2ZPYA

Crystal structure of the mouse radxin ferm domain complexed with the mouse cd44 cytoplasmic peptide
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for CD44 recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Radixin
total genus 87
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2zpyA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2zpyA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zpyA01
2IO0B 4HB0B 2ZVOA 2Y8GA 5D27A 4FA6A 4GB9A 5C16A 3ZVVA 2I1KA 2FJLA 2V3SA 2D10A 3DXCA 5DPSA 1OEYA 3MTNB 3V5WA 3W1SA 4DHJD 5AEKB 4B9KA 5KHQA 1FHWA 2LXCA 2WX1A 2BF8B 2A4ZA 1X1FA 5C23A 2D2QA 4WJOA 4ANVA 5DPRA 3ZTCA 2HD5B 1E8XA 1OQNA 1WXMA 1HBKA 1NU2A 2P8VA 2CB8A 4MSQB 4K17A 3QHTA 4IM3A 2IZVB 1EGXA 3TMPB 3JSVA 2DX1A 4N9F4 2N0YA 4KHAA 3CIKA 1M7EA 4BVUC 1K8RB 2D3GA 2JXXA 1PFJA 5DIFB 3ODOA 4K2OA 4K2PA 1UELA 3VHTC 2XEWA 4KIKA 2K6QA 4Z2MB 3KUZA 3KUCB 4DX8A 4MGIE 3BJIA 4E71A 2P0HA 2MWSB 2WX0A 4HXDA 2K2JA 2LVQA 4TKNA 3UF8A 4NQLB 2RLOA 3QC8B 4MGYE 2COPA 4NJ6A 1TXDA 1YJ1A 3VQIA 4NY0A 1WXSA 1GC7A 2GBKA 2MBBB 2MWNB 1YX6B 3WAMA 2HE7A 2NBVB 2V1YA 2YLMA 2MBQA 2W2XC 4FJZA 2K2UA 4OVUA 1WZ3A 1MIZB 5LONB 5CHFA 1E90A 2V4LA 4ZRKA 1V9JA 4LDTB 4G50A 3W1SC 4BKSD 4GPTB 3DXDA 2MKRA 1OY2A 2D9YA 3S2AA 3TL5A 4TYZA 2H7EA 3SU8X 4HDQA 3A1QA 4W9DA 1XQQA 2MRPA 4FULA 4K7UA 5D2MB 2IFSA 1L7YA 4DDID 1I2HA 2V76A 5E6OA 2JVCA 2DYOA 5AZGA 3RCZA 1FGZA 1WX7A 3QWZB 1E8ZA 4FJYA 1TBEA 1B55A 2X18A 4TUUA 4AUQC 4GXBA 2PJHA 2R09A 5JLJB 3D8EA 1WMHA 1DROA 4KDIC 4WJNA 1K5DB 2EMTA 2KUPA 1DBHA 1GUAB 1HE8A 3QARA 2KTRA 3RYTA 1V86A 1IP9A 2R2OA 3O65B 1E5WA 1MIXA 3L17A 1RJ2A 2JZ3B 5JP4A 3F5RA 4X57B 2FIDA 1J19A 1QC6A 3ULBA 4EJNA 1ZW7A 2N7DA 2HTHA 2NS5A 2PE9A 2IO3B 3DVNU 3SDLC 4HJKA 3UQBA 3KUDB 3RULA 4GMVA 3GYOA 1N3HA 4KZ0A 4IW0A 4MM3A 4EZLA 1OQYA 3PZDA 1M94A 2JRHA 4G0NB 1GC6A 5D3WA 2JWZA 2H7DA 4HAXB 1UD7A 3NHEB 4WJ7A 5G2NA 5J17A 1H10A 3UIPB 2VRWB 4HATB 3I3TB 3QX1A 2YS1A 3M62B 3ZKJC 2COFA 4KVGB 1NBFC 1WXVA 1MK9B 1ZM0A 2L00B 2N1WA 3VVWB 4HPLB 3H6NA 2J0MA 2LZ6A 4WJQA 4E74A 4ZRJA 2M38A 2N9EB 3HM3A 2I1JA 5C6RA 1WGRA 2MBEA 4F7ZA 3UZTA 2BKFA 1RLFA 4GMXB 4NAWA 4NNJB 4EUTA 3ML8A 2IO2B 1XODA 4GOCA 1BTNA 2D9WA 2KQSA 1UGMA 1WGGA 2IBIB 2BWES 2J7QB 4HCPB 1Z2MA 3R7QA 2NVUI 3L0WB 2D11A 2DN6A 4ICUA 4FLHA 3AU5A 4C0AA 2DZMA 2UWQA 3M95A 3VUXA 4BOSC 4DXAB 1NTYA 3LJUX 2FCQA 3H1UA 4KSLC 5CHVC 2RVBB 1HB6A 3ULCA 2ELAA 3VTUA 4GN1A 2R2QA 2LG1A 2IO1B 3K9OB 4DK5A 4FADA 5DPTA 3U30A 2I5CA 5J3QA 2QKLA 3QQ8B 2GOWA 2JF5A 1QQGA 1WFYA 4ICVA 2K1FA 1E8YA 1P98A 3KY9A 2YF0A 2BYVE 3NZUA 5IAAC 2MBHA 2NR2A 1VD2A 1P6SA 1XCGA 3VTWA 5C5BA 1J8CA 1WG7A 1ZVRA 3VOQA 1DDMA 3X23A 4A3PA 2J0JA 1FXTB 2P0FA 1XX0A 4IWQA 4PS3A 4TQ1A 2DKPA 3ZTDA 2RQ1A 3QWMA 3ZNGC 2KX0A 1X86A 3R66C 2FJ9A 4J6IA 3L16A 1VCBA 2MQJA 3GZNI 3VUYA 4B95A 2VSZA 4MGKE 1WIAA 3A33B 2IYBA 4KIKB 2K00A 4IWPA 4CHKA 2C7NB 3PRMB 2CKHB 1V88A 4URKA 2L0FA 1RFAA 2C7HA 3VUWA 1EVHA 4FJVB 1J0WA 3JSVB 1P3RA 3HK0A 2WYQA 2RNRB 1MG8A 1WF9A 2BWFA 1AQCA 2BKRB 4W9LA 5HKHA 3WALA 4XWXA 2M14A 4A6HA 1EUVB 2KMAA 3EFUA 2OQBA 2DZIA 4ZRIA 2MBOA 4LDTD 2LJ5A 3N3KB 3FLVA 2RGNB 2LUEA 2MW5A 4GIVA 3B1LX 2BYEA 5TR5A 3APFA 4P7IA 4HAUB 3MJWA 2L0TA 2LULA 2JRIB 3KW5B 2O6VD 4F1SA 1IYFA 4DX90 3TJPA 1ZC4B 1WX8A 2CS4A 1U27A 1PQSA 2N7EA 1U4AA 4W9HA 2Q13A 2DZKA 2LD9A 1BWNA 2COCA 3R3MA 4BFRA 4IOYX 4I6PA 3ZW3A 3ONSA 4TV3A 4BKSA 3TIXA 2GBNA 3A4RA 1IRSA 2M17A 4GDLB 4ZYNA 3FP5A 3EECA 1LFDA 5D3YA 3NS8A 4Z2NA 2N23A 2Y7BA 3AU4A 1CMXB 4WJPA 2RUKB 2HRJA 2KWUB 1WVHA 2LOZA 3PRZA 1OTRB 3DVGY 1DYNA 2D9ZA 4IM2A 5D3VA 2FDQA 1J0GA 2Z0OA 4JGHB 3TO1A 1JRUA 4HAWB 3FSSA 4W9GA 3ZNID 4GDLA 4FHKA 1V5UA 3KRXA 2C7MB 1U5DA 2NPTB 2PPHA 2GS0A 2KQ7A 3CSTA 1HB8A 2XQNM 4HPMB 3V61A 4RM9A 3PG7A 2LGXA 2MFQA 2RSGA 2MA9B 2D07B 2QKMA 3KYCD 5KCVA 4FN2A 3QCAA 3PVWA 2DHZA 3LDZE 2YVCA 1WJUA 2Z59B 3HM6X 2KC1A 2DX5A 1AARA 3QAQA 5D7GA 4AP4C 3PP2A 2O2VB 4PYZA 4GU2A 3PLUA 4GGQA 1Q67A 4F7HA 1SHCA 3PTFC 4II3B 3KSYA 1DDVA 1WJ4A 1GNUA 2ZCBA 5AZFA 2Z0QA 5DH9B 3H7PA 3TVVA 1WH3A 5E6PA 5IA7A 3EC8A 2KTRB 2GCLA 4GDKA 2LWPA 4GZUA 3PVUA 3DBRI 2W2XD 1PLSA 4HB2B 3ALBA 3APCA 3GOEA 2DYQA 1PMSA 1WX9A 3PLVA 2LRWA 4LJOB 2MCNB 3PEGA 3SD5A 4A6KA 2XK5B 4EZKA 2W2WA 1RRBA 3RT3B 1UPQA 3ZNHB 3IHPC 3JW0X 2J59M 3PHXB 3BY4B 1LB1A 1WJ6A 3QA8A 1MAIA 2FNJB 2BPSA 2MSED 1EF1A 2DAFA 2ZNVC 1BAKA 3N7CA 1WE6A 1P5TA 2KMCA 3SO6A 1I7AA 2KX3A 2LXAA 2KDFB 5KHOA 3SHQA 5GOWB 2LKOA 4MELA 4EEWA 1Q1OA 2KGXB 1TZ1A 2DAJA 1XD4A 1TTNA 3DVNV 1C3TA 4MGZE 2AEHA 2ZVNA 4BKTA 2ZNVB 3A9JA 1LW3A 2JP2A 1UH6A 1I42A 5KQ1A 1NI2A 1H4RA 1GJZA 2DA0A 2LOXA 4KHOA 2CY5A 3TCAA 2DX5B 3W1YA 3HW2B 4H8SA 1WRDB 2N1VA 3SUZA 3Q3JA 1V80A 1EAZA 4MJSB 2AL6A 3VH4B 3UIOB 1WGYA 2LGDA 1W1GA 2D9XA 3MPXA 3ODWA 2Z0DB 2EC1A 2NMBA 4TQ0A 4W9EA 2KFKA 3CMMB 2CODA 4IWOA 3ZDTA 4JL9A 3RZFA 4CYEA 2ZPYA 2NBWB 2PZ1A 1QZEA 1ACAA 3NSUA 2RGFA 4HAVB 3AULA 3M3JA 4BKGA 3R7RA 1V81A 1MPHA 1V5TA 4WWNA 4B6WA 1NDDA 3OAWA 1V5MA 2FIFA 1BTKA 1DDWA 3FEHA 4M0WB 2COAA 2G35A 3KRWA 2KFJA 2ZPNA 3B08A 4M8MA 2EJ8A 1XD3B 2Z0EB 3MHSD 3DBHI 1Q5WB 2GBRA 3H7PB 3L54A 3QJZA 5JHHA 3DBSA 4MDKE 1A5RA 1WR1A 2OOBB 2M1MA 3CSFA 3Q3FA 1WJMA 1Y8RC 1U29A 3UGBB 3TW1A 4DHZB 2GBMA 3ENEA 3WANA 2J0KA 3OJ3A 4HK2A 3UINB 1XT9B 2HJ8A 1V2YA 1E7VA 2FCNA 2LRUA 2P0DA 4F7UP 3P2BA 3RZWC 3DBLI 2NZ8B 3NOBA 2XK5A 2DHKA 2ZZPB 3PGEA 1NTIA 1V89A 4CHJA 3C0RB 3ECIA 2Y5BB 2JUOA 2AL3A 2K8BA 4GSWA 2RR9A 4WSFA 2LBBA 1UNPA 4RMAA 4WQOB 1V49A 4A6FB 2MLBA 3N32A 3G9WA 3CXBB 2R0DA 2NCNA 1LQBA 2KWVB 3WAOA 4GDKB 4HAYB 1EF5A 1KOTA 2YT1A 2IYDB 3PHWB 5JHBA 4FHJA 4MT7A 1K5GB 1WGDA 2EMSA 4YL8A 2KWCA 1TQZA 2KKCA 2RSUA 1P3QU 1WJ1A 5LLIA 2AWTA 1ST7A 2O6VB 4ANWA 2LGYA 2EKEC 2KD0A 4EFOA 2KLGA 2K8HA 5DI9B 3VIAA 5AZHA 4IC7B 1YQBA 2M0XA 1S3SG 1RAXA 2K25A 2JZZA 1X11A 2RPQA 2LYDA 4BBKA 5BO4B 1P0RA 3ZRCA 3DXEA 1U2BA 3K9PB 3ZDMC 1MK7B 2L2IA 5FI0A 2PE6B 3DDCB 4HWIB 5HE2A 4BOZB 5E6NA 2GBJA 5HE0A 3PSCA 4DBBA 1U5EA 1WI1A 2VKIA 2K8CA 2D4QA 2N9PC 3KYDD 3WA0A 1OEYJ 3APDA 3PS6A 4W9CA 3VH3B 3NZSA 4NAWB 1WGQA 1WM3A 3U8ZA 3P7ZA 3UQAA 2KO3A 3AI5A 1X05A 2CRFA 1C1YB 2ELBA 3WYFB 3PPAA 3PV1A 2E2XA 1F9JA 4HB4B 3L10B 2FCMA 4JQWC 2G4SA 3ZLZA 3A98B 4KSKC 1I35A 5DHAB 2GJYA 5GMVA 1Z87A 3A8PA 2DHIA 1RRPB 1U5GA 3T06A 5J3TA 1Q0WB 1WR6E 2KJRA 2VRRB 4G11A 3CF6E 2G3QB 4HCNB 4K7SA 1UNQA 2GMIC 2FUHB 1LXDA 4K7WA 5LOPB 5D3XA 2UYZB 2IY1B 2KN5A 5D6JB 1G6JA 3ZVRA 1UBQA 5LXHA 2CQUA 5CLLB 3IFWB 3HHMA 2N9XA 1WY8A 4A5KA 3NY5A 4XC2A 4PNKA 4DWFA 1L2NA 5C5BB 3D32A 4FBJB 1YX5B 5FR6A 5C1ZA 2KCJA 5HE1A 1TJ6A 3OANA 5J3YA 1BT0A 2CHXA 3VFKA 4A20A 4HLEA 5EDSA 4NJ7A 1XKEA 2REXA 3ODXA 4XX5A 4ASWC 2DYBA 2YS3A 3HQCA 2L8JA 3TBLD 3ZUNA 2BCJA 1EO6A 1KI1B 3A9KB 3SYXA 2DYNA 3QK0A 3ZO5B 4NQKE 2G4DB 1AWEA 1WM2A 2PEAA 4I6NB 4PYUA 3PVLA 1FB8A 1WYWB 3A4SC 4JIOU 4PS8A 4AJWA 1UPRA 1UZXB 2JY6A 2NBUA 2DENB 3L08A 2ZCCA 2YRYA 1FHXA 4KZCA 4WWOA 5JZEB 4EMOA 1WXAA 4OVVA 5JHAA 1YD8U 2KVRA 1KM7A 2N4FA 2C9WB 5CTRC 3QBVB 4A3OA 1FGYA 4E3CA 1ZSQA 2CHWA 2D9VA 2CAYA 5FI1A 4A6FA 2ROVA 1ISNA 3SNHA 2M4NA 3DCGA 3U7DA 3L13A 2LI5A 4HHVA 2LVOA 2XBBC 2UZRA 1TGZB 4AJYB 4AWJA 2L7RA 2UZSA 2IY0B 3ZIMA 3A8QA 3VDZA 1V6EA 4IAPA 3IG3A 2MDXA 4WAAA 4EKUA 2CU1A 1MKEA 4HAZB 2KJ6A 5G55A 4WWPA 3KH0A 4W9FA 5IJMA 3ZNZB 4AOFA 4W9JA 2G45B 3WIMA 3ML9A 3OJ4B 4BBNC 3IBEA 2LVPA 4LCDE 4BBNF 4KAXB 2KJHB 4MH0E 4MSMB 4ANUA 3KZ1A 5CX3A 2GCJA 2KDEB 4HB3B 4W9IA 2KZRA 2OJRA 1M7RA 3TFMA 4L6EA 1UBIA 3WAPA 5JH5C 4IFSA 3V6CB 2YSZA 3JYUA 1P1AA 5L83A 4PQ0A 2CR5A 3RCPA 2KDBA 2L05A 3AJ4A 3VXWA 1SE9A 4RM8A 3ZRFA 2KANA 1V5PA 2DHJA 5C79A 2LASA 3RUIB 5JHGA 2JT4B 2KTFA 2DLWA 4DHJB 5J2RA 2DTCA 2AYOB 2CHZA 1LM8B 3VAWA 2FCSA 1OMWA 4Y94A 2ABDA 2Y8FA 1T0YA 5L81A 1WE7A 4HDOA 2NPTA 3QIJA 1UNRA 1X1MA 2ADZA 3DQVA 2KC2A 1XR0B 2MP2B 1X1GA 2DFKA 3F0WA 2L1CA 4II2B 5L95C 3A9JB 4YONA 1WZ0A 1WMHB 4WVFB 4KV2A 4LJPB 2OTXA 1SIFA 1ZGUB 1Y19B 4W9KA 2JPHA 2KHWB 2A5UA 3GYPA 2L76A 2O2VA 3N30A 4K1RB 1UEFA 4MK0A 4D0NB 3DOWA 4MJSA 1KLVA 5CLQB 1KZ7A 1ZC3B 5EFXA 2KFKB 4DDGD 5HE3A 3M1IB 4B6HA 2QHOA 4I6LB 5D94A 2DKQA 5DHFB 3A9KA 1E8WA 3LJ3A 2KK8A 4M8NA 1R4NI 4F8CB 1R4MI 3PRPB 3M63B 4ZDVA 2KDIA 5KQ4A 1H8CA 1WGHA 1FHOA 2L3ZA 2WDTB 1D3ZA 2KOXA 1GG3A 3JVZX 2MX2A 1WGUA 2C60A 4HVBA 3V62A 5J18A 5DPWA 4EZJA 2UVMA 2HTHB 1YIWA 1W1HA 4IG7B 1KJTA 4MY6A 2ROZB 3B0AA 3D8FA 1Y5OA 2W9NA 2KNBA 1U5FA 2M8SA 2MP2A 1OGWA 3EPYA 1KZGA 1IPGA 2KXJA 4KDLB 4NSWA 3V60A 3KVFB 1FAOA 3PREA 2CY4A 2ZJDA 3DVGX 4IUMB 3SV1A 3DPDA 2BYFA 3EHVA 1S1QB 2RD0A 3HIZA 4IM0A 4CO7A 3FM8C 1WI0A 2B3AA 4F7GA 1W1DA 3ML4A 3PSEB 4DBGA 1WJNA 3T9LA 3AXCA 3OLMD 2YT0A 3O96A 3H9DA 2Z0PA 1E7UA 2ZEQA 3BINA 1ZKHA 2WWZA 3VTVA 2BGFA 3T8MA 4DHZE 5CHWA 4ANXA 3P6AA 3H7SA 1V61A 4XZ4A 5DCNA 3IVFA 4EOYA 2O6VA 3MDBC 1P9DU 2KLCA 4KHBB 4JLCA 1NTVA 2FAZA 2K6DB 2WH5A 4G3XB 4MEMA 4PS7A 2I5FA 1NVLA 2DZJA 2C5LC 4K81A 3V6EB 2K39A 3X0WA 1V5OA 1SGHA 3RD2A 5LXIB 4CHMA 2DYMA 3D8DA 1FOEA 3A1QB 2ASQA 4NPNA 2YS5A 1Z5SB 3PT2B
chains in the Genus database with same CATH superfamily
1L4ZB 1SJED 1NEKB 1I4HA 5FK9C 1I4QA 2I1KA 3GB1A 2D10A 3V5WA 2PIAA 3I5JC 5KHQA 2WX1A 2MJEA 5C23A 4WJOA 1OQNA 3UI3A 5HHDG 4MSQB 2CB8A 1HZ6A 2IZVB 1EGXA 3TMPB 4K3BA 2DX1A 1M7EA 4BVUC 2JXXA 5DIFB 2XEWA 4ILGB 4Z2MB 3KUCB 3N20C 4MGIE 1GB1A 2P0HA 3W2DA 4HXDA 2K2JA 1SEBD 3Q8CA 2LUMA 2ZW0A 3VQIA 1C4AA 4NZLB 4Q2JA 1GC7A 1YX6B 4OVUA 2MBQA 2W2XC 3Q14C 1XLOA 1V9JA 1KC7A 4GPTB 2M0AA 3S2AA 2H7EA 4ITKA 4XYCA 1N62A 1XQQA 3TEXA 2IFSA 1L7YA 5AZGA 1WX7A 2LMCA 4C4VB 3SBGA 3D8EA 1WMHA 1GUAB 1HE8A 3QARA 1IP9A 3O65B 3V3XA 1MIXA 3L17A 2JZ3B 2N7DA 1ZW7A 2NS5A 3AEDB 2WXJA 4GMVA 3W5VB 4MM3A 1PGXA 1GC6A 5J17A 4HAXB 5IO9A 1H10A 4HATB 2YS1A 3ZKJC 2DBYA 3VVWB 1MK9B 2N1WA 2E6XA 2M38A 2N9EB 4EUTA 2XN9C 1SE3A 3ML8A 2KQSA 2IBIB 2WXLA 4M02A 3AU5A 1EU3A 4BOSC 4DXAB 3LJUX 3H1UA 3ULCA 3VR9B 2R2QA 4FADA 2I5CA 1PYWD 2YF0A 2BYVE 4KHBA 1XCGA 3VOQA 2J0JA 1J7AA 2P0FA 4USAA 1XX0A 1R4NB 4IWQA 4TQ1A 4KGSA 3ZTDA 4J6IA 3GZNI 4MGKE 1KBLA 2K00A 4XDDA 4CHKA 2C7NB 1E7PB 2UU7A 4WURA 1J0WA 2N7JA 5HKHA 4W9LA 2BKRB 2KMAA 2M14A 1EUVB 3PZ7A 1TZOA 1YN3A 3PO0A 2RGNB 2AX5A 2INCC 3B1LX 2BYEA 1GGOA 4P7IA 4HAUB 1K53A 2LULA 3KW5B 4F1SA 4DX90 1ZC4B 2CS4A 2PVOD 1U4AA 4W9HA 2DZKA 4MACA 3IAM1 3ONSA 1I7HA 4ZYNA 3RNBC 5D3YA 1FNVA 2Y7BA 2RUKB 5D3VA 3CIRB 1ZXIA 4HAWB 2WLBA 4FHKA 4HPMB 2J52A 4RM9A 2D07B 3PVWA 3RNEC 2YVCA 1WJUA 3PP2A 4GU2A 3PTFC 1SHCA 1DDVA 4DXFA 5IRSA 4JK8A 3H7PA 1ZDXA 5IA7A 3EC8A 4A55A 3PVUA 3ALBA 1GAQB 1WX9A 1R7SA 2XK5B 1JQ4A 2YEPB 3IHPC 2J59M 1QT9A 2FUG1 3PHXB 2OEDA 3I57A 4ZHPA 2DAFA 3T3NA 2CU3A 1WE6A 2KMCA 3SO6A 1I7AA 5GOWB 1Q1OA 2KGXB 1C3TA 2ZVNA 2K22A 2LGIA 3A9JA 1I42A 1UH6A 3W1YA 3HW2B 3SUZA 1V80A 4H2AA 1FM0D 1WGYA 3R2IA 2Z0DB 3ODWA 4TQ0A 1IBXB 4W9EA 2KFKA 3AE4B 3ZDTA 3RZFA 2RGFA 4WWNA 1MPHA 1EU4A 3OAWA 1V5MA 2FIFA 3NVVA 3WCQA 4M0WB 2COAA 4OSNA 2KR0A 2Z0EB 3MHSD 3H7PB 3L54A 1P7FA 3BYYB 3UGBB 2M1MA 4EFOA 4DHZB 1WJMA 1Y8RC 1KH0A 2HTME 1V2YA 1E7VA 2FCNA 2P0DA 3DBLI 2NZ8B 3NOBA 2XK5A 3PGEA 1AWDA 2JUOA 2K8BA 2KMMA 2WXFA 3B9JA 4WSFA 4P1CC 4RMAA 4WQOB 1V49A 2INPE 3CXBB 1TYGB 2KWVB 2NCNA 1KOTA 4GDKB 4HAYB 1EF5A 3EUB2 2YT1A 2K0PA 2LJIA 4FHJA 2KWCA 4YL8A 3Q6BA 1K50A 2KKCA 1P3QU 4ANWA 1ST7A 1TKYA 2EKEC 2KLGA 1PGAA 5DI9B 1MVKA 3B77A 3DXEA 5FI0A 4RGOS 5I2SA 5HE2A 5HE0A 4DBBA 2N9PC 1U5EA 1WI1A 2K8CA 3RFZB 2BS3B 3APDA 1FRRA 4NAWB 4CSQA 1TY2A 3UQAA 3Q8FA 1XLNA 2KO3A 3DBHB 1X05A 2CRFA 1C1YB 3PPAA 3PV1A 2W3RA 4JQWC 4YSZB 1F2RC 3A98B 2V0GA 4KSKC 5DHAB 2GJYA 1VR9A 4MGZE 3NS8A 1U5GA 4HCNB 2FUHB 1A70A 2UYZB 2KN5A 5D6JB 1UBQA 5CLLB 1WY8A 4A5KA 3NY5A 1QOFA 1L2NA 5C5BB 3D32A 3IT6B 2KCJA 1FXAA 2GRIA 4P1BC 1MJDA 1TJ6A 2RDGA 3DHIC 4JPSA 2REXA 4XX5A 2DYBA 1TJEA 4FXCA 2L8JA 3GE8C 3TBLD 2BCJA 1EWCA 4A9AA 3BVZA 4NQKE 2KWDA 4GOUA 1AWEA 1WM2A 2G4DB 3Q8AA 4AJWA 2AQ3B 1UZXB 2JY6A 1TKGA 3KQ4A 2ZCCA 4EMOA 4QJ5B 5JHAA 5J2RA 2ZKMX 2D9VA 2CAYA 5FI1A 4A6FA 2BQQA 1ISNA 3U7DA 2WXHA 3E9OA 2RMMA 1UWMA 5JVLA 3A8QA 3VDZA 2WXPA 4EKUA 2CU1A 1C4PA 4WWPA 5IJMA 1CQVA 3ML9A 4BBNC 5H8YE 5HG2A 2SEBD 3RPFC 1FRDA 2WXRA 3AEBB 2VZKB 4W9IA 1NYQA 2KZRA 3GE3C 1DYQA 2YSZA 3NJTA 2KDBA 3RCPA 2L05A 3AEFB 1SE9A 2HDEA 1V5PA 5C79A 2AYOB 3LXFA 4QJ4B 1T77A 1WE7A 3RNGC 5I2MA 2LFIA 3DCXA 3A9JB 4WVFB 2OTXA 1SIFA 1Y19B 2JPHA 1HXYD 3GYPA 4MJSA 4MK0A 2KFKB 4DDGD 4B6HA 1R4MI 3M63B 4JKHA 1WGHA 2L3ZA 3DBLB 2KOXA 2MX2A 5J18A 4QXAB 2UVMA 2HTHB 3SFDB 3HIEA 2IDYA 1KJTA 2ROZB 4ILHA 1OGWA 1IPGA 2VZKD 4IUMB 3DVGX 4RCOA 2RD0A 4IM0A 1YQ4B 4F7GA 3IAS1 1KTKA 3OLMD 2YT0A 3O96A 2MH7A 1E7UA 1ZKHA 5IP4D 2R61A 2BGFA 1MFWA 3U12A 3FKYA 2O6VA 1P9DU 2KLCA 5EE3A 2EELA 2K6DB 4G3XB 2I5FA 4N58A 2KACA 1WYGA 3NS1A 2WHIA 2Z59A 1V5OA 4CHMA 2DYMA 2V3NA 3IT4B 2TSSA 3PT2B 2ZVOA 2Y8GA 3NG0A 4C00A 3DXCA 1OEYA 4LNIA 1PGBA 3TUOA 2A4ZA 1X1FA 2GUMA 3ZTCA 2HD5B 1WXMA 1GOZA 3TEWA 3QHTA 3SEBA 5LNK1 1JRPA 4IM3A 3JSVA 3AEAB 4YWGG 3P42A 2KIEA 1MG4A 4RGNA 1UELA 4B0EA 4KIKA 3BJIA 1YJIA 2MWSB 3E9SA 1YMHE 2RLOA 2E3TA 5HFYA 1C9FA 2COPA 2KUQA 4NJ6A 2IGGA 1WXSA 3MFGA 3E9PA 2MWNB 2HE7A 2NBVB 2V1YA 2YLMA 4ZHOA 2K2UA 5BYSA 2OJWA 1MIZB 4JKAA 2V4LA 4ZRKA 3W1SC 5C3JB 3MP9A 1L0VB 4GNKB 2MRPA 5E6OA 1EWYC 2DYOA 3B2GA 1TBEA 1B55A 2INNE 4TUUA 2KUPA 1J0GA 1DBHA 4WAFA 4XWTA 3RYTA 3DHGC 1PFDA 2PMVA 4EJNA 2HTHA 3MC9A 2G9HD 4WIPA 4IW0A 3AE7B 4YSYB 3PZDA 2Z4DA 1LGRA 4ARCA 2Y5PA 2H7DA 1UD7A 4K3CA 2BS2B 1VLBA 1HZ5A 2RDBC 4N59A 1ZM0A 1E6EB 4E74A 3H6NA 4ZRJA 4F7ZA 5C6RA 1WGRA 2BKFA 1RLFA 4GMXB 2D9WA 3B2FA 4HCPB 2Z13A 2NVUI 3L0WB 2DN6A 4ICUA 3ZGZA 2DZMA 3M95A 3VUXA 2UWQA 1NTYA 4KSLC 1FCLA 3DBRB 5BMIA 2MHJA 5IOIA 2L83A 4DK5A 4P16A 4MJSB 5J3QA 1Z5SB 4P6VF 1E8YA 3KY9A 3NZUA 5IAAC 3FILA 3W5UB 1P6SA 3VTWA 1J8CA 1JWAD 1VBGA 3X23A 1FXTB 5EE1A 2DKPA 3ZNGC 1FEHA 5HI1A 2DIKA 1I4RA 4B95A 1WIAA 1YQ3B 3I9V1 4URKA 4L1BA 4JKGA 4A90A 2GI9A 3SBTA 1I4XA 1P3RA 2I38A 2WYQA 3JSVB 4LK0M 2Z8LA 1FIQA 3EFUA 2OQBA 4LDTD 5LG4B 2MW5A 4GIVA 1ZPSA 2IGHA 5TR5A 2J42A 2NMQA 3FC4A 3TJPA 2N7EA 1SXTA 4LNNA 5D3DA 3J9CA 4BFRA 4BKSA 1FFVA 2M17A 4BAXA 5JXVA 3EECA 1LFDA 2WXNA 1XO3A 2N0SB 4WJPA 4XWWA 3PRZA 3U52E 2Z0OA 1JRUA 3FSSA 2NPTB 3KRXA 3P4PB 5BMGA 3CSTA 3PG7A 3KYCD 2MA9B 3LDZE 2Z59B 3HM6X 5D7GA 4HPPA 2O2VB 1SJHD 3PLUA 3AV8A 4GGQA 1ACCA 2Z0QA 3TVVA 3DBRI 4HB2B 2MCNB 2JWUA 4EZKA 4L1RA 4MM3B 1RRBA 3RT3B 1UPQA 2JXTA 3QA8A 5AUIA 2MSED 1EF1A 3EFCA 3N1YC 1P5TA 2KX3A 2LXAA 1V1PB 4EEWA 2X8XX 1XD4A 1TTNA 3DVNV 2AEHA 4BKTA 2M19A 5BYRA 1J7CA 1F1HA 1SE2A 1GJZA 2DA0A 3FAHA 4H8SA 2CJNA 1WRDB 2VH2A 1EAZA 2LGDA 3HRDD 2NMBA 4ZOHC 2CODA 4IWOA 1QZEA 3AULA 3OWEB 4HAVB 4BKGA 3R7RA 1V5TA 1NDDA 1BTKA 3FEHA 3KRWA 2KFJA 2H89B 1FCCC 3AE5B 1BUIC 3DBHI 2GBRA 4MDKE 1QKZA 1A5RA 1WR1A 2OOBB 1DOYA 3CSFA 3N1ZC 1U29A 2GBMA 4RFBA 3ENEA 2J0KA 3UINB 2WXGA 4II2B 1NTIA 1V89A 3NWDA 4CHJA 1OQQA 2RR9A 2LBBA 4ILJA 3N32A 2RPVA 2R0DA 3WAOA 2L1AA 2IYDB 5JHBA 4MT7A 2LHEA 1WJ1A 2O6VB 2LGYA 4ZRPA 1L6UA 2D3BA 2M0XA 1RAXA 2JZZA 2RPQA 2WGSA 2LYDA 4BBKA 4A6QA 1P0RA 3AE8B 2L2IA 2PE6B 2GBJA 1T0QC 2NBVA 2WDQB 2VKIA 5G5GA 3VH3B 1OEYJ 4PK1A 3NZSA 1WGQA 3U8ZA 1XCTL 4RF0A 3WYFB 4OW0A 1F9JA 4HB4B 2FCMA 3ZLZA 2G4SA 2JYEA 4JKGB 1N5XA 3AE2B 2KQ7A 3A8PA 2DHIA 1RRPB 1Q0WB 4K7SA 2KJRA 1K52A 2G3QB 4JWUC 1LXDA 4K7WA 5LOPB 4MT5A 5D3XA 3NWFA 2N9XA 2DNFA 5D3IB 4FBJB 2KVZA 3OANA 2CHXA 3ODXA 4ASWC 1ZUD2 3ZUNA 2Z14A 2G1EA 1EO6A 1KI1B 1ET9A 1MI0A 3QK0A 3A58A 2PEAA 4I6NB 3PVLA 1FB8A 1WYWB 1N6ZA 4JIOU 4PS8A 4IKGA 1QF6A 4YT0B 4WWMA 1FPYA 2DENB 4XE0A 3L08A 1FHXA 4OT1A 1UGJA 1YN5A 4KZCA 4WWOA 5JZEB 1WXAA 2R2YA 5CTRC 4E3CA 3QBVB 1ZSQA 4HSIA 2MJ3A 2M4NA 2ROVA 1QQRA 3ZQ4A 4D2KA 1T0SC 4C7YA 2BTEA 2MEKA 1IGDA 1B9RA 2UZRA 1UNSA 4AWJA 2L7RA 2UZSA 1QILA 1DOIA 2IY0B 3IG3A 4IAPA 4WAAA 1MKEA 4HAZB 1LO5D 3U7ZA 2Y5CA 2LVPA 4LCDE 2KJHB 1L0XB 1STEA 3KZ1A 3BK1A 2OJRA 2KDMA 4KX6B 3WAPA 2VH1A 5JH5C 1MPEA 2CJOA 3Q8BA 3RI7C 1P1AA 3ZRFA 2KANA 1MHHE 2QSDA 3RUIB 1AW7A 2JT4B 2KTFA 2DLWA 1ENFA 1JCKB 2CHZA 2SAKA 3VAWA 1IGCA 1OMWA 2Y8FA 4G0NB 1UNRA 2ADZA 3IXSA 1XR0B 1X1GA 3F0WA 3R2TA 1HTQA 3BK2A 4YONA 1OFFA 1WZ0A 2V9HA 4W9KA 2L76A 2LGSA 4K1RB 5EFXA 1ZC3B 5HE3A 2QHOA 2FBWB 1XF5L 4M8NA 3VRAB 4ZDVA 4QJ3B 1H8CA 2GLSA 4EZJA 3D8FA 1Y5OA 1HA5A 2MP2A 1KZGA 4KDLB 1V97A 5T8IA 3V60A 3KVFB 1UUPA 3PREA 2CY4A 2RDHA 2AQ2B 1FMAD 4DBGA 2Z0PA 5AUKA 2ZEQA 1F52A 3GP7A 4GLSC 1YN4A 1T6BX 5DCNA 3IVFA 1P7EA 4EE2A 5M4YB 4KGTA 3AEGB 3MC8A 2WH5A 4MEMA 4PS7A 1NVLA 4K81A 3V6EB 2R82A 4US9A 5LXIB 2WXIA 1V8CA 3A1QB 2IO0B 4DXGA 4HB0B 5D27A 2PVGC 4FA6A 5C16A 2FJLA 2V3SA 3W1SA 1ZDVA 1ZOYB 3MTNB 5AEKB 2LXCA 2BF8B 1HBKA 1NU2A 2NTTA 2P8VA 4K17A 2L32A 3HVZA 2X38A 4KHAA 3BZDB 3CIKA 1PFJA 4K2OA 4YTNB 1E10A 3KUZA 1E0ZA 1D5MC 2WX0A 4TKNA 3UF8A 4NQLB 3VR8B 3QC8B 4MGYE 1TXDA 1YJ1A 4JKFA 4NY0A 4CQNA 2OHFA 4M0WA 3E9LA 2MBBB 3NRZA 3URYA 4FJZA 1WZ3A 5CHFA 1E90A 3DWMA 4JX1C 4HEA1 4G50A 2MKRA 1OY2A 4TYZA 4HDQA 3A1QA 4W9DA 4FULA 5D2MB 4DDID 1I2HA 2V76A 2JVCA 3RCZA 1FGZA 1E8ZA 1DIKA 1L0YB 2X18A 4AUQC 4GXBA 4RF1A 4KDIC 1N5WA 4UDUC 2EMTA 4KKIA 2KTRA 1V86A 3P4SB 1E5WA 3Q8EA 1ZXHA 2H88B 5JP4A 2FIDA 2PE9A 4LNOA 3RULA 3GYOA 1N3HA 3BIID 1OQYA 3NHEB 4WJ7A 1I4PA 3UIPB 2VRWB 3I3TB 3QX1A 3ZXVA 1NBFC 1WXVA 2L00B 1VBHA 4HPLB 4WJQA 2J0MA 2LZ6A 3C8YA 3HM3A 4OZBA 2I1JA 3KWVA 2MBEA 4NAWA 4NNJB 2IO2B 4GOCA 1BTNA 2J7QB 2BWES 2NTSA 1SBBB 4US8A 4FLHA 1C78A 5CHVC 2RVBB 2DLBA 3H8HA 3K9OB 3U30A 4ICVA 2JF5A 1WFYA 3NVWA 2MBHA 2NR2A 1VD2A 2MJDA 1WG7A 3NZ3A 1UWXA 4A3PA 2WXKA 2IJ0A 3QWMA 2KX0A 1X86A 2Q5WD 3L16A 5EE9A 3VUYA 3A33B 1M4VA 3PRMB 1V88A 1K51A 3VUWA 1EVHA 3HK0A 1WF9A 3ABVB 1AQCA 4S17A 3MHZA 4XWXA 4A6HA 4ZRIA 2MBOA 2LJ5A 1KF6B 1F77A 2LUEA 4C7ZA 3APFA 2KN4A 2L0TA 2JRIB 2O6VD 3W9CB 1WX8A 2Q13A 2LD9A 4I6PA 4TV3A 3TIXA 2GBNA 4GDLB 1JROA 2N23A 3AU4A 2HRJA 2KWUB 1ROEA 4IM2A 3ENBA 2FDQA 3TO1A 3ZNID 1V1PA 1QOAA 1D5ZC 2C7MB 2ZW1A 2PPHA 2GS0A 1UF0A 2MFQA 2RSGA 2QKMA 4FN2A 2DHZA 1QOBA 1AARA 2X0SA 1Q67A 4F7HA 4II3B 5AZFA 3SR6A 1T5XD 3VRBB 5E6PA 2LWPA 3AN1A 2W2XD 3APCA 3GOEA 2KT7A 2DYQA 1WGKA 2LRWA 3RNAC 3PEGA 3SD5A 1N61A 5MPOA 3ZNHB 4RGMA 4JK9A 1L4DB 1MAIA 2FNJB 2BPSA 2ZNVC 4REZA 4A8XC 1HQRD 3N7CA 5KHOA 2KDFB 4MELA 3RNFC 1TZ1A 1RM6C 1XXGA 2ZNVB 3AE6B 3BWUD 4C4VA 2JP2A 5KQ1A 1NI2A 1H4RA 4KHOA 3TCAA 2CY5A 2DX5B 1NYRA 1W1GA 3MPXA 2BB5A 3CMMB 4JL9A 4CYEA 3M3JA 2NBWB 1ACAA 3NSUA 1V81A 3AM9A 4B6WA 3AE3B 1DDWA 3N9YC 1KFYB 3B08A 4M8MA 4HKQA 1XD3B 5JHHA 4IDIA 4NAMA 3Q3FA 1L5PA 3TW1A 3WANA 3OJ3A 4HK2A 1XT9B 2HJ8A 4F7UP 3RZWC 1AN8A 3Q69A 2DHKA 2ZZPB 2QILA 2Y5BB 1UNPA 2PTLA 4A6FB 3NVZA 3NW8A 3G9WA 2D3CA 1BXTA 2J53A 3PHWB 2EMSA 1TQZA 1KLGD 5LLIA 2AWTA 3VIAA 1QOGA 2KAJA 4IC7B 2K25A 1X11A 5BO4B 3AEEB 3EGRA 1MK7B 3DDCB 4HWIB 4BOZB 5E6NA 2QEJC 3PSCA 3KYDD 3PS6A 1SF0A 4W9CA 1VZ6A 3P7ZA 3AI5A 4MH8A 3L10B 1VZ7A 2QCZA 1I35A 5J3TA 1WR6E 2WXOA 4G11A 1YOVB 1TS5A 3GZNB 3LYYA 1G6JA 1VDVA 5LXHA 2CQUA 4D6WA 4OHJA 2RRFA 4XC2A 4DWFA 3U4EG 5C1ZA 5FR6A 1XLQA 2B76B 2IPKD 5HE1A 5BYQA 3AE9B 1JWMD 1BT0A 4HLEA 4A20A 4YXDB 1XKEA 4LLGM 4LNFA 2YS3A 3HQCA 4TMAB 5H92C 3SYXA 2DYNA 3ZO5B 4PYUA 1WWTA 4YTMB 1UPRA 1JMLA 2YRYA 4OVVA 2WXMA 2KVRA 1KM7A 2C9WB 4A3OA 2CHWA 1BMLC 3L13A 5C2TB 2XBBC 1ZE3D 4AJYB 2WNMA 4RNAA 3ZIMA 1V6EA 2IGDA 1YJJA 2EKIA 5G55A 4W9FA 1D5XC 4AOFA 4W9JA 3IBEA 4BBNF 4KAXB 4MH0E 4MSMB 2GCJA 1CZPA 2KDEB 1M7RA 3FILB 3Q2AC 1DGJA 1C4CA 5TSSA 4IFSA 1RYJA 2FE8A 3JYUA 5L83A 2CR5A 4B0MA 2DHJA 3NVYA 4L2YA 4DHJB 2DTCA 1LM8B 2WXQA 4Y94A 2FCSA 5L81A 4HDOA 3DQVA 1JWSD 2DFKA 1WMHB 4KV2A 1KRHA 2KHWB 2A5UA 4D0NB 5CLQB 1KZ7A 1WRIA 3M1IB 5D94A 1TY0A 2DKQA 5DHFB 3LJ3A 1E8WA 2LHDA 2KK8A 1R4NI 4F8CB 3PRPB 5KQ4A 1JDEA 1PUTA 1FNUA 3JVZX 1TS2A 1Q10A 1WGUA 2C60A 2WS3B 3MJ5A 1YIWA 1W1HA 4MY6A 3B0AA 1B1ZA 2V3PA 3EPYA 2KXJA 4NSWA 3EA6A 1FD6A 2ZJDA 4C56C 4JE3B 1TT5B 3SV1A 3DPDA 2BYFA 1MHXA 3HIZA 4CO7A 3FM8C 1WI0A 2B3AA 1MI1A 2WP9B 1W1DA 3PSEB 1WJNA 1JWUD 3AXCA 3H9DA 3BINA 3VTVA 3T8MA 4DHZE 5CHWA 4J3OD 4ANXA 1V61A 2QIEB 3ZJVA 1QLBB 4KHBB 1NTVA 2BVCA 2FAZA 4ZRQA 4S0RA 2C5LC 2K39A 3X0WA 1SGHA 3D8DA 2N9KA 2ASQA 1T3QA 4NPNA 3R7QA 2K9XA 4GB9A 2WU5B 3ZVVA 5DPSA 1D3ZA 3RNCC 2XNAC 4DHJD 4B9KA 1FHWA 2D2QA 4ANVA 5DPRA 2WDVB 3P4RB 1E8XA 1C76A 1C79A 4TSSA 4HJGE 4N9F4 2N0YA 1K8RB 2D3GA 2JX5A 4HROA 3KWLA 3ODOA 3E56A 4K2PA 2DWQA 3VHTC 2K6QA 2PLPA 4DX8A 4E71A 1XLPA 2LVQA 1I4GA 3DHHC 2QC8A 2QDFA 2GBKA 3WAMA 5LONB 2JU6X 4LDTB 4BKSD 2JSVX 3DXDA 2D9YA 3TL5A 3ZJUA 3SU8X 1D4BA 4K7UA 3QWZB 4M00A 4FJYA 2PJHA 1EM7A 2R09A 5JLJB 4WJNA 1DROA 1K5DB 2R2OA 1RJ2A 3F5RA 4X57B 1HEZE 1J19A 1QC6A 3ULBA 3NWAA 3SDLC 2IO3B 3DVNU 4HJKA 3UQBA 3KUDB 2YT2A 4KZ0A 4EZLA 1ZP0B 2JRHA 1M94A 5G2NA 5D3WA 2JWZA 2INDC 4WQMA 4OZAA 3M62B 1F0ZA 2COFA 1WXQA 4KVGB 4M01A 1XCQL 3NUHB 5GXGB 2I2YA 4JK7A 4RH6A 2Y3AA 3UZTA 3CWIA 1XODA 1UGMA 1WGGA 3N1XC 1Z2MA 3HVDA 2D11A 1SIJA 4WH4A 3I63C 4C0AA 2ONQA 2FCQA 3DWGC 3RMKC 1HB6A 2KIGA 3MC0B 2ELAA 3VTUA 4GN1A 2LG1A 2IO1B 5DPTA 1TS4A 2QKLA 3QQ8B 2GOWA 1QQGA 2K1FA 1P98A 1SSNA 5C5BA 1ZVRA 1DDMA 2W55A 4PS3A 3SFEB 2RQ1A 3TEZA 3R66C 2FJ9A 1PDXA 1VCBA 2MQJA 2VSZA 3ZJTA 1CK1A 4KIKB 2IYBA 4IWPA 2CKHB 4LNKA 3R8BA 2L0FA 1RFAA 2C7HA 4NJCA 4FJVB 4IOIE 1R4MB 2RNRB 1MG8A 2BWFA 3WALA 1TKEA 2DZIA 1JW9D 1DOXA 3N3KB 3FLVA 4N6EB 3MJWA 1IYFA 1U27A 1PQSA 1BWNA 2COCA 3R3MA 4IOYX 3ZW3A 3FVCA 3A4RA 3U2SC 1IRSA 1VZ8A 3FP5A 4JKEA 3P4QB 4Z2NA 1CMXB 1VJKA 1WVHA 2LOZA 1OTRB 1TIFA 3DVGY 1DYNA 2D9ZA 3HUIA 4L23A 2BYTA 4JGHB 1NI3A 2BBCA 4W9GA 3O13A 4GDLA 1V5UA 1U5DA 2JQRB 1HB8A 2XQNM 1N63A 3V61A 2LGXA 5I4DA 5KCVA 3QCAA 3KLSX 3QAQA 2KC1A 2DX5A 4AP4C 4DQOC 4PYZA 1RWSA 1JALA 1NVID 1YNTE 3KSYA 1WJ4A 2W54A 1GNUA 2ZCBA 5DH9B 1WH3A 1WSPA 4GDKA 2KTRB 2GCLA 4GZUA 1PLSA 1PMSA 3PLVA 4LJOB 1D6EC 4A6KA 4YSXB 2W2WA 4KKJA 2ICIA 1AYFA 3JW0X 3BY4B 2ON8A 1LB1A 1WJ6A 3AECB 1BAKA 4C80A 4BZAA 2K49A 3SHQA 2LKOA 1OQRA 1IUEA 2DAJA 3V05A 5BMHA 1LW3A 3HSAA 2LOXA 4PT5A 3Q3JA 3VH4B 2AL6A 2D9XA 1V1OA 4YTPB 2EC1A 2WU2B 4O1NA 3TSSA 2ZPYA 2PZ1A 4QAYA 3OHMB 2JZPA 3P63A 2G35A 1KLUD 2ZPNA 1SE4A 2EJ8A 1Q5WB 3QJZA 3DBSA 3Q3OC 2FJUB 2W3SA 1L6VA 2D3AA 3P2BA 2D5GA 2LRUA 3ECIA 3C0RB 2AL3A 4GSWA 3ZYYX 2MLBA 4OZCA 1LQBA 1FXIA 4OVZA 1JWBD 4ZYSA 1K5GB 1WGDA 1XEEA 1Y56A 2RSUA 1NENB 3P1MA 4XDCA 2AQ1B 2KD0A 2K8HA 5AZHA 1E9MA 1YQBA 1S3SG 3ZRCA 4RGTA 2HJ1A 3ZDMC 1U2BA 3K9PB 3BYTB 2D4QA 3WA0A 1WM3A 2GB1A 1FFUA 2ELBA 2E2XA 2N9LA 2WQYB 4JKDA 2BT6A 5GMVA 5EE0A 1Z87A 3T06A 5IKCM 2VRRB 3CF6E 1UNQA 2GMIC 4XGAB 1CJEA 2IY1B 2V4IB 3OG5A 3ZVRA 4HRSA 3IFWB 3HHMA 5FKAC 4PNKA 4LTUA 1YX5B 2KQ4X 4ARIA 5J3YA 3VFKA 5EDSA 4HKZE 4NJ7A 3Q3MC 2ACZB 3ETRA 5FR3A 5IN7A 4DIXA 2L52A 3A9KB 3PZ8A 1F2RI 2K3UA 3A4SC 4JKCA 3RN9C 5G5HA 1ZYIA 2NBUA 2PKOA 1YD8U 2N4FA 1FGYA 2BB6A 3BVMA 3DCGA 1ESFA 3SNHA 1GPXA 2LI5A 4HHVA 1FNWA 2LVOA 1SB3C 1TGZB 1VRAB 3TEYA 2QJLA 2MDXA 4AS1A 3L4PA 2KJ6A 3KH0A 3AE1B 2WDRB 3ZNZB 3WIMA 2G45B 3AMZA 3OJ4B 2K5PA 4ANUA 5CX3A 1ET6A 4HB3B 2KYWA 3TFMA 4L6EA 1UBIA 2BW2A 3LB8C 1N60A 3V6CB 4PQ0A 3AJ4A 3VXWA 4RM8A 2BS4B 2LASA 3T3OA 5JHGA 1C77A 2JYTA 4R3DA 3E66A 2YEPF 4JLCA 2NPTA 1T0YA 2ABDA 2M56B 2PW9A 3QIJA 1X1MA 3UIOB 2KC2A 2MP2B 1TS3A 5L95C 2J4XA 2L1CA 2W82A 4LJPB 1ZGUB 4JKBA 2O2VA 3N30A 1UEFA 3DOWA 1KLVA 3ZXRA 3AB5A 1IBXA 3C19A 4I6LB 4KGRA 3Q3NC 3BVGA 1GB4A 3GS2A 3A9KA 2KDIA 2K8EA 1FHOA 2WDTB 1GG3A 4HVBA 5DPWA 3V62A 4JWSC 4IG7B 4AQ7A 2W9NA 2KNBA 1U5FA 2M8SA 2LEKA 1RFKA 1FAOA 1FO4A 3EHVA 1S1QB 3ML4A 1HTOA 1J7BA 3T9LA 4ACFA 2WWZA 3AH7A 5E6JA 3P6AA 3H7SA 4XZ4A 4EOYA 3MDBC 2QMTA 1T0RC 2DZJA 3RD2A 1FOEA 2YS5A 2N1VA
chains in the Genus database with same CATH topology
2I1KA 2D10A 3V5WA 5KHQA 2WX1A 5C23A 4WJOA 1OQNA 4MSQB 2CB8A 2IZVB 1EGXA 3TMPB 2DX1A 1M7EA 4BVUC 2JXXA 5DIFB 2XEWA 4ILGB 4Z2MB 3KUCB 4MGIE 2P0HA 4HXDA 2K2JA 3VQIA 1GC7A 1YX6B 4OVUA 2MBQA 2W2XC 1V9JA 1KC7A 4GPTB 3S2AA 2H7EA 1XQQA 2IFSA 1L7YA 5AZGA 1WX7A 3SBGA 3D8EA 1WMHA 1GUAB 1HE8A 3QARA 1IP9A 3O65B 1MIXA 3L17A 2JZ3B 2N7DA 1ZW7A 2NS5A 4GMVA 4MM3A 1GC6A 5J17A 4HAXB 1H10A 4HATB 2YS1A 3ZKJC 3VVWB 1MK9B 2N1WA 2M38A 2N9EB 4EUTA 3ML8A 2KQSA 2IBIB 3AU5A 4BOSC 4DXAB 3LJUX 3H1UA 3ULCA 2R2QA 4FADA 2I5CA 2YF0A 2BYVE 1XCGA 3VOQA 2J0JA 2P0FA 1XX0A 4IWQA 4TQ1A 3ZTDA 4J6IA 3GZNI 4MGKE 1KBLA 2K00A 4CHKA 2C7NB 1J0WA 5HKHA 4W9LA 2BKRB 2KMAA 2M14A 1EUVB 2RGNB 3B1LX 2BYEA 1GGOA 4P7IA 4HAUB 2LULA 3KW5B 4F1SA 4DX90 1ZC4B 2CS4A 1U4AA 4W9HA 2DZKA 3ONSA 4ZYNA 5D3YA 2Y7BA 2RUKB 5D3VA 4HAWB 4FHKA 4HPMB 4RM9A 2D07B 3PVWA 2YVCA 1WJUA 3PP2A 4GU2A 3PTFC 1SHCA 1DDVA 4JK8A 3H7PA 5IA7A 3EC8A 3PVUA 3ALBA 1WX9A 2XK5B 3IHPC 2J59M 3PHXB 2DAFA 1WE6A 2KMCA 3SO6A 1I7AA 5GOWB 1Q1OA 2KGXB 1C3TA 2ZVNA 3A9JA 1I42A 1UH6A 3W1YA 3HW2B 3SUZA 1V80A 1WGYA 2Z0DB 3ODWA 4TQ0A 4W9EA 2KFKA 3ZDTA 3RZFA 2RGFA 4WWNA 1MPHA 3OAWA 1V5MA 2FIFA 4M0WB 2COAA 2Z0EB 3MHSD 3H7PB 3L54A 3UGBB 2M1MA 4EFOA 4DHZB 1WJMA 1Y8RC 1V2YA 1E7VA 2FCNA 2P0DA 3DBLI 2NZ8B 3NOBA 2XK5A 3PGEA 2JUOA 2K8BA 4WSFA 4RMAA 4WQOB 1V49A 3CXBB 2NCNA 2KWVB 1KOTA 4GDKB 4HAYB 1EF5A 2YT1A 4FHJA 2KWCA 4YL8A 2KKCA 1P3QU 4ANWA 1ST7A 2EKEC 2KLGA 5DI9B 3DXEA 5FI0A 5HE2A 5HE0A 4DBBA 2N9PC 1U5EA 1WI1A 2K8CA 3APDA 4NAWB 3UQAA 2KO3A 1X05A 2CRFA 1C1YB 3PPAA 3PV1A 4JQWC 3A98B 4KSKC 5DHAB 2GJYA 4MGZE 3NS8A 1U5GA 4HCNB 2FUHB 2UYZB 2KN5A 5D6JB 1UBQA 5CLLB 1WY8A 4A5KA 3NY5A 1L2NA 5C5BB 3D32A 2KCJA 1TJ6A 2REXA 4XX5A 2DYBA 3TBLD 2L8JA 2BCJA 4NQKE 2G4DB 1AWEA 1WM2A 4AJWA 1UZXB 2JY6A 2ZCCA 4EMOA 5JHAA 5J2RA 2D9VA 2CAYA 5FI1A 4A6FA 1ISNA 3U7DA 3E9OA 5JVLA 3A8QA 3VDZA 4EKUA 2CU1A 4WWPA 5IJMA 3ML9A 4BBNC 4W9IA 2KZRA 2YSZA 2KDBA 3RCPA 2L05A 1SE9A 1V5PA 5C79A 2AYOB 1WE7A 3A9JB 4WVFB 2OTXA 1SIFA 1Y19B 2JPHA 3GYPA 4MJSA 4MK0A 2KFKB 4DDGD 4B6HA 1R4MI 3M63B 4JKHA 1WGHA 2L3ZA 2KOXA 2MX2A 5J18A 2UVMA 2HTHB 1KJTA 2ROZB 4ILHA 1OGWA 1IPGA 4IUMB 3DVGX 2RD0A 4IM0A 4F7GA 3OLMD 2YT0A 3O96A 1E7UA 1ZKHA 2BGFA 2O6VA 1P9DU 2KLCA 2K6DB 4G3XB 2I5FA 1V5OA 4CHMA 2DYMA 3PT2B 2ZVOA 2Y8GA 3DXCA 1OEYA 2A4ZA 1X1FA 3ZTCA 2HD5B 1WXMA 3QHTA 4IM3A 3JSVA 1UELA 4KIKA 3BJIA 2MWSB 2RLOA 2COPA 4NJ6A 1WXSA 3E9PA 2MWNB 2HE7A 2NBVB 2V1YA 2YLMA 2K2UA 1MIZB 4JKAA 2V4LA 4ZRKA 3W1SC 2MRPA 5E6OA 2DYOA 1TBEA 1B55A 4TUUA 2KUPA 1J0GA 1DBHA 3RYTA 4EJNA 2HTHA 4IW0A 3PZDA 2H7DA 1UD7A 1ZM0A 4E74A 3H6NA 4ZRJA 4F7ZA 5C6RA 1WGRA 2BKFA 1RLFA 4GMXB 2D9WA 4HCPB 2NVUI 3L0WB 2DN6A 4ICUA 2DZMA 3M95A 3VUXA 2UWQA 1NTYA 4KSLC 4DK5A 4MJSB 5J3QA 1Z5SB 1E8YA 3KY9A 3NZUA 5IAAC 1P6SA 3VTWA 1J8CA 1VBGA 3X23A 1FXTB 2DKPA 3ZNGC 2DIKA 4B95A 1WIAA 4URKA 4JKGA 3SBTA 3JSVB 1P3RA 2WYQA 3EFUA 2OQBA 4LDTD 2MW5A 4GIVA 5TR5A 3TJPA 2N7EA 4BFRA 4BKSA 2M17A 3EECA 1LFDA 4WJPA 3PRZA 2Z0OA 1JRUA 3FSSA 2NPTB 3KRXA 3CSTA 3PG7A 3KYCD 2MA9B 3LDZE 2Z59B 3HM6X 5D7GA 2O2VB 3PLUA 4GGQA 2Z0QA 3TVVA 3DBRI 4HB2B 2MCNB 4EZKA 1RRBA 3RT3B 1UPQA 3QA8A 2MSED 1EF1A 1P5TA 2KX3A 2LXAA 4EEWA 1XD4A 1TTNA 3DVNV 2AEHA 4BKTA 1GJZA 2DA0A 4H8SA 1WRDB 1EAZA 2LGDA 2NMBA 2CODA 4IWOA 1QZEA 3AULA 4HAVB 4BKGA 3R7RA 1V5TA 1NDDA 1BTKA 3FEHA 3KRWA 2KFJA 3DBHI 2GBRA 4MDKE 1A5RA 1WR1A 2OOBB 3CSFA 1U29A 2GBMA 3ENEA 2J0KA 3UINB 4II2B 1NTIA 1V89A 4CHJA 2RR9A 2LBBA 4ILJA 3N32A 2R0DA 3WAOA 2IYDB 5JHBA 4MT7A 1WJ1A 2O6VB 2LGYA 2M0XA 1RAXA 2JZZA 2RPQA 2LYDA 4BBKA 1P0RA 2L2IA 2PE6B 2GBJA 2VKIA 3VH3B 1OEYJ 3NZSA 1WGQA 3U8ZA 3WYFB 1F9JA 4HB4B 2FCMA 3ZLZA 2G4SA 4JKGB 2KQ7A 3A8PA 2DHIA 1RRPB 1Q0WB 4K7SA 2KJRA 2G3QB 1LXDA 4K7WA 5LOPB 5D3XA 2N9XA 4FBJB 3OANA 2CHXA 3ODXA 4ASWC 3ZUNA 1EO6A 1KI1B 3QK0A 2PEAA 4I6NB 3PVLA 1FB8A 1WYWB 4JIOU 4PS8A 2DENB 3L08A 1FHXA 4KZCA 4WWOA 5JZEB 1WXAA 5CTRC 4E3CA 3QBVB 1ZSQA 2M4NA 2ROVA 2UZRA 4AWJA 2L7RA 2UZSA 2IY0B 3IG3A 4IAPA 4WAAA 1MKEA 4HAZB 2LVPA 4LCDE 2KJHB 3KZ1A 2OJRA 3WAPA 5JH5C 1P1AA 3ZRFA 2KANA 3RUIB 2JT4B 2KTFA 2DLWA 2CHZA 3VAWA 1OMWA 2Y8FA 4G0NB 1UNRA 2ADZA 1XR0B 1X1GA 3F0WA 4YONA 1WZ0A 4W9KA 2L76A 4K1RB 5EFXA 1ZC3B 5HE3A 2QHOA 4M8NA 4ZDVA 1H8CA 4EZJA 3D8FA 1Y5OA 2MP2A 1KZGA 4KDLB 3V60A 3KVFB 3PREA 2CY4A 4DBGA 2Z0PA 2ZEQA 5DCNA 3IVFA 2WH5A 4MEMA 4PS7A 1NVLA 4K81A 3V6EB 2R82A 5LXIB 3A1QB 2IO0B 4HB0B 5D27A 4FA6A 5C16A 2FJLA 2V3SA 3W1SA 3MTNB 5AEKB 2LXCA 2BF8B 1HBKA 1NU2A 2P8VA 4K17A 4KHAA 3CIKA 1PFJA 4K2OA 3KUZA 2WX0A 4TKNA 3UF8A 4NQLB 3QC8B 4MGYE 1TXDA 1YJ1A 4JKFA 4NY0A 3E9LA 2MBBB 4FJZA 1WZ3A 5CHFA 1E90A 4G50A 2MKRA 1OY2A 4TYZA 4HDQA 3A1QA 4W9DA 4FULA 5D2MB 4DDID 1I2HA 2V76A 2JVCA 3RCZA 1FGZA 1E8ZA 1DIKA 2X18A 4AUQC 4GXBA 4KDIC 2EMTA 2KTRA 1V86A 1E5WA 5JP4A 2FIDA 2PE9A 3RULA 3GYOA 1N3HA 1OQYA 3NHEB 4WJ7A 3UIPB 2VRWB 3I3TB 3QX1A 1NBFC 1WXVA 2L00B 1VBHA 4HPLB 4WJQA 2J0MA 2LZ6A 3HM3A 2I1JA 2MBEA 4NAWA 4NNJB 2IO2B 4GOCA 1BTNA 2J7QB 2BWES 4FLHA 5CHVC 2RVBB 3K9OB 3U30A 4ICVA 2JF5A 1WFYA 2MBHA 2NR2A 1VD2A 1WG7A 4A3PA 3QWMA 2KX0A 1X86A 3L16A 3VUYA 3A33B 3PRMB 1V88A 3VUWA 1EVHA 3HK0A 1WF9A 1AQCA 4XWXA 4A6HA 4ZRIA 2MBOA 2LJ5A 2LUEA 3APFA 2L0TA 2JRIB 2O6VD 1WX8A 2Q13A 2LD9A 4I6PA 4TV3A 3TIXA 2GBNA 4GDLB 2N23A 3AU4A 2HRJA 2KWUB 4IM2A 3ENBA 2FDQA 3TO1A 3ZNID 2C7MB 2PPHA 2GS0A 2MFQA 2RSGA 2QKMA 4FN2A 2DHZA 1AARA 2X0SA 1Q67A 4F7HA 4II3B 5AZFA 5E6PA 2LWPA 2W2XD 3APCA 3GOEA 2DYQA 2LRWA 3PEGA 3SD5A 3ZNHB 4JK9A 1MAIA 2FNJB 2BPSA 2ZNVC 3N7CA 5KHOA 2KDFB 4MELA 1TZ1A 2ZNVB 2JP2A 5KQ1A 1NI2A 1H4RA 4KHOA 3TCAA 2CY5A 2DX5B 1W1GA 3MPXA 3CMMB 4JL9A 4CYEA 3M3JA 2NBWB 1ACAA 3NSUA 1V81A 4B6WA 1DDWA 3B08A 4M8MA 1XD3B 5JHHA 3Q3FA 3TW1A 3WANA 3OJ3A 4HK2A 1XT9B 2HJ8A 4F7UP 3RZWC 2DHKA 2ZZPB 2Y5BB 1UNPA 4A6FB 3G9WA 3PHWB 2EMSA 1TQZA 5LLIA 2AWTA 3VIAA 4IC7B 2K25A 1X11A 5BO4B 1MK7B 3DDCB 4HWIB 4BOZB 5E6NA 3PSCA 3KYDD 3PS6A 4W9CA 3P7ZA 3AI5A 3L10B 1I35A 5J3TA 1WR6E 4G11A 1G6JA 5LXHA 2CQUA 4XC2A 4DWFA 5C1ZA 5FR6A 5HE1A 4HLEA 1BT0A 4A20A 1XKEA 2YS3A 3HQCA 3SYXA 2DYNA 3ZO5B 4PYUA 1UPRA 2YRYA 4OVVA 2KVRA 1KM7A 2C9WB 4A3OA 2CHWA 3L13A 2XBBC 4AJYB 3ZIMA 1V6EA 5G55A 4W9FA 4AOFA 4W9JA 3IBEA 4BBNF 4KAXB 4MH0E 4MSMB 2GCJA 2KDEB 1M7RA 4IFSA 3JYUA 5L83A 2CR5A 2DHJA 4DHJB 2DTCA 1LM8B 2FCSA 4Y94A 5L81A 4HDOA 3DQVA 2DFKA 1WMHB 4KV2A 2KHWB 2A5UA 4D0NB 5CLQB 1KZ7A 3M1IB 5D94A 2DKQA 5DHFB 3LJ3A 1E8WA 2KK8A 1R4NI 4F8CB 3PRPB 5KQ4A 1JDEA 3JVZX 1WGUA 2C60A 1YIWA 1W1HA 4MY6A 3B0AA 3EPYA 2KXJA 4NSWA 2ZJDA 3SV1A 3DPDA 2BYFA 3HIZA 4CO7A 3FM8C 1WI0A 2B3AA 1W1DA 3PSEB 1WJNA 3AXCA 3H9DA 3BINA 3VTVA 3T8MA 4DHZE 5CHWA 4ANXA 1V61A 4KHBB 1NTVA 2FAZA 2C5LC 2K39A 3X0WA 1SGHA 3D8DA 2ASQA 3R7QA 4NPNA 4GB9A 3ZVVA 5DPSA 1D3ZA 4DHJD 4B9KA 1FHWA 2D2QA 4ANVA 5DPRA 1E8XA 4N9F4 2N0YA 1K8RB 2D3GA 3ODOA 4K2PA 3VHTC 2K6QA 4DX8A 4E71A 2LVQA 2GBKA 3WAMA 5LONB 4LDTB 4BKSD 3DXDA 2D9YA 3TL5A 3SU8X 4K7UA 3QWZB 4FJYA 2PJHA 2R09A 5JLJB 4WJNA 1DROA 1K5DB 2R2OA 1RJ2A 3F5RA 4X57B 1J19A 1QC6A 3ULBA 3SDLC 2IO3B 3DVNU 4HJKA 3UQBA 3KUDB 4KZ0A 4EZLA 2JRHA 1M94A 5G2NA 5D3WA 2JWZA 3M62B 2COFA 4KVGB 4JK7A 3UZTA 1XODA 1UGMA 1WGGA 1Z2MA 2D11A 4C0AA 2FCQA 1HB6A 2ELAA 3VTUA 4GN1A 2LG1A 2IO1B 5DPTA 2QKLA 3QQ8B 2GOWA 1QQGA 2K1FA 1P98A 5C5BA 1ZVRA 1DDMA 4PS3A 2RQ1A 3R66C 2FJ9A 1VCBA 2MQJA 2VSZA 4KIKB 2IYBA 4IWPA 2CKHB 2L0FA 1RFAA 2C7HA 4FJVB 2RNRB 1MG8A 2BWFA 3WALA 2DZIA 3N3KB 3FLVA 3MJWA 1IYFA 1U27A 1PQSA 1BWNA 2COCA 3R3MA 4IOYX 3ZW3A 3A4RA 1IRSA 3FP5A 4JKEA 4Z2NA 1CMXB 1WVHA 2LOZA 1OTRB 3DVGY 1DYNA 2D9ZA 4JGHB 4W9GA 4GDLA 1V5UA 1U5DA 1HB8A 2XQNM 3V61A 2LGXA 5KCVA 3QCAA 3QAQA 2KC1A 2DX5A 4AP4C 4PYZA 3KSYA 1WJ4A 2ZCBA 1GNUA 5DH9B 1WH3A 4GDKA 2KTRB 2GCLA 4GZUA 1PLSA 1PMSA 3PLVA 4LJOB 4A6KA 2W2WA 3JW0X 3BY4B 1LB1A 1WJ6A 1BAKA 3SHQA 2LKOA 2DAJA 1LW3A 2LOXA 3Q3JA 3VH4B 2AL6A 2D9XA 2EC1A 2ZPYA 2PZ1A 2G35A 2ZPNA 2EJ8A 1Q5WB 3QJZA 3DBSA 3P2BA 2LRUA 3ECIA 3C0RB 2AL3A 4GSWA 2MLBA 1LQBA 1K5GB 1WGDA 2RSUA 2KD0A 2K8HA 5AZHA 1YQBA 1S3SG 3ZRCA 3ZDMC 1U2BA 3K9PB 2D4QA 3WA0A 1WM3A 2ELBA 2E2XA 4JKDA 5GMVA 1Z87A 3T06A 2VRRB 3CF6E 1UNQA 2GMIC 2IY1B 3ZVRA 3IFWB 3HHMA 4PNKA 1YX5B 5J3YA 3VFKA 5EDSA 4NJ7A 3A9KB 3A4SC 4JKCA 2NBUA 1YD8U 2N4FA 1FGYA 3DCGA 3SNHA 2LI5A 4HHVA 2LVOA 1TGZB 2MDXA 2KJ6A 3KH0A 3ZNZB 3WIMA 2G45B 3OJ4B 4ANUA 5CX3A 4HB3B 3TFMA 4L6EA 1UBIA 3V6CB 4PQ0A 3AJ4A 3VXWA 4RM8A 2LASA 5JHGA 3E66A 4JLCA 2NPTA 1T0YA 2ABDA 3UIOB 3QIJA 1X1MA 2KC2A 2MP2B 5L95C 2L1CA 4LJPB 1ZGUB 4JKBA 2O2VA 3N30A 1UEFA 3DOWA 1KLVA 4I6LB 3A9KA 2KDIA 1FHOA 2WDTB 1GG3A 4HVBA 5DPWA 3V62A 4IG7B 2W9NA 2KNBA 1U5FA 2M8SA 1FAOA 3EHVA 1S1QB 3ML4A 3T9LA 2WWZA 3P6AA 3H7SA 4XZ4A 4EOYA 3MDBC 2DZJA 3RD2A 1FOEA 2YS5A 2N1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO0 B;  4HB0 B;  2ZVO A;  2Y8G A;  5D27 A;  4FA6 A;  4GB9 A;  5C16 A;  3ZVV A;  2I1K A;  2FJL A;  2V3S A;  2D10 A;  3DXC A;  5DPS A;  1OEY A;  3MTN B;  3V5W A;  3W1S A;  4DHJ D;  5AEK B;  4B9K A;  5KHQ A;  1FHW A;  2LXC A;  2WX1 A;  2BF8 B;  2A4Z A;  1X1F A;  5C23 A;  2D2Q A;  4WJO A;  4ANV A;  5DPR A;  3ZTC A;  2HD5 B;  1E8X A;  1OQN A;  1WXM A;  1HBK A;  1NU2 A;  2P8V A;  2CB8 A;  4MSQ B;  4K17 A;  3QHT A;  4IM3 A;  2IZV B;  1EGX A;  3TMP B;  3JSV A;  2DX1 A;  4N9F 4;  2N0Y A;  4KHA A;  3CIK A;  1M7E A;  4BVU C;  1K8R B;  2D3G A;  2JXX A;  1PFJ A;  5DIF B;  3ODO A;  4K2O A;  4K2P A;  1UEL A;  3VHT C;  2XEW A;  4KIK A;  2K6Q A;  4Z2M B;  3KUZ A;  3KUC B;  4DX8 A;  4MGI E;  3BJI A;  4E71 A;  2P0H A;  2MWS B;  2WX0 A;  4HXD A;  2K2J A;  2LVQ A;  4TKN A;  3UF8 A;  4NQL B;  2RLO A;  3QC8 B;  4MGY E;  2COP A;  4NJ6 A;  1TXD A;  1YJ1 A;  3VQI A;  4NY0 A;  1WXS A;  1GC7 A;  2GBK A;  2MBB B;  2MWN B;  1YX6 B;  3WAM A;  2HE7 A;  2NBV B;  2V1Y A;  2YLM A;  2MBQ A;  2W2X C;  4FJZ A;  2K2U A;  4OVU A;  1WZ3 A;  1MIZ B;  5LON B;  5CHF A;  1E90 A;  2V4L A;  4ZRK A;  1V9J A;  4LDT B;  4G50 A;  3W1S C;  4BKS D;  4GPT B;  3DXD A;  2MKR A;  1OY2 A;  2D9Y A;  3S2A A;  3TL5 A;  4TYZ A;  2H7E A;  3SU8 X;  4HDQ A;  3A1Q A;  4W9D A;  1XQQ A;  2MRP A;  4FUL A;  4K7U A;  5D2M B;  2IFS A;  1L7Y A;  4DDI D;  1I2H A;  2V76 A;  5E6O A;  2JVC A;  2DYO A;  5AZG A;  3RCZ A;  1FGZ A;  1WX7 A;  3QWZ B;  1E8Z A;  4FJY A;  1TBE A;  1B55 A;  2X18 A;  4TUU A;  4AUQ C;  4GXB A;  2PJH A;  2R09 A;  5JLJ B;  3D8E A;  1WMH A;  1DRO A;  4KDI C;  4WJN A;  1K5D B;  2EMT A;  2KUP A;  1DBH A;  1GUA B;  1HE8 A;  3QAR A;  2KTR A;  3RYT A;  1V86 A;  1IP9 A;  2R2O A;  3O65 B;  1E5W A;  1MIX A;  3L17 A;  1RJ2 A;  2JZ3 B;  5JP4 A;  3F5R A;  4X57 B;  2FID A;  1J19 A;  1QC6 A;  3ULB A;  4EJN A;  1ZW7 A;  2N7D A;  2HTH A;  2NS5 A;  2PE9 A;  2IO3 B;  3DVN U;  3SDL C;  4HJK A;  3UQB A;  3KUD B;  3RUL A;  4GMV A;  3GYO A;  1N3H A;  4KZ0 A;  4IW0 A;  4MM3 A;  4EZL A;  1OQY A;  3PZD A;  1M94 A;  2JRH A;  4G0N B;  1GC6 A;  5D3W A;  2JWZ A;  2H7D A;  4HAX B;  1UD7 A;  3NHE B;  4WJ7 A;  5G2N A;  5J17 A;  1H10 A;  3UIP B;  2VRW B;  4HAT B;  3I3T B;  3QX1 A;  2YS1 A;  3M62 B;  3ZKJ C;  2COF A;  4KVG B;  1NBF C;  1WXV A;  1MK9 B;  1ZM0 A;  2L00 B;  2N1W A;  3VVW B;  4HPL B;  3H6N A;  2J0M A;  2LZ6 A;  4WJQ A;  4E74 A;  4ZRJ A;  2M38 A;  2N9E B;  3HM3 A;  2I1J A;  5C6R A;  1WGR A;  2MBE A;  4F7Z A;  3UZT A;  2BKF A;  1RLF A;  4GMX B;  4NAW A;  4NNJ B;  4EUT A;  3ML8 A;  2IO2 B;  1XOD A;  4GOC A;  1BTN A;  2D9W A;  2KQS A;  1UGM A;  1WGG A;  2IBI B;  2BWE S;  2J7Q B;  4HCP B;  1Z2M A;  3R7Q A;  2NVU I;  3L0W B;  2D11 A;  2DN6 A;  4ICU A;  4FLH A;  3AU5 A;  4C0A A;  2DZM A;  2UWQ A;  3M95 A;  3VUX A;  4BOS C;  4DXA B;  1NTY A;  3LJU X;  2FCQ A;  3H1U A;  4KSL C;  5CHV C;  2RVB B;  1HB6 A;  3ULC A;  2ELA A;  3VTU A;  4GN1 A;  2R2Q A;  2LG1 A;  2IO1 B;  3K9O B;  4DK5 A;  4FAD A;  5DPT A;  3U30 A;  2I5C A;  5J3Q A;  2QKL A;  3QQ8 B;  2GOW A;  2JF5 A;  1QQG A;  1WFY A;  4ICV A;  2K1F A;  1E8Y A;  1P98 A;  3KY9 A;  2YF0 A;  2BYV E;  3NZU A;  5IAA C;  2MBH A;  2NR2 A;  1VD2 A;  1P6S A;  1XCG A;  3VTW A;  5C5B A;  1J8C A;  1WG7 A;  1ZVR A;  3VOQ A;  1DDM A;  3X23 A;  4A3P A;  2J0J A;  1FXT B;  2P0F A;  1XX0 A;  4IWQ A;  4PS3 A;  4TQ1 A;  2DKP A;  3ZTD A;  2RQ1 A;  3QWM A;  3ZNG C;  2KX0 A;  1X86 A;  3R66 C;  2FJ9 A;  4J6I A;  3L16 A;  1VCB A;  2MQJ A;  3GZN I;  3VUY A;  4B95 A;  2VSZ A;  4MGK E;  1WIA A;  3A33 B;  2IYB A;  4KIK B;  2K00 A;  4IWP A;  4CHK A;  2C7N B;  3PRM B;  2CKH B;  1V88 A;  4URK A;  2L0F A;  1RFA A;  2C7H A;  3VUW A;  1EVH A;  4FJV B;  1J0W A;  3JSV B;  1P3R A;  3HK0 A;  2WYQ A;  2RNR B;  1MG8 A;  1WF9 A;  2BWF A;  1AQC A;  2BKR B;  4W9L A;  5HKH A;  3WAL A;  4XWX A;  2M14 A;  4A6H A;  1EUV B;  2KMA A;  3EFU A;  2OQB A;  2DZI A;  4ZRI A;  2MBO A;  4LDT D;  2LJ5 A;  3N3K B;  3FLV A;  2RGN B;  2LUE A;  2MW5 A;  4GIV A;  3B1L X;  2BYE A;  5TR5 A;  3APF A;  4P7I A;  4HAU B;  3MJW A;  2L0T A;  2LUL A;  2JRI B;  3KW5 B;  2O6V D;  4F1S A;  1IYF A;  4DX9 0;  3TJP A;  1ZC4 B;  1WX8 A;  2CS4 A;  1U27 A;  1PQS A;  2N7E A;  1U4A A;  4W9H A;  2Q13 A;  2DZK A;  2LD9 A;  1BWN A;  2COC A;  3R3M A;  4BFR A;  4IOY X;  4I6P A;  3ZW3 A;  3ONS A;  4TV3 A;  4BKS A;  3TIX A;  2GBN A;  3A4R A;  1IRS A;  2M17 A;  4GDL B;  4ZYN A;  3FP5 A;  3EEC A;  1LFD A;  5D3Y A;  3NS8 A;  4Z2N A;  2N23 A;  2Y7B A;  3AU4 A;  1CMX B;  4WJP A;  2RUK B;  2HRJ A;  2KWU B;  1WVH A;  2LOZ A;  3PRZ A;  1OTR B;  3DVG Y;  1DYN A;  2D9Z A;  4IM2 A;  5D3V A;  2FDQ A;  1J0G A;  2Z0O A;  4JGH B;  3TO1 A;  1JRU A;  4HAW B;  3FSS A;  4W9G A;  3ZNI D;  4GDL A;  4FHK A;  1V5U A;  3KRX A;  2C7M B;  1U5D A;  2NPT B;  2PPH A;  2GS0 A;  2KQ7 A;  3CST A;  1HB8 A;  2XQN M;  4HPM B;  3V61 A;  4RM9 A;  3PG7 A;  2LGX A;  2MFQ A;  2RSG A;  2MA9 B;  2D07 B;  2QKM A;  3KYC D;  5KCV A;  4FN2 A;  3QCA A;  3PVW A;  2DHZ A;  3LDZ E;  2YVC A;  1WJU A;  2Z59 B;  3HM6 X;  2KC1 A;  2DX5 A;  1AAR A;  3QAQ A;  5D7G A;  4AP4 C;  3PP2 A;  2O2V B;  4PYZ A;  4GU2 A;  3PLU A;  4GGQ A;  1Q67 A;  4F7H A;  1SHC A;  3PTF C;  4II3 B;  3KSY A;  1DDV A;  1WJ4 A;  1GNU A;  2ZCB A;  5AZF A;  2Z0Q A;  5DH9 B;  3H7P A;  3TVV A;  1WH3 A;  5E6P A;  5IA7 A;  3EC8 A;  2KTR B;  2GCL A;  4GDK A;  2LWP A;  4GZU A;  3PVU A;  3DBR I;  2W2X D;  1PLS A;  4HB2 B;  3ALB A;  3APC A;  3GOE A;  2DYQ A;  1PMS A;  1WX9 A;  3PLV A;  2LRW A;  4LJO B;  2MCN B;  3PEG A;  3SD5 A;  4A6K A;  2XK5 B;  4EZK A;  2W2W A;  1RRB A;  3RT3 B;  1UPQ A;  3ZNH B;  3IHP C;  3JW0 X;  2J59 M;  3PHX B;  3BY4 B;  1LB1 A;  1WJ6 A;  3QA8 A;  1MAI A;  2FNJ B;  2BPS A;  2MSE D;  1EF1 A;  2DAF A;  2ZNV C;  1BAK A;  3N7C A;  1WE6 A;  1P5T A;  2KMC A;  3SO6 A;  1I7A A;  2KX3 A;  2LXA A;  2KDF B;  5KHO A;  3SHQ A;  5GOW B;  2LKO A;  4MEL A;  4EEW A;  1Q1O A;  2KGX B;  1TZ1 A;  2DAJ A;  1XD4 A;  1TTN A;  3DVN V;  1C3T A;  4MGZ E;  2AEH A;  2ZVN A;  4BKT A;  2ZNV B;  3A9J A;  1LW3 A;  2JP2 A;  1UH6 A;  1I42 A;  5KQ1 A;  1NI2 A;  1H4R A;  1GJZ A;  2DA0 A;  2LOX A;  4KHO A;  2CY5 A;  3TCA A;  2DX5 B;  3W1Y A;  3HW2 B;  4H8S A;  1WRD B;  2N1V A;  3SUZ A;  3Q3J A;  1V80 A;  1EAZ A;  4MJS B;  2AL6 A;  3VH4 B;  3UIO B;  1WGY A;  2LGD A;  1W1G A;  2D9X A;  3MPX A;  3ODW A;  2Z0D B;  2EC1 A;  2NMB A;  4TQ0 A;  4W9E A;  2KFK A;  3CMM B;  2COD A;  4IWO A;  3ZDT A;  4JL9 A;  3RZF A;  4CYE A;  2ZPY A;  2NBW B;  2PZ1 A;  1QZE A;  1ACA A;  3NSU A;  2RGF A;  4HAV B;  3AUL A;  3M3J A;  4BKG A;  3R7R A;  1V81 A;  1MPH A;  1V5T A;  4WWN A;  4B6W A;  1NDD A;  3OAW A;  1V5M A;  2FIF A;  1BTK A;  1DDW A;  3FEH A;  4M0W B;  2COA A;  2G35 A;  3KRW A;  2KFJ A;  2ZPN A;  3B08 A;  4M8M A;  2EJ8 A;  1XD3 B;  2Z0E B;  3MHS D;  3DBH I;  1Q5W B;  2GBR A;  3H7P B;  3L54 A;  3QJZ A;  5JHH A;  3DBS A;  4MDK E;  1A5R A;  1WR1 A;  2OOB B;  2M1M A;  3CSF A;  3Q3F A;  1WJM A;  1Y8R C;  1U29 A;  3UGB B;  3TW1 A;  4DHZ B;  2GBM A;  3ENE A;  3WAN A;  2J0K A;  3OJ3 A;  4HK2 A;  3UIN B;  1XT9 B;  2HJ8 A;  1V2Y A;  1E7V A;  2FCN A;  2LRU A;  2P0D A;  4F7U P;  3P2B A;  3RZW C;  3DBL I;  2NZ8 B;  3NOB A;  2XK5 A;  2DHK A;  2ZZP B;  3PGE A;  1NTI A;  1V89 A;  4CHJ A;  3C0R B;  3ECI A;  2Y5B B;  2JUO A;  2AL3 A;  2K8B A;  4GSW A;  2RR9 A;  4WSF A;  2LBB A;  1UNP A;  4RMA A;  4WQO B;  1V49 A;  4A6F B;  2MLB A;  3N32 A;  3G9W A;  3CXB B;  2R0D A;  2NCN A;  1LQB A;  2KWV B;  3WAO A;  4GDK B;  4HAY B;  1EF5 A;  1KOT A;  2YT1 A;  2IYD B;  3PHW B;  5JHB A;  4FHJ A;  4MT7 A;  1K5G B;  1WGD A;  2EMS A;  4YL8 A;  2KWC A;  1TQZ A;  2KKC A;  2RSU A;  1P3Q U;  1WJ1 A;  5LLI A;  2AWT A;  1ST7 A;  2O6V B;  4ANW A;  2LGY A;  2EKE C;  2KD0 A;  4EFO A;  2KLG A;  2K8H A;  5DI9 B;  3VIA A;  5AZH A;  4IC7 B;  1YQB A;  2M0X A;  1S3S G;  1RAX A;  2K25 A;  2JZZ A;  1X11 A;  2RPQ A;  2LYD A;  4BBK A;  5BO4 B;  1P0R A;  3ZRC A;  3DXE A;  1U2B A;  3K9P B;  3ZDM C;  1MK7 B;  2L2I A;  5FI0 A;  2PE6 B;  3DDC B;  4HWI B;  5HE2 A;  4BOZ B;  5E6N A;  2GBJ A;  5HE0 A;  3PSC A;  4DBB A;  1U5E A;  1WI1 A;  2VKI A;  2K8C A;  2D4Q A;  2N9P C;  3KYD D;  3WA0 A;  1OEY J;  3APD A;  3PS6 A;  4W9C A;  3VH3 B;  3NZS A;  4NAW B;  1WGQ A;  1WM3 A;  3U8Z A;  3P7Z A;  3UQA A;  2KO3 A;  3AI5 A;  1X05 A;  2CRF A;  1C1Y B;  2ELB A;  3WYF B;  3PPA A;  3PV1 A;  2E2X A;  1F9J A;  4HB4 B;  3L10 B;  2FCM A;  4JQW C;  2G4S A;  3ZLZ A;  3A98 B;  4KSK C;  1I35 A;  5DHA B;  2GJY A;  5GMV A;  1Z87 A;  3A8P A;  2DHI A;  1RRP B;  1U5G A;  3T06 A;  5J3T A;  1Q0W B;  1WR6 E;  2KJR A;  2VRR B;  4G11 A;  3CF6 E;  2G3Q B;  4HCN B;  4K7S A;  1UNQ A;  2GMI C;  2FUH B;  1LXD A;  4K7W A;  5LOP B;  5D3X A;  2UYZ B;  2IY1 B;  2KN5 A;  5D6J B;  1G6J A;  3ZVR A;  1UBQ A;  5LXH A;  2CQU A;  5CLL B;  3IFW B;  3HHM A;  2N9X A;  1WY8 A;  4A5K A;  3NY5 A;  4XC2 A;  4PNK A;  4DWF A;  1L2N A;  5C5B B;  3D32 A;  4FBJ B;  1YX5 B;  5FR6 A;  5C1Z A;  2KCJ A;  5HE1 A;  1TJ6 A;  3OAN A;  5J3Y A;  1BT0 A;  2CHX A;  3VFK A;  4A20 A;  4HLE A;  5EDS A;  4NJ7 A;  1XKE A;  2REX A;  3ODX A;  4XX5 A;  4ASW C;  2DYB A;  2YS3 A;  3HQC A;  2L8J A;  3TBL D;  3ZUN A;  2BCJ A;  1EO6 A;  1KI1 B;  3A9K B;  3SYX A;  2DYN A;  3QK0 A;  3ZO5 B;  4NQK E;  2G4D B;  1AWE A;  1WM2 A;  2PEA A;  4I6N B;  4PYU A;  3PVL A;  1FB8 A;  1WYW B;  3A4S C;  4JIO U;  4PS8 A;  4AJW A;  1UPR A;  1UZX B;  2JY6 A;  2NBU A;  2DEN B;  3L08 A;  2ZCC A;  2YRY A;  1FHX A;  4KZC A;  4WWO A;  5JZE B;  4EMO A;  1WXA A;  4OVV A;  5JHA A;  1YD8 U;  2KVR A;  1KM7 A;  2N4F A;  2C9W B;  5CTR C;  3QBV B;  4A3O A;  1FGY A;  4E3C A;  1ZSQ A;  2CHW A;  2D9V A;  2CAY A;  5FI1 A;  4A6F A;  2ROV A;  1ISN A;  3SNH A;  2M4N A;  3DCG A;  3U7D A;  3L13 A;  2LI5 A;  4HHV A;  2LVO A;  2XBB C;  2UZR A;  1TGZ B;  4AJY B;  4AWJ A;  2L7R A;  2UZS A;  2IY0 B;  3ZIM A;  3A8Q A;  3VDZ A;  1V6E A;  4IAP A;  3IG3 A;  2MDX A;  4WAA A;  4EKU A;  2CU1 A;  1MKE A;  4HAZ B;  2KJ6 A;  5G55 A;  4WWP A;  3KH0 A;  4W9F A;  5IJM A;  3ZNZ B;  4AOF A;  4W9J A;  2G45 B;  3WIM A;  3ML9 A;  3OJ4 B;  4BBN C;  3IBE A;  2LVP A;  4LCD E;  4BBN F;  4KAX B;  2KJH B;  4MH0 E;  4MSM B;  4ANU A;  3KZ1 A;  5CX3 A;  2GCJ A;  2KDE B;  4HB3 B;  4W9I A;  2KZR A;  2OJR A;  1M7R A;  3TFM A;  4L6E A;  1UBI A;  3WAP A;  5JH5 C;  4IFS A;  3V6C B;  2YSZ A;  3JYU A;  1P1A A;  5L83 A;  4PQ0 A;  2CR5 A;  3RCP A;  2KDB A;  2L05 A;  3AJ4 A;  3VXW A;  1SE9 A;  4RM8 A;  3ZRF A;  2KAN A;  1V5P A;  2DHJ A;  5C79 A;  2LAS A;  3RUI B;  5JHG A;  2JT4 B;  2KTF A;  2DLW A;  4DHJ B;  5J2R A;  2DTC A;  2AYO B;  2CHZ A;  1LM8 B;  3VAW A;  2FCS A;  1OMW A;  4Y94 A;  2ABD A;  2Y8F A;  1T0Y A;  5L81 A;  1WE7 A;  4HDO A;  2NPT A;  3QIJ A;  1UNR A;  1X1M A;  2ADZ A;  3DQV A;  2KC2 A;  1XR0 B;  2MP2 B;  1X1G A;  2DFK A;  3F0W A;  2L1C A;  4II2 B;  5L95 C;  3A9J B;  4YON A;  1WZ0 A;  1WMH B;  4WVF B;  4KV2 A;  4LJP B;  2OTX A;  1SIF A;  1ZGU B;  1Y19 B;  4W9K A;  2JPH A;  2KHW B;  2A5U A;  3GYP A;  2L76 A;  2O2V A;  3N30 A;  4K1R B;  1UEF A;  4MK0 A;  4D0N B;  3DOW A;  4MJS A;  1KLV A;  5CLQ B;  1KZ7 A;  1ZC3 B;  5EFX A;  2KFK B;  4DDG D;  5HE3 A;  3M1I B;  4B6H A;  2QHO A;  4I6L B;  5D94 A;  2DKQ A;  5DHF B;  3A9K A;  1E8W A;  3LJ3 A;  2KK8 A;  4M8N A;  1R4N I;  4F8C B;  1R4M I;  3PRP B;  3M63 B;  4ZDV A;  2KDI A;  5KQ4 A;  1H8C A;  1WGH A;  1FHO A;  2L3Z A;  2WDT B;  1D3Z A;  2KOX A;  1GG3 A;  3JVZ X;  2MX2 A;  1WGU A;  2C60 A;  4HVB A;  3V62 A;  5J18 A;  5DPW A;  4EZJ A;  2UVM A;  2HTH B;  1YIW A;  1W1H A;  4IG7 B;  1KJT A;  4MY6 A;  2ROZ B;  3B0A A;  3D8F A;  1Y5O A;  2W9N A;  2KNB A;  1U5F A;  2M8S A;  2MP2 A;  1OGW A;  3EPY A;  1KZG A;  1IPG A;  2KXJ A;  4KDL B;  4NSW A;  3V60 A;  3KVF B;  1FAO A;  3PRE A;  2CY4 A;  2ZJD A;  3DVG X;  4IUM B;  3SV1 A;  3DPD A;  2BYF A;  3EHV A;  1S1Q B;  2RD0 A;  3HIZ A;  4IM0 A;  4CO7 A;  3FM8 C;  1WI0 A;  2B3A A;  4F7G A;  1W1D A;  3ML4 A;  3PSE B;  4DBG A;  1WJN A;  3T9L A;  3AXC A;  3OLM D;  2YT0 A;  3O96 A;  3H9D A;  2Z0P A;  1E7U A;  2ZEQ A;  3BIN A;  1ZKH A;  2WWZ A;  3VTV A;  2BGF A;  3T8M A;  4DHZ E;  5CHW A;  4ANX A;  3P6A A;  3H7S A;  1V61 A;  4XZ4 A;  5DCN A;  3IVF A;  4EOY A;  2O6V A;  3MDB C;  1P9D U;  2KLC A;  4KHB B;  4JLC A;  1NTV A;  2FAZ A;  2K6D B;  2WH5 A;  4G3X B;  4MEM A;  4PS7 A;  2I5F A;  1NVL A;  2DZJ A;  2C5L C;  4K81 A;  3V6E B;  2K39 A;  3X0W A;  1V5O A;  1SGH A;  3RD2 A;  5LXI B;  4CHM A;  2DYM A;  3D8D A;  1FOE A;  3A1Q B;  2ASQ A;  4NPN A;  2YS5 A;  1Z5S B;  3PT2 B; 
#chains in the Genus database with same CATH topology
 1L4Z B;  1SJE D;  1NEK B;  1I4H A;  5FK9 C;  1I4Q A;  2I1K A;  3GB1 A;  2D10 A;  3V5W A;  2PIA A;  3I5J C;  5KHQ A;  2WX1 A;  2MJE A;  5C23 A;  4WJO A;  1OQN A;  3UI3 A;  5HHD G;  4MSQ B;  2CB8 A;  1HZ6 A;  2IZV B;  1EGX A;  3TMP B;  4K3B A;  2DX1 A;  1M7E A;  4BVU C;  2JXX A;  5DIF B;  2XEW A;  4ILG B;  4Z2M B;  3KUC B;  3N20 C;  4MGI E;  1GB1 A;  2P0H A;  3W2D A;  4HXD A;  2K2J A;  1SEB D;  3Q8C A;  2LUM A;  2ZW0 A;  3VQI A;  1C4A A;  4NZL B;  4Q2J A;  1GC7 A;  1YX6 B;  4OVU A;  2MBQ A;  2W2X C;  3Q14 C;  1XLO A;  1V9J A;  1KC7 A;  4GPT B;  2M0A A;  3S2A A;  2H7E A;  4ITK A;  4XYC A;  1N62 A;  1XQQ A;  3TEX A;  2IFS A;  1L7Y A;  5AZG A;  1WX7 A;  2LMC A;  4C4V B;  3SBG A;  3D8E A;  1WMH A;  1GUA B;  1HE8 A;  3QAR A;  1IP9 A;  3O65 B;  3V3X A;  1MIX A;  3L17 A;  2JZ3 B;  2N7D A;  1ZW7 A;  2NS5 A;  3AED B;  2WXJ A;  4GMV A;  3W5V B;  4MM3 A;  1PGX A;  1GC6 A;  5J17 A;  4HAX B;  5IO9 A;  1H10 A;  4HAT B;  2YS1 A;  3ZKJ C;  2DBY A;  3VVW B;  1MK9 B;  2N1W A;  2E6X A;  2M38 A;  2N9E B;  4EUT A;  2XN9 C;  1SE3 A;  3ML8 A;  2KQS A;  2IBI B;  2WXL A;  4M02 A;  3AU5 A;  1EU3 A;  4BOS C;  4DXA B;  3LJU X;  3H1U A;  3ULC A;  3VR9 B;  2R2Q A;  4FAD A;  2I5C A;  1PYW D;  2YF0 A;  2BYV E;  4KHB A;  1XCG A;  3VOQ A;  2J0J A;  1J7A A;  2P0F A;  4USA A;  1XX0 A;  1R4N B;  4IWQ A;  4TQ1 A;  4KGS A;  3ZTD A;  4J6I A;  3GZN I;  4MGK E;  1KBL A;  2K00 A;  4XDD A;  4CHK A;  2C7N B;  1E7P B;  2UU7 A;  4WUR A;  1J0W A;  2N7J A;  5HKH A;  4W9L A;  2BKR B;  2KMA A;  2M14 A;  1EUV B;  3PZ7 A;  1TZO A;  1YN3 A;  3PO0 A;  2RGN B;  2AX5 A;  2INC C;  3B1L X;  2BYE A;  1GGO A;  4P7I A;  4HAU B;  1K53 A;  2LUL A;  3KW5 B;  4F1S A;  4DX9 0;  1ZC4 B;  2CS4 A;  2PVO D;  1U4A A;  4W9H A;  2DZK A;  4MAC A;  3IAM 1;  3ONS A;  1I7H A;  4ZYN A;  3RNB C;  5D3Y A;  1FNV A;  2Y7B A;  2RUK B;  5D3V A;  3CIR B;  1ZXI A;  4HAW B;  2WLB A;  4FHK A;  4HPM B;  2J52 A;  4RM9 A;  2D07 B;  3PVW A;  3RNE C;  2YVC A;  1WJU A;  3PP2 A;  4GU2 A;  3PTF C;  1SHC A;  1DDV A;  4DXF A;  5IRS A;  4JK8 A;  3H7P A;  1ZDX A;  5IA7 A;  3EC8 A;  4A55 A;  3PVU A;  3ALB A;  1GAQ B;  1WX9 A;  1R7S A;  2XK5 B;  1JQ4 A;  2YEP B;  3IHP C;  2J59 M;  1QT9 A;  2FUG 1;  3PHX B;  2OED A;  3I57 A;  4ZHP A;  2DAF A;  3T3N A;  2CU3 A;  1WE6 A;  2KMC A;  3SO6 A;  1I7A A;  5GOW B;  1Q1O A;  2KGX B;  1C3T A;  2ZVN A;  2K22 A;  2LGI A;  3A9J A;  1I42 A;  1UH6 A;  3W1Y A;  3HW2 B;  3SUZ A;  1V80 A;  4H2A A;  1FM0 D;  1WGY A;  3R2I A;  2Z0D B;  3ODW A;  4TQ0 A;  1IBX B;  4W9E A;  2KFK A;  3AE4 B;  3ZDT A;  3RZF A;  2RGF A;  4WWN A;  1MPH A;  1EU4 A;  3OAW A;  1V5M A;  2FIF A;  3NVV A;  3WCQ A;  4M0W B;  2COA A;  4OSN A;  2KR0 A;  2Z0E B;  3MHS D;  3H7P B;  3L54 A;  1P7F A;  3BYY B;  3UGB B;  2M1M A;  4EFO A;  4DHZ B;  1WJM A;  1Y8R C;  1KH0 A;  2HTM E;  1V2Y A;  1E7V A;  2FCN A;  2P0D A;  3DBL I;  2NZ8 B;  3NOB A;  2XK5 A;  3PGE A;  1AWD A;  2JUO A;  2K8B A;  2KMM A;  2WXF A;  3B9J A;  4WSF A;  4P1C C;  4RMA A;  4WQO B;  1V49 A;  2INP E;  3CXB B;  1TYG B;  2KWV B;  2NCN A;  1KOT A;  4GDK B;  4HAY B;  1EF5 A;  3EUB 2;  2YT1 A;  2K0P A;  2LJI A;  4FHJ A;  2KWC A;  4YL8 A;  3Q6B A;  1K50 A;  2KKC A;  1P3Q U;  4ANW A;  1ST7 A;  1TKY A;  2EKE C;  2KLG A;  1PGA A;  5DI9 B;  1MVK A;  3B77 A;  3DXE A;  5FI0 A;  4RGO S;  5I2S A;  5HE2 A;  5HE0 A;  4DBB A;  2N9P C;  1U5E A;  1WI1 A;  2K8C A;  3RFZ B;  2BS3 B;  3APD A;  1FRR A;  4NAW B;  4CSQ A;  1TY2 A;  3UQA A;  3Q8F A;  1XLN A;  2KO3 A;  3DBH B;  1X05 A;  2CRF A;  1C1Y B;  3PPA A;  3PV1 A;  2W3R A;  4JQW C;  4YSZ B;  1F2R C;  3A98 B;  2V0G A;  4KSK C;  5DHA B;  2GJY A;  1VR9 A;  4MGZ E;  3NS8 A;  1U5G A;  4HCN B;  2FUH B;  1A70 A;  2UYZ B;  2KN5 A;  5D6J B;  1UBQ A;  5CLL B;  1WY8 A;  4A5K A;  3NY5 A;  1QOF A;  1L2N A;  5C5B B;  3D32 A;  3IT6 B;  2KCJ A;  1FXA A;  2GRI A;  4P1B C;  1MJD A;  1TJ6 A;  2RDG A;  3DHI C;  4JPS A;  2REX A;  4XX5 A;  2DYB A;  1TJE A;  4FXC A;  2L8J A;  3GE8 C;  3TBL D;  2BCJ A;  1EWC A;  4A9A A;  3BVZ A;  4NQK E;  2KWD A;  4GOU A;  1AWE A;  1WM2 A;  2G4D B;  3Q8A A;  4AJW A;  2AQ3 B;  1UZX B;  2JY6 A;  1TKG A;  3KQ4 A;  2ZCC A;  4EMO A;  4QJ5 B;  5JHA A;  5J2R A;  2ZKM X;  2D9V A;  2CAY A;  5FI1 A;  4A6F A;  2BQQ A;  1ISN A;  3U7D A;  2WXH A;  3E9O A;  2RMM A;  1UWM A;  5JVL A;  3A8Q A;  3VDZ A;  2WXP A;  4EKU A;  2CU1 A;  1C4P A;  4WWP A;  5IJM A;  1CQV A;  3ML9 A;  4BBN C;  5H8Y E;  5HG2 A;  2SEB D;  3RPF C;  1FRD A;  2WXR A;  3AEB B;  2VZK B;  4W9I A;  1NYQ A;  2KZR A;  3GE3 C;  1DYQ A;  2YSZ A;  3NJT A;  2KDB A;  3RCP A;  2L05 A;  3AEF B;  1SE9 A;  2HDE A;  1V5P A;  5C79 A;  2AYO B;  3LXF A;  4QJ4 B;  1T77 A;  1WE7 A;  3RNG C;  5I2M A;  2LFI A;  3DCX A;  3A9J B;  4WVF B;  2OTX A;  1SIF A;  1Y19 B;  2JPH A;  1HXY D;  3GYP A;  4MJS A;  4MK0 A;  2KFK B;  4DDG D;  4B6H A;  1R4M I;  3M63 B;  4JKH A;  1WGH A;  2L3Z A;  3DBL B;  2KOX A;  2MX2 A;  5J18 A;  4QXA B;  2UVM A;  2HTH B;  3SFD B;  3HIE A;  2IDY A;  1KJT A;  2ROZ B;  4ILH A;  1OGW A;  1IPG A;  2VZK D;  4IUM B;  3DVG X;  4RCO A;  2RD0 A;  4IM0 A;  1YQ4 B;  4F7G A;  3IAS 1;  1KTK A;  3OLM D;  2YT0 A;  3O96 A;  2MH7 A;  1E7U A;  1ZKH A;  5IP4 D;  2R61 A;  2BGF A;  1MFW A;  3U12 A;  3FKY A;  2O6V A;  1P9D U;  2KLC A;  5EE3 A;  2EEL A;  2K6D B;  4G3X B;  2I5F A;  4N58 A;  2KAC A;  1WYG A;  3NS1 A;  2WHI A;  2Z59 A;  1V5O A;  4CHM A;  2DYM A;  2V3N A;  3IT4 B;  2TSS A;  3PT2 B;  2ZVO A;  2Y8G A;  3NG0 A;  4C00 A;  3DXC A;  1OEY A;  4LNI A;  1PGB A;  3TUO A;  2A4Z A;  1X1F A;  2GUM A;  3ZTC A;  2HD5 B;  1WXM A;  1GOZ A;  3TEW A;  3QHT A;  3SEB A;  5LNK 1;  1JRP A;  4IM3 A;  3JSV A;  3AEA B;  4YWG G;  3P42 A;  2KIE A;  1MG4 A;  4RGN A;  1UEL A;  4B0E A;  4KIK A;  3BJI A;  1YJI A;  2MWS B;  3E9S A;  1YMH E;  2RLO A;  2E3T A;  5HFY A;  1C9F A;  2COP A;  2KUQ A;  4NJ6 A;  2IGG A;  1WXS A;  3MFG A;  3E9P A;  2MWN B;  2HE7 A;  2NBV B;  2V1Y A;  2YLM A;  4ZHO A;  2K2U A;  5BYS A;  2OJW A;  1MIZ B;  4JKA A;  2V4L A;  4ZRK A;  3W1S C;  5C3J B;  3MP9 A;  1L0V B;  4GNK B;  2MRP A;  5E6O A;  1EWY C;  2DYO A;  3B2G A;  1TBE A;  1B55 A;  2INN E;  4TUU A;  2KUP A;  1J0G A;  1DBH A;  4WAF A;  4XWT A;  3RYT A;  3DHG C;  1PFD A;  2PMV A;  4EJN A;  2HTH A;  3MC9 A;  2G9H D;  4WIP A;  4IW0 A;  3AE7 B;  4YSY B;  3PZD A;  2Z4D A;  1LGR A;  4ARC A;  2Y5P A;  2H7D A;  1UD7 A;  4K3C A;  2BS2 B;  1VLB A;  1HZ5 A;  2RDB C;  4N59 A;  1ZM0 A;  1E6E B;  4E74 A;  3H6N A;  4ZRJ A;  4F7Z A;  5C6R A;  1WGR A;  2BKF A;  1RLF A;  4GMX B;  2D9W A;  3B2F A;  4HCP B;  2Z13 A;  2NVU I;  3L0W B;  2DN6 A;  4ICU A;  3ZGZ A;  2DZM A;  3M95 A;  3VUX A;  2UWQ A;  1NTY A;  4KSL C;  1FCL A;  3DBR B;  5BMI A;  2MHJ A;  5IOI A;  2L83 A;  4DK5 A;  4P16 A;  4MJS B;  5J3Q A;  1Z5S B;  4P6V F;  1E8Y A;  3KY9 A;  3NZU A;  5IAA C;  3FIL A;  3W5U B;  1P6S A;  3VTW A;  1J8C A;  1JWA D;  1VBG A;  3X23 A;  1FXT B;  5EE1 A;  2DKP A;  3ZNG C;  1FEH A;  5HI1 A;  2DIK A;  1I4R A;  4B95 A;  1WIA A;  1YQ3 B;  3I9V 1;  4URK A;  4L1B A;  4JKG A;  4A90 A;  2GI9 A;  3SBT A;  1I4X A;  1P3R A;  2I38 A;  2WYQ A;  3JSV B;  4LK0 M;  2Z8L A;  1FIQ A;  3EFU A;  2OQB A;  4LDT D;  5LG4 B;  2MW5 A;  4GIV A;  1ZPS A;  2IGH A;  5TR5 A;  2J42 A;  2NMQ A;  3FC4 A;  3TJP A;  2N7E A;  1SXT A;  4LNN A;  5D3D A;  3J9C A;  4BFR A;  4BKS A;  1FFV A;  2M17 A;  4BAX A;  5JXV A;  3EEC A;  1LFD A;  2WXN A;  1XO3 A;  2N0S B;  4WJP A;  4XWW A;  3PRZ A;  3U52 E;  2Z0O A;  1JRU A;  3FSS A;  2NPT B;  3KRX A;  3P4P B;  5BMG A;  3CST A;  3PG7 A;  3KYC D;  2MA9 B;  3LDZ E;  2Z59 B;  3HM6 X;  5D7G A;  4HPP A;  2O2V B;  1SJH D;  3PLU A;  3AV8 A;  4GGQ A;  1ACC A;  2Z0Q A;  3TVV A;  3DBR I;  4HB2 B;  2MCN B;  2JWU A;  4EZK A;  4L1R A;  4MM3 B;  1RRB A;  3RT3 B;  1UPQ A;  2JXT A;  3QA8 A;  5AUI A;  2MSE D;  1EF1 A;  3EFC A;  3N1Y C;  1P5T A;  2KX3 A;  2LXA A;  1V1P B;  4EEW A;  2X8X X;  1XD4 A;  1TTN A;  3DVN V;  2AEH A;  4BKT A;  2M19 A;  5BYR A;  1J7C A;  1F1H A;  1SE2 A;  1GJZ A;  2DA0 A;  3FAH A;  4H8S A;  2CJN A;  1WRD B;  2VH2 A;  1EAZ A;  2LGD A;  3HRD D;  2NMB A;  4ZOH C;  2COD A;  4IWO A;  1QZE A;  3AUL A;  3OWE B;  4HAV B;  4BKG A;  3R7R A;  1V5T A;  1NDD A;  1BTK A;  3FEH A;  3KRW A;  2KFJ A;  2H89 B;  1FCC C;  3AE5 B;  1BUI C;  3DBH I;  2GBR A;  4MDK E;  1QKZ A;  1A5R A;  1WR1 A;  2OOB B;  1DOY A;  3CSF A;  3N1Z C;  1U29 A;  2GBM A;  4RFB A;  3ENE A;  2J0K A;  3UIN B;  2WXG A;  4II2 B;  1NTI A;  1V89 A;  3NWD A;  4CHJ A;  1OQQ A;  2RR9 A;  2LBB A;  4ILJ A;  3N32 A;  2RPV A;  2R0D A;  3WAO A;  2L1A A;  2IYD B;  5JHB A;  4MT7 A;  2LHE A;  1WJ1 A;  2O6V B;  2LGY A;  4ZRP A;  1L6U A;  2D3B A;  2M0X A;  1RAX A;  2JZZ A;  2RPQ A;  2WGS A;  2LYD A;  4BBK A;  4A6Q A;  1P0R A;  3AE8 B;  2L2I A;  2PE6 B;  2GBJ A;  1T0Q C;  2NBV A;  2WDQ B;  2VKI A;  5G5G A;  3VH3 B;  1OEY J;  4PK1 A;  3NZS A;  1WGQ A;  3U8Z A;  1XCT L;  4RF0 A;  3WYF B;  4OW0 A;  1F9J A;  4HB4 B;  2FCM A;  3ZLZ A;  2G4S A;  2JYE A;  4JKG B;  1N5X A;  3AE2 B;  2KQ7 A;  3A8P A;  2DHI A;  1RRP B;  1Q0W B;  4K7S A;  2KJR A;  1K52 A;  2G3Q B;  4JWU C;  1LXD A;  4K7W A;  5LOP B;  4MT5 A;  5D3X A;  3NWF A;  2N9X A;  2DNF A;  5D3I B;  4FBJ B;  2KVZ A;  3OAN A;  2CHX A;  3ODX A;  4ASW C;  1ZUD 2;  3ZUN A;  2Z14 A;  2G1E A;  1EO6 A;  1KI1 B;  1ET9 A;  1MI0 A;  3QK0 A;  3A58 A;  2PEA A;  4I6N B;  3PVL A;  1FB8 A;  1WYW B;  1N6Z A;  4JIO U;  4PS8 A;  4IKG A;  1QF6 A;  4YT0 B;  4WWM A;  1FPY A;  2DEN B;  4XE0 A;  3L08 A;  1FHX A;  4OT1 A;  1UGJ A;  1YN5 A;  4KZC A;  4WWO A;  5JZE B;  1WXA A;  2R2Y A;  5CTR C;  4E3C A;  3QBV B;  1ZSQ A;  4HSI A;  2MJ3 A;  2M4N A;  2ROV A;  1QQR A;  3ZQ4 A;  4D2K A;  1T0S C;  4C7Y A;  2BTE A;  2MEK A;  1IGD A;  1B9R A;  2UZR A;  1UNS A;  4AWJ A;  2L7R A;  2UZS A;  1QIL A;  1DOI A;  2IY0 B;  3IG3 A;  4IAP A;  4WAA A;  1MKE A;  4HAZ B;  1LO5 D;  3U7Z A;  2Y5C A;  2LVP A;  4LCD E;  2KJH B;  1L0X B;  1STE A;  3KZ1 A;  3BK1 A;  2OJR A;  2KDM A;  4KX6 B;  3WAP A;  2VH1 A;  5JH5 C;  1MPE A;  2CJO A;  3Q8B A;  3RI7 C;  1P1A A;  3ZRF A;  2KAN A;  1MHH E;  2QSD A;  3RUI B;  1AW7 A;  2JT4 B;  2KTF A;  2DLW A;  1ENF A;  1JCK B;  2CHZ A;  2SAK A;  3VAW A;  1IGC A;  1OMW A;  2Y8F A;  4G0N B;  1UNR A;  2ADZ A;  3IXS A;  1XR0 B;  1X1G A;  3F0W A;  3R2T A;  1HTQ A;  3BK2 A;  4YON A;  1OFF A;  1WZ0 A;  2V9H A;  4W9K A;  2L76 A;  2LGS A;  4K1R B;  5EFX A;  1ZC3 B;  5HE3 A;  2QHO A;  2FBW B;  1XF5 L;  4M8N A;  3VRA B;  4ZDV A;  4QJ3 B;  1H8C A;  2GLS A;  4EZJ A;  3D8F A;  1Y5O A;  1HA5 A;  2MP2 A;  1KZG A;  4KDL B;  1V97 A;  5T8I A;  3V60 A;  3KVF B;  1UUP A;  3PRE A;  2CY4 A;  2RDH A;  2AQ2 B;  1FMA D;  4DBG A;  2Z0P A;  5AUK A;  2ZEQ A;  1F52 A;  3GP7 A;  4GLS C;  1YN4 A;  1T6B X;  5DCN A;  3IVF A;  1P7E A;  4EE2 A;  5M4Y B;  4KGT A;  3AEG B;  3MC8 A;  2WH5 A;  4MEM A;  4PS7 A;  1NVL A;  4K81 A;  3V6E B;  2R82 A;  4US9 A;  5LXI B;  2WXI A;  1V8C A;  3A1Q B;  2IO0 B;  4DXG A;  4HB0 B;  5D27 A;  2PVG C;  4FA6 A;  5C16 A;  2FJL A;  2V3S A;  3W1S A;  1ZDV A;  1ZOY B;  3MTN B;  5AEK B;  2LXC A;  2BF8 B;  1HBK A;  1NU2 A;  2NTT A;  2P8V A;  4K17 A;  2L32 A;  3HVZ A;  2X38 A;  4KHA A;  3BZD B;  3CIK A;  1PFJ A;  4K2O A;  4YTN B;  1E10 A;  3KUZ A;  1E0Z A;  1D5M C;  2WX0 A;  4TKN A;  3UF8 A;  4NQL B;  3VR8 B;  3QC8 B;  4MGY E;  1TXD A;  1YJ1 A;  4JKF A;  4NY0 A;  4CQN A;  2OHF A;  4M0W A;  3E9L A;  2MBB B;  3NRZ A;  3URY A;  4FJZ A;  1WZ3 A;  5CHF A;  1E90 A;  3DWM A;  4JX1 C;  4HEA 1;  4G50 A;  2MKR A;  1OY2 A;  4TYZ A;  4HDQ A;  3A1Q A;  4W9D A;  4FUL A;  5D2M B;  4DDI D;  1I2H A;  2V76 A;  2JVC A;  3RCZ A;  1FGZ A;  1E8Z A;  1DIK A;  1L0Y B;  2X18 A;  4AUQ C;  4GXB A;  4RF1 A;  4KDI C;  1N5W A;  4UDU C;  2EMT A;  4KKI A;  2KTR A;  1V86 A;  3P4S B;  1E5W A;  3Q8E A;  1ZXH A;  2H88 B;  5JP4 A;  2FID A;  2PE9 A;  4LNO A;  3RUL A;  3GYO A;  1N3H A;  3BII D;  1OQY A;  3NHE B;  4WJ7 A;  1I4P A;  3UIP B;  2VRW B;  3I3T B;  3QX1 A;  3ZXV A;  1NBF C;  1WXV A;  2L00 B;  1VBH A;  4HPL B;  4WJQ A;  2J0M A;  2LZ6 A;  3C8Y A;  3HM3 A;  4OZB A;  2I1J A;  3KWV A;  2MBE A;  4NAW A;  4NNJ B;  2IO2 B;  4GOC A;  1BTN A;  2J7Q B;  2BWE S;  2NTS A;  1SBB B;  4US8 A;  4FLH A;  1C78 A;  5CHV C;  2RVB B;  2DLB A;  3H8H A;  3K9O B;  3U30 A;  4ICV A;  2JF5 A;  1WFY A;  3NVW A;  2MBH A;  2NR2 A;  1VD2 A;  2MJD A;  1WG7 A;  3NZ3 A;  1UWX A;  4A3P A;  2WXK A;  2IJ0 A;  3QWM A;  2KX0 A;  1X86 A;  2Q5W D;  3L16 A;  5EE9 A;  3VUY A;  3A33 B;  1M4V A;  3PRM B;  1V88 A;  1K51 A;  3VUW A;  1EVH A;  3HK0 A;  1WF9 A;  3ABV B;  1AQC A;  4S17 A;  3MHZ A;  4XWX A;  4A6H A;  4ZRI A;  2MBO A;  2LJ5 A;  1KF6 B;  1F77 A;  2LUE A;  4C7Z A;  3APF A;  2KN4 A;  2L0T A;  2JRI B;  2O6V D;  3W9C B;  1WX8 A;  2Q13 A;  2LD9 A;  4I6P A;  4TV3 A;  3TIX A;  2GBN A;  4GDL B;  1JRO A;  2N23 A;  3AU4 A;  2HRJ A;  2KWU B;  1ROE A;  4IM2 A;  3ENB A;  2FDQ A;  3TO1 A;  3ZNI D;  1V1P A;  1QOA A;  1D5Z C;  2C7M B;  2ZW1 A;  2PPH A;  2GS0 A;  1UF0 A;  2MFQ A;  2RSG A;  2QKM A;  4FN2 A;  2DHZ A;  1QOB A;  1AAR A;  2X0S A;  1Q67 A;  4F7H A;  4II3 B;  5AZF A;  3SR6 A;  1T5X D;  3VRB B;  5E6P A;  2LWP A;  3AN1 A;  2W2X D;  3APC A;  3GOE A;  2KT7 A;  2DYQ A;  1WGK A;  2LRW A;  3RNA C;  3PEG A;  3SD5 A;  1N61 A;  5MPO A;  3ZNH B;  4RGM A;  4JK9 A;  1L4D B;  1MAI A;  2FNJ B;  2BPS A;  2ZNV C;  4REZ A;  4A8X C;  1HQR D;  3N7C A;  5KHO A;  2KDF B;  4MEL A;  3RNF C;  1TZ1 A;  1RM6 C;  1XXG A;  2ZNV B;  3AE6 B;  3BWU D;  4C4V A;  2JP2 A;  5KQ1 A;  1NI2 A;  1H4R A;  4KHO A;  3TCA A;  2CY5 A;  2DX5 B;  1NYR A;  1W1G A;  3MPX A;  2BB5 A;  3CMM B;  4JL9 A;  4CYE A;  3M3J A;  2NBW B;  1ACA A;  3NSU A;  1V81 A;  3AM9 A;  4B6W A;  3AE3 B;  1DDW A;  3N9Y C;  1KFY B;  3B08 A;  4M8M A;  4HKQ A;  1XD3 B;  5JHH A;  4IDI A;  4NAM A;  3Q3F A;  1L5P A;  3TW1 A;  3WAN A;  3OJ3 A;  4HK2 A;  1XT9 B;  2HJ8 A;  4F7U P;  3RZW C;  1AN8 A;  3Q69 A;  2DHK A;  2ZZP B;  2QIL A;  2Y5B B;  1UNP A;  2PTL A;  4A6F B;  3NVZ A;  3NW8 A;  3G9W A;  2D3C A;  1BXT A;  2J53 A;  3PHW B;  2EMS A;  1TQZ A;  1KLG D;  5LLI A;  2AWT A;  3VIA A;  1QOG A;  2KAJ A;  4IC7 B;  2K25 A;  1X11 A;  5BO4 B;  3AEE B;  3EGR A;  1MK7 B;  3DDC B;  4HWI B;  4BOZ B;  5E6N A;  2QEJ C;  3PSC A;  3KYD D;  3PS6 A;  1SF0 A;  4W9C A;  1VZ6 A;  3P7Z A;  3AI5 A;  4MH8 A;  3L10 B;  1VZ7 A;  2QCZ A;  1I35 A;  5J3T A;  1WR6 E;  2WXO A;  4G11 A;  1YOV B;  1TS5 A;  3GZN B;  3LYY A;  1G6J A;  1VDV A;  5LXH A;  2CQU A;  4D6W A;  4OHJ A;  2RRF A;  4XC2 A;  4DWF A;  3U4E G;  5C1Z A;  5FR6 A;  1XLQ A;  2B76 B;  2IPK D;  5HE1 A;  5BYQ A;  3AE9 B;  1JWM D;  1BT0 A;  4HLE A;  4A20 A;  4YXD B;  1XKE A;  4LLG M;  4LNF A;  2YS3 A;  3HQC A;  4TMA B;  5H92 C;  3SYX A;  2DYN A;  3ZO5 B;  4PYU A;  1WWT A;  4YTM B;  1UPR A;  1JML A;  2YRY A;  4OVV A;  2WXM A;  2KVR A;  1KM7 A;  2C9W B;  4A3O A;  2CHW A;  1BML C;  3L13 A;  5C2T B;  2XBB C;  1ZE3 D;  4AJY B;  2WNM A;  4RNA A;  3ZIM A;  1V6E A;  2IGD A;  1YJJ A;  2EKI A;  5G55 A;  4W9F A;  1D5X C;  4AOF A;  4W9J A;  3IBE A;  4BBN F;  4KAX B;  4MH0 E;  4MSM B;  2GCJ A;  1CZP A;  2KDE B;  1M7R A;  3FIL B;  3Q2A C;  1DGJ A;  1C4C A;  5TSS A;  4IFS A;  1RYJ A;  2FE8 A;  3JYU A;  5L83 A;  2CR5 A;  4B0M A;  2DHJ A;  3NVY A;  4L2Y A;  4DHJ B;  2DTC A;  1LM8 B;  2WXQ A;  4Y94 A;  2FCS A;  5L81 A;  4HDO A;  3DQV A;  1JWS D;  2DFK A;  1WMH B;  4KV2 A;  1KRH A;  2KHW B;  2A5U A;  4D0N B;  5CLQ B;  1KZ7 A;  1WRI A;  3M1I B;  5D94 A;  1TY0 A;  2DKQ A;  5DHF B;  3LJ3 A;  1E8W A;  2LHD A;  2KK8 A;  1R4N I;  4F8C B;  3PRP B;  5KQ4 A;  1JDE A;  1PUT A;  1FNU A;  3JVZ X;  1TS2 A;  1Q10 A;  1WGU A;  2C60 A;  2WS3 B;  3MJ5 A;  1YIW A;  1W1H A;  4MY6 A;  3B0A A;  1B1Z A;  2V3P A;  3EPY A;  2KXJ A;  4NSW A;  3EA6 A;  1FD6 A;  2ZJD A;  4C56 C;  4JE3 B;  1TT5 B;  3SV1 A;  3DPD A;  2BYF A;  1MHX A;  3HIZ A;  4CO7 A;  3FM8 C;  1WI0 A;  2B3A A;  1MI1 A;  2WP9 B;  1W1D A;  3PSE B;  1WJN A;  1JWU D;  3AXC A;  3H9D A;  3BIN A;  3VTV A;  3T8M A;  4DHZ E;  5CHW A;  4J3O D;  4ANX A;  1V61 A;  2QIE B;  3ZJV A;  1QLB B;  4KHB B;  1NTV A;  2BVC A;  2FAZ A;  4ZRQ A;  4S0R A;  2C5L C;  2K39 A;  3X0W A;  1SGH A;  3D8D A;  2N9K A;  2ASQ A;  1T3Q A;  4NPN A;  3R7Q A;  2K9X A;  4GB9 A;  2WU5 B;  3ZVV A;  5DPS A;  1D3Z A;  3RNC C;  2XNA C;  4DHJ D;  4B9K A;  1FHW A;  2D2Q A;  4ANV A;  5DPR A;  2WDV B;  3P4R B;  1E8X A;  1C76 A;  1C79 A;  4TSS A;  4HJG E;  4N9F 4;  2N0Y A;  1K8R B;  2D3G A;  2JX5 A;  4HRO A;  3KWL A;  3ODO A;  3E56 A;  4K2P A;  2DWQ A;  3VHT C;  2K6Q A;  2PLP A;  4DX8 A;  4E71 A;  1XLP A;  2LVQ A;  1I4G A;  3DHH C;  2QC8 A;  2QDF A;  2GBK A;  3WAM A;  5LON B;  2JU6 X;  4LDT B;  4BKS D;  2JSV X;  3DXD A;  2D9Y A;  3TL5 A;  3ZJU A;  3SU8 X;  1D4B A;  4K7U A;  3QWZ B;  4M00 A;  4FJY A;  2PJH A;  1EM7 A;  2R09 A;  5JLJ B;  4WJN A;  1DRO A;  1K5D B;  2R2O A;  1RJ2 A;  3F5R A;  4X57 B;  1HEZ E;  1J19 A;  1QC6 A;  3ULB A;  3NWA A;  3SDL C;  2IO3 B;  3DVN U;  4HJK A;  3UQB A;  3KUD B;  2YT2 A;  4KZ0 A;  4EZL A;  1ZP0 B;  2JRH A;  1M94 A;  5G2N A;  5D3W A;  2JWZ A;  2IND C;  4WQM A;  4OZA A;  3M62 B;  1F0Z A;  2COF A;  1WXQ A;  4KVG B;  4M01 A;  1XCQ L;  3NUH B;  5GXG B;  2I2Y A;  4JK7 A;  4RH6 A;  2Y3A A;  3UZT A;  3CWI A;  1XOD A;  1UGM A;  1WGG A;  3N1X C;  1Z2M A;  3HVD A;  2D11 A;  1SIJ A;  4WH4 A;  3I63 C;  4C0A A;  2ONQ A;  2FCQ A;  3DWG C;  3RMK C;  1HB6 A;  2KIG A;  3MC0 B;  2ELA A;  3VTU A;  4GN1 A;  2LG1 A;  2IO1 B;  5DPT A;  1TS4 A;  2QKL A;  3QQ8 B;  2GOW A;  1QQG A;  2K1F A;  1P98 A;  1SSN A;  5C5B A;  1ZVR A;  1DDM A;  2W55 A;  4PS3 A;  3SFE B;  2RQ1 A;  3TEZ A;  3R66 C;  2FJ9 A;  1PDX A;  1VCB A;  2MQJ A;  2VSZ A;  3ZJT A;  1CK1 A;  4KIK B;  2IYB A;  4IWP A;  2CKH B;  4LNK A;  3R8B A;  2L0F A;  1RFA A;  2C7H A;  4NJC A;  4FJV B;  4IOI E;  1R4M B;  2RNR B;  1MG8 A;  2BWF A;  3WAL A;  1TKE A;  2DZI A;  1JW9 D;  1DOX A;  3N3K B;  3FLV A;  4N6E B;  3MJW A;  1IYF A;  1U27 A;  1PQS A;  1BWN A;  2COC A;  3R3M A;  4IOY X;  3ZW3 A;  3FVC A;  3A4R A;  3U2S C;  1IRS A;  1VZ8 A;  3FP5 A;  4JKE A;  3P4Q B;  4Z2N A;  1CMX B;  1VJK A;  1WVH A;  2LOZ A;  1OTR B;  1TIF A;  3DVG Y;  1DYN A;  2D9Z A;  3HUI A;  4L23 A;  2BYT A;  4JGH B;  1NI3 A;  2BBC A;  4W9G A;  3O13 A;  4GDL A;  1V5U A;  1U5D A;  2JQR B;  1HB8 A;  2XQN M;  1N63 A;  3V61 A;  2LGX A;  5I4D A;  5KCV A;  3QCA A;  3KLS X;  3QAQ A;  2KC1 A;  2DX5 A;  4AP4 C;  4DQO C;  4PYZ A;  1RWS A;  1JAL A;  1NVI D;  1YNT E;  3KSY A;  1WJ4 A;  2W54 A;  1GNU A;  2ZCB A;  5DH9 B;  1WH3 A;  1WSP A;  4GDK A;  2KTR B;  2GCL A;  4GZU A;  1PLS A;  1PMS A;  3PLV A;  4LJO B;  1D6E C;  4A6K A;  4YSX B;  2W2W A;  4KKJ A;  2ICI A;  1AYF A;  3JW0 X;  3BY4 B;  2ON8 A;  1LB1 A;  1WJ6 A;  3AEC B;  1BAK A;  4C80 A;  4BZA A;  2K49 A;  3SHQ A;  2LKO A;  1OQR A;  1IUE A;  2DAJ A;  3V05 A;  5BMH A;  1LW3 A;  3HSA A;  2LOX A;  4PT5 A;  3Q3J A;  3VH4 B;  2AL6 A;  2D9X A;  1V1O A;  4YTP B;  2EC1 A;  2WU2 B;  4O1N A;  3TSS A;  2ZPY A;  2PZ1 A;  4QAY A;  3OHM B;  2JZP A;  3P63 A;  2G35 A;  1KLU D;  2ZPN A;  1SE4 A;  2EJ8 A;  1Q5W B;  3QJZ A;  3DBS A;  3Q3O C;  2FJU B;  2W3S A;  1L6V A;  2D3A A;  3P2B A;  2D5G A;  2LRU A;  3ECI A;  3C0R B;  2AL3 A;  4GSW A;  3ZYY X;  2MLB A;  4OZC A;  1LQB A;  1FXI A;  4OVZ A;  1JWB D;  4ZYS A;  1K5G B;  1WGD A;  1XEE A;  1Y56 A;  2RSU A;  1NEN B;  3P1M A;  4XDC A;  2AQ1 B;  2KD0 A;  2K8H A;  5AZH A;  1E9M A;  1YQB A;  1S3S G;  3ZRC A;  4RGT A;  2HJ1 A;  3ZDM C;  1U2B A;  3K9P B;  3BYT B;  2D4Q A;  3WA0 A;  1WM3 A;  2GB1 A;  1FFU A;  2ELB A;  2E2X A;  2N9L A;  2WQY B;  4JKD A;  2BT6 A;  5GMV A;  5EE0 A;  1Z87 A;  3T06 A;  5IKC M;  2VRR B;  3CF6 E;  1UNQ A;  2GMI C;  4XGA B;  1CJE A;  2IY1 B;  2V4I B;  3OG5 A;  3ZVR A;  4HRS A;  3IFW B;  3HHM A;  5FKA C;  4PNK A;  4LTU A;  1YX5 B;  2KQ4 X;  4ARI A;  5J3Y A;  3VFK A;  5EDS A;  4HKZ E;  4NJ7 A;  3Q3M C;  2ACZ B;  3ETR A;  5FR3 A;  5IN7 A;  4DIX A;  2L52 A;  3A9K B;  3PZ8 A;  1F2R I;  2K3U A;  3A4S C;  4JKC A;  3RN9 C;  5G5H A;  1ZYI A;  2NBU A;  2PKO A;  1YD8 U;  2N4F A;  1FGY A;  2BB6 A;  3BVM A;  3DCG A;  1ESF A;  3SNH A;  1GPX A;  2LI5 A;  4HHV A;  1FNW A;  2LVO A;  1SB3 C;  1TGZ B;  1VRA B;  3TEY A;  2QJL A;  2MDX A;  4AS1 A;  3L4P A;  2KJ6 A;  3KH0 A;  3AE1 B;  2WDR B;  3ZNZ B;  3WIM A;  2G45 B;  3AMZ A;  3OJ4 B;  2K5P A;  4ANU A;  5CX3 A;  1ET6 A;  4HB3 B;  2KYW A;  3TFM A;  4L6E A;  1UBI A;  2BW2 A;  3LB8 C;  1N60 A;  3V6C B;  4PQ0 A;  3AJ4 A;  3VXW A;  4RM8 A;  2BS4 B;  2LAS A;  3T3O A;  5JHG A;  1C77 A;  2JYT A;  4R3D A;  3E66 A;  2YEP F;  4JLC A;  2NPT A;  1T0Y A;  2ABD A;  2M56 B;  2PW9 A;  3QIJ A;  1X1M A;  3UIO B;  2KC2 A;  2MP2 B;  1TS3 A;  5L95 C;  2J4X A;  2L1C A;  2W82 A;  4LJP B;  1ZGU B;  4JKB A;  2O2V A;  3N30 A;  1UEF A;  3DOW A;  1KLV A;  3ZXR A;  3AB5 A;  1IBX A;  3C19 A;  4I6L B;  4KGR A;  3Q3N C;  3BVG A;  1GB4 A;  3GS2 A;  3A9K A;  2KDI A;  2K8E A;  1FHO A;  2WDT B;  1GG3 A;  4HVB A;  5DPW A;  3V62 A;  4JWS C;  4IG7 B;  4AQ7 A;  2W9N A;  2KNB A;  1U5F A;  2M8S A;  2LEK A;  1RFK A;  1FAO A;  1FO4 A;  3EHV A;  1S1Q B;  3ML4 A;  1HTO A;  1J7B A;  3T9L A;  4ACF A;  2WWZ A;  3AH7 A;  5E6J A;  3P6A A;  3H7S A;  4XZ4 A;  4EOY A;  3MDB C;  2QMT A;  1T0R C;  2DZJ A;  3RD2 A;  1FOE A;  2YS5 A;  2N1V A; 
#chains in the Genus database with same CATH homology
 2I1K A;  2D10 A;  3V5W A;  5KHQ A;  2WX1 A;  5C23 A;  4WJO A;  1OQN A;  4MSQ B;  2CB8 A;  2IZV B;  1EGX A;  3TMP B;  2DX1 A;  1M7E A;  4BVU C;  2JXX A;  5DIF B;  2XEW A;  4ILG B;  4Z2M B;  3KUC B;  4MGI E;  2P0H A;  4HXD A;  2K2J A;  3VQI A;  1GC7 A;  1YX6 B;  4OVU A;  2MBQ A;  2W2X C;  1V9J A;  1KC7 A;  4GPT B;  3S2A A;  2H7E A;  1XQQ A;  2IFS A;  1L7Y A;  5AZG A;  1WX7 A;  3SBG A;  3D8E A;  1WMH A;  1GUA B;  1HE8 A;  3QAR A;  1IP9 A;  3O65 B;  1MIX A;  3L17 A;  2JZ3 B;  2N7D A;  1ZW7 A;  2NS5 A;  4GMV A;  4MM3 A;  1GC6 A;  5J17 A;  4HAX B;  1H10 A;  4HAT B;  2YS1 A;  3ZKJ C;  3VVW B;  1MK9 B;  2N1W A;  2M38 A;  2N9E B;  4EUT A;  3ML8 A;  2KQS A;  2IBI B;  3AU5 A;  4BOS C;  4DXA B;  3LJU X;  3H1U A;  3ULC A;  2R2Q A;  4FAD A;  2I5C A;  2YF0 A;  2BYV E;  1XCG A;  3VOQ A;  2J0J A;  2P0F A;  1XX0 A;  4IWQ A;  4TQ1 A;  3ZTD A;  4J6I A;  3GZN I;  4MGK E;  1KBL A;  2K00 A;  4CHK A;  2C7N B;  1J0W A;  5HKH A;  4W9L A;  2BKR B;  2KMA A;  2M14 A;  1EUV B;  2RGN B;  3B1L X;  2BYE A;  1GGO A;  4P7I A;  4HAU B;  2LUL A;  3KW5 B;  4F1S A;  4DX9 0;  1ZC4 B;  2CS4 A;  1U4A A;  4W9H A;  2DZK A;  3ONS A;  4ZYN A;  5D3Y A;  2Y7B A;  2RUK B;  5D3V A;  4HAW B;  4FHK A;  4HPM B;  4RM9 A;  2D07 B;  3PVW A;  2YVC A;  1WJU A;  3PP2 A;  4GU2 A;  3PTF C;  1SHC A;  1DDV A;  4JK8 A;  3H7P A;  5IA7 A;  3EC8 A;  3PVU A;  3ALB A;  1WX9 A;  2XK5 B;  3IHP C;  2J59 M;  3PHX B;  2DAF A;  1WE6 A;  2KMC A;  3SO6 A;  1I7A A;  5GOW B;  1Q1O A;  2KGX B;  1C3T A;  2ZVN A;  3A9J A;  1I42 A;  1UH6 A;  3W1Y A;  3HW2 B;  3SUZ A;  1V80 A;  1WGY A;  2Z0D B;  3ODW A;  4TQ0 A;  4W9E A;  2KFK A;  3ZDT A;  3RZF A;  2RGF A;  4WWN A;  1MPH A;  3OAW A;  1V5M A;  2FIF A;  4M0W B;  2COA A;  2Z0E B;  3MHS D;  3H7P B;  3L54 A;  3UGB B;  2M1M A;  4EFO A;  4DHZ B;  1WJM A;  1Y8R C;  1V2Y A;  1E7V A;  2FCN A;  2P0D A;  3DBL I;  2NZ8 B;  3NOB A;  2XK5 A;  3PGE A;  2JUO A;  2K8B A;  4WSF A;  4RMA A;  4WQO B;  1V49 A;  3CXB B;  2NCN A;  2KWV B;  1KOT A;  4GDK B;  4HAY B;  1EF5 A;  2YT1 A;  4FHJ A;  2KWC A;  4YL8 A;  2KKC A;  1P3Q U;  4ANW A;  1ST7 A;  2EKE C;  2KLG A;  5DI9 B;  3DXE A;  5FI0 A;  5HE2 A;  5HE0 A;  4DBB A;  2N9P C;  1U5E A;  1WI1 A;  2K8C A;  3APD A;  4NAW B;  3UQA A;  2KO3 A;  1X05 A;  2CRF A;  1C1Y B;  3PPA A;  3PV1 A;  4JQW C;  3A98 B;  4KSK C;  5DHA B;  2GJY A;  4MGZ E;  3NS8 A;  1U5G A;  4HCN B;  2FUH B;  2UYZ B;  2KN5 A;  5D6J B;  1UBQ A;  5CLL B;  1WY8 A;  4A5K A;  3NY5 A;  1L2N A;  5C5B B;  3D32 A;  2KCJ A;  1TJ6 A;  2REX A;  4XX5 A;  2DYB A;  3TBL D;  2L8J A;  2BCJ A;  4NQK E;  2G4D B;  1AWE A;  1WM2 A;  4AJW A;  1UZX B;  2JY6 A;  2ZCC A;  4EMO A;  5JHA A;  5J2R A;  2D9V A;  2CAY A;  5FI1 A;  4A6F A;  1ISN A;  3U7D A;  3E9O A;  5JVL A;  3A8Q A;  3VDZ A;  4EKU A;  2CU1 A;  4WWP A;  5IJM A;  3ML9 A;  4BBN C;  4W9I A;  2KZR A;  2YSZ A;  2KDB A;  3RCP A;  2L05 A;  1SE9 A;  1V5P A;  5C79 A;  2AYO B;  1WE7 A;  3A9J B;  4WVF B;  2OTX A;  1SIF A;  1Y19 B;  2JPH A;  3GYP A;  4MJS A;  4MK0 A;  2KFK B;  4DDG D;  4B6H A;  1R4M I;  3M63 B;  4JKH A;  1WGH A;  2L3Z A;  2KOX A;  2MX2 A;  5J18 A;  2UVM A;  2HTH B;  1KJT A;  2ROZ B;  4ILH A;  1OGW A;  1IPG A;  4IUM B;  3DVG X;  2RD0 A;  4IM0 A;  4F7G A;  3OLM D;  2YT0 A;  3O96 A;  1E7U A;  1ZKH A;  2BGF A;  2O6V A;  1P9D U;  2KLC A;  2K6D B;  4G3X B;  2I5F A;  1V5O A;  4CHM A;  2DYM A;  3PT2 B;  2ZVO A;  2Y8G A;  3DXC A;  1OEY A;  2A4Z A;  1X1F A;  3ZTC A;  2HD5 B;  1WXM A;  3QHT A;  4IM3 A;  3JSV A;  1UEL A;  4KIK A;  3BJI A;  2MWS B;  2RLO A;  2COP A;  4NJ6 A;  1WXS A;  3E9P A;  2MWN B;  2HE7 A;  2NBV B;  2V1Y A;  2YLM A;  2K2U A;  1MIZ B;  4JKA A;  2V4L A;  4ZRK A;  3W1S C;  2MRP A;  5E6O A;  2DYO A;  1TBE A;  1B55 A;  4TUU A;  2KUP A;  1J0G A;  1DBH A;  3RYT A;  4EJN A;  2HTH A;  4IW0 A;  3PZD A;  2H7D A;  1UD7 A;  1ZM0 A;  4E74 A;  3H6N A;  4ZRJ A;  4F7Z A;  5C6R A;  1WGR A;  2BKF A;  1RLF A;  4GMX B;  2D9W A;  4HCP B;  2NVU I;  3L0W B;  2DN6 A;  4ICU A;  2DZM A;  3M95 A;  3VUX A;  2UWQ A;  1NTY A;  4KSL C;  4DK5 A;  4MJS B;  5J3Q A;  1Z5S B;  1E8Y A;  3KY9 A;  3NZU A;  5IAA C;  1P6S A;  3VTW A;  1J8C A;  1VBG A;  3X23 A;  1FXT B;  2DKP A;  3ZNG C;  2DIK A;  4B95 A;  1WIA A;  4URK A;  4JKG A;  3SBT A;  3JSV B;  1P3R A;  2WYQ A;  3EFU A;  2OQB A;  4LDT D;  2MW5 A;  4GIV A;  5TR5 A;  3TJP A;  2N7E A;  4BFR A;  4BKS A;  2M17 A;  3EEC A;  1LFD A;  4WJP A;  3PRZ A;  2Z0O A;  1JRU A;  3FSS A;  2NPT B;  3KRX A;  3CST A;  3PG7 A;  3KYC D;  2MA9 B;  3LDZ E;  2Z59 B;  3HM6 X;  5D7G A;  2O2V B;  3PLU A;  4GGQ A;  2Z0Q A;  3TVV A;  3DBR I;  4HB2 B;  2MCN B;  4EZK A;  1RRB A;  3RT3 B;  1UPQ A;  3QA8 A;  2MSE D;  1EF1 A;  1P5T A;  2KX3 A;  2LXA A;  4EEW A;  1XD4 A;  1TTN A;  3DVN V;  2AEH A;  4BKT A;  1GJZ A;  2DA0 A;  4H8S A;  1WRD B;  1EAZ A;  2LGD A;  2NMB A;  2COD A;  4IWO A;  1QZE A;  3AUL A;  4HAV B;  4BKG A;  3R7R A;  1V5T A;  1NDD A;  1BTK A;  3FEH A;  3KRW A;  2KFJ A;  3DBH I;  2GBR A;  4MDK E;  1A5R A;  1WR1 A;  2OOB B;  3CSF A;  1U29 A;  2GBM A;  3ENE A;  2J0K A;  3UIN B;  4II2 B;  1NTI A;  1V89 A;  4CHJ A;  2RR9 A;  2LBB A;  4ILJ A;  3N32 A;  2R0D A;  3WAO A;  2IYD B;  5JHB A;  4MT7 A;  1WJ1 A;  2O6V B;  2LGY A;  2M0X A;  1RAX A;  2JZZ A;  2RPQ A;  2LYD A;  4BBK A;  1P0R A;  2L2I A;  2PE6 B;  2GBJ A;  2VKI A;  3VH3 B;  1OEY J;  3NZS A;  1WGQ A;  3U8Z A;  3WYF B;  1F9J A;  4HB4 B;  2FCM A;  3ZLZ A;  2G4S A;  4JKG B;  2KQ7 A;  3A8P A;  2DHI A;  1RRP B;  1Q0W B;  4K7S A;  2KJR A;  2G3Q B;  1LXD A;  4K7W A;  5LOP B;  5D3X A;  2N9X A;  4FBJ B;  3OAN A;  2CHX A;  3ODX A;  4ASW C;  3ZUN A;  1EO6 A;  1KI1 B;  3QK0 A;  2PEA A;  4I6N B;  3PVL A;  1FB8 A;  1WYW B;  4JIO U;  4PS8 A;  2DEN B;  3L08 A;  1FHX A;  4KZC A;  4WWO A;  5JZE B;  1WXA A;  5CTR C;  4E3C A;  3QBV B;  1ZSQ A;  2M4N A;  2ROV A;  2UZR A;  4AWJ A;  2L7R A;  2UZS A;  2IY0 B;  3IG3 A;  4IAP A;  4WAA A;  1MKE A;  4HAZ B;  2LVP A;  4LCD E;  2KJH B;  3KZ1 A;  2OJR A;  3WAP A;  5JH5 C;  1P1A A;  3ZRF A;  2KAN A;  3RUI B;  2JT4 B;  2KTF A;  2DLW A;  2CHZ A;  3VAW A;  1OMW A;  2Y8F A;  4G0N B;  1UNR A;  2ADZ A;  1XR0 B;  1X1G A;  3F0W A;  4YON A;  1WZ0 A;  4W9K A;  2L76 A;  4K1R B;  5EFX A;  1ZC3 B;  5HE3 A;  2QHO A;  4M8N A;  4ZDV A;  1H8C A;  4EZJ A;  3D8F A;  1Y5O A;  2MP2 A;  1KZG A;  4KDL B;  3V60 A;  3KVF B;  3PRE A;  2CY4 A;  4DBG A;  2Z0P A;  2ZEQ A;  5DCN A;  3IVF A;  2WH5 A;  4MEM A;  4PS7 A;  1NVL A;  4K81 A;  3V6E B;  2R82 A;  5LXI B;  3A1Q B;  2IO0 B;  4HB0 B;  5D27 A;  4FA6 A;  5C16 A;  2FJL A;  2V3S A;  3W1S A;  3MTN B;  5AEK B;  2LXC A;  2BF8 B;  1HBK A;  1NU2 A;  2P8V A;  4K17 A;  4KHA A;  3CIK A;  1PFJ A;  4K2O A;  3KUZ A;  2WX0 A;  4TKN A;  3UF8 A;  4NQL B;  3QC8 B;  4MGY E;  1TXD A;  1YJ1 A;  4JKF A;  4NY0 A;  3E9L A;  2MBB B;  4FJZ A;  1WZ3 A;  5CHF A;  1E90 A;  4G50 A;  2MKR A;  1OY2 A;  4TYZ A;  4HDQ A;  3A1Q A;  4W9D A;  4FUL A;  5D2M B;  4DDI D;  1I2H A;  2V76 A;  2JVC A;  3RCZ A;  1FGZ A;  1E8Z A;  1DIK A;  2X18 A;  4AUQ C;  4GXB A;  4KDI C;  2EMT A;  2KTR A;  1V86 A;  1E5W A;  5JP4 A;  2FID A;  2PE9 A;  3RUL A;  3GYO A;  1N3H A;  1OQY A;  3NHE B;  4WJ7 A;  3UIP B;  2VRW B;  3I3T B;  3QX1 A;  1NBF C;  1WXV A;  2L00 B;  1VBH A;  4HPL B;  4WJQ A;  2J0M A;  2LZ6 A;  3HM3 A;  2I1J A;  2MBE A;  4NAW A;  4NNJ B;  2IO2 B;  4GOC A;  1BTN A;  2J7Q B;  2BWE S;  4FLH A;  5CHV C;  2RVB B;  3K9O B;  3U30 A;  4ICV A;  2JF5 A;  1WFY A;  2MBH A;  2NR2 A;  1VD2 A;  1WG7 A;  4A3P A;  3QWM A;  2KX0 A;  1X86 A;  3L16 A;  3VUY A;  3A33 B;  3PRM B;  1V88 A;  3VUW A;  1EVH A;  3HK0 A;  1WF9 A;  1AQC A;  4XWX A;  4A6H A;  4ZRI A;  2MBO A;  2LJ5 A;  2LUE A;  3APF A;  2L0T A;  2JRI B;  2O6V D;  1WX8 A;  2Q13 A;  2LD9 A;  4I6P A;  4TV3 A;  3TIX A;  2GBN A;  4GDL B;  2N23 A;  3AU4 A;  2HRJ A;  2KWU B;  4IM2 A;  3ENB A;  2FDQ A;  3TO1 A;  3ZNI D;  2C7M B;  2PPH A;  2GS0 A;  2MFQ A;  2RSG A;  2QKM A;  4FN2 A;  2DHZ A;  1AAR A;  2X0S A;  1Q67 A;  4F7H A;  4II3 B;  5AZF A;  5E6P A;  2LWP A;  2W2X D;  3APC A;  3GOE A;  2DYQ A;  2LRW A;  3PEG A;  3SD5 A;  3ZNH B;  4JK9 A;  1MAI A;  2FNJ B;  2BPS A;  2ZNV C;  3N7C A;  5KHO A;  2KDF B;  4MEL A;  1TZ1 A;  2ZNV B;  2JP2 A;  5KQ1 A;  1NI2 A;  1H4R A;  4KHO A;  3TCA A;  2CY5 A;  2DX5 B;  1W1G A;  3MPX A;  3CMM B;  4JL9 A;  4CYE A;  3M3J A;  2NBW B;  1ACA A;  3NSU A;  1V81 A;  4B6W A;  1DDW A;  3B08 A;  4M8M A;  1XD3 B;  5JHH A;  3Q3F A;  3TW1 A;  3WAN A;  3OJ3 A;  4HK2 A;  1XT9 B;  2HJ8 A;  4F7U P;  3RZW C;  2DHK A;  2ZZP B;  2Y5B B;  1UNP A;  4A6F B;  3G9W A;  3PHW B;  2EMS A;  1TQZ A;  5LLI A;  2AWT A;  3VIA A;  4IC7 B;  2K25 A;  1X11 A;  5BO4 B;  1MK7 B;  3DDC B;  4HWI B;  4BOZ B;  5E6N A;  3PSC A;  3KYD D;  3PS6 A;  4W9C A;  3P7Z A;  3AI5 A;  3L10 B;  1I35 A;  5J3T A;  1WR6 E;  4G11 A;  1G6J A;  5LXH A;  2CQU A;  4XC2 A;  4DWF A;  5C1Z A;  5FR6 A;  5HE1 A;  4HLE A;  1BT0 A;  4A20 A;  1XKE A;  2YS3 A;  3HQC A;  3SYX A;  2DYN A;  3ZO5 B;  4PYU A;  1UPR A;  2YRY A;  4OVV A;  2KVR A;  1KM7 A;  2C9W B;  4A3O A;  2CHW A;  3L13 A;  2XBB C;  4AJY B;  3ZIM A;  1V6E A;  5G55 A;  4W9F A;  4AOF A;  4W9J A;  3IBE A;  4BBN F;  4KAX B;  4MH0 E;  4MSM B;  2GCJ A;  2KDE B;  1M7R A;  4IFS A;  3JYU A;  5L83 A;  2CR5 A;  2DHJ A;  4DHJ B;  2DTC A;  1LM8 B;  2FCS A;  4Y94 A;  5L81 A;  4HDO A;  3DQV A;  2DFK A;  1WMH B;  4KV2 A;  2KHW B;  2A5U A;  4D0N B;  5CLQ B;  1KZ7 A;  3M1I B;  5D94 A;  2DKQ A;  5DHF B;  3LJ3 A;  1E8W A;  2KK8 A;  1R4N I;  4F8C B;  3PRP B;  5KQ4 A;  1JDE A;  3JVZ X;  1WGU A;  2C60 A;  1YIW A;  1W1H A;  4MY6 A;  3B0A A;  3EPY A;  2KXJ A;  4NSW A;  2ZJD A;  3SV1 A;  3DPD A;  2BYF A;  3HIZ A;  4CO7 A;  3FM8 C;  1WI0 A;  2B3A A;  1W1D A;  3PSE B;  1WJN A;  3AXC A;  3H9D A;  3BIN A;  3VTV A;  3T8M A;  4DHZ E;  5CHW A;  4ANX A;  1V61 A;  4KHB B;  1NTV A;  2FAZ A;  2C5L C;  2K39 A;  3X0W A;  1SGH A;  3D8D A;  2ASQ A;  3R7Q A;  4NPN A;  4GB9 A;  3ZVV A;  5DPS A;  1D3Z A;  4DHJ D;  4B9K A;  1FHW A;  2D2Q A;  4ANV A;  5DPR A;  1E8X A;  4N9F 4;  2N0Y A;  1K8R B;  2D3G A;  3ODO A;  4K2P A;  3VHT C;  2K6Q A;  4DX8 A;  4E71 A;  2LVQ A;  2GBK A;  3WAM A;  5LON B;  4LDT B;  4BKS D;  3DXD A;  2D9Y A;  3TL5 A;  3SU8 X;  4K7U A;  3QWZ B;  4FJY A;  2PJH A;  2R09 A;  5JLJ B;  4WJN A;  1DRO A;  1K5D B;  2R2O A;  1RJ2 A;  3F5R A;  4X57 B;  1J19 A;  1QC6 A;  3ULB A;  3SDL C;  2IO3 B;  3DVN U;  4HJK A;  3UQB A;  3KUD B;  4KZ0 A;  4EZL A;  2JRH A;  1M94 A;  5G2N A;  5D3W A;  2JWZ A;  3M62 B;  2COF A;  4KVG B;  4JK7 A;  3UZT A;  1XOD A;  1UGM A;  1WGG A;  1Z2M A;  2D11 A;  4C0A A;  2FCQ A;  1HB6 A;  2ELA A;  3VTU A;  4GN1 A;  2LG1 A;  2IO1 B;  5DPT A;  2QKL A;  3QQ8 B;  2GOW A;  1QQG A;  2K1F A;  1P98 A;  5C5B A;  1ZVR A;  1DDM A;  4PS3 A;  2RQ1 A;  3R66 C;  2FJ9 A;  1VCB A;  2MQJ A;  2VSZ A;  4KIK B;  2IYB A;  4IWP A;  2CKH B;  2L0F A;  1RFA A;  2C7H A;  4FJV B;  2RNR B;  1MG8 A;  2BWF A;  3WAL A;  2DZI A;  3N3K B;  3FLV A;  3MJW A;  1IYF A;  1U27 A;  1PQS A;  1BWN A;  2COC A;  3R3M A;  4IOY X;  3ZW3 A;  3A4R A;  1IRS A;  3FP5 A;  4JKE A;  4Z2N A;  1CMX B;  1WVH A;  2LOZ A;  1OTR B;  3DVG Y;  1DYN A;  2D9Z A;  4JGH B;  4W9G A;  4GDL A;  1V5U A;  1U5D A;  1HB8 A;  2XQN M;  3V61 A;  2LGX A;  5KCV A;  3QCA A;  3QAQ A;  2KC1 A;  2DX5 A;  4AP4 C;  4PYZ A;  3KSY A;  1WJ4 A;  2ZCB A;  1GNU A;  5DH9 B;  1WH3 A;  4GDK A;  2KTR B;  2GCL A;  4GZU A;  1PLS A;  1PMS A;  3PLV A;  4LJO B;  4A6K A;  2W2W A;  3JW0 X;  3BY4 B;  1LB1 A;  1WJ6 A;  1BAK A;  3SHQ A;  2LKO A;  2DAJ A;  1LW3 A;  2LOX A;  3Q3J A;  3VH4 B;  2AL6 A;  2D9X A;  2EC1 A;  2ZPY A;  2PZ1 A;  2G35 A;  2ZPN A;  2EJ8 A;  1Q5W B;  3QJZ A;  3DBS A;  3P2B A;  2LRU A;  3ECI A;  3C0R B;  2AL3 A;  4GSW A;  2MLB A;  1LQB A;  1K5G B;  1WGD A;  2RSU A;  2KD0 A;  2K8H A;  5AZH A;  1YQB A;  1S3S G;  3ZRC A;  3ZDM C;  1U2B A;  3K9P B;  2D4Q A;  3WA0 A;  1WM3 A;  2ELB A;  2E2X A;  4JKD A;  5GMV A;  1Z87 A;  3T06 A;  2VRR B;  3CF6 E;  1UNQ A;  2GMI C;  2IY1 B;  3ZVR A;  3IFW B;  3HHM A;  4PNK A;  1YX5 B;  5J3Y A;  3VFK A;  5EDS A;  4NJ7 A;  3A9K B;  3A4S C;  4JKC A;  2NBU A;  1YD8 U;  2N4F A;  1FGY A;  3DCG A;  3SNH A;  2LI5 A;  4HHV A;  2LVO A;  1TGZ B;  2MDX A;  2KJ6 A;  3KH0 A;  3ZNZ B;  3WIM A;  2G45 B;  3OJ4 B;  4ANU A;  5CX3 A;  4HB3 B;  3TFM A;  4L6E A;  1UBI A;  3V6C B;  4PQ0 A;  3AJ4 A;  3VXW A;  4RM8 A;  2LAS A;  5JHG A;  3E66 A;  4JLC A;  2NPT A;  1T0Y A;  2ABD A;  3UIO B;  3QIJ A;  1X1M A;  2KC2 A;  2MP2 B;  5L95 C;  2L1C A;  4LJP B;  1ZGU B;  4JKB A;  2O2V A;  3N30 A;  1UEF A;  3DOW A;  1KLV A;  4I6L B;  3A9K A;  2KDI A;  1FHO A;  2WDT B;  1GG3 A;  4HVB A;  5DPW A;  3V62 A;  4IG7 B;  2W9N A;  2KNB A;  1U5F A;  2M8S A;  1FAO A;  3EHV A;  1S1Q B;  3ML4 A;  3T9L A;  2WWZ A;  3P6A A;  3H7S A;  4XZ4 A;  4EOY A;  3MDB C;  2DZJ A;  3RD2 A;  1FOE A;  2YS5 A;  2N1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...