2X8X X;  5DPT A;  4RMA A;  4DX9 0;  3QJZ A;  2GS0 A;  2OHF A;  4EEW A;  2GUM A;  1N5W A;  2M17 A;  1SE4 A;  3A9J B;  2M0A A;  4RCO A;  1H4R A;  4X57 B;  3LXF A;  2G3Q B;  1C77 A;  3TEZ A;  2BYT A;  3DXD A;  2XNA C;  3RUL A;  1XXG A;  4BVU C;  3NWF A;  4IM2 A;  4JX1 C;  1F77 A;  3ZNH B;  1F52 A;  2RMM A;  4LDT D;  3NZS A;  1EF1 A;  1WJ1 A;  1FD6 A;  5DI9 B;  2MFQ A;  2KDE B;  3L10 B;  3GE3 C;  2I2Y A;  1FB8 A;  3NRZ A;  3PRZ A;  3BZD B;  1RFK A;  2LYD A;  3AE5 B;  1TZ1 A;  3ZJV A;  2KWC A;  5L83 A;  1D5Z C;  1QZE A;  1WGH A;  2K6Q A;  2Y3A A;  3VAW A;  1GC7 A;  4K17 A;  5HE0 A;  1JQ4 A;  2BGF A;  1JWS D;  1LXD A;  1V61 A;  5D3X A;  2MQJ A;  3AEG B;  2W9N A;  1TJ6 A;  1C3T A;  4EZJ A;  5G2N A;  1V8C A;  2WHI A;  2KQS A;  2PE9 A;  1HQR D;  1YJI A;  1ZDX A;  2PEA A;  1OGW A;  3DVN V;  2EC1 A;  1XLO A;  3PLV A;  2R09 A;  1L4Z B;  5KCV A;  1YD8 U;  3FEH A;  2CU1 A;  5IJM A;  2P8V A;  2JF5 A;  4BBN C;  3QX1 A;  4II3 B;  2KTR B;  1NVI D;  1BXT A;  2D5G A;  3BYY B;  3N30 A;  3RNA C;  2W2X D;  1X86 A;  1WMH B;  1YNT E;  1ET6 A;  1WE6 A;  2LGI A;  2A5U A;  2CRF A;  3NVZ A;  4MH8 A;  4YL8 A;  3U30 A;  1N5X A;  2MEK A;  3RPF C;  1V5T A;  4WWP A;  3SR6 A;  3A9K B;  2LGS A;  4JIO U;  2JZ3 B;  1Q10 A;  2GRI A;  4M8M A;  2W54 A;  1BWN A;  1ET9 A;  5D7G A;  2AYO B;  1YIW A;  2L32 A;  1V5M A;  1SHC A;  3SHQ A;  2DHZ A;  4M8N A;  4OVV A;  4OZB A;  3SBT A;  5E6N A;  1UWX A;  2COD A;  3HSA A;  3KRX A;  1XLP A;  2M8S A;  3RD2 A;  4HKQ A;  1OMW A;  3GP7 A;  4ARI A;  1G6J A;  1K51 A;  3P4R B;  1WXV A;  5M4Y B;  1NYR A;  1ZW7 A;  1GJZ A;  3UQA A;  4MGZ E;  2GBK A;  3OAW A;  2VH2 A;  3BWU D;  1NDD A;  3WAP A;  2KDI A;  3TIX A;  1EF5 A;  3AJ4 A;  3VOQ A;  2DZK A;  2QCZ A;  1I35 A;  5AUI A;  3NSU A;  5IO9 A;  2Y8G A;  2HJ1 A;  4L1B A;  1YOV B;  1P7F A;  3MC8 A;  2Z59 B;  1V1O A;  2DX5 B;  2HTH A;  5EE0 A;  1U5G A;  4GOU A;  3BYT B;  5C16 A;  5FKA C;  3BK1 A;  4IWO A;  4A6K A;  4BAX A;  1OQQ A;  4URK A;  4LJP B;  3TVV A;  2DHI A;  3FC4 A;  4HAW B;  1XF5 L;  3ZGZ A;  1D3Z A;  2FJU B;  2H88 B;  4I6N B;  3PVW A;  5IOI A;  4XDD A;  3TEY A;  3IAM 1;  2RVB B;  4C7Z A;  1ZC3 B;  2MDX A;  4OVU A;  5G5H A;  1UEF A;  5E6P A;  3Q3O C;  1GAQ B;  4ZRJ A;  2D3C A;  4FJY A;  3KYD D;  2IO3 B;  4K7U A;  4NPN A;  3UGB B;  2K8E A;  1YQ4 B;  3TCA A;  3CIK A;  1PUT A;  4IWQ A;  1WYG A;  2Y5C A;  2LVQ A;  3P63 A;  2LHE A;  1OEY A;  2LG1 A;  3DPD A;  4W9L A;  4H2A A;  3RMK C;  3SDL C;  4UDU C;  3APF A;  3KQ4 A;  2N0Y A;  3OWE B;  4B6W A;  3ZO5 B;  5C2T B;  3I9V 1;  3Q8B A;  4LK0 M;  4HAV B;  3PS6 A;  1E5W A;  2WNM A;  4KHB B;  3X23 A;  3DXE A;  4KHA A;  2N4F A;  2D9V A;  2PVG C;  1VZ7 A;  1HZ5 A;  4O1N A;  3WAM A;  1CQV A;  4WH4 A;  2JQR B;  2PIA A;  3ZNZ B;  5J17 A;  1DRO A;  2WXL A;  2BKR B;  2DIK A;  3RZF A;  3FVC A;  3NW8 A;  1CZP A;  2KWV B;  2LEK A;  1P0R A;  3SBG A;  3B1L X;  2J52 A;  3N7C A;  1I4X A;  3ETR A;  1ZGU B;  2UZS A;  3PG7 A;  4NQL B;  3A9J A;  4II2 B;  4IAP A;  1NTV A;  3ZDM C;  2KJH B;  1DOY A;  2FUG 1;  2HDE A;  4BOZ B;  1IP9 A;  2WXK A;  4MJS A;  3CF6 E;  3ENE A;  1E8Y A;  1JRU A;  2R2Y A;  5AEK B;  2PTL A;  2NR2 A;  4C4V B;  2LRW A;  1UWM A;  2JXT A;  2Z0Q A;  2QKM A;  4IFS A;  4AJY B;  3QQ8 B;  3M1I B;  2N7J A;  4JKH A;  2ZZP B;  2I5F A;  4ICU A;  4A6H A;  2NBW B;  3B9J A;  3ZYY X;  1KBL A;  1E8W A;  4F7G A;  2J59 M;  2SAK A;  1X1G A;  1XD3 B;  1EO6 A;  2N23 A;  1EWY C;  2KC1 A;  3H9D A;  2P0H A;  1V86 A;  3H1U A;  3KUC B;  4LNK A;  4JWS C;  3RUI B;  4F7U P;  4KGS A;  4QAY A;  2WXP A;  3L08 A;  1L6V A;  4C00 A;  2DYN A;  5HFY A;  3P2B A;  3VUW A;  1SEB D;  1FHW A;  2LD9 A;  2W82 A;  1RRB A;  3FAH A;  3V62 A;  5GOW B;  1RLF A;  1YN4 A;  2W3R A;  2BS3 B;  2CB8 A;  1QKZ A;  4HSI A;  4NAM A;  4DX8 A;  4W9K A;  1X11 A;  1XX0 A;  3DBH B;  2R2O A;  2I5C A;  3ODW A;  3RNF C;  4ZHP A;  1XT9 B;  1J7A A;  2KJ6 A;  4NJ6 A;  3Q8E A;  1KZG A;  4WWN A;  5CLL B;  3ULB A;  2V9H A;  2KTR A;  2R2Q A;  4HAZ B;  2WYQ A;  1FMA D;  3JYU A;  5D94 A;  1Y5O A;  3E9S A;  1LM8 B;  1WRD B;  4MDK E;  3VIA A;  4HCP B;  2NTS A;  2FDQ A;  2O6V B;  3PPA A;  1WZ3 A;  2WP9 B;  3ODX A;  2BYV E;  1L7Y A;  2RDB C;  2V76 A;  4W9J A;  1ZDV A;  1TS4 A;  4WJQ A;  4XZ4 A;  5DHA B;  4CO7 A;  4C4V A;  1ZYI A;  2K25 A;  1UBQ A;  2YS1 A;  1AAR A;  2VSZ A;  1U5E A;  4TSS A;  5BMI A;  2WWZ A;  4ICV A;  3R7Q A;  2DNF A;  2R82 A;  2CQU A;  1J19 A;  2GCL A;  1VBG A;  3MJ5 A;  3V5W A;  3B0A A;  3EPY A;  3IT6 B;  2LOZ A;  1FAO A;  1I7H A;  3ZRF A;  2BBC A;  2G45 B;  1AN8 A;  1DBH A;  4FA6 A;  4AS1 A;  1NEN B;  2JYT A;  3MDB C;  3W2D A;  3VR8 B;  1ST7 A;  2LOX A;  4GZU A;  4G0N B;  1ROE A;  2LAS A;  1Q67 A;  5CLQ B;  1VLB A;  2ZVN A;  1WX8 A;  4WWM A;  3ZQ4 A;  3PTF C;  2Z0O A;  2QMT A;  2I38 A;  4JWU C;  4CHJ A;  1TIF A;  4RF0 A;  3A33 B;  4MT5 A;  5CHV C;  4JKE A;  3D8E A;  4HHV A;  1IGC A;  3EFC A;  4JQW C;  2QIL A;  2L00 B;  2IND C;  2BCJ A;  4KIK A;  2YT1 A;  2O2V A;  3V6E B;  3DBR B;  1WI0 A;  1VZ6 A;  4W9E A;  4GDL B;  1AYF A;  5E6O A;  5FR3 A;  2BKF A;  4J3O D;  3P4P B;  3AU5 A;  4YTM B;  1MKE A;  3L17 A;  1FXI A;  2MRP A;  3L0W B;  4E71 A;  2O6V A;  2KD0 A;  3DVN U;  1N3H A;  4US9 A;  1ZVR A;  5KQ1 A;  3KUZ A;  3ZVR A;  3VR9 B;  3K9O B;  1SIJ A;  4GDK B;  4XWX A;  1RM6 C;  4PT5 A;  5AZH A;  4S17 A;  3BK2 A;  3LB8 C;  2L0T A;  1XEE A;  1RFA A;  1WXA A;  1FXT B;  2K6D B;  3ZRC A;  3DQV A;  5KHQ A;  1UH6 A;  3BIN A;  2ADZ A;  1ESF A;  2WDR B;  2ASQ A;  2C9W B;  2CHZ A;  1IBX B;  4K81 A;  3IHP C;  1A70 A;  2DLW A;  2MBB B;  2ZW1 A;  1LGR A;  4BKS D;  2MBQ A;  1QOB A;  3LJ3 A;  4B95 A;  2H7D A;  2LVP A;  2N9E B;  4I6L B;  1DOX A;  2NTT A;  2V1Y A;  4DDI D;  3P1M A;  2GJY A;  5AZF A;  3ALB A;  4ILJ A;  4DXA B;  2JX5 A;  3N1Y C;  3SFE B;  5BMH A;  2WDQ B;  3ZIM A;  1HA5 A;  3HW2 B;  5EDS A;  3UZT A;  2DZM A;  2MW5 A;  3RNE C;  4WQM A;  4DHJ B;  2YRY A;  2IYB A;  2D9Y A;  2INN E;  2IDY A;  5T8I A;  3U4E G;  4DQO C;  1GNU A;  1BTN A;  2R61 A;  3W1S A;  4CQN A;  2OOB B;  4IC7 B;  1W1H A;  4E74 A;  2ZEQ A;  1Y8R C;  2YT0 A;  3UIP B;  4NY0 A;  4GIV A;  4JKA A;  1L2N A;  4YSX B;  4EFO A;  1DDM A;  3ENB A;  2COA A;  4P1B C;  1EWC A;  1DYQ A;  3RZW C;  4FJV B;  5HE1 A;  2KUQ A;  3MJW A;  1UNS A;  1MIX A;  1FFV A;  2K49 A;  1JCK B;  4FN2 A;  5D3Y A;  1XKE A;  3CMM B;  3D8F A;  3N32 A;  5C23 A;  2LGD A;  1CK1 A;  3R7R A;  3VTW A;  3AEC B;  2W3S A;  1J0G A;  2PKO A;  1FGZ A;  1JWM D;  1ZOY B;  4Z2N A;  1KFY B;  3A8Q A;  4F8C B;  1I2H A;  4B9K A;  1FM0 D;  3AE9 B;  2JWZ A;  1AW7 A;  2NCN A;  2Z8L A;  4FLH A;  3ZVV A;  1MPH A;  2FBW B;  2MKR A;  2LHD A;  1VD2 A;  2N9X A;  3OJ4 B;  4B0M A;  2PLP A;  2JP2 A;  4HAT B;  3PP2 A;  2LGY A;  3GZN I;  4USA A;  1TZO A;  1KM7 A;  2C5L C;  2DYB A;  2KNB A;  2N9P C;  4QJ3 B;  3I63 C;  1MI0 A;  1TY0 A;  4A6F A;  1V5O A;  4M0W B;  3A58 A;  2TSS A;  3MFG A;  2GBR A;  1WGK A;  3HVZ A;  5FK9 C;  1XLN A;  1YJ1 A;  1ZUD 2;  5E6J A;  3SNH A;  4OT1 A;  4KGR A;  2W55 A;  3W1S C;  2DN6 A;  3A4R A;  2CY4 A;  3ML9 A;  1R4N B;  3OLM D;  2KXJ A;  2IGD A;  4HLE A;  1JRO A;  2GBN A;  1VDV A;  4LNO A;  4WJ7 A;  3WIM A;  1P3R A;  4G3X B;  4P16 A;  2LGX A;  1TJE A;  4AQ7 A;  2KOX A;  4HEA 1;  2NBV B;  2RUK B;  4PYU A;  5CTR C;  2IBI B;  4HDO A;  1QQR A;  4TMA B;  3C0R B;  1STE A;  5IRS A;  1FXA A;  2WXM A;  1JWU D;  2EJ8 A;  2Q5W D;  3CXB B;  1WZ0 A;  1TXD A;  2YEP F;  4C7Y A;  1P3Q U;  3NS8 A;  1DGJ A;  3E9P A;  3JVZ X;  1KZ7 A;  2Z0E B;  3LDZ E;  5BO4 B;  1YN3 A;  3DXC A;  2BT6 A;  4YTP B;  4OZA A;  1XOD A;  3U2S C;  2KC2 A;  1PYW D;  2KO3 A;  3KVF B;  1DDW A;  4M02 A;  1M7R A;  2M38 A;  3MHS D;  2O2V B;  4R3D A;  2WU2 B;  2RD0 A;  4HVB A;  1ZC4 B;  2BYE A;  1FHX A;  2KLG A;  2V3N A;  3QAQ A;  4ZDV A;  4GU2 A;  2PJH A;  4KVG B;  3JSV A;  1V2Y A;  1N60 A;  1CMX B;  1BML C;  3IFW B;  3FLV A;  2D3B A;  2H7E A;  1WFY A;  4AP4 C;  3GYO A;  4EJN A;  3ZXR A;  3VDZ A;  4FHK A;  4ZOH C;  1RWS A;  2VZK B;  2Y5P A;  3O96 A;  5BYS A;  2OED A;  2K0P A;  1AWE A;  1DYN A;  2RPV A;  4B0E A;  4GDK A;  3U7D A;  2IO1 B;  3QCA A;  4KZ0 A;  1T0Y A;  1IRS A;  2ZVO A;  1GPX A;  1D4B A;  3B77 A;  4N6E B;  3DBS A;  3R8B A;  1WJM A;  2KMM A;  4HJK A;  4GOC A;  1JRP A;  5J2R A;  3L16 A;  1FPY A;  2Q13 A;  4GXB A;  3T3N A;  4W9H A;  4MJS B;  2WXR A;  4P6V F;  2MJ3 A;  3IBE A;  4GB9 A;  1HB6 A;  2HTM E;  2WXO A;  4DXF A;  2D3A A;  1DDV A;  1NI2 A;  4BKT A;  4NAW A;  1C4C A;  4J6I A;  2COF A;  1IUE A;  4GLS C;  4HB0 B;  2HE7 A;  5JLJ B;  3PRP B;  2KMA A;  4C0A A;  2CHX A;  2E6X A;  1U5F A;  4LNN A;  1HTO A;  1L0Y B;  2PW9 A;  2J4X A;  1KOT A;  2PPH A;  1T3Q A;  4JKG B;  2DZI A;  2L7R A;  1ACA A;  2PMV A;  5C79 A;  1JDE A;  1YX5 B;  5HI1 A;  5DH9 B;  2X0S A;  1E7P B;  2WXI A;  3V6C B;  3RNG C;  4NJ7 A;  4LLG M;  5JH5 C;  2N7E A;  1KC7 A;  1QOA A;  3ONS A;  3AE7 B;  5I4D A;  4JL9 A;  1FIQ A;  4LJO B;  3M62 B;  3Q8C A;  2JPH A;  4REZ A;  5C5B A;  2D07 B;  2COC A;  3Q3M C;  4A90 A;  4A6F B;  1JAL A;  1C9F A;  5JHA A;  4AWJ A;  4F7H A;  4MT7 A;  2LKO A;  3F0W A;  1Z87 A;  1MPE A;  4AOF A;  3CIR B;  4S0R A;  2OJR A;  1XD4 A;  3H7S A;  4ILG B;  1K50 A;  1J7B A;  1Z5S B;  4QXA B;  1SIF A;  3TMP B;  2ZPY A;  4ANV A;  2D4Q A;  3VUX A;  4DWF A;  5C6R A;  2H89 B;  4JK9 A;  3NZ3 A;  2CKH B;  2WDV B;  1PDX A;  1VJK A;  3PGE A;  4LNI A;  3ODO A;  3AMZ A;  1SB3 C;  3DVG Y;  2NVU I;  3SO6 A;  2DAF A;  5JHG A;  3RNB C;  3ABV B;  2JRH A;  3PRE A;  1GGO A;  3ZDT A;  1V5P A;  1K53 A;  4JGH B;  4EOY A;  1WMH A;  4LCD E;  2N9L A;  3ZNI D;  5LNK 1;  1QIL A;  1RAX A;  2L05 A;  4ZYN A;  3HHM A;  4IG7 B;  5TSS A;  4JKD A;  3DHG C;  3DHH C;  4A3P A;  1TT5 B;  3O13 A;  3PEG A;  5LOP B;  4HRS A;  4MGK E;  5FI1 A;  1V5U A;  4HXD A;  1UGJ A;  2JVC A;  4BKG A;  2WDT B;  4WSF A;  2BW2 A;  4WQO B;  3E66 A;  1QF6 A;  4JKC A;  4NSW A;  1ZXH A;  2MBO A;  1GB1 A;  2R0D A;  4EKU A;  4ILH A;  2DBY A;  3V3X A;  2BB5 A;  2MP2 B;  1UNQ A;  2MHJ A;  4AUQ C;  1YJJ A;  2IZV B;  1KF6 B;  4A3O A;  3P6A A;  4CYE A;  3AM9 A;  4JKF A;  1ZKH A;  3VTU A;  2K8C A;  2CS4 A;  3DBR I;  2VRW B;  1WF9 A;  2G9H D;  3DBL B;  1E10 A;  1QT9 A;  3PO0 A;  4TUU A;  3KYC D;  4D2K A;  4ARC A;  5HHD G;  2ZKM X;  1K8R B;  5DIF B;  1JWA D;  4FXC A;  3T3O A;  3EA6 A;  5JP4 A;  1EVH A;  4GN1 A;  4EUT A;  2KQ7 A;  1WGY A;  2BS4 B;  5JVL A;  1L4D B;  3BII D;  3IVF A;  4PS7 A;  4DHZ E;  2NZ8 B;  4KSK C;  2DYO A;  2B76 B;  1SE2 A;  2WXF A;  2AL3 A;  2DX5 A;  5DCN A;  3FIL B;  2VH1 A;  2IO0 B;  2KTF A;  3RYT A;  1V88 A;  3W5V B;  1WY8 A;  3KH0 A;  5LLI A;  3BJI A;  2AQ3 B;  5GXG B;  1P7E A;  2VZK D;  3L13 A;  2YF0 A;  2IY0 B;  2HD5 B;  2BF8 B;  3KRW A;  2WX1 A;  4RGM A;  2KAJ A;  5HG2 A;  2NMB A;  2CU3 A;  1R4M B;  2M56 B;  1MHX A;  1WJN A;  4F1S A;  1T77 A;  2J42 A;  1C4P A;  2HJ8 A;  1VRA B;  1WGQ A;  3WAL A;  4GMV A;  4I6P A;  2ZNV C;  1ACC A;  2SEB D;  2E3T A;  1IBX A;  1V89 A;  3SD5 A;  4JKG A;  5EE3 A;  3CWI A;  2RNR B;  4K3C A;  2OJW A;  3S2A A;  2KKC A;  2EKI A;  2INP E;  2K39 A;  1HBK A;  2KQ4 X;  2KWU B;  2D2Q A;  2XQN M;  2MP2 A;  3UIN B;  3U12 A;  4DBB A;  3RCP A;  3GB1 A;  3Q3F A;  1TQZ A;  3ML8 A;  3DWM A;  1XCG A;  2Z59 A;  4BZA A;  2RSU A;  4K2O A;  2Y7B A;  1ZP0 B;  1BUI C;  2D11 A;  4CHM A;  3TSS A;  3NS1 A;  3N3K B;  3RFZ B;  1SBB B;  1ZPS A;  5C5B B;  4IOY X;  1HB8 A;  3QIJ A;  4L1R A;  1TKG A;  1QOF A;  2LFI A;  2LMC A;  4GNK B;  1FCL A;  4MSM B;  4PQ0 A;  1NYQ A;  3H7P A;  2AX5 A;  2RPQ A;  3PZ8 A;  5I2M A;  1MFW A;  1P98 A;  5BMG A;  1J0W A;  4ANU A;  3W5U B;  3AH7 A;  3T06 A;  2N7D A;  1LO5 D;  4Y94 A;  4A5K A;  4MH0 E;  1WGG A;  4HJG E;  1U27 A;  2KDF B;  2COP A;  2KIG A;  1SXT A;  3PHW B;  2CY5 A;  3A8P A;  2JZP A;  2PVO D;  4YXD B;  1E90 A;  1HE8 A;  3KW5 B;  1LFD A;  4EZL A;  1XCT L;  2KK8 A;  1V1P A;  2MH7 A;  1R7S A;  1KLG D;  2I1K A;  1WX7 A;  2JUO A;  3NUH B;  1QOG A;  2J0M A;  1AWD A;  3IXS A;  5LON B;  1W1G A;  4FAD A;  4XWW A;  3KLS X;  4L6E A;  4PNK A;  1SE3 A;  2LUE A;  1QQG A;  3H8H A;  3VFK A;  2KLC A;  2L1C A;  2V4I B;  2DKQ A;  1H10 A;  4IW0 A;  4MSQ B;  3SFD B;  3QBV B;  3QAR A;  2JZZ A;  4MGY E;  2Z0P A;  1FCC C;  1TBE A;  2WXG A;  3HM3 A;  1WJ4 A;  5AZG A;  1I7A A;  3O65 B;  3URY A;  2KZR A;  1UBI A;  2EEL A;  2JRI B;  3VRA B;  1B55 A;  3AEB B;  4ZRP A;  3E9O A;  1J8C A;  2BWF A;  2RGF A;  1I42 A;  2OTX A;  2ROZ B;  5FI0 A;  1ZSQ A;  3AE8 B;  4YTN B;  2RDG A;  2FID A;  3HIE A;  3NJT A;  1B9R A;  2PE6 B;  2M14 A;  1XLQ A;  4CHK A;  5HE3 A;  1YMH E;  2B3A A;  3BVM A;  1KJT A;  1P6S A;  3WYF B;  1MVK A;  2CHW A;  4YON A;  4FJZ A;  3PZ7 A;  3TW1 A;  2WXN A;  3TL5 A;  1SJE D;  2YS3 A;  1Q0W B;  2KX0 A;  3MTN B;  1D5X C;  2REX A;  3PSC A;  3RCZ A;  1WR6 E;  4IWP A;  2M0X A;  3WAN A;  2WXH A;  1ZE3 D;  4KKI A;  3P4S B;  4WIP A;  2NPT B;  1V1P B;  3PZD A;  4ZRK A;  1WH3 A;  4G11 A;  4IM0 A;  2BWE S;  3PSE B;  1D6E C;  2RDH A;  1FGY A;  5G5G A;  2LXC A;  3TEW A;  1EUV B;  2NS5 A;  2KFK A;  1PMS A;  5IP4 D;  2GOW A;  2LJ5 A;  2NBU A;  2FAZ A;  2QC8 A;  3AE2 B;  3MPX A;  3BY4 B;  5I2S A;  1SJH D;  1C79 A;  3NVW A;  1QC6 A;  1N63 A;  2RR9 A;  2K8B A;  4DIX A;  4DDG D;  3B08 A;  1OTR B;  1UZX B;  1S3S G;  3HIZ A;  1CJE A;  3HUI A;  4E3C A;  3AU4 A;  4TKN A;  1ZM0 A;  3AE1 B;  1L6U A;  3ZUN A;  5IKC M;  1FHO A;  4F7Z A;  2MWN B;  3R2I A;  3E9L A;  1FNU A;  2JYE A;  3AV8 A;  2K00 A;  1TS2 A;  3PVL A;  3VHT C;  4W9I A;  4IKG A;  3PHX B;  4MEM A;  2GBM A;  3WCQ A;  2NBV A;  4RGT A;  1WX9 A;  3AI5 A;  2JXX A;  3P42 A;  1NU2 A;  3ZKJ C;  1N61 A;  1KH0 A;  1S1Q B;  2BQQ A;  2DHJ A;  3E56 A;  2EKE C;  1X05 A;  5JZE B;  5DPS A;  2BTE A;  1NTI A;  2LUM A;  1OQR A;  3T9L A;  2NPT A;  2C7M B;  1C78 A;  2KMC A;  2N0S B;  3H6N A;  4RFB A;  5D6J B;  4KX6 B;  4JPS A;  1L0X B;  2G4S A;  3OHM B;  3VVW B;  4TQ1 A;  4WWO A;  1VCB A;  1UPR A;  2K2J A;  1V97 A;  2LVO A;  4ZRQ A;  4WJP A;  2XK5 A;  1T6B X;  4IOI E;  1WIA A;  2D9X A;  3RNC C;  1I4Q A;  3AE3 B;  5JHH A;  3TFM A;  2ELB A;  1YX6 B;  3EFU A;  2LI5 A;  3GE8 C;  2PZ1 A;  2M19 A;  3UF8 A;  3H7P B;  2V0G A;  1I4P A;  2MBE A;  1UNP A;  2WU5 B;  2FE8 A;  3TEX A;  2MCN B;  4NZL B;  2YLM A;  5H92 C;  3HVD A;  2MJE A;  1QLB B;  5HKH A;  1M4V A;  2RQ1 A;  1U2B A;  4B6H A;  2C7N B;  2X38 A;  4HPP A;  1TGZ B;  1F1H A;  1MJD A;  3APD A;  5CHF A;  2GBJ A;  1FOE A;  4W9G A;  1VBH A;  1IYF A;  3CSF A;  2DFK A;  3ML4 A;  3QHT A;  4KGT A;  3QK0 A;  3WAO A;  2MWS B;  5JHB A;  3Q3N C;  4WAF A;  3K9P B;  2DKP A;  3GYP A;  2K22 A;  3NZU A;  1E0Z A;  3ZLZ A;  2JY6 A;  2DX1 A;  3PV1 A;  5D3I B;  3V61 A;  4RGN A;  3TJP A;  1U29 A;  4OW0 A;  4PS3 A;  1V6E A;  3ZJU A;  1WXM A;  2W2W A;  1YQB A;  2UZR A;  4KKJ A;  1WGD A;  2ZJD A;  3KZ1 A;  5JXV A;  1PGX A;  3FP5 A;  1WM2 A;  1Y56 A;  2YSZ A;  1P5T A;  3NVV A;  5TR5 A;  1PLS A;  3ZNG C;  2L76 A;  5GMV A;  4NNJ B;  3HM6 X;  3RI7 C;  1TS3 A;  3ZXV A;  4KAX B;  1KRH A;  2EMS A;  4OSN A;  4TV3 A;  2XK5 B;  2Z14 A;  5HE2 A;  2K2U A;  3U8Z A;  4BOS C;  4WJN A;  2KN5 A;  2MJD A;  5D27 A;  3CST A;  1W1D A;  1WGR A;  1E7U A;  4RH6 A;  1T0Q C;  4M01 A;  4EMO A;  4MM3 A;  3BVZ A;  2HRJ A;  5LG4 B;  2ICI A;  1M94 A;  1UPQ A;  3FM8 C;  2M4N A;  4HRO A;  5DPR A;  1RRP B;  1V9J A;  3BVG A;  1Q5W B;  3PRM B;  3Q3J A;  4HB3 B;  2BS2 B;  4DHJ D;  1UF0 A;  1UD7 A;  1JW9 D;  4KSL C;  1BAK A;  3N1X C;  1OY2 A;  1UEL A;  3HRD D;  2VRR B;  3W1Y A;  2NMQ A;  2JSV X;  1E9M A;  4WUR A;  2K5P A;  5DHF B;  1WM3 A;  1F0Z A;  2CR5 A;  1WE7 A;  3KUD B;  4HPM B;  2Z4D A;  2QEJ C;  1XCQ L;  3R2T A;  1NBF C;  1LB1 A;  1PFD A;  2ABD A;  1K5G B;  4FHJ A;  5DPW A;  2KUP A;  1WJ6 A;  2QSD A;  5D2M B;  1NI3 A;  1SE9 A;  2ZNV B;  3FKY A;  3N9Y C;  4PYZ A;  4KZC A;  1FNW A;  1TY2 A;  2JU6 X;  3NHE B;  2GLS A;  4IDI A;  5J3Y A;  2FCM A;  4FUL A;  3W9C B;  1I4G A;  4TYZ A;  2RRF A;  2QKL A;  4CSQ A;  3DOW A;  3KWV A;  2CAY A;  1YN5 A;  3ZTC A;  1OQN A;  2IFS A;  2AEH A;  3A4S C;  3EHV A;  4PS8 A;  1FRR A;  1ISN A;  1T0R C;  4HDQ A;  1ZXI A;  2ONQ A;  4AJW A;  4XWT A;  2V4L A;  1N6Z A;  2DYM A;  1Y19 B;  2D9Z A;  2A4Z A;  1OEY J;  3NVY A;  4PK1 A;  1LW3 A;  4H8S A;  3MC0 B;  2BPS A;  4DHZ B;  1K5D B;  4HAX B;  1PQS A;  1WXQ A;  5AUK A;  1NVL A;  5MPO A;  1XQQ A;  4ZHO A;  3RN9 C;  3L4P A;  1X1M A;  3NY5 A;  1PFJ A;  4IUM B;  2ROV A;  4M0W A;  3Q14 C;  2P0D A;  3VXW A;  2ZCC A;  3ECI A;  1X1F A;  2QIE B;  1C1Y B;  1XO3 A;  4MY6 A;  1RJ2 A;  1UUP A;  2L2I A;  2DYQ A;  3IG3 A;  1HTQ A;  2QHO A;  2XN9 C;  4K7S A;  4YSZ B;  5IA7 A;  2UWQ A;  2LRU A;  4KDL B;  3EGR A;  4YSY B;  4RM9 A;  1EU4 A;  3VUY A;  3MC9 A;  1WRI A;  3NG0 A;  5CHW A;  2L83 A;  1E7V A;  1WG7 A;  2AQ2 B;  1V49 A;  2HTH B;  5BYR A;  4C80 A;  2RLO A;  1SF0 A;  1ENF A;  2KFJ A;  2IGH A;  3EC8 A;  1V81 A;  4HK2 A;  3M3J A;  3SYX A;  4BBK A;  3A9K A;  4JKB A;  2YS5 A;  2WXQ A;  2UVM A;  2ON8 A;  5D3V A;  4GGQ A;  2M1M A;  3QWZ B;  2ZW0 A;  2L8J A;  3C8Y A;  3FSS A;  4EZK A;  4XC2 A;  1MHH E;  5H8Y E;  1H8C A;  1PGA A;  2DEN B;  1D5M C;  3AEE B;  2V3P A;  3VH3 B;  2DTC A;  2GB1 A;  3AED B;  1C4A A;  1EAZ A;  1F2R I;  1MIZ B;  3JSV B;  5IN7 A;  2MSE D;  3EEC A;  2E2X A;  5C3J B;  3KSY A;  2D10 A;  1WVH A;  2UYZ B;  4W9C A;  2I1J A;  4KIK B;  4K7W A;  3LYY A;  2L0F A;  4NQK E;  3V60 A;  3VTV A;  1FO4 A;  2DA0 A;  1I4R A;  4MM3 B;  3F5R A;  3D32 A;  2Z0D B;  3V05 A;  4WJO A;  2LXA A;  2LZ6 A;  4DK5 A;  3DCX A;  1FFU A;  2KJR A;  4GPT B;  3Q8A A;  2RGN B;  3J9C A;  1WWT A;  3DBL I;  1C76 A;  4HWI B;  5J18 A;  1IPG A;  2IY1 B;  3SV1 A;  1FRD A;  2J53 A;  4OVZ A;  3IAS 1;  1JWB D;  4OZC A;  1FNV A;  4YWG G;  2BVC A;  3DBH I;  3AE4 B;  4ZRI A;  3VH4 B;  3IT4 B;  3GS2 A;  3NOB A;  2EMT A;  1VR9 A;  2BB6 A;  4US8 A;  5BYQ A;  4D0N B;  1E6E B;  2MLB A;  4RNA A;  4BBN F;  1N62 A;  1WYW B;  1F9J A;  3U7Z A;  1WSP A;  2G1E A;  2G4D B;  3TO1 A;  1GOZ A;  4QJ4 B;  2INC C;  2L3Z A;  1KI1 B;  4NJC A;  3UI3 A;  4XDC A;  3R66 C;  4L2Y A;  4YT0 B;  4A55 A;  2DZJ A;  3B2F A;  3EUB 2;  2KAC A;  3AN1 A;  2FJL A;  2N1V A;  2W2X C;  3AE6 B;  4HCN B;  1GC6 A;  4EE2 A;  3DHI C;  1E8Z A;  2X18 A;  3NWA A;  2JT4 B;  3OG5 A;  4OHJ A;  4RGO S;  5EE1 A;  4K3B A;  4DXG A;  4MAC A;  4GMX B;  1BTK A;  3A1Q A;  2FCN A;  3QWM A;  1F2R C;  1MI1 A;  2WH5 A;  2FCS A;  4Q2J A;  4XX5 A;  2DWQ A;  4KHB A;  1M7E A;  3I5J C;  1GG3 A;  4XYC A;  3PLU A;  3MP9 A;  1T5X D;  1Z2M A;  3UQB A;  4TQ0 A;  3VRB B;  5IAA C;  3Q2A C;  3HK0 A;  3KY9 A;  1K52 A;  4C56 C;  3AUL A;  3ZW3 A;  4A8X C;  1KLU D;  1EGX A;  2ELA A;  1I4H A;  2DHK A;  4HPL B;  4K1R B;  1SSN A;  3Q69 A;  1UGM A;  2JWU A;  4MGI E;  5D3W A;  3Q6B A;  3APC A;  3QC8 B;  1TYG B;  1E8X A;  3QA8 A;  2QJL A;  4XE0 A;  3R3M A;  3Q8F A;  1TTN A;  3DCG A;  4KDI C;  2MBH A;  2AWT A;  4DBG A;  4M00 A;  1TKY A;  2RSG A;  1GUA B;  4QJ5 B;  2K9X A;  1MG8 A;  4A6Q A;  3D8D A;  2CJN A;  2WGS A;  5J3T A;  1V80 A;  4ANW A;  1FEH A;  2G35 A;  3VQI A;  2IPK D;  2GCJ A;  2YVC A;  2V3S A;  2KCJ A;  2QDF A;  4IM3 A;  4ANX A;  4W9D A;  4BFR A;  2P0F A;  3TBL D;  3ZJT A;  1SGH A;  5FR6 A;  2FJ9 A;  4BKS A;  3OJ3 A;  3HQC A;  2D3G A;  4JLC A;  4HKZ E;  2KFK B;  1TKE A;  2IJ0 A;  2KN4 A;  1Q1O A;  2N1W A;  3AEA B;  2L52 A;  2ACZ B;  3SUZ A;  1MK7 B;  3A1Q B;  1U4A A;  2MA9 B;  2LBB A;  3AXC A;  4GSW A;  4G50 A;  3A98 B;  2BYF A;  1IGD A;  3C19 A;  2GMI C;  4A9A A;  2Y5B B;  2MX2 A; 
#chains in the Genus database with same CATH homology
 3P7Z A;  3ULC A;  2D9W A;  3ZTD A;  5EFX A;  2FIF A;  5L95 C;  3G9W A;  2WX0 A;  3PT2 B;  2XBB C;  3RT3 B;  2KHW B;  2O6V D;  3DVG X;  5L81 A;  2KX3 A;  4KHO A;  4WVF B;  4JK8 A;  2LUL A;  2C7H A;  2IYD B;  2FNJ B;  1BT0 A;  1AQC A;  3I3T B;  2VKI A;  2DAJ A;  1WR1 A;  4ASW C;  5LXI B;  5J3Q A;  3T8M A;  3PVU A;  2J7Q B;  4WAA A;  2ZCB A;  4N9F 4;  2K1F A;  3SU8 X;  1A5R A;  4Z2M B;  1WJU A;  4A20 A;  1MAI A;  3OAN A;  1R4M I;  5LXH A;  5KQ4 A;  4HB4 B;  4W9F A;  4JK7 A;  3GOE A;  1XR0 B;  1NTY A;  4K2P A;  4MEL A;  2XEW A;  2AL6 A;  5G55 A;  4HAU B;  1WXS A;  2K8H A;  4KV2 A;  2IO2 B;  1WI1 A;  3JW0 X;  5KHO A;  3DDC B;  1MK9 B;  1U5D A;  1KLV A;  2J0K A;  2OQB A;  3WA0 A;  1UNR A;  1OQY A;  5CX3 A;  2C60 A;  3L54 A;  4FBJ B;  4P7I A;  1R4N I;  2KDB A;  4GDL A;  3UIO B;  2KGX B;  3X0W A;  1WGU A;  2KVR A;  2J0J A;  5C1Z A;  1DIK A;  2Y8F A;  4HB2 B;  1P1A A;  1P9D U;  2LWP A;  2FUH B;  4LDT B;  4RM8 A;  2FCQ A;  2KAN A;  2ZPN A;  4MK0 A;  3M95 A;  3M63 B;  3LJU X;  4HAY B;  4NAW B;  1LQB A;  5DPT A;  4RMA A;  4DX9 0;  3QJZ A;  2GS0 A;  4EEW A;  2M17 A;  3A9J B;  1H4R A;  4X57 B;  2G3Q B;  3DXD A;  3RUL A;  4BVU C;  4IM2 A;  3ZNH B;  4LDT D;  3NZS A;  1EF1 A;  1WJ1 A;  5DI9 B;  2MFQ A;  2KDE B;  3L10 B;  1FB8 A;  3PRZ A;  2LYD A;  1TZ1 A;  2KWC A;  5L83 A;  1QZE A;  1WGH A;  2K6Q A;  3VAW A;  1GC7 A;  4K17 A;  5HE0 A;  2BGF A;  1LXD A;  1V61 A;  5D3X A;  2MQJ A;  2W9N A;  1TJ6 A;  1C3T A;  4EZJ A;  5G2N A;  2KQS A;  2PE9 A;  2PEA A;  1OGW A;  3DVN V;  2EC1 A;  3PLV A;  2R09 A;  5KCV A;  1YD8 U;  3FEH A;  2CU1 A;  5IJM A;  2P8V A;  2JF5 A;  4BBN C;  3QX1 A;  4II3 B;  2KTR B;  3N30 A;  2W2X D;  1X86 A;  1WMH B;  1WE6 A;  2A5U A;  2CRF A;  4YL8 A;  3U30 A;  1V5T A;  4WWP A;  3A9K B;  4JIO U;  2JZ3 B;  4M8M A;  1BWN A;  5D7G A;  2AYO B;  1YIW A;  1V5M A;  1SHC A;  3SHQ A;  2DHZ A;  4M8N A;  4OVV A;  3SBT A;  5E6N A;  2COD A;  3KRX A;  2M8S A;  3RD2 A;  1OMW A;  1G6J A;  1WXV A;  1ZW7 A;  1GJZ A;  3UQA A;  4MGZ E;  3OAW A;  2GBK A;  1NDD A;  3WAP A;  2KDI A;  3TIX A;  1EF5 A;  3AJ4 A;  3VOQ A;  2DZK A;  1I35 A;  3NSU A;  2Y8G A;  2Z59 B;  2DX5 B;  2HTH A;  1U5G A;  5C16 A;  4IWO A;  4A6K A;  4URK A;  4LJP B;  3TVV A;  2DHI A;  4HAW B;  1D3Z A;  4I6N B;  3PVW A;  2RVB B;  1ZC3 B;  4OVU A;  2MDX A;  1UEF A;  5E6P A;  4ZRJ A;  4FJY A;  3KYD D;  2IO3 B;  4K7U A;  4NPN A;  3UGB B;  3TCA A;  3CIK A;  4IWQ A;  2LVQ A;  1OEY A;  2LG1 A;  3DPD A;  4W9L A;  3SDL C;  3APF A;  2N0Y A;  4B6W A;  3ZO5 B;  4HAV B;  3PS6 A;  1E5W A;  4KHB B;  3X23 A;  3DXE A;  4KHA A;  2N4F A;  2D9V A;  3WAM A;  3ZNZ B;  5J17 A;  1DRO A;  2BKR B;  2DIK A;  3RZF A;  2KWV B;  1P0R A;  3SBG A;  3B1L X;  3N7C A;  1ZGU B;  2UZS A;  3PG7 A;  4NQL B;  3A9J A;  4II2 B;  4IAP A;  1NTV A;  3ZDM C;  2KJH B;  4BOZ B;  1IP9 A;  4MJS A;  3CF6 E;  3ENE A;  1E8Y A;  1JRU A;  5AEK B;  2NR2 A;  2LRW A;  2Z0Q A;  2QKM A;  4IFS A;  4AJY B;  3QQ8 B;  3M1I B;  4JKH A;  2ZZP B;  2I5F A;  4ICU A;  4A6H A;  2NBW B;  1KBL A;  1E8W A;  4F7G A;  2J59 M;  1X1G A;  1XD3 B;  1EO6 A;  2N23 A;  2KC1 A;  3H9D A;  2P0H A;  1V86 A;  3H1U A;  3KUC B;  3RUI B;  4F7U P;  3L08 A;  2DYN A;  3P2B A;  3VUW A;  1FHW A;  2LD9 A;  1RRB A;  3V62 A;  5GOW B;  1RLF A;  2CB8 A;  4DX8 A;  4W9K A;  1X11 A;  1XX0 A;  2R2O A;  2I5C A;  3ODW A;  1XT9 B;  2KJ6 A;  4NJ6 A;  1KZG A;  4WWN A;  5CLL B;  3ULB A;  2KTR A;  2R2Q A;  4HAZ B;  2WYQ A;  3JYU A;  5D94 A;  1Y5O A;  1LM8 B;  1WRD B;  4MDK E;  3VIA A;  4HCP B;  2FDQ A;  2O6V B;  3PPA A;  1WZ3 A;  3ODX A;  2BYV E;  1L7Y A;  2V76 A;  4W9J A;  4WJQ A;  4XZ4 A;  5DHA B;  4CO7 A;  2K25 A;  1UBQ A;  2YS1 A;  1AAR A;  2VSZ A;  1U5E A;  2WWZ A;  4ICV A;  3R7Q A;  2R82 A;  2CQU A;  1J19 A;  2GCL A;  1VBG A;  3V5W A;  3B0A A;  3EPY A;  2LOZ A;  1FAO A;  3ZRF A;  2G45 B;  1DBH A;  4FA6 A;  3MDB C;  1ST7 A;  2LOX A;  4GZU A;  4G0N B;  2LAS A;  1Q67 A;  5CLQ B;  2ZVN A;  1WX8 A;  3PTF C;  2Z0O A;  4CHJ A;  3A33 B;  5CHV C;  4JKE A;  3D8E A;  4HHV A;  4JQW C;  2L00 B;  2BCJ A;  4KIK A;  2YT1 A;  2O2V A;  3V6E B;  1WI0 A;  4W9E A;  4GDL B;  5E6O A;  2BKF A;  3AU5 A;  1MKE A;  3L17 A;  2MRP A;  3L0W B;  4E71 A;  2O6V A;  2KD0 A;  3DVN U;  1N3H A;  1ZVR A;  5KQ1 A;  3KUZ A;  3ZVR A;  3K9O B;  4GDK B;  4XWX A;  5AZH A;  2L0T A;  1RFA A;  1WXA A;  1FXT B;  2K6D B;  3ZRC A;  3DQV A;  5KHQ A;  1UH6 A;  3BIN A;  2ADZ A;  2ASQ A;  2C9W B;  2CHZ A;  4K81 A;  3IHP C;  2DLW A;  2MBB B;  4BKS D;  2MBQ A;  3LJ3 A;  4B95 A;  2H7D A;  2LVP A;  2N9E B;  4I6L B;  2V1Y A;  4DDI D;  2GJY A;  5AZF A;  3ALB A;  4ILJ A;  4DXA B;  3ZIM A;  3HW2 B;  5EDS A;  3UZT A;  2DZM A;  2MW5 A;  4DHJ B;  2YRY A;  2IYB A;  2D9Y A;  1GNU A;  1BTN A;  3W1S A;  2OOB B;  4IC7 B;  1W1H A;  4E74 A;  2ZEQ A;  1Y8R C;  2YT0 A;  3UIP B;  4NY0 A;  4GIV A;  4JKA A;  1L2N A;  4EFO A;  1DDM A;  3ENB A;  2COA A;  3RZW C;  4FJV B;  5HE1 A;  3MJW A;  1MIX A;  4FN2 A;  5D3Y A;  1XKE A;  3CMM B;  3D8F A;  3N32 A;  5C23 A;  2LGD A;  3R7R A;  3VTW A;  1J0G A;  1FGZ A;  4Z2N A;  3A8Q A;  4F8C B;  1I2H A;  4B9K A;  2JWZ A;  2NCN A;  4FLH A;  3ZVV A;  1MPH A;  2MKR A;  1VD2 A;  2N9X A;  3OJ4 B;  2JP2 A;  4HAT B;  3PP2 A;  2LGY A;  3GZN I;  1KM7 A;  2C5L C;  2DYB A;  2KNB A;  2N9P C;  4A6F A;  1V5O A;  4M0W B;  2GBR A;  1YJ1 A;  3SNH A;  3W1S C;  2DN6 A;  3A4R A;  2CY4 A;  3ML9 A;  3OLM D;  2KXJ A;  4HLE A;  2GBN A;  4WJ7 A;  3WIM A;  1P3R A;  4G3X B;  2LGX A;  2KOX A;  2NBV B;  2RUK B;  4PYU A;  5CTR C;  2IBI B;  4HDO A;  3C0R B;  2EJ8 A;  3CXB B;  1WZ0 A;  1TXD A;  1P3Q U;  3NS8 A;  3E9P A;  3JVZ X;  1KZ7 A;  2Z0E B;  3LDZ E;  5BO4 B;  3DXC A;  1XOD A;  2KC2 A;  2KO3 A;  3KVF B;  1DDW A;  1M7R A;  2M38 A;  3MHS D;  2O2V B;  2RD0 A;  4HVB A;  1ZC4 B;  2BYE A;  1FHX A;  2KLG A;  3QAQ A;  4ZDV A;  4GU2 A;  2PJH A;  4KVG B;  3JSV A;  1V2Y A;  1CMX B;  3IFW B;  3FLV A;  2H7E A;  1WFY A;  4AP4 C;  3GYO A;  4EJN A;  3VDZ A;  4FHK A;  3O96 A;  1AWE A;  1DYN A;  4GDK A;  3U7D A;  2IO1 B;  3QCA A;  4KZ0 A;  1T0Y A;  1IRS A;  2ZVO A;  3DBS A;  1WJM A;  4HJK A;  4GOC A;  5J2R A;  3L16 A;  2Q13 A;  4GXB A;  4W9H A;  4MJS B;  3IBE A;  4GB9 A;  1HB6 A;  1DDV A;  1NI2 A;  4BKT A;  4NAW A;  4J6I A;  2COF A;  4HB0 B;  2HE7 A;  5JLJ B;  3PRP B;  2KMA A;  4C0A A;  2CHX A;  1U5F A;  1KOT A;  2PPH A;  2DZI A;  4JKG B;  2L7R A;  1ACA A;  5C79 A;  1JDE A;  1YX5 B;  5DH9 B;  2X0S A;  3V6C B;  4NJ7 A;  5JH5 C;  2N7E A;  1KC7 A;  3ONS A;  4JL9 A;  4LJO B;  3M62 B;  2JPH A;  5C5B A;  2D07 B;  2COC A;  4A6F B;  5JHA A;  4AWJ A;  4F7H A;  4MT7 A;  2LKO A;  3F0W A;  1Z87 A;  4AOF A;  2OJR A;  1XD4 A;  3H7S A;  4ILG B;  1Z5S B;  1SIF A;  3TMP B;  2ZPY A;  4ANV A;  2D4Q A;  3VUX A;  4DWF A;  5C6R A;  4JK9 A;  2CKH B;  3PGE A;  3ODO A;  3DVG Y;  2NVU I;  3SO6 A;  2DAF A;  5JHG A;  2JRH A;  3PRE A;  1GGO A;  3ZDT A;  1V5P A;  4JGH B;  4EOY A;  1WMH A;  4LCD E;  3ZNI D;  1RAX A;  2L05 A;  4ZYN A;  3HHM A;  4IG7 B;  4JKD A;  4A3P A;  3PEG A;  5LOP B;  4MGK E;  5FI1 A;  1V5U A;  4HXD A;  2JVC A;  4BKG A;  2WDT B;  4WSF A;  4WQO B;  3E66 A;  4JKC A;  4NSW A;  2MBO A;  2R0D A;  4EKU A;  4ILH A;  2MP2 B;  1UNQ A;  4AUQ C;  2IZV B;  4A3O A;  3P6A A;  4CYE A;  4JKF A;  1ZKH A;  3VTU A;  2K8C A;  2CS4 A;  3DBR I;  2VRW B;  1WF9 A;  4TUU A;  3KYC D;  1K8R B;  5DIF B;  5JP4 A;  1EVH A;  4GN1 A;  4EUT A;  2KQ7 A;  1WGY A;  5JVL A;  3IVF A;  4PS7 A;  4DHZ E;  2NZ8 B;  4KSK C;  2DYO A;  2AL3 A;  2DX5 A;  5DCN A;  2IO0 B;  2KTF A;  3RYT A;  1V88 A;  1WY8 A;  3KH0 A;  5LLI A;  3BJI A;  3L13 A;  2YF0 A;  2IY0 B;  2HD5 B;  2BF8 B;  3KRW A;  2WX1 A;  2NMB A;  1WJN A;  4F1S A;  2HJ8 A;  1WGQ A;  3WAL A;  4GMV A;  4I6P A;  2ZNV C;  1V89 A;  3SD5 A;  4JKG A;  2RNR B;  3S2A A;  2KKC A;  2K39 A;  1HBK A;  2KWU B;  2D2Q A;  2XQN M;  2MP2 A;  3UIN B;  4DBB A;  3RCP A;  3Q3F A;  1TQZ A;  3ML8 A;  1XCG A;  2RSU A;  4K2O A;  2Y7B A;  2D11 A;  4CHM A;  3N3K B;  5C5B B;  4IOY X;  1HB8 A;  3QIJ A;  4MSM B;  4PQ0 A;  3H7P A;  2RPQ A;  1P98 A;  1J0W A;  4ANU A;  3T06 A;  2N7D A;  4Y94 A;  4A5K A;  4MH0 E;  1WGG A;  1U27 A;  2KDF B;  2COP A;  3PHW B;  2CY5 A;  3A8P A;  1E90 A;  1HE8 A;  3KW5 B;  1LFD A;  4EZL A;  2KK8 A;  2I1K A;  1WX7 A;  2JUO A;  2J0M A;  5LON B;  1W1G A;  4FAD A;  4L6E A;  4PNK A;  2LUE A;  1QQG A;  3VFK A;  2KLC A;  2L1C A;  2DKQ A;  1H10 A;  4IW0 A;  4MSQ B;  3QBV B;  3QAR A;  2JZZ A;  4MGY E;  2Z0P A;  1TBE A;  3HM3 A;  1WJ4 A;  5AZG A;  1I7A A;  3O65 B;  2KZR A;  1UBI A;  2JRI B;  1B55 A;  3E9O A;  1J8C A;  2BWF A;  2RGF A;  1I42 A;  2OTX A;  2ROZ B;  5FI0 A;  1ZSQ A;  2FID A;  2PE6 B;  2M14 A;  4CHK A;  5HE3 A;  2B3A A;  1KJT A;  1P6S A;  3WYF B;  2CHW A;  4YON A;  4FJZ A;  3TW1 A;  3TL5 A;  2YS3 A;  1Q0W B;  2KX0 A;  3MTN B;  2REX A;  3PSC A;  3RCZ A;  1WR6 E;  4IWP A;  2M0X A;  3WAN A;  2NPT B;  3PZD A;  4ZRK A;  1WH3 A;  4G11 A;  4IM0 A;  2BWE S;  3PSE B;  1FGY A;  2LXC A;  1EUV B;  2NS5 A;  2KFK A;  1PMS A;  2GOW A;  2LJ5 A;  2NBU A;  2FAZ A;  3MPX A;  3BY4 B;  1QC6 A;  2RR9 A;  2K8B A;  4DDG D;  3B08 A;  1OTR B;  1UZX B;  1S3S G;  3HIZ A;  4E3C A;  3AU4 A;  4TKN A;  1ZM0 A;  3ZUN A;  1FHO A;  4F7Z A;  2MWN B;  3E9L A;  2K00 A;  3PVL A;  3VHT C;  4W9I A;  3PHX B;  4MEM A;  2GBM A;  1WX9 A;  3AI5 A;  2JXX A;  1NU2 A;  3ZKJ C;  1S1Q B;  2DHJ A;  2EKE C;  1X05 A;  5JZE B;  5DPS A;  1NTI A;  3T9L A;  2NPT A;  2C7M B;  2KMC A;  5D6J B;  3H6N A;  2G4S A;  3VVW B;  4TQ1 A;  4WWO A;  1VCB A;  1UPR A;  2K2J A;  2LVO A;  4WJP A;  2XK5 A;  1WIA A;  2D9X A;  5JHH A;  3TFM A;  2ELB A;  1YX6 B;  3EFU A;  2LI5 A;  2PZ1 A;  3UF8 A;  3H7P B;  2MBE A;  1UNP A;  2MCN B;  2YLM A;  5HKH A;  2RQ1 A;  1U2B A;  4B6H A;  2C7N B;  1TGZ B;  3APD A;  5CHF A;  2GBJ A;  1FOE A;  4W9G A;  1VBH A;  1IYF A;  3CSF A;  2DFK A;  3ML4 A;  3QHT A;  3QK0 A;  3WAO A;  2MWS B;  5JHB A;  3K9P B;  2DKP A;  3GYP A;  3NZU A;  3ZLZ A;  2JY6 A;  2DX1 A;  3PV1 A;  3V61 A;  3TJP A;  1U29 A;  4PS3 A;  1V6E A;  1WXM A;  2W2W A;  1YQB A;  2UZR A;  1WGD A;  2ZJD A;  3KZ1 A;  3FP5 A;  1WM2 A;  2YSZ A;  1P5T A;  5TR5 A;  1PLS A;  3ZNG C;  2L76 A;  5GMV A;  4NNJ B;  3HM6 X;  4KAX B;  2EMS A;  4TV3 A;  2XK5 B;  5HE2 A;  2K2U A;  3U8Z A;  4BOS C;  4WJN A;  2KN5 A;  5D27 A;  3CST A;  1W1D A;  1WGR A;  1E7U A;  4EMO A;  4MM3 A;  2HRJ A;  1M94 A;  1UPQ A;  3FM8 C;  2M4N A;  5DPR A;  1RRP B;  1V9J A;  1Q5W B;  3PRM B;  3Q3J A;  4HB3 B;  4DHJ D;  1UD7 A;  4KSL C;  1BAK A;  1OY2 A;  1UEL A;  2VRR B;  3W1Y A;  5DHF B;  1WM3 A;  2CR5 A;  1WE7 A;  3KUD B;  4HPM B;  1NBF C;  1LB1 A;  2ABD A;  1K5G B;  4FHJ A;  5DPW A;  2KUP A;  1WJ6 A;  5D2M B;  1SE9 A;  2ZNV B;  4PYZ A;  4KZC A;  3NHE B;  5J3Y A;  2FCM A;  4FUL A;  4TYZ A;  2QKL A;  3DOW A;  2CAY A;  3ZTC A;  1OQN A;  2IFS A;  2AEH A;  3A4S C;  3EHV A;  4PS8 A;  1ISN A;  4HDQ A;  4AJW A;  2V4L A;  2DYM A;  1Y19 B;  2D9Z A;  2A4Z A;  1OEY J;  1LW3 A;  4H8S A;  2BPS A;  4DHZ B;  1K5D B;  4HAX B;  1PQS A;  1NVL A;  1XQQ A;  1X1M A;  3NY5 A;  1PFJ A;  4IUM B;  2ROV A;  2P0D A;  3VXW A;  2ZCC A;  3ECI A;  1X1F A;  1C1Y B;  4MY6 A;  1RJ2 A;  2L2I A;  2DYQ A;  3IG3 A;  2QHO A;  4K7S A;  5IA7 A;  2UWQ A;  2LRU A;  4KDL B;  4RM9 A;  3VUY A;  5CHW A;  1E7V A;  1WG7 A;  1V49 A;  2HTH B;  2RLO A;  2KFJ A;  3EC8 A;  1V81 A;  4HK2 A;  3M3J A;  3SYX A;  4BBK A;  3A9K A;  4JKB A;  2YS5 A;  2UVM A;  5D3V A;  4GGQ A;  2M1M A;  3QWZ B;  2L8J A;  3FSS A;  4EZK A;  4XC2 A;  1H8C A;  2DEN B;  3VH3 B;  2DTC A;  1EAZ A;  1MIZ B;  3JSV B;  2MSE D;  3EEC A;  2E2X A;  3KSY A;  2D10 A;  1WVH A;  2UYZ B;  4W9C A;  2I1J A;  4KIK B;  4K7W A;  2L0F A;  4NQK E;  3V60 A;  3VTV A;  2DA0 A;  3F5R A;  3D32 A;  2Z0D B;  4WJO A;  2LXA A;  2LZ6 A;  4DK5 A;  2KJR A;  4GPT B;  2RGN B;  3DBL I;  4HWI B;  5J18 A;  1IPG A;  2IY1 B;  3SV1 A;  3DBH I;  4ZRI A;  3VH4 B;  3NOB A;  2EMT A;  4D0N B;  2MLB A;  4BBN F;  1WYW B;  1F9J A;  3TO1 A;  2G4D B;  2L3Z A;  1KI1 B;  3R66 C;  2DZJ A;  2FJL A;  2N1V A;  2W2X C;  4HCN B;  1GC6 A;  1E8Z A;  2X18 A;  2JT4 B;  4GMX B;  1BTK A;  3A1Q A;  2FCN A;  3QWM A;  2WH5 A;  2FCS A;  4XX5 A;  1M7E A;  1GG3 A;  3PLU A;  1Z2M A;  3UQB A;  4TQ0 A;  5IAA C;  3HK0 A;  3KY9 A;  3AUL A;  3ZW3 A;  1EGX A;  2ELA A;  2DHK A;  4HPL B;  4K1R B;  1UGM A;  4MGI E;  5D3W A;  3APC A;  3QC8 B;  1E8X A;  3QA8 A;  3R3M A;  1TTN A;  3DCG A;  4KDI C;  2MBH A;  2AWT A;  4DBG A;  2RSG A;  1GUA B;  1MG8 A;  3D8D A;  5J3T A;  1V80 A;  4ANW A;  2G35 A;  3VQI A;  2GCJ A;  2YVC A;  2V3S A;  2KCJ A;  4IM3 A;  4ANX A;  4W9D A;  4BFR A;  3TBL D;  2P0F A;  1SGH A;  5FR6 A;  2FJ9 A;  4BKS A;  3OJ3 A;  3HQC A;  2D3G A;  4JLC A;  2KFK B;  1Q1O A;  2N1W A;  3SUZ A;  1MK7 B;  3A1Q B;  1U4A A;  2MA9 B;  2LBB A;  3AXC A;  4GSW A;  4G50 A;  3A98 B;  2BYF A;  2GMI C;  2Y5B B;  2MX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...