2ZPYA

Crystal structure of the mouse radxin ferm domain complexed with the mouse cd44 cytoplasmic peptide
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
295
structure length
295
Chain Sequence
KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Radixin
publication title Structural basis for CD44 recognition by ERM proteins
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 87
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
A PF09380 FERM_C FERM C-terminal PH-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2zpyA02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2zpyA03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2zpyA01
3W1YA 3ODWA 5CHWA 1T0YA 2ZZPB 2UVMA 3GYOA 3PVWA 1OQNA 1WM3A 3V5WA 1Y5OA 4WJPA 2BYFA 3CIKA 4GGQA 4MSQB 3NOBA 3V62A 4MGZE 3T8MA 2LD9A 4E74A 4KHBB 5C16A 2ELAA 2OQBA 1P1AA 3FM8C 1I2HA 2LBBA 2KKCA 4D0NB 3SYXA 3QWMA 3APDA 1MAIA 1QZEA 1V6EA 3SV1A 4EZJA 1DBHA 4LDTB 3JW0X 3ECIA 1DROA 3A4RA 4DDGD 4ASWC 3ZNGC 2JP2A 1E90A 4KVGB 4NSWA 2FIFA 3BJIA 1WE6A 4GB9A 3P6AA 3H7PA 3PRMB 4MGKE 1X1GA 3B0AA 1WF9A 2KX0A 2MFQA 4IWOA 2ZNVC 3ULCA 1FHOA 2MBBB 2G4SA 3GZNI 2YS1A 4OVUA 3VXWA 1MIXA 4FHKA 1DDVA 3IBEA 1R4NI 4EFOA 3DCGA 3WANA 2JY6A 1U5FA 1J0GA 4G11A 3WYFB 4AOFA 1RAXA 5DPTA 1SIFA 2C5LC 1EO6A 4YL8A 3WAOA 4FJZA 4GMXB 2CR5A 1WJ6A 3PGEA 3IG3A 4PQ0A 2DYNA 1GNUA 2M14A 2NVUI 3N3KB 4GU2A 3ZLZA 2LYDA 2J0KA 3D8EA 2D10A 4F1SA 4HXDA 3L54A 3PS6A 5D27A 2KX3A 2MKRA 2OJRA 4ZRKA 2N23A 5E6NA 4FLHA 4EEWA 1C1YB 4EZLA 2XBBC 1XR0B 3PPAA 2K1FA 2RD0A 2LGDA 3I3TB 1TBEA 2L2IA 3MDBC 2BKRB 3DBHI 1E8YA 5DHFB 4JGHB 3NZUA 2KMCA 3PLUA 3ZNID 2K2JA 3F5RA 2MP2A 2LASA 4B6HA 1WMHA 2K25A 1TXDA 1X1MA 2JUOA 4N9F4 2DZIA 1TTNA 2BWFA 1OEYJ 2CQUA 1FHXA 2LOZA 2KD0A 2FCQA 3PT2B 1XD3B 5LOPB 2FJLA 4DWFA 2N9PC 3A9KB 1NTIA 3PV1A 3VDZA 1KLVA 2COCA 3KSYA 1UBIA 4M8NA 3ZDMC 3UQAA 2I1KA 2NCNA 1AQCA 3O96A 4KV2A 4ZRIA 2HJ8A 4HDOA 2HD5B 2L76A 2GS0A 2KK8A 2KTRB 2IO3B 5DPWA 3AU5A 4PNKA 5L83A 3EHVA 4KSLC 2M4NA 3LDZE 4WJQA 2KTFA 3RULA 4CHJA 3ZNZB 4KDLB 1P6SA 2LUEA 1E8XA 1UNQA 1EGXA 2K6QA 1X05A 2KJHB 1FB8A 2RSUA 5DIFB 4EMOA 3D8DA 2G3QB 3DXEA 4WJ7A 2KJRA 3WALA 2K39A 4DX90 2D11A 2O2VB 3ZVVA 2REXA 3AJ4A 3QJZA 2NBUA 4BKSA 3DVNV 2KDBA 1NU2A 2KCJA 4JLCA 2LVPA 5GOWB 4IM3A 5BO4B 1GJZA 3DQVA 2FUHB 4DDID 2KDEB 2W9NA 3RUIB 1OY2A 2Z0EB 3EPYA 1XCGA 2GOWA 1F9JA 2M1MA 5LLIA 3S2AA 1WJMA 3JSVA 2MA9B 4CYEA 4FA6A 2KC1A 2VKIA 1UNPA 2LZ6A 2L1CA 2JXXA 4NQKE 2Z0QA 3KY9A 3A1QB 1U29A 4GDKB 1WX8A 3VAWA 2FCNA 1QQGA 2COAA 2C7MB 3RZFA 1E5WA 1BTNA 3A4SC 2MBQA 2ROZB 3HK0A 2HTHA 4MELA 2UYZB 5HE1A 1L7YA 5C1ZA 2IO1B 1FAOA 1WGYA 2W2XD 3AXCA 4HDQA 4TYZA 3LJ3A 4OVVA 2A4ZA 3PREA 2ZJDA 1ST7A 1Q0WB 1WJ4A 3ZTCA 4NAWB 2ROVA 4DHZB 1HB6A 2WWZA 3VUYA 4XWXA 2JPHA 4M8MA 5DH9B 1ISNA 4FBJB 2L0TA 3CF6E 4JQWC 5FI1A 1WFYA 3ZIMA 1ZC3B 3U7DA 4F7GA 2DX1A 4J6IA 3PG7A 3KRWA 2XK5B 1MPHA 4RMAA 1L2NA 2Y8FA 3SNHA 1ZSQA 1V81A 5J17A 2GCJA 2YT1A 4FADA 4I6LB 1WGHA 1WRDB 3Q3JA 2KDIA 2KFKB 2HE7A 1Q67A 4MH0E 1YX6B 1XKEA 2CHZA 1Z87A 2IZVB 2VRWB 3KRXA 1WVHA 3DOWA 2MLBA 2NPTA 2CY5A 2N1WA 2OTXA 1E7UA 5KCVA 1WE7A 2JZ3B 1KZ7A 4W9EA 3CSTA 4IFSA 3WIMA 2LRWA 5E6OA 3ZDTA 4NQLB 1Z5SB 2K8HA 1MIZB 3A9JA 2LJ5A 3T06A 2YVCA 5D3VA 4KSKC 2CU1A 1LW3A 1BTKA 2ELBA 2G35A 5G55A 1WI1A 2C9WB 2DX5B 4Z2NA 1RRPB 5JLJB 2KWCA 2P0HA 1OEYA 1K8RB 3QC8B 1S3SG 1KJTA 3QQ8B 1W1DA 3OJ4B 2K2UA 1SE9A 1V2YA 3HM6X 1LM8B 2LVOA 4HAWB 2NBVB 4W9DA 1Q1OA 4TQ0A 4DX8A 1WY8A 3LJUX 2KZRA 1UH6A 4XX5A 3HM3A 2UZSA 2M17A 4GN1A 3DXDA 3ZNHB 2L00B 1E8WA 2ZNVB 2MQJA 2DYBA 3QHTA 4W9KA 1OMWA 2DAFA 2FCMA 3M3JA 4KZCA 4GSWA 4IG7B 2D4QA 1V61A 3H6NA 3R7QA 3DDCB 3QWZB 4ANVA 2I5FA 4DXAB 4GZUA 3CSFA 2NMBA 1PMSA 2IYDB 3ODOA 2FJ9A 3VIAA 2YLMA 1P3QU 3MTNB 1U27A 4HWIB 4URKA 5KQ1A 2M8SA 3A8PA 3A9KA 5KQ4A 3V6EB 2DHIA 2V3SA 2LULA 4HHVA 3AU4A 4DHZE 2L3ZA 2N1VA 4WAAA 3UQBA 2IFSA 4KZ0A 3JVZX 2WDTB 4KDIC 3T9LA 2RLOA 1OQYA 1WH3A 3N32A 2LGXA 3ZW3A 1WGDA 2EMSA 3TVVA 2NBWB 2MBHA 4LCDE 4ANWA 2C7HA 4IOYX 3QIJA 1X1FA 3DXCA 3QA8A 3ULBA 4KHAA 4MJSA 2KWVB 2LG1A 3M62B 4K81A 3N7CA 3L10B 1IRSA 3K9PB 3KYCD 2B3AA 4B95A 2GCLA 1UEFA 2RGFA 1JRUA 1M94A 2ZVOA 5AZGA 2GBKA 4K7UA 5HE0A 2JF5A 3D32A 1GC7A 1XX0A 3NS8A 5J3YA 4IAPA 2LVQA 5C5BA 4X57B 3X0WA 3RD2A 2QHOA 2KQSA 1ZC4B 4IWPA 4K1RB 3KUDB 2D9ZA 2O6VA 4EJNA 1EUVB 1M7EA 2N4FA 3ML9A 1FXTB 1UZXB 2WYQA 3CMMB 4GIVA 1EF1A 4IM2A 4F7UP 2RNRB 2MWNB 2IO2B 2RPQA 1LQBA 3HW2B 2QKMA 1I42A 3SO6A 4BBNF 2KN5A 4B9KA 3PP2A 2CAYA 1WR1A 4G3XB 2L05A 1XD4A 3V61A 1V86A 5EDSA 2YRYA 4KIKA 4H8SA 3SUZA 3L17A 1P5TA 1NTVA 1DDMA 2A5UA 3NHEB 1U5EA 2MRPA 2GBRA 2R09A 2JVCA 2IYBA 1WXVA 2N9EB 3R7RA 4ICVA 2DYMA 4FHJA 3BINA 3PRZA 3VVWB 3ONSA 2WX0A 4TQ1A 4BFRA 2ASQA 2KQ7A 3OANA 3R3MA 2MBOA 4DBGA 4B6WA 3AULA 3M63B 4II3B 3BY4B 2ZPNA 3PEGA 5IA7A 2COPA 4NJ7A 1EAZA 2NS5A 4C0AA 2RR9A 1M7RA 2I5CA 3IFWB 4GPTB 1E8ZA 3VFKA 3H7PB 2AL6A 5FI0A 2UZRA 4DK5A 1YQBA 3FSSA 2GBMA 4HB0B 1LFDA 1MK7B 3DVNU 2GBJA 2ZPYA 1SGHA 1WIAA 5L81A 3JYUA 2CB8A 4EUTA 4K7WA 4A5KA 2BF8B 1WZ0A 3PHXB 2IY1B 1GC6A 4BKSD 2G45B 3RCPA 2IBIB 5IAAC 1UNRA 4HJKA 1HE8A 5J3TA 2JZZA 3MPXA 3TBLD 2DFKA 4HAVB 2FIDA 3QBVB 2KDFB 3W1SA 1UD7A 1U5DA 4FJYA 3L16A 5TR5A 5IJMA 1J19A 1AWEA 5CTRC 4GDLA 1KI1B 2DN6A 2J0JA 2OOBB 1N3HA 1RJ2A 3SD5A 2J59M 5DHAB 3TL5A 3SHQA 2KLCA 4ZYNA 3PSCA 2BYVE 2PPHA 3ZKJC 4A6FA 5DPSA 5D2MB 3VUWA 5CHVC 1W1HA 1EF5A 2DYOA 3P7ZA 1OGWA 1P98A 3RZWC 4NY0A 1OTRB 3L0WB 1K5DB 3OAWA 5KHOA 4MGIE 1SHCA 1IYFA 3DVGX 2DLWA 1WXAA 1TGZB 2IY0B 4HAYB 2IO0B 2MP2B 2FNJB 2DHKA 2L7RA 1FHWA 4II2B 1WMHB 4Z2MB 5CX3A 4EZKA 1LB1A 3VOQA 4ICUA 2J7QB 2J0MA 3APFA 5G2NA 2PE9A 4JIOU 4I6NB 1GG3A 4EOYA 1MK9B 2KLGA 1WJNA 1QC6A 4WQOB 2RSGA 2I1JA 1V88A 2KHWB 1VD2A 2XQNM 2PJHA 2PZ1A 3NZSA 3HIZA 4W9IA 2GMIC 3ZUNA 5JHGA 1YIWA 3QARA 4NNJB 4WWPA 2D9VA 3GYPA 4RM8A 1X86A 2PE6B 2V76A 1V89A 4MK0A 2UWQA 3ODXA 4K17A 5HE3A 1MG8A 4W9LA 4BKTA 2C7NB 2H7EA 4DBBA 4ANUA 1WR6E 2LKOA 5JH5C 2XEWA 1TQZA 3R66C 2Y8GA 3FP5A 1UBQA 2AYOB 3A33B 4IC7B 2HRJA 2NZ8B 2KO3A 4HCNB 4HB4B 5D3XA 1HBKA 3HHMA 2KVRA 4PS8A 3QCAA 1EVHA 3TIXA 2Z0DB 2P0DA 3UIPB 2D07B 2YS5A 3ZRCA 2DZMA 4PS7A 1H8CA 5AZHA 3H7SA 4HVBA 4MM3A 4Y94A 3QAQA 2D9XA 4FULA 2KNBA 3VHTC 2EC1A 3L08A 4AWJA 3JSVB 4W9FA 2KUPA 1WYWB 1WXSA 3U8ZA 5JHBA 5DI9B 3W1SC 5D7GA 1WM2A 3PSEB 2DKQA 3WAPA 5AEKB 5LONB 4IWQA 2KWUB 5C23A 4W9GA 2HTHB 4HPLB 4F7HA 1CMXB 1U4AA 1WXMA 1VCBA 2CHWA 4KAXB 4A3OA 3SDLC 3A98B 4AJWA 1DDWA 2D3GA 4MY6A 2C60A 4TUUA 2BGFA 2ADZA 2K6DB 3TJPA 1FGZA 3EC8A 2LRUA 3C0RB 3PRPB 1I7AA 1PFJA 3DBLI 3L13A 3DVGY 1WGGA 5C79A 2W2WA 5D6JB 2MCNB 3ZO5B 2K8CA 5C6RA 5JHHA 2FAZA 2GBNA 1WZ3A 2BPSA 4CHMA 1GUAB 4CO7A 2COFA 2KTRA 2N7EA 1HB8A 2YS3A 1PLSA 2N0YA 4LJOB 1V49A 4WSFA 2YT0A 4ZDVA 2KOXA 3OLMD 4G50A 2RVBB 2D2QA 2GJYA 1Q5WB 4A3PA 1V9JA 1D3ZA 2NPTB 2YF0A 3Q3FA 1V5PA 1WGQA 4W9JA 2LXAA 4HAXB 3VUXA 4YONA 2W2XC 1RRBA 4TKNA 5CLLB 3ZVRA 2O6VD 1U5GA 3KH0A 4NPNA 1V80A 2KC2A 2DTCA 2M0XA 1WI0A 3NY5A 2P0FA 2LGYA 2O2VA 1Z2MA 2D9YA 2Z59B 3WAMA 1G6JA 4A20A 3A9JB 3DBRI 3WA0A 4HPMB 1YX5B 5DPRA 1PQSA 3GOEA 4CHKA 2WX1A 1TJ6A 5FR6A 4DHJD 1FOEA 4WWOA 1BT0A 3VH3B 3IHPC 4BVUC 3A8QA 1I35A 2FDQA 2KMAA 2E2XA 4MGYE 3PZDA 3DBSA 4PYZA 1MKEA 4AJYB 2N7DA 4MDKE 3P2BA 2ABDA 5J2RA 3AI5A 3CXBB 2DZKA 4AUQC 3RYTA 3UF8A 2CS4A 1NTYA 2ZCCA 3PVLA 3ML4A 3TW1A 5CLQB 1R4MI 2JRIB 1U2BA 4WJOA 4A6HA 4W9CA 2Z0OA 5AZFA 2FCSA 2RUKB 3ALBA 2EMTA 1DYNA 2K00A 2JWZA 4JL9A 1UGMA 3A1QA 1YD8U 3VQIA 4GDKA 3PVUA 3KVFB 2VSZA 1NBFC 2DHJA 4HB2B 1BAKA 4FN2A 1H4RA 4BBNC 2LWPA 2CY4A 4HLEA 1Y8RC 3VTVA 5KHQA 3H9DA 5LXHA 2LXCA 2R2OA 3B08A 4NAWA 1KZGA 3TFMA 2MBEA 4LJPB 1P0RA 4ZRJA 1XQQA 1KM7A 3QX1A 5LXIB 2CKHB 2AEHA 3UINB 4MSMB 2V1YA 3V6CB 4HATB 1WX9A 4WJNA 3RCZA 4GMVA 5L95C 4ANXA 1NDDA 2KANA 3KZ1A 2XK5A 3TCAA 2Q13A 2CODA 2Y7BA 1J8CA 2DHZA 2EKEC 2KXJA 2DENB 4E3CA 3MHSD 1NI2A 5JZEB 4MJSB 2D9WA 3SU8X 1V5MA 3PHWB 2KFKA 1ZKHA 4F8CB 5EFXA 1H10A 3N30A 1E7VA 1BWNA 4AP4C 1LXDA 2LOXA 1V5UA 3V60A 2VRRB 2H7DA 3H1UA 1RLFA 4MT7A 5J18A 2CHXA 2R0DA 3FEHA 4P7IA 5C5BB 1ACAA 1A5RA 2DAJA 3KUCB 3UIOB 2ZCBA 4FJVB 4TV3A 2O6VB 1WX7A 2BWES 1UELA 4HK2A 4BOZB 1J0WA 4K2OA 1V5TA 3VTUA 2ZVNA 1K5GB 3PTFC 1S1QB 2BYEA 4PS3A 3M1IB 1TZ1A 2Y5BB 3APCA 4DHJB 2KGXB 2G4DB 2DX5A 2Z0PA 3NSUA 4KIKB 4IM0A 1WGRA 4L6EA 1IPGA 4WWNA 1XODA 4K7SA 1ZGUB 3EFUA 5D94A 3RT3B 3KW5B 1RFAA 4G0NB 4I6PA 4M0WB 3VTWA 4HAZB 3TO1A 5CHFA 2L0FA 2V4LA 1B55A 4E71A 2WH5A 4GOCA 4IUMB 4HB3B 3OJ3A 2L8JA 1ZM0A 2BKFA 5DCNA 4XC2A 2DYQA 4EKUA 4BBKA 3M95A 4HCPB 4XZ4A 3PLVA 1UPRA 5D3YA 1C3TA 1UPQA 3ZRFA 1W1GA 2KFJA 3B1LX 1ZVRA 1ZW7A 2EJ8A 4LDTD 5E6PA 1AARA 2DA0A 1XT9B 3EECA 1FGYA 2MSED 2JT4B 4BOSC 4K2PA 3G9WA 2R2QA 2JRHA 2MWSB 1Y19B 5GMVA 3UZTA 1P9DU 5HE2A 3IVFA 2M38A 3MJWA 3QK0A 4W9HA 1V5OA 1YJ1A 1WJ1A 4A6KA 3O65B 5JHAA 5JP4A 2BCJA 4IW0A 5J3QA 2CRFA 3F0WA 3TMPB 4PYUA 2NR2A 5D3WA 4BKGA 4RM9A 4GXBA 2K8BA 1WGUA 3ML8A 3ENEA 4MEMA 3FLVA 2X18A 3K9OB 2QKLA 2RGNB 4GDLB 2MDXA 2YSZA 3HQCA 2AL3A 2DKPA 1KOTA 4KHOA 1IP9A 2KJ6A 3KUZA 3UGBB 4NJ6A 3KYDD 4A6FB 3VH4B 1P3RA 1WJUA 4WVFB 3X23A 3D8FA 2MX2A 4F7ZA 2DZJA 2P8VA 2LI5A 2RQ1A 2N9XA 5HKHA 3U30A 2AWTA 3ZTDA 1NVLA 4HAUB 2ZEQA 2MW5A 1WG7A 1X11A 2PEAA 3DPDA
chains in the Genus database with same CATH superfamily
3W1YA 3BYYB 3ODWA 5CHWA 1T0YA 2ZZPB 2UVMA 1C4PA 2ACZB 3GYOA 3PVWA 4DQOC 1BUIC 1OQNA 1PFDA 1WM3A 3V5WA 1Y5OA 4WJPA 2BYFA 3KWLA 3CIKA 3BYTB 4A9AA 2QCZA 2KQ4X 4YSXB 4GGQA 3RFZB 2ZW1A 4MSQB 2MH7A 4LLGM 3LYYA 3NOBA 3V62A 4MGZE 3T8MA 3NVVA 1I4GA 2LD9A 4E74A 1AW7A 4KHBB 5C16A 1KLGD 2ELAA 4LNFA 2FJUB 3KLSX 2LMCA 2R82A 3HVDA 2OQBA 2FE8A 1OQRA 1P1AA 4Q2JA 4QJ4B 3FM8C 4A55A 1I2HA 2BB6A 1GB4A 3O13A 2LBBA 2KKCA 4D0NB 3DWGC 1SXTA 1FEHA 1TKGA 3SYXA 3QWMA 3APDA 4P6VF 1MAIA 1QZEA 1V6EA 1YJJA 3SV1A 4EZJA 1DBHA 4NAMA 4LDTB 3JW0X 3ECIA 1DROA 2W54A 3A4RA 1E0ZA 4DDGD 2D3AA 4ASWC 3ZNGC 2JP2A 1E90A 4KVGB 4NSWA 2FIFA 4PK1A 3BJIA 1WE6A 4GB9A 3E9SA 3P6AA 3H7PA 3PRMB 4MGKE 1N5WA 1X1GA 1XCQL 3B0AA 1WF9A 2KX0A 1MI1A 3AM9A 2MFQA 4IWOA 2ZNVC 3ULCA 1FHOA 2MBBB 2G4SA 3GZNI 2YS1A 4OVUA 3U7ZA 3VXWA 1MIXA 4FHKA 1DDVA 4USAA 3GE8C 1L0YB 3IBEA 1R4NI 4EFOA 1TYGB 3DCGA 1T0QC 2E3TA 2Z4DA 3WANA 2JY6A 1U5FA 1J0GA 4G11A 1RWSA 3WYFB 4J3OD 4AOFA 1RAXA 5DPTA 1SIFA 1JWSD 1ROEA 2C5LC 1EO6A 1T77A 1RM6C 5I2SA 1NYRA 2H89B 4YL8A 2LGSA 1EU4A 3WAOA 4FJZA 4GMXB 2KN4A 2CR5A 4MM3B 1WJ6A 3PGEA 3IG3A 4OW0A 3OHMB 4PQ0A 3EUB2 4TSSA 2DYNA 1GNUA 1ENFA 2M14A 2NVUI 4PT5A 3N3KB 4GU2A 3ZLZA 2LYDA 2J0KA 4ZRPA 3D8EA 1VBGA 4ITKA 2D10A 4F1SA 4HXDA 3L54A 1HZ6A 3PS6A 4RFBA 5D27A 1YMHE 2KX3A 2MKRA 2OJRA 4ZRKA 2N23A 5E6NA 3RNEC 1XEEA 4FLHA 4EEWA 2VZKD 1C1YB 4LK0M 4EZLA 4QJ3B 2XBBC 1FNVA 1XR0B 3A58A 3B9JA 4MT5A 1SE2A 3PPAA 2K1FA 2RD0A 4XGAB 2D3BA 2K22A 2LGDA 3I3TB 2Q5WD 3Q6BA 3Q8AA 1TBEA 2L2IA 3MDBC 2BKRB 3DBHI 1E8YA 4RF1A 1V1PA 5DHFB 4JGHB 3NZUA 2KMCA 2YEPF 3PLUA 3ZNID 2K2JA 2WXIA 3F5RA 2MP2A 2LASA 1FFUA 3TEWA 5JVLA 4B6HA 1ZYIA 1WMHA 2K25A 2QC8A 4JKAA 1C78A 3ABVB 4JWSC 2CJOA 1TXDA 1X1MA 2JUOA 4N9F4 1HZ5A 2NMQA 2DZIA 1TTNA 2BWFA 1OEYJ 4S17A 1UWXA 2CQUA 1JMLA 1SJHD 1FHXA 2LOZA 2KD0A 2FCQA 3I9V1 3PT2B 1XD3B 2Z13A 3UI3A 5LOPB 3AEFB 5HG2A 3NVZA 2FJLA 4DWFA 2N9PC 3MC8A 2LFIA 3A9KB 1NTIA 3AE7B 3PV1A 3VDZA 1KLVA 3MC9A 2COCA 1FRRA 2SEBD 4JX1C 4MACA 3KSYA 4M01A 1UBIA 4M8NA 3ZDMC 3UQAA 2I1KA 2NCNA 3IT4B 1AQCA 3O96A 3EGRA 4ZYSA 4KV2A 3E9PA 2R61A 4ZRIA 2HJ8A 4HDOA 2HD5B 2L76A 2GS0A 2KK8A 2KTRB 1XXGA 2IO3B 4C4VA 5DPWA 2PLPA 3AU5A 4PNKA 3FC4A 5L83A 3EHVA 1FO4A 4KSLC 3FILA 2M4NA 3P4RB 3LDZE 2MJ3A 4WJQA 1PGBA 2KTFA 3RULA 4CHJA 3ZNZB 4KDLB 1I4PA 1P6SA 2LUEA 4M00A 1E8XA 1UNQA 1EGXA 2AQ3B 2K6QA 1X05A 2H88B 2KJHB 1FB8A 2R2YA 2RSUA 2VH2A 4BZAA 5DIFB 4EMOA 3D8DA 2G3QB 3DXEA 4WJ7A 2KJRA 4N58A 3WALA 2K39A 2WDVB 4ARIA 5AUIA 1KF6B 1P7EA 4QJ5B 3Q3NC 4DX90 2D11A 2O2VB 3ZVVA 2REXA 3AJ4A 3QJZA 2NBUA 4BKSA 2WXKA 5E6JA 4OT1A 3DVNV 2KDBA 1RYJA 3AE6B 1NU2A 2KCJA 1T5XD 4JLCA 1VBHA 2LVPA 5GOWB 4IM3A 5BO4B 1GJZA 2K8EA 4RF0A 2WP9B 3DQVA 2FUHB 4DDID 1NVID 2KDEB 4AS1A 2W9NA 3RUIB 2W82A 1OY2A 3RI7C 2Z0EB 4NJCA 3EPYA 1XCGA 3GP7A 2GOWA 3N1XC 1F9JA 2AQ1B 1WSPA 2M1MA 5LLIA 1N60A 3URYA 3MHZA 3S2AA 2INPE 1WJMA 3JSVA 2MA9B 3ZXVA 4CYEA 4ZHPA 4FA6A 3KQ4A 2VZKB 4L2YA 2KC1A 1N61A 2VKIA 1UNPA 1JRPA 2LZ6A 2L1CA 2KIEA 2JXXA 4NQKE 4HSIA 2Z0QA 3KY9A 3A1QB 1U29A 1RFKA 4GDKB 1WX8A 3VAWA 4CSQA 2FCNA 1QQGA 3OG5A 2COAA 2C7MB 1R7SA 3RZFA 1E5WA 1BTNA 3A4SC 3N9YC 2MBQA 2ROZB 3HK0A 2HTHA 4MELA 2UYZB 1IBXB 5HE1A 2V4IB 1GPXA 1L7YA 3LB8C 2IO1B 1FAOA 5C1ZA 2FUG1 5IRSA 1WGYA 1J7AA 1QOFA 3MFGA 5D3DA 2W2XD 3AXCA 4HDQA 4EE2A 1WXQA 4TYZA 1TKYA 3LJ3A 4OVVA 2A4ZA 1I4RA 3PREA 5EE9A 2ZJDA 1ST7A 1Q0WB 1WJ4A 2Z8LA 3ZTCA 3KWVA 4NAWB 3E66A 2ROVA 1HB6A 4DHZB 3BVZA 3NVWA 2WWZA 3NWDA 3NWFA 3VUYA 4XWXA 2JPHA 3IT6B 3ZXRA 1TS2A 4M8MA 2BBCA 4C00A 5DH9B 3R2TA 1ISNA 1NENB 4FBJB 2L0TA 3CF6E 3BZDB 4JQWC 5FI1A 1WFYA 3ZIMA 2BB5A 1ZC3B 3U7DA 4F7GA 2EELA 2DX1A 1D5ZC 4US8A 4J6IA 3PG7A 4REZA 3KRWA 2XK5B 5FR3A 4IKGA 1MPHA 4RMAA 4HKZE 1L2NA 3NJTA 1GGOA 2Y8FA 3SNHA 3I57A 1ZSQA 1V81A 5J17A 2GCJA 2YT1A 4FADA 4I6LB 1UWMA 1WGHA 1WRDB 5BYSA 3Q3JA 2KDIA 2KFKB 2HE7A 1Q67A 2L1AA 4MH0E 1VZ7A 3FVCA 1KTKA 4L23A 1YX6B 4ARCA 1XKEA 2CHZA 1Z87A 2IZVB 2VRWB 3KRXA 1WVHA 2DIKA 3DOWA 2LHDA 2BVCA 2MLBA 4CQNA 1WYGA 2NPTA 2CY5A 3AEEB 2N1WA 3U52E 2OTXA 1E7UA 5KCVA 1YN4A 5IKCM 3ZJTA 1WE7A 2RMMA 1MG4A 2JZ3B 1KZ7A 4W9EA 1Q10A 5HHDG 3CSTA 2WS3B 4IFSA 2BT6A 3WIMA 2W55A 1TS5A 2LRWA 5E6OA 3AEBB 4C7YA 1FD6A 3ZDTA 4NQLB 1Z5SB 1I4QA 2K8HA 2WXPA 1MIZB 2Z59A 3A9JA 1KBLA 2LJ5A 3T06A 1PDXA 2YVCA 1PGXA 5D3VA 3U12A 1JWBD 4KSKC 4N6EB 2CU1A 1LW3A 1BTKA 2ON8A 2ELBA 4WQMA 2G35A 5G55A 1WI1A 5I4DA 2C9WB 3HVZA 2DX5B 4Z2NA 1RRPB 5JLJB 1TIFA 2WQYB 2KWCA 2P0HA 1OEYA 1K8RB 3QC8B 3SR6A 1S3SG 3TSSA 1I7HA 3AEAB 3ZYYX 2HDEA 1KJTA 4BAXA 3QQ8B 1W1DA 3OJ4B 2K2UA 1SE9A 1V2YA 3HM6X 2GB1A 1LM8B 2LVOA 4HAWB 1MFWA 2NBVB 4W9DA 1TJEA 1Q1OA 4TQ0A 4DX8A 1WY8A 3LJUX 2PTLA 3AEDB 1JDEA 2K9XA 2LEKA 2KIGA 3NG0A 1TKEA 2KZRA 1UH6A 1ZXHA 4XX5A 5AUKA 3LXFA 3SBTA 2L52A 3AH7A 2WXLA 2Y5CA 3HM3A 1VR9A 2UZSA 2M17A 4GN1A 3N20C 3DXDA 1N62A 3W2DA 3ZNHB 2L00B 1E8WA 2ZNVB 2MQJA 2DYBA 3QHTA 4W9KA 1OMWA 2DAFA 2FCMA 3W9CB 3M3JA 4KZCA 2HTME 1C4AA 2PMVA 4GSWA 4IG7B 2D4QA 1V61A 2WU5B 3H6NA 4XYCA 3R7QA 2FBWB 3DDCB 3QWZB 4ANVA 2I5FA 2EKIA 1XLPA 4DXAB 4P16A 4GZUA 3AE5B 3CSFA 2NMBA 1PMSA 1YN3A 3V05A 2PIAA 2IYDB 3ODOA 2FJ9A 3WCQA 3NVYA 3VIAA 2YLMA 1UGJA 1P3QU 3EA6A 2RDBC 3MTNB 1U27A 4OSNA 4HWIB 4KGSA 4URKA 1C9FA 1DGJA 5KQ1A 2M8SA 3A8PA 3HRDD 4YWGG 3A9KA 5KQ4A 2K3UA 2DHIA 2V3SA 3V6EB 2LULA 4XWTA 2KUQA 4HHVA 3AU4A 1QT9A 2L3ZA 2N1VA 4DHZE 4JKFA 2MJEA 4WAAA 3UQBA 2IFSA 4KZ0A 1JWMD 2JU6X 3JVZX 2WDTB 4P1BC 4KDIC 1XLQA 3T9LA 2RLOA 1OQYA 3P4SB 1WH3A 1F2RC 1XF5L 1MI0A 3N32A 2LGXA 3ZW3A 1WGDA 2BS4B 2EMSA 3TVVA 5IO9A 2NBWB 4MH8A 2MBHA 3GE3C 4LCDE 4ANWA 1QOBA 5MPOA 2C7HA 1ZOYB 1C77A 4IOYX 3QIJA 3RMKC 1X1FA 3IAM1 3DXCA 2WXFA 3QA8A 1N6ZA 4HPPA 1EWYC 3ULBA 2IGGA 4KHAA 4MJSA 1VLBA 2KWVB 2LG1A 3M62B 4K81A 3N7CA 1ET9A 3L10B 1IRSA 3K9PB 3KYCD 3RNBC 3U2SC 2N9LA 2ONQA 2B3AA 4M02A 2WXQA 4B95A 2GCLA 1UEFA 2RGFA 1CK1A 4LNKA 1JRUA 4RGOS 1M94A 2V3PA 2ZVOA 5AZGA 2GBKA 1HTOA 3R2IA 4K7UA 5HE0A 1FFVA 2JF5A 4JKCA 3D32A 1GC7A 4JKGA 1XX0A 3NS8A 5J3YA 4IAPA 2LVQA 1FM0D 5C5BA 5C2TB 4X57B 3X0WA 2E6XA 3RD2A 2QHOA 2KQSA 1ZC4B 4IWPA 4KKIA 4K1RB 2QILA 3KUDB 2D9ZA 2O6VA 1J7BA 4EJNA 1V97A 1EUVB 5BYQA 1M7EA 2MHJA 2N4FA 3ML9A 1FXTB 5LNK1 1UZXB 2WYQA 2JSVX 3CMMB 4GIVA 1EF1A 4IM2A 2JXTA 4HEA1 2M0AA 4F7UP 5HI1A 3GB1A 1F77A 4JK9A 1UNSA 2RNRB 2MWNB 2IO2B 2RPQA 1LQBA 2WXMA 3HW2B 2QKMA 1L4ZB 1DOYA 1HQRD 3DHIC 1I42A 3SO6A 4BBNF 2KN5A 4RCOA 4B9KA 3PP2A 2CAYA 1WR1A 4G3XB 2L05A 1XD4A 3V61A 1V86A 2WU2B 3Q2AC 5EDSA 1MJDA 3N1YC 1GOZA 1AN8A 2YRYA 4KIKA 4H8SA 3SUZA 2WGSA 1TZOA 1TS4A 3L17A 1P5TA 1NTVA 1DDMA 2A5UA 3NHEB 2G1EA 1U5EA 1A70A 2MRPA 3TEYA 1SF0A 4LNIA 1E9MA 2MEKA 1OQQA 2GBRA 5IN7A 4M0WA 1UUPA 5FKAC 3DBLB 2R09A 2JVCA 2IYBA 1BXTA 1WXVA 2N9EB 3R7RA 3T3OA 4ICVA 2DYMA 4TMAB 4FHJA 2L32A 3Q3OC 3BINA 4JK7A 3PRZA 3VVWB 3ONSA 2WX0A 2PVOD 4TQ1A 4BFRA 2ASQA 2KQ7A 3OANA 3R3MA 4DXGA 2MBOA 4DBGA 4B6WA 3AULA 3M63B 2RPVA 4II3B 1XLNA 3BY4B 2ZPNA 3PEGA 5IA7A 2COPA 4NJ7A 1C76A 2WXJA 1EAZA 1ZDVA 2NS5A 4C0AA 1LGRA 2RR9A 1QOGA 5H8YE 1M7RA 2I5CA 3IFWB 4GPTB 1E8ZA 1FXAA 3VFKA 1F52A 3H7PB 2AL6A 1V1OA 5FI0A 2UZRA 1DOIA 4DK5A 3FKYA 1YQBA 3FSSA 4JKDA 2GBMA 4HB0B 1LFDA 1MK7B 3DVNU 2GBJA 2ZPYA 1SGHA 1WIAA 2W3RA 5L81A 3JYUA 2CB8A 1T6BX 3V3XA 1L0XB 4EUTA 1KRHA 2INCC 4K7WA 4A5KA 2G9HD 2BF8B 5EE1A 1WZ0A 3P63A 3Q8BA 3PHXB 2IY1B 1GC6A 4BKSD 3DBRB 4C7ZA 2G45B 3RCPA 2IBIB 5IAAC 1UNRA 4HJKA 1HE8A 5J3TA 2JZZA 3MPXA 3TBLD 2DFKA 4HAVB 2FIDA 3R8BA 1FXIA 3QBVB 2KDFB 3W1SA 1UD7A 3E9LA 1U5DA 4FJYA 3L16A 5TR5A 5IJMA 3VR9B 4YTNB 4HKQA 1J19A 1AWEA 5CTRC 3AMZA 4GDLA 1KI1B 2DN6A 1L4DB 3N1ZC 4QAYA 2J0JA 4ACFA 2OOBB 4RH6A 1N3HA 1RJ2A 3SD5A 2J59M 5DHAB 3TL5A 3SHQA 2KLCA 4ZYNA 3PSCA 2BYVE 3Q8FA 2PPHA 4FXCA 3ZKJC 4A6FA 5DPSA 5D2MB 3VUWA 5CHVC 1R4MB 1W1HA 1EF5A 2DYOA 2WDQB 2LUMA 1JQ4A 3P7ZA 1OGWA 2WXGA 1P98A 3RZWC 5LG4B 2QEJC 4RGMA 1SJED 4NY0A 3AN1A 1OTRB 3L0WB 1K5DB 3OAWA 1XCTL 5KHOA 1D4BA 4MGIE 1SHCA 2X0SA 1V1PB 5IP4D 1IYFA 5TSSA 3DVGX 2DLWA 1QKZA 1WXAA 2N9KA 1XLOA 1TGZB 2IY0B 2J42A 4OZAA 4HAYB 4ZHOA 2IO0B 4ILHA 2MP2B 3RN9C 2FNJB 2DHKA 2L7RA 4JKEA 1FHWA 4II2B 1WMHB 4Z2MB 2CJNA 5CX3A 4EZKA 1LB1A 3VOQA 1TY2A 2INNE 4ICUA 2J7QB 2J0MA 3APFA 1PYWD 1KH0A 4JWUC 5G2NA 2PE9A 4JIOU 4I6NB 1GG3A 1QF6A 5I2MA 1OFFA 4EOYA 1N5XA 3AB5A 1MK9B 2KLGA 1WJNA 1QC6A 4KHBA 2DWQA 1EM7A 2IPKD 4WQOB 2RSGA 2BS3B 2I1JA 4LNNA 1V88A 4S0RA 2N7JA 2KHWB 1VD2A 1JCKB 2XQNM 2PJHA 2PZ1A 3HUIA 3NZSA 3HIZA 4W9IA 4K3BA 2GMIC 3TUOA 3ZUNA 5JHGA 2TSSA 4DIXA 1YIWA 3QARA 1YJIA 4NNJB 2VH1A 3P42A 5BYRA 3IAS1 4WWPA 3NWAA 4XDCA 2D9VA 2B76B 3GYPA 4C4VB 4RM8A 1E6EB 1X86A 4YTMB 3E56A 2PE6B 2V76A 1SSNA 1K51A 1V89A 4MK0A 2UWQA 3FILB 3ODXA 4K17A 5HE3A 1MG8A 4W9LA 3W5VB 1ZDXA 2MJDA 5EE0A 2JZPA 3AE8B 4BKTA 2C7NB 2H7EA 4DBBA 1JWUD 4ANUA 1T0RC 3SBGA 1WR6E 2LKOA 5JH5C 5BMGA 2XEWA 1YNTE 1K52A 1TQZA 3Q69A 3R66C 2Y8GA 2QMTA 4IDIA 3FP5A 1UBQA 2AYOB 3A33B 4IC7B 2HRJA 4B0MA 4UDUC 1UF0A 4R3DA 2NZ8B 2KO3A 4HCNB 4HB4B 5D3XA 1MVKA 4LTUA 2XN9C 1HBKA 2IDYA 3HHMA 4XE0A 2KVRA 4PS8A 2QJLA 3QCAA 3TEZA 3PZ8A 1EVHA 3TIXA 2Z0DB 1EU3A 1D5MC 2P0DA 1VZ6A 2D07B 2YS5A 3UIPB 3ZRCA 3ZJVA 2DZMA 4PS7A 1H8CA 4OZCA 2ICIA 4QXAB 5AZHA 3H7SA 4HVBA 4MM3A 1JROA 1SBBB 4Y94A 1WWTA 2K49A 3B2FA 4YSZB 3QAQA 2D9XA 4FULA 2KNBA 1FCLA 3MC0B 3VHTC 2EC1A 3L08A 4AWJA 3JSVB 4W9FA 2V0GA 2KUPA 1WYWB 1WXSA 4IOIE 3TEXA 2BW2A 3U8ZA 3I63C 5JHBA 3ZGZA 5DI9B 1YQ4B 3W1SC 4WAFA 5D7GA 5GXGB 1P7FA 1WM2A 3PSEB 4JE3B 3T3NA 4WWMA 2DKQA 3WAPA 5AEKB 5LONB 2BTEA 2IGHA 4N59A 3AE4B 1PGAA 3P4PB 1IGDA 3E9OA 4IWQA 2KWUB 5C23A 4W9GA 2HTHB 3DCXA 4HPLB 4F7HA 1CMXB 4JKHA 1U4AA 1VCBA 1WXMA 2YT2A 2CHWA 4KAXB 2GRIA 4A3OA 3SDLC 2Z14A 1B9RA 4ILJA 4AQ7A 3A98B 1FRDA 1WGKA 4AJWA 1DDWA 1LO5D 2D3GA 4XDDA 4MY6A 2C60A 4TUUA 2KAJA 4US9A 3P1MA 2BGFA 3NRZA 2ADZA 2K6DB 3TJPA 1FGZA 3EC8A 2WXOA 4YTPB 2LRUA 3C0RB 3PRPB 1I7AA 1PFJA 3DBLI 3L13A 1MHXA 3DVGY 1WGGA 5C79A 2W2WA 2N0SB 5D6JB 2X38A 1K50A 2MCNB 3ZO5B 2K8CA 3H8HA 5C6RA 5JHHA 2FAZA 3W5UB 1SEBD 2GBNA 1WZ3A 2BPSA 4CHMA 5HFYA 4OHJA 4OVZA 4WURA 1I4XA 3NZ3A 2K0PA 1DOXA 1GUAB 1QQRA 4CO7A 2COFA 2UU7A 4D2KA 2KTRA 2M19A 1ACCA 2N7EA 1HB8A 2YS3A 3FAHA 1PLSA 2PVGC 2N0YA 4LJOB 4OZBA 1V49A 4WSFA 2YT0A 4ZDVA 1Y56A 2KOXA 1ZUD2 3OLMD 2RVBB 1FIQA 4G50A 2D2QA 2BQQA 1GB1A 2GJYA 1Q5WB 4A3PA 1V9JA 2SAKA 1D3ZA 2NPTB 1K53A 2YF0A 3MP9A 4KKJA 3Q3FA 1V5PA 1WGQA 4W9JA 2LXAA 4DXFA 4HAXB 4YONA 3VUXA 2I38A 2W2XC 2J53A 1RRBA 1EWCA 4TKNA 3AE3B 5CLLB 3ZVRA 2JX5A 2O6VD 4KGTA 1U5GA 2NTSA 3KH0A 4NPNA 4YT0B 1HA5A 1V80A 3ETRA 2KC2A 2DTCA 2M0XA 2GUMA 1WI0A 3NY5A 2P0FA 2LGYA 1E10A 2O2VA 1Z2MA 2D9YA 1ZE3D 2Z59B 3WAMA 1G6JA 4A20A 3A9JB 4D6WA 3DBRI 3WA0A 4HPMB 1YX5B 5DPRA 3DHHC 1PQSA 3GOEA 4CHKA 3VR8B 2IJ0A 2WX1A 2WLBA 1TJ6A 5FR6A 4DHJD 1FOEA 4WWOA 1SE3A 1BT0A 1YN5A 3IHPC 3VH3B 3C19A 4BVUC 3A8QA 2DNFA 2HJ1A 3IXSA 3Q14C 1I35A 2KT7A 2FDQA 4JK8A 1ESFA 2KMAA 2OEDA 2E2XA 4MGYE 3PZDA 3DBSA 1WRIA 1QLBB 4PYZA 1MKEA 4GOUA 1C4CA 4AJYB 5T8IA 2N7DA 4MDKE 1KC7A 3P2BA 4YSYB 2ABDA 4XWWA 5J2RA 3CWIA 1SIJA 2GLSA 3AI5A 2YEPB 3CXBB 1T3QA 3VRBB 2DZKA 4AUQC 3RYTA 2JWUA 3UF8A 2CS4A 1NTYA 2WDRB 3RPFC 2ZCCA 2J4XA 3PVLA 5BMIA 2AX5A 3ML4A 3TW1A 5CLQB 1FMAD 1R4MI 2DBYA 3Q3MC 2JRIB 4KGRA 1BMLC 1U2BA 4WJOA 4A6HA 4W9CA 2Z0OA 5AZFA 3DHGC 2FCSA 2RUKB 1QILA 3ALBA 3BWUD 3SFEB 2EMTA 1DYNA 2K00A 2JYEA 2JWZA 4JL9A 1UGMA 3A1QA 1YD8U 3VQIA 4H2AA 1ET6A 4GDKA 3PVUA 3KVFB 3NUHB 2VSZA 1NBFC 2Y5PA 3BVGA 5FK9C 2DHJA 4HB2B 1BAKA 4K3CA 1IBXA 1F0ZA 2QSDA 4FN2A 1H4RA 2WXHA 4BBNC 1VDVA 4ZRQA 2LWPA 2CY4A 4GLSC 4HLEA 1FPYA 2LGIA 2AQ2B 1Y8RC 1DYQA 3VTVA 5KHQA 1F1HA 3BVMA 1TS3A 4A90A 2D3CA 3H9DA 1ZP0B 2J52A 1C79A 5LXHA 2LXCA 1DIKA 1YOVB 2R2OA 3B08A 4NAWA 1KZGA 3TFMA 2MBEA 4LJPB 1P0RA 4ZRJA 3ZJUA 1XQQA 1KM7A 3QX1A 1SB3C 5LXIB 2CKHB 2AEHA 4C56C 3UINB 3GZNB 4MSMB 2V1YA 5IOIA 1PUTA 3V6CB 4HATB 1WX9A 2BYTA 2KMMA 4L1BA 4WJNA 3RNFC 1ZPSA 1R4NB 1STEA 3RCZA 1NYQA 1T0SC 4GMVA 5L95C 1B1ZA 1NDDA 2KANA 3MJ5A 4ANXA 5D3IB 5M4YB 3KZ1A 1JWAD 2JYTA 2XK5A 3TCAA 2Q13A 2CODA 2Y7BA 1HEZE 2IGDA 1J8CA 2DHZA 1NEKB 2WNMA 3B2GA 2EKEC 2KXJA 2DENB 4P1CC 4E3CA 4JPSA 1M4VA 3P4QB 3MHSD 1NI2A 1L6UA 5JZEB 1AWDA 5BMHA 4MJSB 2D9WA 3SU8X 2QDFA 1V5MA 3PHWB 2KFKA 1ZKHA 2DLBA 4F8CB 5EFXA 1H10A 1ZXIA 3N30A 3PZ7A 1E7VA 1BWNA 1NI3A 4AP4C 2KYWA 1LXDA 2LOXA 2BS2B 4WH4A 1V5UA 4C80A 3I5JC 3V60A 3HIEA 2QIEB 2VRRB 2H7DA 4HRSA 3H1UA 2LJIA 4JKGB 1RLFA 3ENBA 4MT7A 5J18A 2CHXA 2R0DA 3FEHA 4P7IA 5C5BB 1L0VB 2RDHA 1HTQA 3AE2B 1TY0A 1ACAA 1L5PA 1A5RA 2DAJA 3KUCB 3UIOB 4RGNA 2ZCBA 4FJVB 4TV3A 2M56B 2O6VB 1MHHE 1WX7A 2BWES 1UELA 1XO3A 1JALA 4HK2A 4BOZB 1J0WA 3DBHB 3BK2A 4K2OA 4GNKB 3U4EG 1V5TA 3B77A 3VTUA 2ZVNA 4HROA 1JW9D 1K5GB 3PTFC 1S1QB 2BYEA 4PS3A 3M1IB 1TZ1A 2Y5BB 3APCA 1GAQB 1J7CA 4DHJB 2KGXB 2KR0A 2G4DB 2DX5A 3AV8A 2Z0PA 5G5GA 4YXDB 2KDMA 3NSUA 1SE4A 4KIKB 2D5GA 4IM0A 1WGRA 4L6EA 2PKOA 2KWDA 1IPGA 4WWNA 1XODA 4K7SA 1ZGUB 3EFUA 5D94A 3RT3B 2KACA 1CJEA 1E7PB 3KW5B 1RFAA 2NBVA 2INDC 4G0NB 4O1NA 4I6PA 4M0WB 3VTWA 1D5XC 4HAZB 2WHIA 1QOAA 3TO1A 4HJGE 4JKBA 2OHFA 5CHFA 2L0FA 2V4LA 3ZQ4A 4RNAA 1B55A 4E71A 3SEBA 2WH5A 4GOCA 4IUMB 5JXVA 3C8YA 4HB3B 1V8CA 2JQRB 2WXRA 3SFDB 3OJ3A 2L8JA 1ZM0A 2BKFA 5DCNA 4XC2A 2DYQA 4EKUA 4BBKA 3DWMA 4ILGB 2CU3A 3M95A 4HCPB 4XZ4A 3PLVA 2PW9A 1UPRA 4NZLB 5D3YA 2Y3AA 1C3TA 1IGCA 1UPQA 3BIID 3ZRFA 1W1GA 4WIPA 2KFJA 3B1LX 1ZVRA 1ZW7A 2EJ8A 2X8XX 2LHEA 4LDTD 1VRAB 5E6PA 1AARA 2DA0A 3PO0A 1XT9B 2I2YA 3EECA 1F2RI 1FGYA 2MSED 4ZOHC 3RNCC 3CIRB 2JT4B 3Q8EA 3EFCA 1VJKA 4BOSC 1L6VA 5G5HA 4K2PA 3G9WA 4LNOA 2R2QA 2L83A 2RRFA 2JRHA 2MWSB 1Y19B 1TT5B 5GMVA 2V9HA 3UZTA 1P9DU 5HE2A 5C3JB 5H92C 1I4HA 2KVZA 3J9CA 3IVFA 2M38A 2XNAC 2NTTA 3MJWA 3QK0A 4W9HA 2OJWA 3RNAC 1V5OA 4KX6B 1YJ1A 1WJ1A 3RNGC 4A6KA 3NW8A 3L4PA 3O65B 5JHAA 5JP4A 2BCJA 4IW0A 2GI9A 1KLUD 5J3QA 2CRFA 3F0WA 3TMPB 4PYUA 2NR2A 3AE9B 5D3WA 1FNUA 4BKGA 4RM9A 1YQ3B 1FNWA 4GXBA 2W3SA 3AE1B 2K8BA 1WGUA 3ML8A 1IUEA 1CZPA 3ENEA 4MEMA 3FLVA 2X18A 1MPEA 3K9OB 3NS1A 2QKLA 2ZKMX 3AECB 2ZW0A 2RGNB 1N63A 4GDLB 2MDXA 2YSZA 3HQCA 2AL3A 2DKPA 1KOTA 3GS2A 4KHOA 1IP9A 2KJ6A 4A8XC 4A6QA 2WXNA 2K5PA 3KUZA 3UGBB 5EE3A 3VRAB 4NJ6A 3KYDD 3AEGB 1D6EC 3OWEB 3BK1A 4A6FB 3VH4B 1P3RA 3HSAA 4L1RA 1KFYB 1WJUA 4WVFB 2V3NA 3X23A 3D8FA 1FCCC 1HXYD 1AYFA 2MX2A 2RDGA 4F7ZA 2DZJA 2P8VA 4B0EA 2LI5A 2RQ1A 2N9XA 5HKHA 3U30A 2AWTA 3ZTDA 1CQVA 1NVLA 4HAUB 1VZ8A 2ZEQA 2MW5A 1WG7A 4RGTA 1X11A 2PEAA 3DPDA 3Q8CA
chains in the Genus database with same CATH topology
3W1YA 3ODWA 5CHWA 1T0YA 2ZZPB 2UVMA 3GYOA 3PVWA 1OQNA 1WM3A 3V5WA 1Y5OA 4WJPA 2BYFA 3CIKA 4GGQA 4MSQB 3NOBA 3V62A 4MGZE 3T8MA 2LD9A 4E74A 4KHBB 5C16A 2ELAA 2R82A 2OQBA 1P1AA 3FM8C 1I2HA 2LBBA 2KKCA 4D0NB 3SYXA 3QWMA 3APDA 1MAIA 1QZEA 1V6EA 3SV1A 4EZJA 1DBHA 4LDTB 3JW0X 3ECIA 1DROA 3A4RA 4DDGD 4ASWC 3ZNGC 2JP2A 1E90A 4KVGB 4NSWA 2FIFA 3BJIA 1WE6A 4GB9A 3P6AA 3H7PA 3PRMB 4MGKE 1X1GA 3B0AA 1WF9A 2KX0A 2MFQA 4IWOA 2ZNVC 3ULCA 1FHOA 2MBBB 2G4SA 3GZNI 2YS1A 4OVUA 3VXWA 1MIXA 4FHKA 1DDVA 3IBEA 1R4NI 4EFOA 3DCGA 3WANA 2JY6A 1U5FA 1J0GA 4G11A 3WYFB 4AOFA 1RAXA 5DPTA 1SIFA 2C5LC 1EO6A 4YL8A 3WAOA 4FJZA 4GMXB 2CR5A 1WJ6A 3PGEA 3IG3A 4PQ0A 2DYNA 1GNUA 2M14A 2NVUI 3N3KB 4GU2A 3ZLZA 2LYDA 2J0KA 3D8EA 1VBGA 2D10A 4F1SA 4HXDA 3L54A 3PS6A 5D27A 2KX3A 2MKRA 2OJRA 4ZRKA 2N23A 5E6NA 4FLHA 4EEWA 1C1YB 4EZLA 2XBBC 1XR0B 3PPAA 2K1FA 2RD0A 2LGDA 3I3TB 1TBEA 2L2IA 3MDBC 2BKRB 3DBHI 1E8YA 5DHFB 4JGHB 3NZUA 2KMCA 3PLUA 3ZNID 2K2JA 3F5RA 2MP2A 2LASA 5JVLA 4B6HA 1WMHA 2K25A 4JKAA 1TXDA 1X1MA 2JUOA 4N9F4 2DZIA 1TTNA 2BWFA 1OEYJ 2CQUA 1FHXA 2LOZA 2KD0A 2FCQA 3PT2B 1XD3B 5LOPB 2FJLA 4DWFA 2N9PC 3A9KB 1NTIA 3PV1A 3VDZA 1KLVA 2COCA 3KSYA 1UBIA 4M8NA 3ZDMC 3UQAA 2I1KA 2NCNA 1AQCA 3O96A 4KV2A 3E9PA 4ZRIA 2HJ8A 4HDOA 2HD5B 2L76A 2GS0A 2KK8A 2KTRB 2IO3B 5DPWA 3AU5A 4PNKA 5L83A 3EHVA 4KSLC 2M4NA 3LDZE 4WJQA 2KTFA 3RULA 4CHJA 3ZNZB 4KDLB 1P6SA 2LUEA 1E8XA 1UNQA 1EGXA 2K6QA 1X05A 2KJHB 1FB8A 2RSUA 5DIFB 4EMOA 3D8DA 2G3QB 3DXEA 4WJ7A 2KJRA 3WALA 2K39A 4DX90 2D11A 2O2VB 3ZVVA 2REXA 3AJ4A 3QJZA 2NBUA 4BKSA 3DVNV 2KDBA 1NU2A 2KCJA 4JLCA 1VBHA 2LVPA 5GOWB 4IM3A 5BO4B 1GJZA 3DQVA 2FUHB 4DDID 2KDEB 2W9NA 3RUIB 1OY2A 2Z0EB 3EPYA 1XCGA 2GOWA 1F9JA 2M1MA 5LLIA 3S2AA 1WJMA 3JSVA 2MA9B 4CYEA 4FA6A 2KC1A 2VKIA 1UNPA 2LZ6A 2L1CA 2JXXA 4NQKE 2Z0QA 3KY9A 3A1QB 1U29A 4GDKB 1WX8A 3VAWA 2FCNA 1QQGA 2COAA 2C7MB 3RZFA 1E5WA 1BTNA 3A4SC 2MBQA 2ROZB 3HK0A 2HTHA 4MELA 2UYZB 5HE1A 1L7YA 5C1ZA 2IO1B 1FAOA 1WGYA 2W2XD 3AXCA 4HDQA 4TYZA 3LJ3A 4OVVA 2A4ZA 3PREA 2ZJDA 1ST7A 1Q0WB 1WJ4A 3ZTCA 4NAWB 3E66A 2ROVA 1HB6A 4DHZB 2WWZA 3VUYA 4XWXA 2JPHA 4M8MA 5DH9B 1ISNA 4FBJB 2L0TA 3CF6E 4JQWC 5FI1A 1WFYA 3ZIMA 1ZC3B 3U7DA 4F7GA 2DX1A 4J6IA 3PG7A 3KRWA 2XK5B 1MPHA 4RMAA 1L2NA 1GGOA 2Y8FA 3SNHA 1ZSQA 1V81A 5J17A 2GCJA 2YT1A 4FADA 4I6LB 1WGHA 1WRDB 3Q3JA 2KDIA 2KFKB 2HE7A 1Q67A 4MH0E 1YX6B 1XKEA 2CHZA 1Z87A 2IZVB 2VRWB 3KRXA 1WVHA 2DIKA 3DOWA 2MLBA 2NPTA 2CY5A 2N1WA 2OTXA 1E7UA 5KCVA 1WE7A 2JZ3B 1KZ7A 4W9EA 3CSTA 4IFSA 3WIMA 2LRWA 5E6OA 3ZDTA 4NQLB 1Z5SB 2K8HA 1MIZB 3A9JA 1KBLA 2LJ5A 3T06A 2YVCA 5D3VA 4KSKC 2CU1A 1LW3A 1BTKA 2ELBA 2G35A 5G55A 1WI1A 2C9WB 2DX5B 4Z2NA 1RRPB 5JLJB 2KWCA 2P0HA 1OEYA 1K8RB 3QC8B 1S3SG 1KJTA 3QQ8B 1W1DA 3OJ4B 2K2UA 1SE9A 1V2YA 3HM6X 1LM8B 2LVOA 4HAWB 2NBVB 4W9DA 1Q1OA 4TQ0A 4DX8A 1WY8A 3LJUX 1JDEA 2KZRA 1UH6A 4XX5A 3SBTA 3HM3A 2UZSA 2M17A 4GN1A 3DXDA 3ZNHB 2L00B 1E8WA 2ZNVB 2MQJA 2DYBA 3QHTA 4W9KA 1OMWA 2DAFA 2FCMA 3M3JA 4KZCA 4GSWA 4IG7B 2D4QA 1V61A 3H6NA 3R7QA 3DDCB 3QWZB 4ANVA 2I5FA 4DXAB 4GZUA 3CSFA 2NMBA 1PMSA 2IYDB 3ODOA 2FJ9A 3VIAA 2YLMA 1P3QU 3MTNB 1U27A 4HWIB 4URKA 5KQ1A 2M8SA 3A8PA 3A9KA 5KQ4A 3V6EB 2DHIA 2V3SA 2LULA 4HHVA 3AU4A 4DHZE 2L3ZA 2N1VA 4JKFA 4WAAA 3UQBA 2IFSA 4KZ0A 3JVZX 2WDTB 4KDIC 3T9LA 2RLOA 1OQYA 1WH3A 3N32A 2LGXA 3ZW3A 1WGDA 2EMSA 3TVVA 2NBWB 2MBHA 4LCDE 4ANWA 2C7HA 4IOYX 3QIJA 1X1FA 3DXCA 3QA8A 3ULBA 4KHAA 4MJSA 2KWVB 2LG1A 3M62B 4K81A 3N7CA 3L10B 1IRSA 3K9PB 3KYCD 2B3AA 4B95A 2GCLA 1UEFA 2RGFA 1JRUA 1M94A 2ZVOA 5AZGA 2GBKA 4K7UA 5HE0A 2JF5A 4JKCA 3D32A 1GC7A 4JKGA 1XX0A 3NS8A 5J3YA 4IAPA 2LVQA 5C5BA 4X57B 3X0WA 3RD2A 2QHOA 2KQSA 1ZC4B 4IWPA 4K1RB 3KUDB 2D9ZA 2O6VA 4EJNA 1EUVB 1M7EA 2N4FA 3ML9A 1FXTB 1UZXB 2WYQA 3CMMB 4GIVA 1EF1A 4IM2A 4F7UP 4JK9A 2RNRB 2MWNB 2IO2B 2RPQA 1LQBA 3HW2B 2QKMA 1I42A 3SO6A 4BBNF 2KN5A 4B9KA 3PP2A 2CAYA 1WR1A 4G3XB 2L05A 1XD4A 3V61A 1V86A 5EDSA 2YRYA 4KIKA 4H8SA 3SUZA 3L17A 1P5TA 1NTVA 1DDMA 2A5UA 3NHEB 1U5EA 2MRPA 2GBRA 2R09A 2JVCA 2IYBA 1WXVA 2N9EB 3R7RA 4ICVA 2DYMA 4FHJA 3BINA 4JK7A 3PRZA 3VVWB 3ONSA 2WX0A 4TQ1A 4BFRA 2ASQA 2KQ7A 3OANA 3R3MA 2MBOA 4DBGA 4B6WA 3AULA 3M63B 4II3B 3BY4B 2ZPNA 3PEGA 5IA7A 2COPA 4NJ7A 1EAZA 2NS5A 4C0AA 2RR9A 1M7RA 2I5CA 3IFWB 4GPTB 1E8ZA 3VFKA 3H7PB 2AL6A 5FI0A 2UZRA 4DK5A 1YQBA 3FSSA 4JKDA 2GBMA 4HB0B 1LFDA 1MK7B 3DVNU 2GBJA 2ZPYA 1SGHA 1WIAA 5L81A 3JYUA 2CB8A 4EUTA 4K7WA 4A5KA 2BF8B 1WZ0A 3PHXB 2IY1B 1GC6A 4BKSD 2G45B 3RCPA 2IBIB 5IAAC 1UNRA 4HJKA 1HE8A 5J3TA 2JZZA 3MPXA 3TBLD 2DFKA 4HAVB 2FIDA 3QBVB 2KDFB 3W1SA 1UD7A 3E9LA 1U5DA 4FJYA 3L16A 5TR5A 5IJMA 1J19A 1AWEA 5CTRC 4GDLA 1KI1B 2DN6A 2J0JA 2OOBB 1N3HA 1RJ2A 3SD5A 2J59M 5DHAB 3TL5A 3SHQA 2KLCA 4ZYNA 3PSCA 2BYVE 2PPHA 3ZKJC 4A6FA 5DPSA 5D2MB 3VUWA 5CHVC 1W1HA 1EF5A 2DYOA 3P7ZA 1OGWA 1P98A 3RZWC 4NY0A 1OTRB 3L0WB 1K5DB 3OAWA 5KHOA 4MGIE 1SHCA 2X0SA 1IYFA 3DVGX 2DLWA 1WXAA 1TGZB 2IY0B 4HAYB 2IO0B 4ILHA 2MP2B 2FNJB 2DHKA 2L7RA 4JKEA 1FHWA 4II2B 1WMHB 4Z2MB 5CX3A 4EZKA 1LB1A 3VOQA 4ICUA 2J7QB 2J0MA 3APFA 5G2NA 2PE9A 4JIOU 4I6NB 1GG3A 4EOYA 1MK9B 2KLGA 1WJNA 1QC6A 4WQOB 2RSGA 2I1JA 1V88A 2KHWB 1VD2A 2XQNM 2PJHA 2PZ1A 3NZSA 3HIZA 4W9IA 2GMIC 3ZUNA 5JHGA 1YIWA 3QARA 4NNJB 4WWPA 2D9VA 3GYPA 4RM8A 1X86A 2PE6B 2V76A 1V89A 4MK0A 2UWQA 3ODXA 4K17A 5HE3A 1MG8A 4W9LA 4BKTA 2C7NB 2H7EA 4DBBA 4ANUA 3SBGA 1WR6E 2LKOA 5JH5C 2XEWA 1TQZA 3R66C 2Y8GA 3FP5A 1UBQA 2AYOB 3A33B 4IC7B 2HRJA 2NZ8B 2KO3A 4HCNB 4HB4B 5D3XA 1HBKA 3HHMA 2KVRA 4PS8A 3QCAA 1EVHA 3TIXA 2Z0DB 2P0DA 3UIPB 2D07B 2YS5A 3ZRCA 2DZMA 4PS7A 1H8CA 5AZHA 3H7SA 4HVBA 4MM3A 4Y94A 3QAQA 2D9XA 4FULA 2KNBA 3VHTC 2EC1A 3L08A 4AWJA 3JSVB 4W9FA 2KUPA 1WYWB 1WXSA 3U8ZA 5JHBA 5DI9B 3W1SC 5D7GA 1WM2A 3PSEB 2DKQA 3WAPA 5AEKB 5LONB 3E9OA 4IWQA 2KWUB 5C23A 4W9GA 2HTHB 4HPLB 4F7HA 1CMXB 4JKHA 1U4AA 1VCBA 1WXMA 2CHWA 4KAXB 4A3OA 3SDLC 4ILJA 3A98B 4AJWA 1DDWA 2D3GA 4MY6A 2C60A 4TUUA 2BGFA 2ADZA 2K6DB 3TJPA 1FGZA 3EC8A 2LRUA 3C0RB 3PRPB 1I7AA 1PFJA 3DBLI 3L13A 3DVGY 1WGGA 5C79A 2W2WA 5D6JB 2MCNB 3ZO5B 2K8CA 5C6RA 5JHHA 2FAZA 2GBNA 1WZ3A 2BPSA 4CHMA 1GUAB 4CO7A 2COFA 2KTRA 2N7EA 1HB8A 2YS3A 1PLSA 2N0YA 4LJOB 1V49A 4WSFA 2YT0A 4ZDVA 2KOXA 3OLMD 4G50A 2RVBB 2D2QA 2GJYA 1Q5WB 4A3PA 1V9JA 1D3ZA 2NPTB 2YF0A 3Q3FA 1V5PA 1WGQA 4W9JA 2LXAA 4HAXB 4YONA 3VUXA 2W2XC 1RRBA 4TKNA 5CLLB 3ZVRA 2O6VD 1U5GA 3KH0A 4NPNA 1V80A 2KC2A 2DTCA 2M0XA 1WI0A 3NY5A 2P0FA 2LGYA 2O2VA 1Z2MA 2D9YA 2Z59B 3WAMA 1G6JA 4A20A 3A9JB 3DBRI 3WA0A 4HPMB 1YX5B 5DPRA 1PQSA 3GOEA 4CHKA 2WX1A 1TJ6A 5FR6A 4DHJD 1FOEA 4WWOA 1BT0A 3VH3B 3IHPC 4BVUC 3A8QA 1I35A 2FDQA 4JK8A 2KMAA 2E2XA 4MGYE 3PZDA 3DBSA 4PYZA 1MKEA 4AJYB 2N7DA 4MDKE 1KC7A 3P2BA 2ABDA 5J2RA 3AI5A 3CXBB 2DZKA 4AUQC 3RYTA 3UF8A 2CS4A 1NTYA 2ZCCA 3PVLA 3ML4A 3TW1A 5CLQB 1R4MI 2JRIB 1U2BA 4WJOA 4A6HA 4W9CA 2Z0OA 5AZFA 2FCSA 2RUKB 3ALBA 2EMTA 1DYNA 2K00A 2JWZA 4JL9A 1UGMA 3A1QA 1YD8U 3VQIA 4GDKA 3PVUA 3KVFB 2VSZA 1NBFC 2DHJA 4HB2B 1BAKA 4FN2A 1H4RA 4BBNC 2LWPA 2CY4A 4HLEA 1Y8RC 3VTVA 5KHQA 3H9DA 5LXHA 2LXCA 1DIKA 2R2OA 3B08A 4NAWA 1KZGA 3TFMA 2MBEA 4LJPB 1P0RA 4ZRJA 1XQQA 1KM7A 3QX1A 5LXIB 2CKHB 2AEHA 3UINB 4MSMB 2V1YA 3V6CB 4HATB 1WX9A 4WJNA 3RCZA 4GMVA 5L95C 4ANXA 1NDDA 2KANA 3KZ1A 2XK5A 3TCAA 2Q13A 2CODA 2Y7BA 1J8CA 2DHZA 2EKEC 2KXJA 2DENB 4E3CA 3MHSD 1NI2A 5JZEB 4MJSB 2D9WA 3SU8X 1V5MA 3PHWB 2KFKA 1ZKHA 4F8CB 5EFXA 1H10A 3N30A 1E7VA 1BWNA 4AP4C 1LXDA 2LOXA 1V5UA 3V60A 2VRRB 2H7DA 3H1UA 4JKGB 1RLFA 3ENBA 4MT7A 5J18A 2CHXA 2R0DA 3FEHA 4P7IA 5C5BB 1ACAA 1A5RA 2DAJA 3KUCB 3UIOB 2ZCBA 4FJVB 4TV3A 2O6VB 1WX7A 2BWES 1UELA 4HK2A 4BOZB 1J0WA 4K2OA 1V5TA 3VTUA 2ZVNA 1K5GB 3PTFC 1S1QB 2BYEA 4PS3A 3M1IB 1TZ1A 2Y5BB 3APCA 4DHJB 2KGXB 2G4DB 2DX5A 2Z0PA 3NSUA 4KIKB 4IM0A 1WGRA 4L6EA 1IPGA 4WWNA 1XODA 4K7SA 1ZGUB 3EFUA 5D94A 3RT3B 3KW5B 1RFAA 4G0NB 4I6PA 4M0WB 3VTWA 4HAZB 3TO1A 4JKBA 5CHFA 2L0FA 2V4LA 1B55A 4E71A 2WH5A 4GOCA 4IUMB 4HB3B 3OJ3A 2L8JA 1ZM0A 2BKFA 5DCNA 4XC2A 2DYQA 4EKUA 4BBKA 4ILGB 3M95A 4HCPB 4XZ4A 3PLVA 1UPRA 5D3YA 1C3TA 1UPQA 3ZRFA 1W1GA 2KFJA 3B1LX 1ZVRA 1ZW7A 2EJ8A 4LDTD 5E6PA 1AARA 2DA0A 1XT9B 3EECA 1FGYA 2MSED 2JT4B 4BOSC 4K2PA 3G9WA 2R2QA 2JRHA 2MWSB 1Y19B 5GMVA 3UZTA 1P9DU 5HE2A 3IVFA 2M38A 3MJWA 3QK0A 4W9HA 1V5OA 1YJ1A 1WJ1A 4A6KA 3O65B 5JHAA 5JP4A 2BCJA 4IW0A 5J3QA 2CRFA 3F0WA 3TMPB 4PYUA 2NR2A 5D3WA 4BKGA 4RM9A 4GXBA 2K8BA 1WGUA 3ML8A 3ENEA 4MEMA 3FLVA 2X18A 3K9OB 2QKLA 2RGNB 4GDLB 2MDXA 2YSZA 3HQCA 2AL3A 2DKPA 1KOTA 4KHOA 1IP9A 2KJ6A 3KUZA 3UGBB 4NJ6A 3KYDD 4A6FB 3VH4B 1P3RA 1WJUA 4WVFB 3X23A 3D8FA 2MX2A 4F7ZA 2DZJA 2P8VA 2LI5A 2RQ1A 2N9XA 5HKHA 3U30A 2AWTA 3ZTDA 1NVLA 4HAUB 2ZEQA 2MW5A 1WG7A 1X11A 2PEAA 3DPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1Y A;  3ODW A;  5CHW A;  1T0Y A;  2ZZP B;  2UVM A;  3GYO A;  3PVW A;  1OQN A;  1WM3 A;  3V5W A;  1Y5O A;  4WJP A;  2BYF A;  3CIK A;  4GGQ A;  4MSQ B;  3NOB A;  3V62 A;  4MGZ E;  3T8M A;  2LD9 A;  4E74 A;  4KHB B;  5C16 A;  2ELA A;  2OQB A;  1P1A A;  3FM8 C;  1I2H A;  2LBB A;  2KKC A;  4D0N B;  3SYX A;  3QWM A;  3APD A;  1MAI A;  1QZE A;  1V6E A;  3SV1 A;  4EZJ A;  1DBH A;  4LDT B;  3JW0 X;  3ECI A;  1DRO A;  3A4R A;  4DDG D;  4ASW C;  3ZNG C;  2JP2 A;  1E90 A;  4KVG B;  4NSW A;  2FIF A;  3BJI A;  1WE6 A;  4GB9 A;  3P6A A;  3H7P A;  3PRM B;  4MGK E;  1X1G A;  3B0A A;  1WF9 A;  2KX0 A;  2MFQ A;  4IWO A;  2ZNV C;  3ULC A;  1FHO A;  2MBB B;  2G4S A;  3GZN I;  2YS1 A;  4OVU A;  3VXW A;  1MIX A;  4FHK A;  1DDV A;  3IBE A;  1R4N I;  4EFO A;  3DCG A;  3WAN A;  2JY6 A;  1U5F A;  1J0G A;  4G11 A;  3WYF B;  4AOF A;  1RAX A;  5DPT A;  1SIF A;  2C5L C;  1EO6 A;  4YL8 A;  3WAO A;  4FJZ A;  4GMX B;  2CR5 A;  1WJ6 A;  3PGE A;  3IG3 A;  4PQ0 A;  2DYN A;  1GNU A;  2M14 A;  2NVU I;  3N3K B;  4GU2 A;  3ZLZ A;  2LYD A;  2J0K A;  3D8E A;  2D10 A;  4F1S A;  4HXD A;  3L54 A;  3PS6 A;  5D27 A;  2KX3 A;  2MKR A;  2OJR A;  4ZRK A;  2N23 A;  5E6N A;  4FLH A;  4EEW A;  1C1Y B;  4EZL A;  2XBB C;  1XR0 B;  3PPA A;  2K1F A;  2RD0 A;  2LGD A;  3I3T B;  1TBE A;  2L2I A;  3MDB C;  2BKR B;  3DBH I;  1E8Y A;  5DHF B;  4JGH B;  3NZU A;  2KMC A;  3PLU A;  3ZNI D;  2K2J A;  3F5R A;  2MP2 A;  2LAS A;  4B6H A;  1WMH A;  2K25 A;  1TXD A;  1X1M A;  2JUO A;  4N9F 4;  2DZI A;  1TTN A;  2BWF A;  1OEY J;  2CQU A;  1FHX A;  2LOZ A;  2KD0 A;  2FCQ A;  3PT2 B;  1XD3 B;  5LOP B;  2FJL A;  4DWF A;  2N9P C;  3A9K B;  1NTI A;  3PV1 A;  3VDZ A;  1KLV A;  2COC A;  3KSY A;  1UBI A;  4M8N A;  3ZDM C;  3UQA A;  2I1K A;  2NCN A;  1AQC A;  3O96 A;  4KV2 A;  4ZRI A;  2HJ8 A;  4HDO A;  2HD5 B;  2L76 A;  2GS0 A;  2KK8 A;  2KTR B;  2IO3 B;  5DPW A;  3AU5 A;  4PNK A;  5L83 A;  3EHV A;  4KSL C;  2M4N A;  3LDZ E;  4WJQ A;  2KTF A;  3RUL A;  4CHJ A;  3ZNZ B;  4KDL B;  1P6S A;  2LUE A;  1E8X A;  1UNQ A;  1EGX A;  2K6Q A;  1X05 A;  2KJH B;  1FB8 A;  2RSU A;  5DIF B;  4EMO A;  3D8D A;  2G3Q B;  3DXE A;  4WJ7 A;  2KJR A;  3WAL A;  2K39 A;  4DX9 0;  2D11 A;  2O2V B;  3ZVV A;  2REX A;  3AJ4 A;  3QJZ A;  2NBU A;  4BKS A;  3DVN V;  2KDB A;  1NU2 A;  2KCJ A;  4JLC A;  2LVP A;  5GOW B;  4IM3 A;  5BO4 B;  1GJZ A;  3DQV A;  2FUH B;  4DDI D;  2KDE B;  2W9N A;  3RUI B;  1OY2 A;  2Z0E B;  3EPY A;  1XCG A;  2GOW A;  1F9J A;  2M1M A;  5LLI A;  3S2A A;  1WJM A;  3JSV A;  2MA9 B;  4CYE A;  4FA6 A;  2KC1 A;  2VKI A;  1UNP A;  2LZ6 A;  2L1C A;  2JXX A;  4NQK E;  2Z0Q A;  3KY9 A;  3A1Q B;  1U29 A;  4GDK B;  1WX8 A;  3VAW A;  2FCN A;  1QQG A;  2COA A;  2C7M B;  3RZF A;  1E5W A;  1BTN A;  3A4S C;  2MBQ A;  2ROZ B;  3HK0 A;  2HTH A;  4MEL A;  2UYZ B;  5HE1 A;  1L7Y A;  5C1Z A;  2IO1 B;  1FAO A;  1WGY A;  2W2X D;  3AXC A;  4HDQ A;  4TYZ A;  3LJ3 A;  4OVV A;  2A4Z A;  3PRE A;  2ZJD A;  1ST7 A;  1Q0W B;  1WJ4 A;  3ZTC A;  4NAW B;  2ROV A;  4DHZ B;  1HB6 A;  2WWZ A;  3VUY A;  4XWX A;  2JPH A;  4M8M A;  5DH9 B;  1ISN A;  4FBJ B;  2L0T A;  3CF6 E;  4JQW C;  5FI1 A;  1WFY A;  3ZIM A;  1ZC3 B;  3U7D A;  4F7G A;  2DX1 A;  4J6I A;  3PG7 A;  3KRW A;  2XK5 B;  1MPH A;  4RMA A;  1L2N A;  2Y8F A;  3SNH A;  1ZSQ A;  1V81 A;  5J17 A;  2GCJ A;  2YT1 A;  4FAD A;  4I6L B;  1WGH A;  1WRD B;  3Q3J A;  2KDI A;  2KFK B;  2HE7 A;  1Q67 A;  4MH0 E;  1YX6 B;  1XKE A;  2CHZ A;  1Z87 A;  2IZV B;  2VRW B;  3KRX A;  1WVH A;  3DOW A;  2MLB A;  2NPT A;  2CY5 A;  2N1W A;  2OTX A;  1E7U A;  5KCV A;  1WE7 A;  2JZ3 B;  1KZ7 A;  4W9E A;  3CST A;  4IFS A;  3WIM A;  2LRW A;  5E6O A;  3ZDT A;  4NQL B;  1Z5S B;  2K8H A;  1MIZ B;  3A9J A;  2LJ5 A;  3T06 A;  2YVC A;  5D3V A;  4KSK C;  2CU1 A;  1LW3 A;  1BTK A;  2ELB A;  2G35 A;  5G55 A;  1WI1 A;  2C9W B;  2DX5 B;  4Z2N A;  1RRP B;  5JLJ B;  2KWC A;  2P0H A;  1OEY A;  1K8R B;  3QC8 B;  1S3S G;  1KJT A;  3QQ8 B;  1W1D A;  3OJ4 B;  2K2U A;  1SE9 A;  1V2Y A;  3HM6 X;  1LM8 B;  2LVO A;  4HAW B;  2NBV B;  4W9D A;  1Q1O A;  4TQ0 A;  4DX8 A;  1WY8 A;  3LJU X;  2KZR A;  1UH6 A;  4XX5 A;  3HM3 A;  2UZS A;  2M17 A;  4GN1 A;  3DXD A;  3ZNH B;  2L00 B;  1E8W A;  2ZNV B;  2MQJ A;  2DYB A;  3QHT A;  4W9K A;  1OMW A;  2DAF A;  2FCM A;  3M3J A;  4KZC A;  4GSW A;  4IG7 B;  2D4Q A;  1V61 A;  3H6N A;  3R7Q A;  3DDC B;  3QWZ B;  4ANV A;  2I5F A;  4DXA B;  4GZU A;  3CSF A;  2NMB A;  1PMS A;  2IYD B;  3ODO A;  2FJ9 A;  3VIA A;  2YLM A;  1P3Q U;  3MTN B;  1U27 A;  4HWI B;  4URK A;  5KQ1 A;  2M8S A;  3A8P A;  3A9K A;  5KQ4 A;  3V6E B;  2DHI A;  2V3S A;  2LUL A;  4HHV A;  3AU4 A;  4DHZ E;  2L3Z A;  2N1V A;  4WAA A;  3UQB A;  2IFS A;  4KZ0 A;  3JVZ X;  2WDT B;  4KDI C;  3T9L A;  2RLO A;  1OQY A;  1WH3 A;  3N32 A;  2LGX A;  3ZW3 A;  1WGD A;  2EMS A;  3TVV A;  2NBW B;  2MBH A;  4LCD E;  4ANW A;  2C7H A;  4IOY X;  3QIJ A;  1X1F A;  3DXC A;  3QA8 A;  3ULB A;  4KHA A;  4MJS A;  2KWV B;  2LG1 A;  3M62 B;  4K81 A;  3N7C A;  3L10 B;  1IRS A;  3K9P B;  3KYC D;  2B3A A;  4B95 A;  2GCL A;  1UEF A;  2RGF A;  1JRU A;  1M94 A;  2ZVO A;  5AZG A;  2GBK A;  4K7U A;  5HE0 A;  2JF5 A;  3D32 A;  1GC7 A;  1XX0 A;  3NS8 A;  5J3Y A;  4IAP A;  2LVQ A;  5C5B A;  4X57 B;  3X0W A;  3RD2 A;  2QHO A;  2KQS A;  1ZC4 B;  4IWP A;  4K1R B;  3KUD B;  2D9Z A;  2O6V A;  4EJN A;  1EUV B;  1M7E A;  2N4F A;  3ML9 A;  1FXT B;  1UZX B;  2WYQ A;  3CMM B;  4GIV A;  1EF1 A;  4IM2 A;  4F7U P;  2RNR B;  2MWN B;  2IO2 B;  2RPQ A;  1LQB A;  3HW2 B;  2QKM A;  1I42 A;  3SO6 A;  4BBN F;  2KN5 A;  4B9K A;  3PP2 A;  2CAY A;  1WR1 A;  4G3X B;  2L05 A;  1XD4 A;  3V61 A;  1V86 A;  5EDS A;  2YRY A;  4KIK A;  4H8S A;  3SUZ A;  3L17 A;  1P5T A;  1NTV A;  1DDM A;  2A5U A;  3NHE B;  1U5E A;  2MRP A;  2GBR A;  2R09 A;  2JVC A;  2IYB A;  1WXV A;  2N9E B;  3R7R A;  4ICV A;  2DYM A;  4FHJ A;  3BIN A;  3PRZ A;  3VVW B;  3ONS A;  2WX0 A;  4TQ1 A;  4BFR A;  2ASQ A;  2KQ7 A;  3OAN A;  3R3M A;  2MBO A;  4DBG A;  4B6W A;  3AUL A;  3M63 B;  4II3 B;  3BY4 B;  2ZPN A;  3PEG A;  5IA7 A;  2COP A;  4NJ7 A;  1EAZ A;  2NS5 A;  4C0A A;  2RR9 A;  1M7R A;  2I5C A;  3IFW B;  4GPT B;  1E8Z A;  3VFK A;  3H7P B;  2AL6 A;  5FI0 A;  2UZR A;  4DK5 A;  1YQB A;  3FSS A;  2GBM A;  4HB0 B;  1LFD A;  1MK7 B;  3DVN U;  2GBJ A;  2ZPY A;  1SGH A;  1WIA A;  5L81 A;  3JYU A;  2CB8 A;  4EUT A;  4K7W A;  4A5K A;  2BF8 B;  1WZ0 A;  3PHX B;  2IY1 B;  1GC6 A;  4BKS D;  2G45 B;  3RCP A;  2IBI B;  5IAA C;  1UNR A;  4HJK A;  1HE8 A;  5J3T A;  2JZZ A;  3MPX A;  3TBL D;  2DFK A;  4HAV B;  2FID A;  3QBV B;  2KDF B;  3W1S A;  1UD7 A;  1U5D A;  4FJY A;  3L16 A;  5TR5 A;  5IJM A;  1J19 A;  1AWE A;  5CTR C;  4GDL A;  1KI1 B;  2DN6 A;  2J0J A;  2OOB B;  1N3H A;  1RJ2 A;  3SD5 A;  2J59 M;  5DHA B;  3TL5 A;  3SHQ A;  2KLC A;  4ZYN A;  3PSC A;  2BYV E;  2PPH A;  3ZKJ C;  4A6F A;  5DPS A;  5D2M B;  3VUW A;  5CHV C;  1W1H A;  1EF5 A;  2DYO A;  3P7Z A;  1OGW A;  1P98 A;  3RZW C;  4NY0 A;  1OTR B;  3L0W B;  1K5D B;  3OAW A;  5KHO A;  4MGI E;  1SHC A;  1IYF A;  3DVG X;  2DLW A;  1WXA A;  1TGZ B;  2IY0 B;  4HAY B;  2IO0 B;  2MP2 B;  2FNJ B;  2DHK A;  2L7R A;  1FHW A;  4II2 B;  1WMH B;  4Z2M B;  5CX3 A;  4EZK A;  1LB1 A;  3VOQ A;  4ICU A;  2J7Q B;  2J0M A;  3APF A;  5G2N A;  2PE9 A;  4JIO U;  4I6N B;  1GG3 A;  4EOY A;  1MK9 B;  2KLG A;  1WJN A;  1QC6 A;  4WQO B;  2RSG A;  2I1J A;  1V88 A;  2KHW B;  1VD2 A;  2XQN M;  2PJH A;  2PZ1 A;  3NZS A;  3HIZ A;  4W9I A;  2GMI C;  3ZUN A;  5JHG A;  1YIW A;  3QAR A;  4NNJ B;  4WWP A;  2D9V A;  3GYP A;  4RM8 A;  1X86 A;  2PE6 B;  2V76 A;  1V89 A;  4MK0 A;  2UWQ A;  3ODX A;  4K17 A;  5HE3 A;  1MG8 A;  4W9L A;  4BKT A;  2C7N B;  2H7E A;  4DBB A;  4ANU A;  1WR6 E;  2LKO A;  5JH5 C;  2XEW A;  1TQZ A;  3R66 C;  2Y8G A;  3FP5 A;  1UBQ A;  2AYO B;  3A33 B;  4IC7 B;  2HRJ A;  2NZ8 B;  2KO3 A;  4HCN B;  4HB4 B;  5D3X A;  1HBK A;  3HHM A;  2KVR A;  4PS8 A;  3QCA A;  1EVH A;  3TIX A;  2Z0D B;  2P0D A;  3UIP B;  2D07 B;  2YS5 A;  3ZRC A;  2DZM A;  4PS7 A;  1H8C A;  5AZH A;  3H7S A;  4HVB A;  4MM3 A;  4Y94 A;  3QAQ A;  2D9X A;  4FUL A;  2KNB A;  3VHT C;  2EC1 A;  3L08 A;  4AWJ A;  3JSV B;  4W9F A;  2KUP A;  1WYW B;  1WXS A;  3U8Z A;  5JHB A;  5DI9 B;  3W1S C;  5D7G A;  1WM2 A;  3PSE B;  2DKQ A;  3WAP A;  5AEK B;  5LON B;  4IWQ A;  2KWU B;  5C23 A;  4W9G A;  2HTH B;  4HPL B;  4F7H A;  1CMX B;  1U4A A;  1WXM A;  1VCB A;  2CHW A;  4KAX B;  4A3O A;  3SDL C;  3A98 B;  4AJW A;  1DDW A;  2D3G A;  4MY6 A;  2C60 A;  4TUU A;  2BGF A;  2ADZ A;  2K6D B;  3TJP A;  1FGZ A;  3EC8 A;  2LRU A;  3C0R B;  3PRP B;  1I7A A;  1PFJ A;  3DBL I;  3L13 A;  3DVG Y;  1WGG A;  5C79 A;  2W2W A;  5D6J B;  2MCN B;  3ZO5 B;  2K8C A;  5C6R A;  5JHH A;  2FAZ A;  2GBN A;  1WZ3 A;  2BPS A;  4CHM A;  1GUA B;  4CO7 A;  2COF A;  2KTR A;  2N7E A;  1HB8 A;  2YS3 A;  1PLS A;  2N0Y A;  4LJO B;  1V49 A;  4WSF A;  2YT0 A;  4ZDV A;  2KOX A;  3OLM D;  4G50 A;  2RVB B;  2D2Q A;  2GJY A;  1Q5W B;  4A3P A;  1V9J A;  1D3Z A;  2NPT B;  2YF0 A;  3Q3F A;  1V5P A;  1WGQ A;  4W9J A;  2LXA A;  4HAX B;  3VUX A;  4YON A;  2W2X C;  1RRB A;  4TKN A;  5CLL B;  3ZVR A;  2O6V D;  1U5G A;  3KH0 A;  4NPN A;  1V80 A;  2KC2 A;  2DTC A;  2M0X A;  1WI0 A;  3NY5 A;  2P0F A;  2LGY A;  2O2V A;  1Z2M A;  2D9Y A;  2Z59 B;  3WAM A;  1G6J A;  4A20 A;  3A9J B;  3DBR I;  3WA0 A;  4HPM B;  1YX5 B;  5DPR A;  1PQS A;  3GOE A;  4CHK A;  2WX1 A;  1TJ6 A;  5FR6 A;  4DHJ D;  1FOE A;  4WWO A;  1BT0 A;  3VH3 B;  3IHP C;  4BVU C;  3A8Q A;  1I35 A;  2FDQ A;  2KMA A;  2E2X A;  4MGY E;  3PZD A;  3DBS A;  4PYZ A;  1MKE A;  4AJY B;  2N7D A;  4MDK E;  3P2B A;  2ABD A;  5J2R A;  3AI5 A;  3CXB B;  2DZK A;  4AUQ C;  3RYT A;  3UF8 A;  2CS4 A;  1NTY A;  2ZCC A;  3PVL A;  3ML4 A;  3TW1 A;  5CLQ B;  1R4M I;  2JRI B;  1U2B A;  4WJO A;  4A6H A;  4W9C A;  2Z0O A;  5AZF A;  2FCS A;  2RUK B;  3ALB A;  2EMT A;  1DYN A;  2K00 A;  2JWZ A;  4JL9 A;  1UGM A;  3A1Q A;  1YD8 U;  3VQI A;  4GDK A;  3PVU A;  3KVF B;  2VSZ A;  1NBF C;  2DHJ A;  4HB2 B;  1BAK A;  4FN2 A;  1H4R A;  4BBN C;  2LWP A;  2CY4 A;  4HLE A;  1Y8R C;  3VTV A;  5KHQ A;  3H9D A;  5LXH A;  2LXC A;  2R2O A;  3B08 A;  4NAW A;  1KZG A;  3TFM A;  2MBE A;  4LJP B;  1P0R A;  4ZRJ A;  1XQQ A;  1KM7 A;  3QX1 A;  5LXI B;  2CKH B;  2AEH A;  3UIN B;  4MSM B;  2V1Y A;  3V6C B;  4HAT B;  1WX9 A;  4WJN A;  3RCZ A;  4GMV A;  5L95 C;  4ANX A;  1NDD A;  2KAN A;  3KZ1 A;  2XK5 A;  3TCA A;  2Q13 A;  2COD A;  2Y7B A;  1J8C A;  2DHZ A;  2EKE C;  2KXJ A;  2DEN B;  4E3C A;  3MHS D;  1NI2 A;  5JZE B;  4MJS B;  2D9W A;  3SU8 X;  1V5M A;  3PHW B;  2KFK A;  1ZKH A;  4F8C B;  5EFX A;  1H10 A;  3N30 A;  1E7V A;  1BWN A;  4AP4 C;  1LXD A;  2LOX A;  1V5U A;  3V60 A;  2VRR B;  2H7D A;  3H1U A;  1RLF A;  4MT7 A;  5J18 A;  2CHX A;  2R0D A;  3FEH A;  4P7I A;  5C5B B;  1ACA A;  1A5R A;  2DAJ A;  3KUC B;  3UIO B;  2ZCB A;  4FJV B;  4TV3 A;  2O6V B;  1WX7 A;  2BWE S;  1UEL A;  4HK2 A;  4BOZ B;  1J0W A;  4K2O A;  1V5T A;  3VTU A;  2ZVN A;  1K5G B;  3PTF C;  1S1Q B;  2BYE A;  4PS3 A;  3M1I B;  1TZ1 A;  2Y5B B;  3APC A;  4DHJ B;  2KGX B;  2G4D B;  2DX5 A;  2Z0P A;  3NSU A;  4KIK B;  4IM0 A;  1WGR A;  4L6E A;  1IPG A;  4WWN A;  1XOD A;  4K7S A;  1ZGU B;  3EFU A;  5D94 A;  3RT3 B;  3KW5 B;  1RFA A;  4G0N B;  4I6P A;  4M0W B;  3VTW A;  4HAZ B;  3TO1 A;  5CHF A;  2L0F A;  2V4L A;  1B55 A;  4E71 A;  2WH5 A;  4GOC A;  4IUM B;  4HB3 B;  3OJ3 A;  2L8J A;  1ZM0 A;  2BKF A;  5DCN A;  4XC2 A;  2DYQ A;  4EKU A;  4BBK A;  3M95 A;  4HCP B;  4XZ4 A;  3PLV A;  1UPR A;  5D3Y A;  1C3T A;  1UPQ A;  3ZRF A;  1W1G A;  2KFJ A;  3B1L X;  1ZVR A;  1ZW7 A;  2EJ8 A;  4LDT D;  5E6P A;  1AAR A;  2DA0 A;  1XT9 B;  3EEC A;  1FGY A;  2MSE D;  2JT4 B;  4BOS C;  4K2P A;  3G9W A;  2R2Q A;  2JRH A;  2MWS B;  1Y19 B;  5GMV A;  3UZT A;  1P9D U;  5HE2 A;  3IVF A;  2M38 A;  3MJW A;  3QK0 A;  4W9H A;  1V5O A;  1YJ1 A;  1WJ1 A;  4A6K A;  3O65 B;  5JHA A;  5JP4 A;  2BCJ A;  4IW0 A;  5J3Q A;  2CRF A;  3F0W A;  3TMP B;  4PYU A;  2NR2 A;  5D3W A;  4BKG A;  4RM9 A;  4GXB A;  2K8B A;  1WGU A;  3ML8 A;  3ENE A;  4MEM A;  3FLV A;  2X18 A;  3K9O B;  2QKL A;  2RGN B;  4GDL B;  2MDX A;  2YSZ A;  3HQC A;  2AL3 A;  2DKP A;  1KOT A;  4KHO A;  1IP9 A;  2KJ6 A;  3KUZ A;  3UGB B;  4NJ6 A;  3KYD D;  4A6F B;  3VH4 B;  1P3R A;  1WJU A;  4WVF B;  3X23 A;  3D8F A;  2MX2 A;  4F7Z A;  2DZJ A;  2P8V A;  2LI5 A;  2RQ1 A;  2N9X A;  5HKH A;  3U30 A;  2AWT A;  3ZTD A;  1NVL A;  4HAU B;  2ZEQ A;  2MW5 A;  1WG7 A;  1X11 A;  2PEA A;  3DPD A; 
#chains in the Genus database with same CATH topology
 3W1Y A;  3BYY B;  3ODW A;  5CHW A;  1T0Y A;  2ZZP B;  2UVM A;  1C4P A;  2ACZ B;  3GYO A;  3PVW A;  4DQO C;  1BUI C;  1OQN A;  1PFD A;  1WM3 A;  3V5W A;  1Y5O A;  4WJP A;  2BYF A;  3KWL A;  3CIK A;  3BYT B;  4A9A A;  2QCZ A;  2KQ4 X;  4YSX B;  4GGQ A;  3RFZ B;  2ZW1 A;  4MSQ B;  2MH7 A;  4LLG M;  3LYY A;  3NOB A;  3V62 A;  4MGZ E;  3T8M A;  3NVV A;  1I4G A;  2LD9 A;  4E74 A;  1AW7 A;  4KHB B;  5C16 A;  1KLG D;  2ELA A;  4LNF A;  2FJU B;  3KLS X;  2LMC A;  2R82 A;  3HVD A;  2OQB A;  2FE8 A;  1OQR A;  1P1A A;  4Q2J A;  4QJ4 B;  3FM8 C;  4A55 A;  1I2H A;  2BB6 A;  1GB4 A;  3O13 A;  2LBB A;  2KKC A;  4D0N B;  3DWG C;  1SXT A;  1FEH A;  1TKG A;  3SYX A;  3QWM A;  3APD A;  4P6V F;  1MAI A;  1QZE A;  1V6E A;  1YJJ A;  3SV1 A;  4EZJ A;  1DBH A;  4NAM A;  4LDT B;  3JW0 X;  3ECI A;  1DRO A;  2W54 A;  3A4R A;  1E0Z A;  4DDG D;  2D3A A;  4ASW C;  3ZNG C;  2JP2 A;  1E90 A;  4KVG B;  4NSW A;  2FIF A;  4PK1 A;  3BJI A;  1WE6 A;  4GB9 A;  3E9S A;  3P6A A;  3H7P A;  3PRM B;  4MGK E;  1N5W A;  1X1G A;  1XCQ L;  3B0A A;  1WF9 A;  2KX0 A;  1MI1 A;  3AM9 A;  2MFQ A;  4IWO A;  2ZNV C;  3ULC A;  1FHO A;  2MBB B;  2G4S A;  3GZN I;  2YS1 A;  4OVU A;  3U7Z A;  3VXW A;  1MIX A;  4FHK A;  1DDV A;  4USA A;  3GE8 C;  1L0Y B;  3IBE A;  1R4N I;  4EFO A;  1TYG B;  3DCG A;  1T0Q C;  2E3T A;  2Z4D A;  3WAN A;  2JY6 A;  1U5F A;  1J0G A;  4G11 A;  1RWS A;  3WYF B;  4J3O D;  4AOF A;  1RAX A;  5DPT A;  1SIF A;  1JWS D;  1ROE A;  2C5L C;  1EO6 A;  1T77 A;  1RM6 C;  5I2S A;  1NYR A;  2H89 B;  4YL8 A;  2LGS A;  1EU4 A;  3WAO A;  4FJZ A;  4GMX B;  2KN4 A;  2CR5 A;  4MM3 B;  1WJ6 A;  3PGE A;  3IG3 A;  4OW0 A;  3OHM B;  4PQ0 A;  3EUB 2;  4TSS A;  2DYN A;  1GNU A;  1ENF A;  2M14 A;  2NVU I;  4PT5 A;  3N3K B;  4GU2 A;  3ZLZ A;  2LYD A;  2J0K A;  4ZRP A;  3D8E A;  1VBG A;  4ITK A;  2D10 A;  4F1S A;  4HXD A;  3L54 A;  1HZ6 A;  3PS6 A;  4RFB A;  5D27 A;  1YMH E;  2KX3 A;  2MKR A;  2OJR A;  4ZRK A;  2N23 A;  5E6N A;  3RNE C;  1XEE A;  4FLH A;  4EEW A;  2VZK D;  1C1Y B;  4LK0 M;  4EZL A;  4QJ3 B;  2XBB C;  1FNV A;  1XR0 B;  3A58 A;  3B9J A;  4MT5 A;  1SE2 A;  3PPA A;  2K1F A;  2RD0 A;  4XGA B;  2D3B A;  2K22 A;  2LGD A;  3I3T B;  2Q5W D;  3Q6B A;  3Q8A A;  1TBE A;  2L2I A;  3MDB C;  2BKR B;  3DBH I;  1E8Y A;  4RF1 A;  1V1P A;  5DHF B;  4JGH B;  3NZU A;  2KMC A;  2YEP F;  3PLU A;  3ZNI D;  2K2J A;  2WXI A;  3F5R A;  2MP2 A;  2LAS A;  1FFU A;  3TEW A;  5JVL A;  4B6H A;  1ZYI A;  1WMH A;  2K25 A;  2QC8 A;  4JKA A;  1C78 A;  3ABV B;  4JWS C;  2CJO A;  1TXD A;  1X1M A;  2JUO A;  4N9F 4;  1HZ5 A;  2NMQ A;  2DZI A;  1TTN A;  2BWF A;  1OEY J;  4S17 A;  1UWX A;  2CQU A;  1JML A;  1SJH D;  1FHX A;  2LOZ A;  2KD0 A;  2FCQ A;  3I9V 1;  3PT2 B;  1XD3 B;  2Z13 A;  3UI3 A;  5LOP B;  3AEF B;  5HG2 A;  3NVZ A;  2FJL A;  4DWF A;  2N9P C;  3MC8 A;  2LFI A;  3A9K B;  1NTI A;  3AE7 B;  3PV1 A;  3VDZ A;  1KLV A;  3MC9 A;  2COC A;  1FRR A;  2SEB D;  4JX1 C;  4MAC A;  3KSY A;  4M01 A;  1UBI A;  4M8N A;  3ZDM C;  3UQA A;  2I1K A;  2NCN A;  3IT4 B;  1AQC A;  3O96 A;  3EGR A;  4ZYS A;  4KV2 A;  3E9P A;  2R61 A;  4ZRI A;  2HJ8 A;  4HDO A;  2HD5 B;  2L76 A;  2GS0 A;  2KK8 A;  2KTR B;  1XXG A;  2IO3 B;  4C4V A;  5DPW A;  2PLP A;  3AU5 A;  4PNK A;  3FC4 A;  5L83 A;  3EHV A;  1FO4 A;  4KSL C;  3FIL A;  2M4N A;  3P4R B;  3LDZ E;  2MJ3 A;  4WJQ A;  1PGB A;  2KTF A;  3RUL A;  4CHJ A;  3ZNZ B;  4KDL B;  1I4P A;  1P6S A;  2LUE A;  4M00 A;  1E8X A;  1UNQ A;  1EGX A;  2AQ3 B;  2K6Q A;  1X05 A;  2H88 B;  2KJH B;  1FB8 A;  2R2Y A;  2RSU A;  2VH2 A;  4BZA A;  5DIF B;  4EMO A;  3D8D A;  2G3Q B;  3DXE A;  4WJ7 A;  2KJR A;  4N58 A;  3WAL A;  2K39 A;  2WDV B;  4ARI A;  5AUI A;  1KF6 B;  1P7E A;  4QJ5 B;  3Q3N C;  4DX9 0;  2D11 A;  2O2V B;  3ZVV A;  2REX A;  3AJ4 A;  3QJZ A;  2NBU A;  4BKS A;  2WXK A;  5E6J A;  4OT1 A;  3DVN V;  2KDB A;  1RYJ A;  3AE6 B;  1NU2 A;  2KCJ A;  1T5X D;  4JLC A;  1VBH A;  2LVP A;  5GOW B;  4IM3 A;  5BO4 B;  1GJZ A;  2K8E A;  4RF0 A;  2WP9 B;  3DQV A;  2FUH B;  4DDI D;  1NVI D;  2KDE B;  4AS1 A;  2W9N A;  3RUI B;  2W82 A;  1OY2 A;  3RI7 C;  2Z0E B;  4NJC A;  3EPY A;  1XCG A;  3GP7 A;  2GOW A;  3N1X C;  1F9J A;  2AQ1 B;  1WSP A;  2M1M A;  5LLI A;  1N60 A;  3URY A;  3MHZ A;  3S2A A;  2INP E;  1WJM A;  3JSV A;  2MA9 B;  3ZXV A;  4CYE A;  4ZHP A;  4FA6 A;  3KQ4 A;  2VZK B;  4L2Y A;  2KC1 A;  1N61 A;  2VKI A;  1UNP A;  1JRP A;  2LZ6 A;  2L1C A;  2KIE A;  2JXX A;  4NQK E;  4HSI A;  2Z0Q A;  3KY9 A;  3A1Q B;  1U29 A;  1RFK A;  4GDK B;  1WX8 A;  3VAW A;  4CSQ A;  2FCN A;  1QQG A;  3OG5 A;  2COA A;  2C7M B;  1R7S A;  3RZF A;  1E5W A;  1BTN A;  3A4S C;  3N9Y C;  2MBQ A;  2ROZ B;  3HK0 A;  2HTH A;  4MEL A;  2UYZ B;  1IBX B;  5HE1 A;  2V4I B;  1GPX A;  1L7Y A;  3LB8 C;  2IO1 B;  1FAO A;  5C1Z A;  2FUG 1;  5IRS A;  1WGY A;  1J7A A;  1QOF A;  3MFG A;  5D3D A;  2W2X D;  3AXC A;  4HDQ A;  4EE2 A;  1WXQ A;  4TYZ A;  1TKY A;  3LJ3 A;  4OVV A;  2A4Z A;  1I4R A;  3PRE A;  5EE9 A;  2ZJD A;  1ST7 A;  1Q0W B;  1WJ4 A;  2Z8L A;  3ZTC A;  3KWV A;  4NAW B;  3E66 A;  2ROV A;  1HB6 A;  4DHZ B;  3BVZ A;  3NVW A;  2WWZ A;  3NWD A;  3NWF A;  3VUY A;  4XWX A;  2JPH A;  3IT6 B;  3ZXR A;  1TS2 A;  4M8M A;  2BBC A;  4C00 A;  5DH9 B;  3R2T A;  1ISN A;  1NEN B;  4FBJ B;  2L0T A;  3CF6 E;  3BZD B;  4JQW C;  5FI1 A;  1WFY A;  3ZIM A;  2BB5 A;  1ZC3 B;  3U7D A;  4F7G A;  2EEL A;  2DX1 A;  1D5Z C;  4US8 A;  4J6I A;  3PG7 A;  4REZ A;  3KRW A;  2XK5 B;  5FR3 A;  4IKG A;  1MPH A;  4RMA A;  4HKZ E;  1L2N A;  3NJT A;  1GGO A;  2Y8F A;  3SNH A;  3I57 A;  1ZSQ A;  1V81 A;  5J17 A;  2GCJ A;  2YT1 A;  4FAD A;  4I6L B;  1UWM A;  1WGH A;  1WRD B;  5BYS A;  3Q3J A;  2KDI A;  2KFK B;  2HE7 A;  1Q67 A;  2L1A A;  4MH0 E;  1VZ7 A;  3FVC A;  1KTK A;  4L23 A;  1YX6 B;  4ARC A;  1XKE A;  2CHZ A;  1Z87 A;  2IZV B;  2VRW B;  3KRX A;  1WVH A;  2DIK A;  3DOW A;  2LHD A;  2BVC A;  2MLB A;  4CQN A;  1WYG A;  2NPT A;  2CY5 A;  3AEE B;  2N1W A;  3U52 E;  2OTX A;  1E7U A;  5KCV A;  1YN4 A;  5IKC M;  3ZJT A;  1WE7 A;  2RMM A;  1MG4 A;  2JZ3 B;  1KZ7 A;  4W9E A;  1Q10 A;  5HHD G;  3CST A;  2WS3 B;  4IFS A;  2BT6 A;  3WIM A;  2W55 A;  1TS5 A;  2LRW A;  5E6O A;  3AEB B;  4C7Y A;  1FD6 A;  3ZDT A;  4NQL B;  1Z5S B;  1I4Q A;  2K8H A;  2WXP A;  1MIZ B;  2Z59 A;  3A9J A;  1KBL A;  2LJ5 A;  3T06 A;  1PDX A;  2YVC A;  1PGX A;  5D3V A;  3U12 A;  1JWB D;  4KSK C;  4N6E B;  2CU1 A;  1LW3 A;  1BTK A;  2ON8 A;  2ELB A;  4WQM A;  2G35 A;  5G55 A;  1WI1 A;  5I4D A;  2C9W B;  3HVZ A;  2DX5 B;  4Z2N A;  1RRP B;  5JLJ B;  1TIF A;  2WQY B;  2KWC A;  2P0H A;  1OEY A;  1K8R B;  3QC8 B;  3SR6 A;  1S3S G;  3TSS A;  1I7H A;  3AEA B;  3ZYY X;  2HDE A;  1KJT A;  4BAX A;  3QQ8 B;  1W1D A;  3OJ4 B;  2K2U A;  1SE9 A;  1V2Y A;  3HM6 X;  2GB1 A;  1LM8 B;  2LVO A;  4HAW B;  1MFW A;  2NBV B;  4W9D A;  1TJE A;  1Q1O A;  4TQ0 A;  4DX8 A;  1WY8 A;  3LJU X;  2PTL A;  3AED B;  1JDE A;  2K9X A;  2LEK A;  2KIG A;  3NG0 A;  1TKE A;  2KZR A;  1UH6 A;  1ZXH A;  4XX5 A;  5AUK A;  3LXF A;  3SBT A;  2L52 A;  3AH7 A;  2WXL A;  2Y5C A;  3HM3 A;  1VR9 A;  2UZS A;  2M17 A;  4GN1 A;  3N20 C;  3DXD A;  1N62 A;  3W2D A;  3ZNH B;  2L00 B;  1E8W A;  2ZNV B;  2MQJ A;  2DYB A;  3QHT A;  4W9K A;  1OMW A;  2DAF A;  2FCM A;  3W9C B;  3M3J A;  4KZC A;  2HTM E;  1C4A A;  2PMV A;  4GSW A;  4IG7 B;  2D4Q A;  1V61 A;  2WU5 B;  3H6N A;  4XYC A;  3R7Q A;  2FBW B;  3DDC B;  3QWZ B;  4ANV A;  2I5F A;  2EKI A;  1XLP A;  4DXA B;  4P16 A;  4GZU A;  3AE5 B;  3CSF A;  2NMB A;  1PMS A;  1YN3 A;  3V05 A;  2PIA A;  2IYD B;  3ODO A;  2FJ9 A;  3WCQ A;  3NVY A;  3VIA A;  2YLM A;  1UGJ A;  1P3Q U;  3EA6 A;  2RDB C;  3MTN B;  1U27 A;  4OSN A;  4HWI B;  4KGS A;  4URK A;  1C9F A;  1DGJ A;  5KQ1 A;  2M8S A;  3A8P A;  3HRD D;  4YWG G;  3A9K A;  5KQ4 A;  2K3U A;  2DHI A;  2V3S A;  3V6E B;  2LUL A;  4XWT A;  2KUQ A;  4HHV A;  3AU4 A;  1QT9 A;  2L3Z A;  2N1V A;  4DHZ E;  4JKF A;  2MJE A;  4WAA A;  3UQB A;  2IFS A;  4KZ0 A;  1JWM D;  2JU6 X;  3JVZ X;  2WDT B;  4P1B C;  4KDI C;  1XLQ A;  3T9L A;  2RLO A;  1OQY A;  3P4S B;  1WH3 A;  1F2R C;  1XF5 L;  1MI0 A;  3N32 A;  2LGX A;  3ZW3 A;  1WGD A;  2BS4 B;  2EMS A;  3TVV A;  5IO9 A;  2NBW B;  4MH8 A;  2MBH A;  3GE3 C;  4LCD E;  4ANW A;  1QOB A;  5MPO A;  2C7H A;  1ZOY B;  1C77 A;  4IOY X;  3QIJ A;  3RMK C;  1X1F A;  3IAM 1;  3DXC A;  2WXF A;  3QA8 A;  1N6Z A;  4HPP A;  1EWY C;  3ULB A;  2IGG A;  4KHA A;  4MJS A;  1VLB A;  2KWV B;  2LG1 A;  3M62 B;  4K81 A;  3N7C A;  1ET9 A;  3L10 B;  1IRS A;  3K9P B;  3KYC D;  3RNB C;  3U2S C;  2N9L A;  2ONQ A;  2B3A A;  4M02 A;  2WXQ A;  4B95 A;  2GCL A;  1UEF A;  2RGF A;  1CK1 A;  4LNK A;  1JRU A;  4RGO S;  1M94 A;  2V3P A;  2ZVO A;  5AZG A;  2GBK A;  1HTO A;  3R2I A;  4K7U A;  5HE0 A;  1FFV A;  2JF5 A;  4JKC A;  3D32 A;  1GC7 A;  4JKG A;  1XX0 A;  3NS8 A;  5J3Y A;  4IAP A;  2LVQ A;  1FM0 D;  5C5B A;  5C2T B;  4X57 B;  3X0W A;  2E6X A;  3RD2 A;  2QHO A;  2KQS A;  1ZC4 B;  4IWP A;  4KKI A;  4K1R B;  2QIL A;  3KUD B;  2D9Z A;  2O6V A;  1J7B A;  4EJN A;  1V97 A;  1EUV B;  5BYQ A;  1M7E A;  2MHJ A;  2N4F A;  3ML9 A;  1FXT B;  5LNK 1;  1UZX B;  2WYQ A;  2JSV X;  3CMM B;  4GIV A;  1EF1 A;  4IM2 A;  2JXT A;  4HEA 1;  2M0A A;  4F7U P;  5HI1 A;  3GB1 A;  1F77 A;  4JK9 A;  1UNS A;  2RNR B;  2MWN B;  2IO2 B;  2RPQ A;  1LQB A;  2WXM A;  3HW2 B;  2QKM A;  1L4Z B;  1DOY A;  1HQR D;  3DHI C;  1I42 A;  3SO6 A;  4BBN F;  2KN5 A;  4RCO A;  4B9K A;  3PP2 A;  2CAY A;  1WR1 A;  4G3X B;  2L05 A;  1XD4 A;  3V61 A;  1V86 A;  2WU2 B;  3Q2A C;  5EDS A;  1MJD A;  3N1Y C;  1GOZ A;  1AN8 A;  2YRY A;  4KIK A;  4H8S A;  3SUZ A;  2WGS A;  1TZO A;  1TS4 A;  3L17 A;  1P5T A;  1NTV A;  1DDM A;  2A5U A;  3NHE B;  2G1E A;  1U5E A;  1A70 A;  2MRP A;  3TEY A;  1SF0 A;  4LNI A;  1E9M A;  2MEK A;  1OQQ A;  2GBR A;  5IN7 A;  4M0W A;  1UUP A;  5FKA C;  3DBL B;  2R09 A;  2JVC A;  2IYB A;  1BXT A;  1WXV A;  2N9E B;  3R7R A;  3T3O A;  4ICV A;  2DYM A;  4TMA B;  4FHJ A;  2L32 A;  3Q3O C;  3BIN A;  4JK7 A;  3PRZ A;  3VVW B;  3ONS A;  2WX0 A;  2PVO D;  4TQ1 A;  4BFR A;  2ASQ A;  2KQ7 A;  3OAN A;  3R3M A;  4DXG A;  2MBO A;  4DBG A;  4B6W A;  3AUL A;  3M63 B;  2RPV A;  4II3 B;  1XLN A;  3BY4 B;  2ZPN A;  3PEG A;  5IA7 A;  2COP A;  4NJ7 A;  1C76 A;  2WXJ A;  1EAZ A;  1ZDV A;  2NS5 A;  4C0A A;  1LGR A;  2RR9 A;  1QOG A;  5H8Y E;  1M7R A;  2I5C A;  3IFW B;  4GPT B;  1E8Z A;  1FXA A;  3VFK A;  1F52 A;  3H7P B;  2AL6 A;  1V1O A;  5FI0 A;  2UZR A;  1DOI A;  4DK5 A;  3FKY A;  1YQB A;  3FSS A;  4JKD A;  2GBM A;  4HB0 B;  1LFD A;  1MK7 B;  3DVN U;  2GBJ A;  2ZPY A;  1SGH A;  1WIA A;  2W3R A;  5L81 A;  3JYU A;  2CB8 A;  1T6B X;  3V3X A;  1L0X B;  4EUT A;  1KRH A;  2INC C;  4K7W A;  4A5K A;  2G9H D;  2BF8 B;  5EE1 A;  1WZ0 A;  3P63 A;  3Q8B A;  3PHX B;  2IY1 B;  1GC6 A;  4BKS D;  3DBR B;  4C7Z A;  2G45 B;  3RCP A;  2IBI B;  5IAA C;  1UNR A;  4HJK A;  1HE8 A;  5J3T A;  2JZZ A;  3MPX A;  3TBL D;  2DFK A;  4HAV B;  2FID A;  3R8B A;  1FXI A;  3QBV B;  2KDF B;  3W1S A;  1UD7 A;  3E9L A;  1U5D A;  4FJY A;  3L16 A;  5TR5 A;  5IJM A;  3VR9 B;  4YTN B;  4HKQ A;  1J19 A;  1AWE A;  5CTR C;  3AMZ A;  4GDL A;  1KI1 B;  2DN6 A;  1L4D B;  3N1Z C;  4QAY A;  2J0J A;  4ACF A;  2OOB B;  4RH6 A;  1N3H A;  1RJ2 A;  3SD5 A;  2J59 M;  5DHA B;  3TL5 A;  3SHQ A;  2KLC A;  4ZYN A;  3PSC A;  2BYV E;  3Q8F A;  2PPH A;  4FXC A;  3ZKJ C;  4A6F A;  5DPS A;  5D2M B;  3VUW A;  5CHV C;  1R4M B;  1W1H A;  1EF5 A;  2DYO A;  2WDQ B;  2LUM A;  1JQ4 A;  3P7Z A;  1OGW A;  2WXG A;  1P98 A;  3RZW C;  5LG4 B;  2QEJ C;  4RGM A;  1SJE D;  4NY0 A;  3AN1 A;  1OTR B;  3L0W B;  1K5D B;  3OAW A;  1XCT L;  5KHO A;  1D4B A;  4MGI E;  1SHC A;  2X0S A;  1V1P B;  5IP4 D;  1IYF A;  5TSS A;  3DVG X;  2DLW A;  1QKZ A;  1WXA A;  2N9K A;  1XLO A;  1TGZ B;  2IY0 B;  2J42 A;  4OZA A;  4HAY B;  4ZHO A;  2IO0 B;  4ILH A;  2MP2 B;  3RN9 C;  2FNJ B;  2DHK A;  2L7R A;  4JKE A;  1FHW A;  4II2 B;  1WMH B;  4Z2M B;  2CJN A;  5CX3 A;  4EZK A;  1LB1 A;  3VOQ A;  1TY2 A;  2INN E;  4ICU A;  2J7Q B;  2J0M A;  3APF A;  1PYW D;  1KH0 A;  4JWU C;  5G2N A;  2PE9 A;  4JIO U;  4I6N B;  1GG3 A;  1QF6 A;  5I2M A;  1OFF A;  4EOY A;  1N5X A;  3AB5 A;  1MK9 B;  2KLG A;  1WJN A;  1QC6 A;  4KHB A;  2DWQ A;  1EM7 A;  2IPK D;  4WQO B;  2RSG A;  2BS3 B;  2I1J A;  4LNN A;  1V88 A;  4S0R A;  2N7J A;  2KHW B;  1VD2 A;  1JCK B;  2XQN M;  2PJH A;  2PZ1 A;  3HUI A;  3NZS A;  3HIZ A;  4W9I A;  4K3B A;  2GMI C;  3TUO A;  3ZUN A;  5JHG A;  2TSS A;  4DIX A;  1YIW A;  3QAR A;  1YJI A;  4NNJ B;  2VH1 A;  3P42 A;  5BYR A;  3IAS 1;  4WWP A;  3NWA A;  4XDC A;  2D9V A;  2B76 B;  3GYP A;  4C4V B;  4RM8 A;  1E6E B;  1X86 A;  4YTM B;  3E56 A;  2PE6 B;  2V76 A;  1SSN A;  1K51 A;  1V89 A;  4MK0 A;  2UWQ A;  3FIL B;  3ODX A;  4K17 A;  5HE3 A;  1MG8 A;  4W9L A;  3W5V B;  1ZDX A;  2MJD A;  5EE0 A;  2JZP A;  3AE8 B;  4BKT A;  2C7N B;  2H7E A;  4DBB A;  1JWU D;  4ANU A;  1T0R C;  3SBG A;  1WR6 E;  2LKO A;  5JH5 C;  5BMG A;  2XEW A;  1YNT E;  1K52 A;  1TQZ A;  3Q69 A;  3R66 C;  2Y8G A;  2QMT A;  4IDI A;  3FP5 A;  1UBQ A;  2AYO B;  3A33 B;  4IC7 B;  2HRJ A;  4B0M A;  4UDU C;  1UF0 A;  4R3D A;  2NZ8 B;  2KO3 A;  4HCN B;  4HB4 B;  5D3X A;  1MVK A;  4LTU A;  2XN9 C;  1HBK A;  2IDY A;  3HHM A;  4XE0 A;  2KVR A;  4PS8 A;  2QJL A;  3QCA A;  3TEZ A;  3PZ8 A;  1EVH A;  3TIX A;  2Z0D B;  1EU3 A;  1D5M C;  2P0D A;  1VZ6 A;  2D07 B;  2YS5 A;  3UIP B;  3ZRC A;  3ZJV A;  2DZM A;  4PS7 A;  1H8C A;  4OZC A;  2ICI A;  4QXA B;  5AZH A;  3H7S A;  4HVB A;  4MM3 A;  1JRO A;  1SBB B;  4Y94 A;  1WWT A;  2K49 A;  3B2F A;  4YSZ B;  3QAQ A;  2D9X A;  4FUL A;  2KNB A;  1FCL A;  3MC0 B;  3VHT C;  2EC1 A;  3L08 A;  4AWJ A;  3JSV B;  4W9F A;  2V0G A;  2KUP A;  1WYW B;  1WXS A;  4IOI E;  3TEX A;  2BW2 A;  3U8Z A;  3I63 C;  5JHB A;  3ZGZ A;  5DI9 B;  1YQ4 B;  3W1S C;  4WAF A;  5D7G A;  5GXG B;  1P7F A;  1WM2 A;  3PSE B;  4JE3 B;  3T3N A;  4WWM A;  2DKQ A;  3WAP A;  5AEK B;  5LON B;  2BTE A;  2IGH A;  4N59 A;  3AE4 B;  1PGA A;  3P4P B;  1IGD A;  3E9O A;  4IWQ A;  2KWU B;  5C23 A;  4W9G A;  2HTH B;  3DCX A;  4HPL B;  4F7H A;  1CMX B;  4JKH A;  1U4A A;  1VCB A;  1WXM A;  2YT2 A;  2CHW A;  4KAX B;  2GRI A;  4A3O A;  3SDL C;  2Z14 A;  1B9R A;  4ILJ A;  4AQ7 A;  3A98 B;  1FRD A;  1WGK A;  4AJW A;  1DDW A;  1LO5 D;  2D3G A;  4XDD A;  4MY6 A;  2C60 A;  4TUU A;  2KAJ A;  4US9 A;  3P1M A;  2BGF A;  3NRZ A;  2ADZ A;  2K6D B;  3TJP A;  1FGZ A;  3EC8 A;  2WXO A;  4YTP B;  2LRU A;  3C0R B;  3PRP B;  1I7A A;  1PFJ A;  3DBL I;  3L13 A;  1MHX A;  3DVG Y;  1WGG A;  5C79 A;  2W2W A;  2N0S B;  5D6J B;  2X38 A;  1K50 A;  2MCN B;  3ZO5 B;  2K8C A;  3H8H A;  5C6R A;  5JHH A;  2FAZ A;  3W5U B;  1SEB D;  2GBN A;  1WZ3 A;  2BPS A;  4CHM A;  5HFY A;  4OHJ A;  4OVZ A;  4WUR A;  1I4X A;  3NZ3 A;  2K0P A;  1DOX A;  1GUA B;  1QQR A;  4CO7 A;  2COF A;  2UU7 A;  4D2K A;  2KTR A;  2M19 A;  1ACC A;  2N7E A;  1HB8 A;  2YS3 A;  3FAH A;  1PLS A;  2PVG C;  2N0Y A;  4LJO B;  4OZB A;  1V49 A;  4WSF A;  2YT0 A;  4ZDV A;  1Y56 A;  2KOX A;  1ZUD 2;  3OLM D;  2RVB B;  1FIQ A;  4G50 A;  2D2Q A;  2BQQ A;  1GB1 A;  2GJY A;  1Q5W B;  4A3P A;  1V9J A;  2SAK A;  1D3Z A;  2NPT B;  1K53 A;  2YF0 A;  3MP9 A;  4KKJ A;  3Q3F A;  1V5P A;  1WGQ A;  4W9J A;  2LXA A;  4DXF A;  4HAX B;  4YON A;  3VUX A;  2I38 A;  2W2X C;  2J53 A;  1RRB A;  1EWC A;  4TKN A;  3AE3 B;  5CLL B;  3ZVR A;  2JX5 A;  2O6V D;  4KGT A;  1U5G A;  2NTS A;  3KH0 A;  4NPN A;  4YT0 B;  1HA5 A;  1V80 A;  3ETR A;  2KC2 A;  2DTC A;  2M0X A;  2GUM A;  1WI0 A;  3NY5 A;  2P0F A;  2LGY A;  1E10 A;  2O2V A;  1Z2M A;  2D9Y A;  1ZE3 D;  2Z59 B;  3WAM A;  1G6J A;  4A20 A;  3A9J B;  4D6W A;  3DBR I;  3WA0 A;  4HPM B;  1YX5 B;  5DPR A;  3DHH C;  1PQS A;  3GOE A;  4CHK A;  3VR8 B;  2IJ0 A;  2WX1 A;  2WLB A;  1TJ6 A;  5FR6 A;  4DHJ D;  1FOE A;  4WWO A;  1SE3 A;  1BT0 A;  1YN5 A;  3IHP C;  3VH3 B;  3C19 A;  4BVU C;  3A8Q A;  2DNF A;  2HJ1 A;  3IXS A;  3Q14 C;  1I35 A;  2KT7 A;  2FDQ A;  4JK8 A;  1ESF A;  2KMA A;  2OED A;  2E2X A;  4MGY E;  3PZD A;  3DBS A;  1WRI A;  1QLB B;  4PYZ A;  1MKE A;  4GOU A;  1C4C A;  4AJY B;  5T8I A;  2N7D A;  4MDK E;  1KC7 A;  3P2B A;  4YSY B;  2ABD A;  4XWW A;  5J2R A;  3CWI A;  1SIJ A;  2GLS A;  3AI5 A;  2YEP B;  3CXB B;  1T3Q A;  3VRB B;  2DZK A;  4AUQ C;  3RYT A;  2JWU A;  3UF8 A;  2CS4 A;  1NTY A;  2WDR B;  3RPF C;  2ZCC A;  2J4X A;  3PVL A;  5BMI A;  2AX5 A;  3ML4 A;  3TW1 A;  5CLQ B;  1FMA D;  1R4M I;  2DBY A;  3Q3M C;  2JRI B;  4KGR A;  1BML C;  1U2B A;  4WJO A;  4A6H A;  4W9C A;  2Z0O A;  5AZF A;  3DHG C;  2FCS A;  2RUK B;  1QIL A;  3ALB A;  3BWU D;  3SFE B;  2EMT A;  1DYN A;  2K00 A;  2JYE A;  2JWZ A;  4JL9 A;  1UGM A;  3A1Q A;  1YD8 U;  3VQI A;  4H2A A;  1ET6 A;  4GDK A;  3PVU A;  3KVF B;  3NUH B;  2VSZ A;  1NBF C;  2Y5P A;  3BVG A;  5FK9 C;  2DHJ A;  4HB2 B;  1BAK A;  4K3C A;  1IBX A;  1F0Z A;  2QSD A;  4FN2 A;  1H4R A;  2WXH A;  4BBN C;  1VDV A;  4ZRQ A;  2LWP A;  2CY4 A;  4GLS C;  4HLE A;  1FPY A;  2LGI A;  2AQ2 B;  1Y8R C;  1DYQ A;  3VTV A;  5KHQ A;  1F1H A;  3BVM A;  1TS3 A;  4A90 A;  2D3C A;  3H9D A;  1ZP0 B;  2J52 A;  1C79 A;  5LXH A;  2LXC A;  1DIK A;  1YOV B;  2R2O A;  3B08 A;  4NAW A;  1KZG A;  3TFM A;  2MBE A;  4LJP B;  1P0R A;  4ZRJ A;  3ZJU A;  1XQQ A;  1KM7 A;  3QX1 A;  1SB3 C;  5LXI B;  2CKH B;  2AEH A;  4C56 C;  3UIN B;  3GZN B;  4MSM B;  2V1Y A;  5IOI A;  1PUT A;  3V6C B;  4HAT B;  1WX9 A;  2BYT A;  2KMM A;  4L1B A;  4WJN A;  3RNF C;  1ZPS A;  1R4N B;  1STE A;  3RCZ A;  1NYQ A;  1T0S C;  4GMV A;  5L95 C;  1B1Z A;  1NDD A;  2KAN A;  3MJ5 A;  4ANX A;  5D3I B;  5M4Y B;  3KZ1 A;  1JWA D;  2JYT A;  2XK5 A;  3TCA A;  2Q13 A;  2COD A;  2Y7B A;  1HEZ E;  2IGD A;  1J8C A;  2DHZ A;  1NEK B;  2WNM A;  3B2G A;  2EKE C;  2KXJ A;  2DEN B;  4P1C C;  4E3C A;  4JPS A;  1M4V A;  3P4Q B;  3MHS D;  1NI2 A;  1L6U A;  5JZE B;  1AWD A;  5BMH A;  4MJS B;  2D9W A;  3SU8 X;  2QDF A;  1V5M A;  3PHW B;  2KFK A;  1ZKH A;  2DLB A;  4F8C B;  5EFX A;  1H10 A;  1ZXI A;  3N30 A;  3PZ7 A;  1E7V A;  1BWN A;  1NI3 A;  4AP4 C;  2KYW A;  1LXD A;  2LOX A;  2BS2 B;  4WH4 A;  1V5U A;  4C80 A;  3I5J C;  3V60 A;  3HIE A;  2QIE B;  2VRR B;  2H7D A;  4HRS A;  3H1U A;  2LJI A;  4JKG B;  1RLF A;  3ENB A;  4MT7 A;  5J18 A;  2CHX A;  2R0D A;  3FEH A;  4P7I A;  5C5B B;  1L0V B;  2RDH A;  1HTQ A;  3AE2 B;  1TY0 A;  1ACA A;  1L5P A;  1A5R A;  2DAJ A;  3KUC B;  3UIO B;  4RGN A;  2ZCB A;  4FJV B;  4TV3 A;  2M56 B;  2O6V B;  1MHH E;  1WX7 A;  2BWE S;  1UEL A;  1XO3 A;  1JAL A;  4HK2 A;  4BOZ B;  1J0W A;  3DBH B;  3BK2 A;  4K2O A;  4GNK B;  3U4E G;  1V5T A;  3B77 A;  3VTU A;  2ZVN A;  4HRO A;  1JW9 D;  1K5G B;  3PTF C;  1S1Q B;  2BYE A;  4PS3 A;  3M1I B;  1TZ1 A;  2Y5B B;  3APC A;  1GAQ B;  1J7C A;  4DHJ B;  2KGX B;  2KR0 A;  2G4D B;  2DX5 A;  3AV8 A;  2Z0P A;  5G5G A;  4YXD B;  2KDM A;  3NSU A;  1SE4 A;  4KIK B;  2D5G A;  4IM0 A;  1WGR A;  4L6E A;  2PKO A;  2KWD A;  1IPG A;  4WWN A;  1XOD A;  4K7S A;  1ZGU B;  3EFU A;  5D94 A;  3RT3 B;  2KAC A;  1CJE A;  1E7P B;  3KW5 B;  1RFA A;  2NBV A;  2IND C;  4G0N B;  4O1N A;  4I6P A;  4M0W B;  3VTW A;  1D5X C;  4HAZ B;  2WHI A;  1QOA A;  3TO1 A;  4HJG E;  4JKB A;  2OHF A;  5CHF A;  2L0F A;  2V4L A;  3ZQ4 A;  4RNA A;  1B55 A;  4E71 A;  3SEB A;  2WH5 A;  4GOC A;  4IUM B;  5JXV A;  3C8Y A;  4HB3 B;  1V8C A;  2JQR B;  2WXR A;  3SFD B;  3OJ3 A;  2L8J A;  1ZM0 A;  2BKF A;  5DCN A;  4XC2 A;  2DYQ A;  4EKU A;  4BBK A;  3DWM A;  4ILG B;  2CU3 A;  3M95 A;  4HCP B;  4XZ4 A;  3PLV A;  2PW9 A;  1UPR A;  4NZL B;  5D3Y A;  2Y3A A;  1C3T A;  1IGC A;  1UPQ A;  3BII D;  3ZRF A;  1W1G A;  4WIP A;  2KFJ A;  3B1L X;  1ZVR A;  1ZW7 A;  2EJ8 A;  2X8X X;  2LHE A;  4LDT D;  1VRA B;  5E6P A;  1AAR A;  2DA0 A;  3PO0 A;  1XT9 B;  2I2Y A;  3EEC A;  1F2R I;  1FGY A;  2MSE D;  4ZOH C;  3RNC C;  3CIR B;  2JT4 B;  3Q8E A;  3EFC A;  1VJK A;  4BOS C;  1L6V A;  5G5H A;  4K2P A;  3G9W A;  4LNO A;  2R2Q A;  2L83 A;  2RRF A;  2JRH A;  2MWS B;  1Y19 B;  1TT5 B;  5GMV A;  2V9H A;  3UZT A;  1P9D U;  5HE2 A;  5C3J B;  5H92 C;  1I4H A;  2KVZ A;  3J9C A;  3IVF A;  2M38 A;  2XNA C;  2NTT A;  3MJW A;  3QK0 A;  4W9H A;  2OJW A;  3RNA C;  1V5O A;  4KX6 B;  1YJ1 A;  1WJ1 A;  3RNG C;  4A6K A;  3NW8 A;  3L4P A;  3O65 B;  5JHA A;  5JP4 A;  2BCJ A;  4IW0 A;  2GI9 A;  1KLU D;  5J3Q A;  2CRF A;  3F0W A;  3TMP B;  4PYU A;  2NR2 A;  3AE9 B;  5D3W A;  1FNU A;  4BKG A;  4RM9 A;  1YQ3 B;  1FNW A;  4GXB A;  2W3S A;  3AE1 B;  2K8B A;  1WGU A;  3ML8 A;  1IUE A;  1CZP A;  3ENE A;  4MEM A;  3FLV A;  2X18 A;  1MPE A;  3K9O B;  3NS1 A;  2QKL A;  2ZKM X;  3AEC B;  2ZW0 A;  2RGN B;  1N63 A;  4GDL B;  2MDX A;  2YSZ A;  3HQC A;  2AL3 A;  2DKP A;  1KOT A;  3GS2 A;  4KHO A;  1IP9 A;  2KJ6 A;  4A8X C;  4A6Q A;  2WXN A;  2K5P A;  3KUZ A;  3UGB B;  5EE3 A;  3VRA B;  4NJ6 A;  3KYD D;  3AEG B;  1D6E C;  3OWE B;  3BK1 A;  4A6F B;  3VH4 B;  1P3R A;  3HSA A;  4L1R A;  1KFY B;  1WJU A;  4WVF B;  2V3N A;  3X23 A;  3D8F A;  1FCC C;  1HXY D;  1AYF A;  2MX2 A;  2RDG A;  4F7Z A;  2DZJ A;  2P8V A;  4B0E A;  2LI5 A;  2RQ1 A;  2N9X A;  5HKH A;  3U30 A;  2AWT A;  3ZTD A;  1CQV A;  1NVL A;  4HAU B;  1VZ8 A;  2ZEQ A;  2MW5 A;  1WG7 A;  4RGT A;  1X11 A;  2PEA A;  3DPD A;  3Q8C A; 
#chains in the Genus database with same CATH homology
 3W1Y A;  3ODW A;  5CHW A;  1T0Y A;  2ZZP B;  2UVM A;  3GYO A;  3PVW A;  1OQN A;  1WM3 A;  3V5W A;  1Y5O A;  4WJP A;  2BYF A;  3CIK A;  4GGQ A;  4MSQ B;  3NOB A;  3V62 A;  4MGZ E;  3T8M A;  2LD9 A;  4E74 A;  4KHB B;  5C16 A;  2ELA A;  2R82 A;  2OQB A;  1P1A A;  3FM8 C;  1I2H A;  2LBB A;  2KKC A;  4D0N B;  3SYX A;  3QWM A;  3APD A;  1MAI A;  1QZE A;  1V6E A;  3SV1 A;  4EZJ A;  1DBH A;  4LDT B;  3JW0 X;  3ECI A;  1DRO A;  3A4R A;  4DDG D;  4ASW C;  3ZNG C;  2JP2 A;  1E90 A;  4KVG B;  4NSW A;  2FIF A;  3BJI A;  1WE6 A;  4GB9 A;  3P6A A;  3H7P A;  3PRM B;  4MGK E;  1X1G A;  3B0A A;  1WF9 A;  2KX0 A;  2MFQ A;  4IWO A;  2ZNV C;  3ULC A;  1FHO A;  2MBB B;  2G4S A;  3GZN I;  2YS1 A;  4OVU A;  3VXW A;  1MIX A;  4FHK A;  1DDV A;  3IBE A;  1R4N I;  4EFO A;  3DCG A;  3WAN A;  2JY6 A;  1U5F A;  1J0G A;  4G11 A;  3WYF B;  4AOF A;  1RAX A;  5DPT A;  1SIF A;  2C5L C;  1EO6 A;  4YL8 A;  3WAO A;  4FJZ A;  4GMX B;  2CR5 A;  1WJ6 A;  3PGE A;  3IG3 A;  4PQ0 A;  2DYN A;  1GNU A;  2M14 A;  2NVU I;  3N3K B;  4GU2 A;  3ZLZ A;  2LYD A;  2J0K A;  3D8E A;  1VBG A;  2D10 A;  4F1S A;  4HXD A;  3L54 A;  3PS6 A;  5D27 A;  2KX3 A;  2MKR A;  2OJR A;  4ZRK A;  2N23 A;  5E6N A;  4FLH A;  4EEW A;  1C1Y B;  4EZL A;  2XBB C;  1XR0 B;  3PPA A;  2K1F A;  2RD0 A;  2LGD A;  3I3T B;  1TBE A;  2L2I A;  3MDB C;  2BKR B;  3DBH I;  1E8Y A;  5DHF B;  4JGH B;  3NZU A;  2KMC A;  3PLU A;  3ZNI D;  2K2J A;  3F5R A;  2MP2 A;  2LAS A;  5JVL A;  4B6H A;  1WMH A;  2K25 A;  4JKA A;  1TXD A;  1X1M A;  2JUO A;  4N9F 4;  2DZI A;  1TTN A;  2BWF A;  1OEY J;  2CQU A;  1FHX A;  2LOZ A;  2KD0 A;  2FCQ A;  3PT2 B;  1XD3 B;  5LOP B;  2FJL A;  4DWF A;  2N9P C;  3A9K B;  1NTI A;  3PV1 A;  3VDZ A;  1KLV A;  2COC A;  3KSY A;  1UBI A;  4M8N A;  3ZDM C;  3UQA A;  2I1K A;  2NCN A;  1AQC A;  3O96 A;  4KV2 A;  3E9P A;  4ZRI A;  2HJ8 A;  4HDO A;  2HD5 B;  2L76 A;  2GS0 A;  2KK8 A;  2KTR B;  2IO3 B;  5DPW A;  3AU5 A;  4PNK A;  5L83 A;  3EHV A;  4KSL C;  2M4N A;  3LDZ E;  4WJQ A;  2KTF A;  3RUL A;  4CHJ A;  3ZNZ B;  4KDL B;  1P6S A;  2LUE A;  1E8X A;  1UNQ A;  1EGX A;  2K6Q A;  1X05 A;  2KJH B;  1FB8 A;  2RSU A;  5DIF B;  4EMO A;  3D8D A;  2G3Q B;  3DXE A;  4WJ7 A;  2KJR A;  3WAL A;  2K39 A;  4DX9 0;  2D11 A;  2O2V B;  3ZVV A;  2REX A;  3AJ4 A;  3QJZ A;  2NBU A;  4BKS A;  3DVN V;  2KDB A;  1NU2 A;  2KCJ A;  4JLC A;  1VBH A;  2LVP A;  5GOW B;  4IM3 A;  5BO4 B;  1GJZ A;  3DQV A;  2FUH B;  4DDI D;  2KDE B;  2W9N A;  3RUI B;  1OY2 A;  2Z0E B;  3EPY A;  1XCG A;  2GOW A;  1F9J A;  2M1M A;  5LLI A;  3S2A A;  1WJM A;  3JSV A;  2MA9 B;  4CYE A;  4FA6 A;  2KC1 A;  2VKI A;  1UNP A;  2LZ6 A;  2L1C A;  2JXX A;  4NQK E;  2Z0Q A;  3KY9 A;  3A1Q B;  1U29 A;  4GDK B;  1WX8 A;  3VAW A;  2FCN A;  1QQG A;  2COA A;  2C7M B;  3RZF A;  1E5W A;  1BTN A;  3A4S C;  2MBQ A;  2ROZ B;  3HK0 A;  2HTH A;  4MEL A;  2UYZ B;  5HE1 A;  1L7Y A;  5C1Z A;  2IO1 B;  1FAO A;  1WGY A;  2W2X D;  3AXC A;  4HDQ A;  4TYZ A;  3LJ3 A;  4OVV A;  2A4Z A;  3PRE A;  2ZJD A;  1ST7 A;  1Q0W B;  1WJ4 A;  3ZTC A;  4NAW B;  3E66 A;  2ROV A;  1HB6 A;  4DHZ B;  2WWZ A;  3VUY A;  4XWX A;  2JPH A;  4M8M A;  5DH9 B;  1ISN A;  4FBJ B;  2L0T A;  3CF6 E;  4JQW C;  5FI1 A;  1WFY A;  3ZIM A;  1ZC3 B;  3U7D A;  4F7G A;  2DX1 A;  4J6I A;  3PG7 A;  3KRW A;  2XK5 B;  1MPH A;  4RMA A;  1L2N A;  1GGO A;  2Y8F A;  3SNH A;  1ZSQ A;  1V81 A;  5J17 A;  2GCJ A;  2YT1 A;  4FAD A;  4I6L B;  1WGH A;  1WRD B;  3Q3J A;  2KDI A;  2KFK B;  2HE7 A;  1Q67 A;  4MH0 E;  1YX6 B;  1XKE A;  2CHZ A;  1Z87 A;  2IZV B;  2VRW B;  3KRX A;  1WVH A;  2DIK A;  3DOW A;  2MLB A;  2NPT A;  2CY5 A;  2N1W A;  2OTX A;  1E7U A;  5KCV A;  1WE7 A;  2JZ3 B;  1KZ7 A;  4W9E A;  3CST A;  4IFS A;  3WIM A;  2LRW A;  5E6O A;  3ZDT A;  4NQL B;  1Z5S B;  2K8H A;  1MIZ B;  3A9J A;  1KBL A;  2LJ5 A;  3T06 A;  2YVC A;  5D3V A;  4KSK C;  2CU1 A;  1LW3 A;  1BTK A;  2ELB A;  2G35 A;  5G55 A;  1WI1 A;  2C9W B;  2DX5 B;  4Z2N A;  1RRP B;  5JLJ B;  2KWC A;  2P0H A;  1OEY A;  1K8R B;  3QC8 B;  1S3S G;  1KJT A;  3QQ8 B;  1W1D A;  3OJ4 B;  2K2U A;  1SE9 A;  1V2Y A;  3HM6 X;  1LM8 B;  2LVO A;  4HAW B;  2NBV B;  4W9D A;  1Q1O A;  4TQ0 A;  4DX8 A;  1WY8 A;  3LJU X;  1JDE A;  2KZR A;  1UH6 A;  4XX5 A;  3SBT A;  3HM3 A;  2UZS A;  2M17 A;  4GN1 A;  3DXD A;  3ZNH B;  2L00 B;  1E8W A;  2ZNV B;  2MQJ A;  2DYB A;  3QHT A;  4W9K A;  1OMW A;  2DAF A;  2FCM A;  3M3J A;  4KZC A;  4GSW A;  4IG7 B;  2D4Q A;  1V61 A;  3H6N A;  3R7Q A;  3DDC B;  3QWZ B;  4ANV A;  2I5F A;  4DXA B;  4GZU A;  3CSF A;  2NMB A;  1PMS A;  2IYD B;  3ODO A;  2FJ9 A;  3VIA A;  2YLM A;  1P3Q U;  3MTN B;  1U27 A;  4HWI B;  4URK A;  5KQ1 A;  2M8S A;  3A8P A;  3A9K A;  5KQ4 A;  3V6E B;  2DHI A;  2V3S A;  2LUL A;  4HHV A;  3AU4 A;  4DHZ E;  2L3Z A;  2N1V A;  4JKF A;  4WAA A;  3UQB A;  2IFS A;  4KZ0 A;  3JVZ X;  2WDT B;  4KDI C;  3T9L A;  2RLO A;  1OQY A;  1WH3 A;  3N32 A;  2LGX A;  3ZW3 A;  1WGD A;  2EMS A;  3TVV A;  2NBW B;  2MBH A;  4LCD E;  4ANW A;  2C7H A;  4IOY X;  3QIJ A;  1X1F A;  3DXC A;  3QA8 A;  3ULB A;  4KHA A;  4MJS A;  2KWV B;  2LG1 A;  3M62 B;  4K81 A;  3N7C A;  3L10 B;  1IRS A;  3K9P B;  3KYC D;  2B3A A;  4B95 A;  2GCL A;  1UEF A;  2RGF A;  1JRU A;  1M94 A;  2ZVO A;  5AZG A;  2GBK A;  4K7U A;  5HE0 A;  2JF5 A;  4JKC A;  3D32 A;  1GC7 A;  4JKG A;  1XX0 A;  3NS8 A;  5J3Y A;  4IAP A;  2LVQ A;  5C5B A;  4X57 B;  3X0W A;  3RD2 A;  2QHO A;  2KQS A;  1ZC4 B;  4IWP A;  4K1R B;  3KUD B;  2D9Z A;  2O6V A;  4EJN A;  1EUV B;  1M7E A;  2N4F A;  3ML9 A;  1FXT B;  1UZX B;  2WYQ A;  3CMM B;  4GIV A;  1EF1 A;  4IM2 A;  4F7U P;  4JK9 A;  2RNR B;  2MWN B;  2IO2 B;  2RPQ A;  1LQB A;  3HW2 B;  2QKM A;  1I42 A;  3SO6 A;  4BBN F;  2KN5 A;  4B9K A;  3PP2 A;  2CAY A;  1WR1 A;  4G3X B;  2L05 A;  1XD4 A;  3V61 A;  1V86 A;  5EDS A;  2YRY A;  4KIK A;  4H8S A;  3SUZ A;  3L17 A;  1P5T A;  1NTV A;  1DDM A;  2A5U A;  3NHE B;  1U5E A;  2MRP A;  2GBR A;  2R09 A;  2JVC A;  2IYB A;  1WXV A;  2N9E B;  3R7R A;  4ICV A;  2DYM A;  4FHJ A;  3BIN A;  4JK7 A;  3PRZ A;  3VVW B;  3ONS A;  2WX0 A;  4TQ1 A;  4BFR A;  2ASQ A;  2KQ7 A;  3OAN A;  3R3M A;  2MBO A;  4DBG A;  4B6W A;  3AUL A;  3M63 B;  4II3 B;  3BY4 B;  2ZPN A;  3PEG A;  5IA7 A;  2COP A;  4NJ7 A;  1EAZ A;  2NS5 A;  4C0A A;  2RR9 A;  1M7R A;  2I5C A;  3IFW B;  4GPT B;  1E8Z A;  3VFK A;  3H7P B;  2AL6 A;  5FI0 A;  2UZR A;  4DK5 A;  1YQB A;  3FSS A;  4JKD A;  2GBM A;  4HB0 B;  1LFD A;  1MK7 B;  3DVN U;  2GBJ A;  2ZPY A;  1SGH A;  1WIA A;  5L81 A;  3JYU A;  2CB8 A;  4EUT A;  4K7W A;  4A5K A;  2BF8 B;  1WZ0 A;  3PHX B;  2IY1 B;  1GC6 A;  4BKS D;  2G45 B;  3RCP A;  2IBI B;  5IAA C;  1UNR A;  4HJK A;  1HE8 A;  5J3T A;  2JZZ A;  3MPX A;  3TBL D;  2DFK A;  4HAV B;  2FID A;  3QBV B;  2KDF B;  3W1S A;  1UD7 A;  3E9L A;  1U5D A;  4FJY A;  3L16 A;  5TR5 A;  5IJM A;  1J19 A;  1AWE A;  5CTR C;  4GDL A;  1KI1 B;  2DN6 A;  2J0J A;  2OOB B;  1N3H A;  1RJ2 A;  3SD5 A;  2J59 M;  5DHA B;  3TL5 A;  3SHQ A;  2KLC A;  4ZYN A;  3PSC A;  2BYV E;  2PPH A;  3ZKJ C;  4A6F A;  5DPS A;  5D2M B;  3VUW A;  5CHV C;  1W1H A;  1EF5 A;  2DYO A;  3P7Z A;  1OGW A;  1P98 A;  3RZW C;  4NY0 A;  1OTR B;  3L0W B;  1K5D B;  3OAW A;  5KHO A;  4MGI E;  1SHC A;  2X0S A;  1IYF A;  3DVG X;  2DLW A;  1WXA A;  1TGZ B;  2IY0 B;  4HAY B;  2IO0 B;  4ILH A;  2MP2 B;  2FNJ B;  2DHK A;  2L7R A;  4JKE A;  1FHW A;  4II2 B;  1WMH B;  4Z2M B;  5CX3 A;  4EZK A;  1LB1 A;  3VOQ A;  4ICU A;  2J7Q B;  2J0M A;  3APF A;  5G2N A;  2PE9 A;  4JIO U;  4I6N B;  1GG3 A;  4EOY A;  1MK9 B;  2KLG A;  1WJN A;  1QC6 A;  4WQO B;  2RSG A;  2I1J A;  1V88 A;  2KHW B;  1VD2 A;  2XQN M;  2PJH A;  2PZ1 A;  3NZS A;  3HIZ A;  4W9I A;  2GMI C;  3ZUN A;  5JHG A;  1YIW A;  3QAR A;  4NNJ B;  4WWP A;  2D9V A;  3GYP A;  4RM8 A;  1X86 A;  2PE6 B;  2V76 A;  1V89 A;  4MK0 A;  2UWQ A;  3ODX A;  4K17 A;  5HE3 A;  1MG8 A;  4W9L A;  4BKT A;  2C7N B;  2H7E A;  4DBB A;  4ANU A;  3SBG A;  1WR6 E;  2LKO A;  5JH5 C;  2XEW A;  1TQZ A;  3R66 C;  2Y8G A;  3FP5 A;  1UBQ A;  2AYO B;  3A33 B;  4IC7 B;  2HRJ A;  2NZ8 B;  2KO3 A;  4HCN B;  4HB4 B;  5D3X A;  1HBK A;  3HHM A;  2KVR A;  4PS8 A;  3QCA A;  1EVH A;  3TIX A;  2Z0D B;  2P0D A;  3UIP B;  2D07 B;  2YS5 A;  3ZRC A;  2DZM A;  4PS7 A;  1H8C A;  5AZH A;  3H7S A;  4HVB A;  4MM3 A;  4Y94 A;  3QAQ A;  2D9X A;  4FUL A;  2KNB A;  3VHT C;  2EC1 A;  3L08 A;  4AWJ A;  3JSV B;  4W9F A;  2KUP A;  1WYW B;  1WXS A;  3U8Z A;  5JHB A;  5DI9 B;  3W1S C;  5D7G A;  1WM2 A;  3PSE B;  2DKQ A;  3WAP A;  5AEK B;  5LON B;  3E9O A;  4IWQ A;  2KWU B;  5C23 A;  4W9G A;  2HTH B;  4HPL B;  4F7H A;  1CMX B;  4JKH A;  1U4A A;  1VCB A;  1WXM A;  2CHW A;  4KAX B;  4A3O A;  3SDL C;  4ILJ A;  3A98 B;  4AJW A;  1DDW A;  2D3G A;  4MY6 A;  2C60 A;  4TUU A;  2BGF A;  2ADZ A;  2K6D B;  3TJP A;  1FGZ A;  3EC8 A;  2LRU A;  3C0R B;  3PRP B;  1I7A A;  1PFJ A;  3DBL I;  3L13 A;  3DVG Y;  1WGG A;  5C79 A;  2W2W A;  5D6J B;  2MCN B;  3ZO5 B;  2K8C A;  5C6R A;  5JHH A;  2FAZ A;  2GBN A;  1WZ3 A;  2BPS A;  4CHM A;  1GUA B;  4CO7 A;  2COF A;  2KTR A;  2N7E A;  1HB8 A;  2YS3 A;  1PLS A;  2N0Y A;  4LJO B;  1V49 A;  4WSF A;  2YT0 A;  4ZDV A;  2KOX A;  3OLM D;  4G50 A;  2RVB B;  2D2Q A;  2GJY A;  1Q5W B;  4A3P A;  1V9J A;  1D3Z A;  2NPT B;  2YF0 A;  3Q3F A;  1V5P A;  1WGQ A;  4W9J A;  2LXA A;  4HAX B;  4YON A;  3VUX A;  2W2X C;  1RRB A;  4TKN A;  5CLL B;  3ZVR A;  2O6V D;  1U5G A;  3KH0 A;  4NPN A;  1V80 A;  2KC2 A;  2DTC A;  2M0X A;  1WI0 A;  3NY5 A;  2P0F A;  2LGY A;  2O2V A;  1Z2M A;  2D9Y A;  2Z59 B;  3WAM A;  1G6J A;  4A20 A;  3A9J B;  3DBR I;  3WA0 A;  4HPM B;  1YX5 B;  5DPR A;  1PQS A;  3GOE A;  4CHK A;  2WX1 A;  1TJ6 A;  5FR6 A;  4DHJ D;  1FOE A;  4WWO A;  1BT0 A;  3VH3 B;  3IHP C;  4BVU C;  3A8Q A;  1I35 A;  2FDQ A;  4JK8 A;  2KMA A;  2E2X A;  4MGY E;  3PZD A;  3DBS A;  4PYZ A;  1MKE A;  4AJY B;  2N7D A;  4MDK E;  1KC7 A;  3P2B A;  2ABD A;  5J2R A;  3AI5 A;  3CXB B;  2DZK A;  4AUQ C;  3RYT A;  3UF8 A;  2CS4 A;  1NTY A;  2ZCC A;  3PVL A;  3ML4 A;  3TW1 A;  5CLQ B;  1R4M I;  2JRI B;  1U2B A;  4WJO A;  4A6H A;  4W9C A;  2Z0O A;  5AZF A;  2FCS A;  2RUK B;  3ALB A;  2EMT A;  1DYN A;  2K00 A;  2JWZ A;  4JL9 A;  1UGM A;  3A1Q A;  1YD8 U;  3VQI A;  4GDK A;  3PVU A;  3KVF B;  2VSZ A;  1NBF C;  2DHJ A;  4HB2 B;  1BAK A;  4FN2 A;  1H4R A;  4BBN C;  2LWP A;  2CY4 A;  4HLE A;  1Y8R C;  3VTV A;  5KHQ A;  3H9D A;  5LXH A;  2LXC A;  1DIK A;  2R2O A;  3B08 A;  4NAW A;  1KZG A;  3TFM A;  2MBE A;  4LJP B;  1P0R A;  4ZRJ A;  1XQQ A;  1KM7 A;  3QX1 A;  5LXI B;  2CKH B;  2AEH A;  3UIN B;  4MSM B;  2V1Y A;  3V6C B;  4HAT B;  1WX9 A;  4WJN A;  3RCZ A;  4GMV A;  5L95 C;  4ANX A;  1NDD A;  2KAN A;  3KZ1 A;  2XK5 A;  3TCA A;  2Q13 A;  2COD A;  2Y7B A;  1J8C A;  2DHZ A;  2EKE C;  2KXJ A;  2DEN B;  4E3C A;  3MHS D;  1NI2 A;  5JZE B;  4MJS B;  2D9W A;  3SU8 X;  1V5M A;  3PHW B;  2KFK A;  1ZKH A;  4F8C B;  5EFX A;  1H10 A;  3N30 A;  1E7V A;  1BWN A;  4AP4 C;  1LXD A;  2LOX A;  1V5U A;  3V60 A;  2VRR B;  2H7D A;  3H1U A;  4JKG B;  1RLF A;  3ENB A;  4MT7 A;  5J18 A;  2CHX A;  2R0D A;  3FEH A;  4P7I A;  5C5B B;  1ACA A;  1A5R A;  2DAJ A;  3KUC B;  3UIO B;  2ZCB A;  4FJV B;  4TV3 A;  2O6V B;  1WX7 A;  2BWE S;  1UEL A;  4HK2 A;  4BOZ B;  1J0W A;  4K2O A;  1V5T A;  3VTU A;  2ZVN A;  1K5G B;  3PTF C;  1S1Q B;  2BYE A;  4PS3 A;  3M1I B;  1TZ1 A;  2Y5B B;  3APC A;  4DHJ B;  2KGX B;  2G4D B;  2DX5 A;  2Z0P A;  3NSU A;  4KIK B;  4IM0 A;  1WGR A;  4L6E A;  1IPG A;  4WWN A;  1XOD A;  4K7S A;  1ZGU B;  3EFU A;  5D94 A;  3RT3 B;  3KW5 B;  1RFA A;  4G0N B;  4I6P A;  4M0W B;  3VTW A;  4HAZ B;  3TO1 A;  4JKB A;  5CHF A;  2L0F A;  2V4L A;  1B55 A;  4E71 A;  2WH5 A;  4GOC A;  4IUM B;  4HB3 B;  3OJ3 A;  2L8J A;  1ZM0 A;  2BKF A;  5DCN A;  4XC2 A;  2DYQ A;  4EKU A;  4BBK A;  4ILG B;  3M95 A;  4HCP B;  4XZ4 A;  3PLV A;  1UPR A;  5D3Y A;  1C3T A;  1UPQ A;  3ZRF A;  1W1G A;  2KFJ A;  3B1L X;  1ZVR A;  1ZW7 A;  2EJ8 A;  4LDT D;  5E6P A;  1AAR A;  2DA0 A;  1XT9 B;  3EEC A;  1FGY A;  2MSE D;  2JT4 B;  4BOS C;  4K2P A;  3G9W A;  2R2Q A;  2JRH A;  2MWS B;  1Y19 B;  5GMV A;  3UZT A;  1P9D U;  5HE2 A;  3IVF A;  2M38 A;  3MJW A;  3QK0 A;  4W9H A;  1V5O A;  1YJ1 A;  1WJ1 A;  4A6K A;  3O65 B;  5JHA A;  5JP4 A;  2BCJ A;  4IW0 A;  5J3Q A;  2CRF A;  3F0W A;  3TMP B;  4PYU A;  2NR2 A;  5D3W A;  4BKG A;  4RM9 A;  4GXB A;  2K8B A;  1WGU A;  3ML8 A;  3ENE A;  4MEM A;  3FLV A;  2X18 A;  3K9O B;  2QKL A;  2RGN B;  4GDL B;  2MDX A;  2YSZ A;  3HQC A;  2AL3 A;  2DKP A;  1KOT A;  4KHO A;  1IP9 A;  2KJ6 A;  3KUZ A;  3UGB B;  4NJ6 A;  3KYD D;  4A6F B;  3VH4 B;  1P3R A;  1WJU A;  4WVF B;  3X23 A;  3D8F A;  2MX2 A;  4F7Z A;  2DZJ A;  2P8V A;  2LI5 A;  2RQ1 A;  2N9X A;  5HKH A;  3U30 A;  2AWT A;  3ZTD A;  1NVL A;  4HAU B;  2ZEQ A;  2MW5 A;  1WG7 A;  1X11 A;  2PEA A;  3DPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...