2ZQ8A

Apo structure of class a beta-lactamase toho-1 r274n/r276n double mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Improvement of crystal quality by surface mutations of beta-lactamase Toho-1
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 94
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zq8A00
3GQZA 5CGXA 2IWBA 1KGEA 2ZQ7A 5F82A 4OH0A 3ITBA 5AQBA 1BSGA 4UHUA 3WRTA 1XA1A 4JKTA 3IF6B 1ZG4A 4MBFA 3SH7A 2WZZA 3M6HA 2OSUA 4DXBA 2Y2IA 2FFYA 2VGJA 5HFOA 1RGZA 5GLBA 3FKVA 4PMAA 2Y2KA 1ES5A 1NZOA 2XFSA 4JXVA 4EUZA 3FZCA 4C3QA 1NZUA 3G2YA 3S1YA 3PBRA 3C7VA 4LV1A 3VOYA 1OMEA 3IF6A 2OV5A 3NY4A 2BG1A 1EI5A 4OPRA 4DE0A 4S2IA 1LL5A 1W79A 3DTMA 4NETA 4UA9A 1YLJA 4OP8A 1HD8A 1MBLA 4S2MA 1BUEA 5EOEA 1HZOA 3BLMA 2EX2A 3G31A 3NCKA 4WZ4A 3HLWA 5A91A 3UO9A 3BFDA 3V5MA 2EXBA 1L2SA 3SH9A 1LI0A 2V1ZA 4BLMA 4IBRA 1KVLA 4F94A 5FSRA 5I94A 2BLSA 4OOLA 5EPHA 4QY5A 3TOIA 3CMZA 4PPRA 4QJGA 1PYYA 1E3UA 1PW8A 3OPHA 4LV2A 4JXSA 3AGEA 3N7WA 2ZQ9A 4RX2A 4QY6A 1XKZA 1W5DA 1ERQA 5CHUA 3MKEA 3UDFA 1WYCA 2X02A 3ZG7B 4YINA 4N1XA 1SDEA 4BJPA 4R1GA 3HL9A 2WAFA 4JF5A 5FDHA 2XD1A 5GHYA 3ZG8B 4E6WA 4C6YA 1PWGA 3Q7ZA 5CERA 2ZMAA 5CHJA 3SS4A 2JC7A 4GZBA 3NBLA 2X71A 4S2KA 1HTZA 3S4XA 4R4SA 2G2UA 4X69A 5EE8A 4ZDXA 3VMAA 5FQIA 2R9XA 1JWVA 1N9BA 4ID4A 2RCXA 3NDGA 3ZCZA 3CJMA 3Q82A 4PM7A 1YQSA 4WYYA 2HP6A 4E6XA 3O86A 4KENB 3VSKA 3VFHA 2ZC4B 3C4OA 1I2SA 2Z2LB 3OPPA 3A3DA 4S2JA 3C5AA 3UDIA 1M6KA 2HDSA 1KVMA 3GRJA 4K0WA 3TSGA 3ZNTA 5CXWA 2EX6A 1FR6A 2WAEA 4S2NA 4BQMA 1GA9A 4H8RA 3OCLA 4ZJ3A 3SS3A 4FSFA 3V39A 4E3IA 1BZAA 5TR7A 4OQIA 1H8YA 2H10A 3ZVWA 4GN2A 4KQQA 3SH8A 3FWLA 4JLFA 5EECA 4B4XA 1RCJA 5L2FA 1EROA 1IYSA 1E25A 1QMEA 1S6RA 2XH9A 4Y7PA 1K6RA 1DJBA 3PBNA 2WKEA 2WKHA 1FSYA 3V3RA 1CEFA 4HBTA 2XK1A 3UY6A 2J9PA 5A92A 4GOGA 1NYYA 3IF6C 5J8XA 1YMXA 3UPOA 2ZM0A 1U60A 4N9LA 1XXMA 4XXRA 3PBSA 4A5RA 3ZVTA 4E3OA 4P6BA 4R23A 3O3VA 3PBQA 3IHAA 1Z6FA 4FCFA 3P09A 5DVAA 5DTSA 2QMIA 1SCWA 4XUXA 5HAQA 1K6SA 1ONGA 4MBHA 1KDWA 1FR1A 3UDXA 3BECA 1PWDA 1SDNA 1FCMA 5F1FA 3EQVA 1JWZA 1K56D 5U47A 4KG5A 3C7UA 2V2FF 3QNCA 4RA7A 4S2LA 2JE5A 1RGYA 3NI9A 3G35A 1PZPA 4HESA 1I2WA 3BRMA 3LCEA 4LCMA 1YLPA 3O88A 3BFEA 5GL9A 5CEDA 1K25A 4MLLA 1BTLA 1KE3A 3TG9A 1NXYA 4EWFA 2WADA 3WS5A 4DE3A 3ZDJA 4FD8A 4Z9QA 1CEGA 1FCNA 3AGFA 3UE0A 2OLUA 1LL9A 3G4PA 5KSCA 4E3KA 1ESUA 3IXGA 1DY6A 4WEKA 4KZ5A 2Z2MB 4C75A 2Y2LA 4KZ4A 1NY0A 2FFFB 1SKFA 5EOOA 3HLCA 3W4QA 1AXBA 5FQ9A 4GD6A 1PIOA 1M40A 3N8RA 3UE3A 3HLEA 1XPBA 1XGJA 3MZEA 4JXGA 2HDUA 1K38A 1ES4A 4L0LA 4QU3A 3S22A 1LI9A 1MWUA 5GLAA 3DWZA 4QD4A 1LHYA 5HAPA 1WE4A 5EVID 3Q07A 4OONA 4ZAMA 3E2KA 1PI5A 5GHXA 4IBXA 4KZ7A 4EQIA 4ZJ1A 1L0DA 5FA7A 3G32A 3HLFA 4P0MA 1K57A 5BOHA 5CTMA 1XP4A 2ZD8A 3IWIA 2WYXA 3LEZA 3OPLA 4S2NC 5E2HA 1BLHA 3UE1A 4X6TA 1JTDA 4OP5A 2Y2PA 1W8QA 2PU4A 2ZC6B 4IVKA 3VP3A 2WKIA 4OKPA 1L0EA 3VOZA 4E3NA 3OC2A 3G34A 2DRWA 2DNSA 4RYEA 2XLNA 3OPRA 1H5XA 3GR2A 3G2ZA 4O7DA 3MZDA 1GHMA 2XEPA 1DJAA 3BYDA 3UPPA 2WGVA 3M2KA 4N92A 4OPZA 3WS1A 2Q9MA 3BFGA 3GSGA 4UA7A 2QPNA 3LY3A 5EUAA 2ZQDA 3SS5A 4IEDA 5KZHA 5FAQA 1XX2A 5CECA 4GDNA 3WWXA 5FI2A 4ZJ2A 3MBZA 4Q8IA 2HPBA 2Y2HA 4RX3A 2Y91A 2ZQCA 4GB7A 2PBYA 4BD1A 4OOMA 1YLZA 4M3KA 5AQ9A 5CEBA 1MPLA 2Q9NA 3IXHA 5CGSA 3QNBA 4D2OA 4EBPA 4JBFA 3WS0A 1K56A 1ES3A 4BENA 3LY4A 3BEBA 4S2PA 2ZJ9A 3HLBA 2EX8A 2Y55A 1ALQA 1KDSA 1BLCA 2J7VA 2E8IA 1PI4A 3GVBA 4JXWA 2Y2NA 2A3UA 3PBTA 1G68A 1TVFA 2XQZA 1PWCA 3AGDA 1DJCA 1KE0A 3FV7A 3A3JA 3M6BA 4Y0UA 3HBRA 2ZLYA 2EX9A 4DKIA 3C4PA 2HP9A 3VSLA 5HW3A 4B88A 1NYMA 4XUZA 2RL3A 1Q2PA 2IWCA 5EVIB 3I7JA 5M19A 3HUOA 3NDEA 1TDLA 3D4FA 1IYQA 3QHYA 1VM1A 3RXXA 2QZ6A 1KE4A 4WEJA 3ZHHA 5A90A 3VP0A 2ZC5B 2ZM8A 4S2OA 3MZFA 4X53A 3FYZA 1JWPA 1C3BA 1MY8A 1YLWA 5M1AA 2WGWB 3EQUA 4OLGA 3W4OA 2P9VB 1ERMA 5CRFA 2Y59A 2UWXA 4U3TA 5EVIA 3ZNYA 3VP1A 4YFMA 1NRFA 5F83A 4OQGA 4X68A 5FQQA 2Y2JA 4QHCA 4LV3A 3GTCA 5FATA 2XD5A 4KG2A 3WS4A 1W8YA 5IHVA 1K57C 1ES2A 4PM6A 5HARA 4DF6A 4GDBA 1WYBA 4DE2A 2WGWA 5DTKA 1CI8A 1QMFA 3UNWA 2P9VA 1BULA 3UN7A 3PAGA 1K55A 4OPYA 4CPKA 2CC1A 4BL3A 3MFDA 5KMWA 3HLDA 4KZ8A 2XDMA 4ZTKA 4R4RA 3UPNA 5GLDA 1GHIA 1PZOA 3OCNA 4N1HA 5FQMA 5HL1A 3IF5A 3ITAA 2JCHA 1K4EA 3DW0A 5FQJA 3A3FA 1GA0A 1ZKJA 1O07A 4X56A 2VGKA 1BLPA 2Y2OA 3VP2A 2B5RA 1ZG6A 4WZ5A 4PM8A 1MWSA 2ZC7A 5AQ7A 1L0GA 4UAAA 4DDSA 2WGIA 3WS2A 4GD8A 2HDRA 5FASA 2A49A 3V50A 4OQHA 3IH9A 4LENA 1VQQA 2PU2A 4KQRA 3Q81A 4NK3A 5KSHA 1EWZA 3P98A 4ZBEA 3ZFZA 5CGWA 3V3SA 3DWKA 5DTTA 2C5WB 5CHMA 1GHPA 4Y0OA 1JVJA 2P74A 2XGNA 3ZG0A 1IYPA 3RJUA 1IEMA 5DF9A 4IVIA 1ZC2A 4LV0A 3JYIA 3N6IA 2JBFA 1PW1A 3ZG5A 2OLVA 1XA7A 2GDNA 3CG5A 4P87A 4Y0TA 5A93A 4EV4A 1CI9A 3VFFA 5E2EA 1Q2QA 4FH4A 4WELA 3PAEA 4OVDA 3FKWA 2XF3A 4WBGA 1BT5A 5D3OA 4WMCD 2HDQA 3IHBA 1L0FA 3MKFA 3BFCA 3O87A 1N4OA 3GMWA 3HVFA 3CZDA 2HP5A 1YM1A 1O7EA 5DF8A 3HUNA 3M2JA 3BLSA 4DDYA 2C6WB 4LCLA 4EBLA 4K0XA 4MNRA 4GNUA 3NC8A 2EXAA 1K54C 4QB8A 3N8SA 5HAIA 2IWDA 4KQOA 3SOIA 4R3JA 5FI6A 1LLBA 4OLDA 2ZQ8A 4JPMA 5FAPA 3GV9A 3LO7A 4DE1A 5E43A 2H0YA 5FI7A 3BM6A 1JTGA 3PTEA 3VP4A 3OZHA 2WZXA 3BFFA 5JYOA 1XGIA 1MXOA 5EVIC 1IYOA 4FH2A 1TEMA 2I72A 3E2LA 1MWTA 2J8YA 3IXDA 1E4DA 4EBNA 2Y2MA 5AQAA 2V20A 2EFUA 4CJNA 2H5SA 1S0WA 2Y4AA 4DXCA 1I5QA 2X01A 3NIAA 1ONHA 4U0XA 1FQGA 5E2FA 4R0QA 5TFQA 1YLTA 1HVBA 1NJ4A 3HLGA 4HBUA 3PBOA 2ZC3B 4KZAA 1K55C 5EVLA 3A3EA 1G6AA 3HREA 1FOFA 4KZ9A 3MXRA 1E3UD 3Q1FA 1W7FA 5TGFA 4OOYA 1KGGA 2XFTA 3IXBA 1K54A 4U0TA 5CTNA 3W4PA 1IKIA 1J9MA 3N8LA 4P85A 4K91A 3WRZA 3ZG9B 1TDGA 3Q7VB 4RVAA 4E3JA 3N4IA 2WUQA 1KGFA 3ZGAB 2EFXA 1FCOA 1YMSA 4JF6A 1MKIA 1SHVA 1H8ZA 4KG6A 4KZ6A 4WZ5C 3HUMA 4HEFA 3IWOA 2WK0A 3RXWA 4B4ZA 5FAOA 3IQAA 5E2GA 4N9KA 3B3XA 4R3BA 2Y2QA 1K4FA 3IH8A 5DF7A 5FQKA 3W8KA 4BD0A 2J9OA 4KZBA 2DCFA 5GLCA 4PM9A 2Y2GA 5G18A 2R9WA 4E3LA 1ESIA 3Q7VA 3A3IA 3ISGA 5M18A 1RP5A 4MBKA 4PM5A 4OQ0A 4JF4A 4WM9A 4BL2A 1CK3A 2H0TA 4MEZA 5GHZA 1IELA 1IKGA 4DRTA 3IWQA 2ZM2A 5F1GA 1BLSA 3IT9A 3MXSA 5HX9A 4UA6A 2XR0A 1Y54A 1YT4A 1FSWA 1MWRA 2G2WA 3G30A 4KZ3A 1YLYA 4X55A 4GKUA 4E3MA 5JYPA 4OPQA 4WMCA 1GCEA 2ZQAA
chains in the Genus database with same CATH superfamily
4IHQA 5IT5A 3F1OA 3NJAA 5F82A 3ITBA 1XA1A 4JKTA 1J3WA 2OSUA 4DXBA 2Y2IA 5HFOA 2A2LA 3FKVA 4PMAA 2JKFA 1NZOA 2XFSA 3G2YA 3S1YA 3IF6A 3NY4A 3EOIA 2W3FA 4OPRA 4S2IA 3DTMA 3NOUC 4MDZA 1BUEA 1HZOA 3BLMA 3NCKA 3G31A 4WZ4A 3HLWA 3V5MA 2EXBA 2M1CA 4F94A 4IBRA 2BLSA 3A0RA 3G6OA 3AGEA 4MN5A 1VEUB 4RX2A 5IU1A 1XKZA 4I3IA 3UB6A 2BASA 5HDDA 4G3VA 4YINA 3TJZC 2ZOHA 1SDEA 4BJPA 3CITA 2WAFA 2XD1A 5DFXA 5I5LA 4C6YA 3S7QA 3Q7ZA 3NBLA 1HTZA 2J3TD 5FQIA 2JHEA 2RCXA 3NDGA 3CJMA 4Y15A 3VFHA 4DN0A 3OPPA 3A3DA 4S2JA 4K0WA 4DJ3A 5CXWA 4NXEA 4Y3IA 4BQMA 1GA9A 3CPTA 4H8RA 1D7EA 5TBMA 3OCLA 1VETB 3V39A 1WA9A 3SH8A 1Y28A 3MF0A 1EROA 1QMEA 4Q0HA 1DJBA 1W63Q 3UY6A 1NYYA 5F6AA 4N9LA 3CUEC 3PBSA 4A5RA 3ZVTA 1P9WA 3IHAA 3D9YA 1Z6FA 2JN7A 5KIZA 5DVAA 1K6SA 5HWVA 3UDXA 5AVFA 1FCMA 3RFBA 3LUQA 3C2WA 4KG5A 3C7UA 4RA7A 1G5UA 2JE5A 5AJGA 1I2WA 1YLPA 5CEDA 1KE3A 1NXYA 5C5KA 3UE0A 1LL9A 4HH3A 1S4RA 4E3KA 2Z2MB 3PR6A 3MQQA 3NECA 1ACFA 1K38A 1ES4A 3MSHA 4QU3A 4HI4A 4EU0A 1A0KA 4NXFA 1PI5A 4BMWA 4KZ7A 4ZJ1A 3C8CA 1L0DA 5TJJA 2GX5A 5BOHA 2V1AA 2ZD8A 2WYXA 3OPLA 3DAVA 4S2NC 3OOVA 2Y2PA 2PU4A 2ZC6B 2HF6A 1TD5A 2WKIA 3VOZA 5EVEA 2DRWA 2DNSA 2EA9A 3MQOA 4FTXA 4Z1WA 3G2ZA 2NUPC 3FPWA 2HV1A 3IS2B 2WGVA 3UPPA 1FIKA 3BFGA 4UA7A 5EUAA 5FEGA 2ZQDA 4GDNA 4ZJ2A 4Q8IA 2HPBA 3BQAA 5HDCA 4BD1A 1YLZA 4M3KA 3IXHA 5CGSA 4JBFA 2KX6A 2ZJ9A 3HLBA 4NXBA 2EX8A 1KDSA 3GVBA 2A3UA 1TVFA 1XJ4A 3AGDA 1DJCA 3M6BA 4Y0UA 2EX9A 3MJQA 2HP9A 5HW3A 2UV0E 3F1NA 3I7JA 1TDLA 3D4FA 1ZHHB 1VM1A 1T1BA 1KE4A 3VP0A 4R70A 1C3BA 1YLWA 2WGWB 3EQUA 3W4OA 1ERMA 5EVIA 3VP1A 5F83A 4X68A 4GS9B 3GTCA 2XD5A 4KG2A 1W8YA 2FZ0A 5DTKA 1QMFA 2B02A 3PAGA 4OPYA 4G3WA 4ZTKA 4R4RA 5F68A 1GHIA 1PZOA 3ITAA 3TW8A 5FQJA 1GA0A 2B5RA 4HOIA 4NXGA 4R3AA 4PAUA 1L0GA 4UAAA 2HJEA 3WS2A 3V50A 2PU2A 3P98A 4ZBEA 3V3SA 1JVJA 5HD3A 3T1QB 2G7UA 4Y0TA 1H0MA 2ZOIA 3QP8A 4ESPA 4EV4A 1CI9A 2W1TB 1Q2QA 4WELA 5E2EA 3P7NA 2XSSA 2QHKA 2XF3A 1BT5A 5F69A 3IX3A 4JGRA 1L0FA 4F3LA 1YM1A 2P7JA 2ZL1B 5DF8A 2M7UA 3M2JA 4EBLA 4LCLA 4MNRA 3VV4A 5DKKA 4DMZA 3N8SA 5HAIA 3C30A 3SOIA 4R3JA 4OLDA 2OWJA 2ZQ8A 3GV9A 5E43A 5L8MA 2H0YA 1GSVA 1XJ6A 4P6ZM 3OZHA 4GHIA 2WZXA 3UB7A 3LIAA 3BFFA 1MXOA 1IYOA 4EESA 1YPRA 1MWTA 2PYRA 4EBNA 2Q0OA 2V20A 2Y4AA 5DJUA 4DXCA 3NIAA 1FQGA 2VV6A 5J4EA 1K55C 5EVLA 4KZ9A 3MXRA 5HWWA 3HCYA 1KGGA 2XFTA 3IXBA 1K54A 3N8LA 4P85A 4K91A 1H3QA 1DP9A 3N4IA 3ZGAB 2EFXA 1YMSA 1MKIA 4KZ6A 2L0WA 3IWOA 3IQAA 4ARZB 4R3BA 1K4FA 5DF7A 2J9OA 4KZBA 2DCFA 3PHYA 4E3LA 1N9OA 3ISGA 4I3JA 1RP5A 4BL2A 3F1OB 5GHZA 4Y17A 4X1LA 1VB6A 1BLSA 2QJ7A 3MXSA 3MS6A 1FSWA 3G30A 4X55A 4GKUA 1LT0A 4WMCA 2ZQ7A 4OH0A 4LPZA 1CJFA 3IF6B 4CQHA 4MBFA 2P08A 4HQAA 2WZZA 3R4KA 3TRCA 2VGJA 1RGZA 5DJTA 3T50A 1ES5A 4EUZA 3EEHA 4P6ZS 1NZUA 3C7VA 4LV1A 2PR6A 3KX0X 4JGQA 3CUEA 2XA7S 4Y5FA 4UA9A 3MR0A 5FL3A 4MN7A 1L2SA 2VV8A 1LI0A 1KVLA 1OTBA 5EPHA 3TOIA 2ZMVA 4QJGA 1PYYA 4JXSA 3N7WA 1ERQA 2QYBA 4JGPA 3LIEA 5CHUA 3MKEA 1WYCA 3ZG7B 2OWHA 4R1GA 3LEQA 5GHYA 3ZG8B 2KDKA 4GZBA 4X69A 5EE8A 3VMAA 1TS7A 3F1PA 1G28A 3Q82A 4HY8A 4PM7A 5TBMB 4D60A 2Z2LB 2ACGA 3C5AA 3UDIA 2HDSA 1KVMA 1TF1A 1FR6A 4S2NA 4PHTA 4KQDA 4ZJ3A 2L1MA 4FSFA 4E3IA 5IS1A 4NKPA 4OQIA 4GN2A 4WL9A 5L2FA 1RCJA 1E25A 3OLOA 4Y7PA 2WKHA 1P9RA 1CEFA 3UPOA 3K2NA 1U60A 4P6BA 2HZ5A 5EM0A 3O3VA 4EQ1A 2FH5A 4FCFA 3P09A 5DTSA 1SCWA 1UWNX 4FOFA 5HAQA 4MBHA 2VEAA 1FR1A 2PD7A 4HH2A 1SDNA 3D3OA 3JPUA 1UWPX 4UEYA 3G35A 4LCMA 3BFEA 1K25A 1MZUA 2PYPA 3WS5A 4FD8A 1FCNA 3AGFA 4HP9A 3QP5A 1ESUA 1DY6A 4C75A 4KZ4A 1NY0A 2FFFB 1SKFA 5EOOA 3W4QA 2PD8A 1T19A 4GD6A 5G4ZA 1PIOA 3N8RA 3HLEA 1XGJA 3NHQA 1P97A 4L0LA 1AWIA 1S67L 3DWZA 4QD4A 1LHYA 5HAPA 1WE4A 5EVID 3Q07A 5GHXA 4CLCE 3CHWP 2V8FA 4P0MA 1XP4A 3KSGA 1BLHA 2YKFA 1L0EA 2XLNA 3OPRA 1H5XA 3GR2A 4GJ4A 4O7DA 1GHMA 2A24B 2WKRA 3GSGA 4XT2A 3SS5A 5KZHA 1T18A 1XX2A 4H6JA 5AVEA 5FI2A 2Y2HA 3QP2A 1CF0A 4RX3A 2W3EA 5K5BA 4OOMA 5LBRA 2V1BA 2Q9NA 4EEUA 3QNBA 4D2OA 1S66L 4AFIA 3EGXC 3BEBA 4S2PA 1OJGA 3F1NB 5HSQA 1OTEA 3CI6A 1PI4A 4I39A 1G68A 1PNEA 4IJGA 1KE0A 1F98A 3A3JA 2O0YA 4DKIA 3VSLA 1NYMA 2RL3A 2IWCA 5EVIB 3NDEA 3QHYA 2VK3A 3FYZA 1JWPA 2W1RA 1D06A 5CRFA 3ZNYA 2UWXA 1V9YA 4YFMA 1K0KA 4CLCC 5FQQA 4QHCA 2XRNA 3B42A 1OJ5A 3S7PA 5HARA 4X1MA 2P9VA 1BULA 1DP6A 3T12B 1K55A 1YKDA 2CC1A 3MFDA 4HIAA 1IOUA 4X25A 3OCNA 5FQMA 2JCHA 1K4EA 1YSQA 3GECA 3A3FA 4QPRA 4X56A 1O07A 1BLPA 1ZG6A 2HDRA 5FASA 5EV0A 4OQHA 1VQQA 4NK3A 5KSHA 2B18A 4WN5A 3ZFZA 1PFLA 3DWKA 5CHMA 3H82A 1GHPA 3KO6A 2EWWA 4O0PA 2XGNA 3ZG0A 3RJUA 2GJ3A 4IVIA 4LV0A 2W3GA 3JYIA 3N6IA 4F3LB 1LSVA 1XA7A 2GDNA 3K3CA 5A93A 3FKWA 4WBGA 5D3OA 4WMCD 1L3LA 4B93A 4NG2A 3BFCA 1N9NA 2INWA 4ETZA 1N4OA 3GMWA 3HVFA 3ICYA 3ZQ5A 4GHIB 2C6WB 4II7A 4QB8A 3MXQA 3VE3A 3KYEA 4UQIM 1LL8A 3LO7A 3BM6A 3PTEA 3MQ0A 4FH2A 2IA2A 1E4DA 4CJNA 4R38A 1I5QA 2X01A 4MCWA 1HVBA 2ZC3B 1P0ZA 1S1ZA 1FOFA 3BY8A 1DRMA 3W4PA 1YSPA 4I38A 3RTYA 3DTEA 3TE8A 1FCOA 4JF6A 4B4ZA 4NEED 5E2GA 4N9KA 4GCZA 2Y2QA 5FQKA 4PM9A 3Q7VA 3H7WB 4G3KA 4MEZA 1IELA 3IX4A 3IWQA 1GSWA 3EEAA 5F1GA 5HX9A 1UGUA 1YT4A 2M7VA 1MWRA 2G2WA 5HPIA 4E3MA 4GLQA 4OPQA 5HDSA 2ZQAA 3GQZA 1KGEA 2JKRI 3FPVA 5AQBA 4KUKA 1BSGA 4UHUA 3WRTA 1ZG4A 3SH7A 4LRYC 4WUJA 3E4QA 2Y2KA 2K2NA 2VZWA 3FC7A 4HJ3A 4C3QA 2JKTI 3T4LA 3VOYA 1OMEA 2OV5A 4DE0A 1LL5A 1W79A 4NETA 3VOLA 1YLJA 4S2MA 3BFDA 2V1ZA 4BLMA 5I94A 5FSRA 3CMZA 4LV2A 2ZQ9A 1W5DA 1N9LA 2GZAA 2X02A 5L07A 3T4JA 3F1PB 3HL9A 2VGLM 5CERA 3KYZA 2ZMAA 4MN6A 4R4SA 2G2UA 4ZDXA 1MKMA 2R9XA 1JWVA 1XFQA 1YQSA 4E6XA 4KENB 2ZC4B 4Y13A 1SKOA 1M6KA 3GRJA 3TSGA 4RQ9A 2J80A 1V9ZA 5TR7A 1H8YA 4K08A 4KQQA 1S1YA 4B4XA 4BWIA 2XH9A 1S6RA 3E4PA 1K6RA 1FSYA 2P04A 3V3RA 3LICA 3UB9A 5A92A 2ZBBA 4XXRA 4E3OA 3CWFA 2JKRM 4R23A 3PBQA 3LYXA 2QMIA 3NULA 5FEFA 4XUXA 3C38A 3KSHA 3BECA 5F1FA 1JWZA 5U47A 3QNCA 2JKTM 1PZPA 4ME4A 3BRMA 3LCEA 1Z09A 5HPFA 1BTLA 4O8GA 2WADA 4DE3A 2V9AA 4Z9QA 3S7OA 1CEGA 2OLUA 3G4PA 4WEKA 4KZ5A 2Y2LA 3EGDC 2VGLS 1BYWA 1TS0A 3UE3A 4JXGA 2HDUA 3S22A 3UE6A 2VKSA 5EFWA 5HZHA 3IX8A 4LRXC 4CLCA 3E2KA 1Y4OA 4IBXA 4EQIA 3LR5A 5FA7A 3IWIA 3LEZA 5E2HA 1H8MA 2JKGA 3UE1A 3D72A 3QP6A 4X6TA 1JTDA 1W8QA 4XT2B 5F5YA 4IVKA 3VP3A 2W0NA 1SZVA 4OKPA 4E3NA 3OC2A 3G34A 4H6JB 3CAXA 2O9CA 3MZDA 1JNUA 3PYPA 2XEPA 1CQAA 1TS8A 3WS1A 3LY3A 4L9FA 4IEDA 3CPTB 5CECA 3WWXA 3H9WA 2PBYA 2PR5A 1T1CA 4EBPA 2PRFA 3T4KA 1K56A 3WS0A 3LY4A 4L9GA 5J3WA 1ALQA 1BLCA 2E8IA 4JXWA 2Y2NA 3PBTA 2XQZA 1IFQA 3FV7A 3HBRA 2EWVA 2ZLYA 2MJ6A 3C4PA 4YNRA 3O5YA 2VV7A 3HUOA 4YWZA 3RXXA 3MZFA 4X53A 3GDIA 1MY8A 2J3TC 4OLGA 2P9VB 3LGOA 4O01A 1HLUP 3ULFA 2Y59A 4U3TA 3UMEA 4OQGA 4LV3A 3LIDA 3IBRA 3WS4A 5IHVA 1K57C 1ES2A 4EXOA 4GDBA 4DE2A 4EETB 3UNWA 1CI8A 3UN7A 3UB8A 5CX7A 2O99A 2Z6CA 4BL3A 3HLDA 4KZ8A 2XDMA 1F2KA 3UPNA 5GLDA 4N1HA 3IF5A 3B33A 1ZKJA 2VGKA 2Y2OA 3UB5P 3H82B 4ZRRA 4LLOB 3BY9A 1OT9A 5AQ7A 4DDSA 4GD8A 3LI8A 2A49A 3IH9A 4E04A 1KOUA 4KQRA 3Q81A 3VE4A 1DP8A 4EERA 2C5WB 5DF9A 1IEMA 3MFXA 2JBFA 4P87A 3LFVA 3PAEA 3V67A 3IHBA 3T4QA 5HD5A 3CZDA 1O7EA 3BLSA 4K0XA 3B47A 4IUHA 1K54C 4BBVA 4KQOA 2AVXA 5FI6A 1LLBA 4JPMA 2V8CA 3JVUA 1EW0A 1JTGA 2LB5A 1NRJA 1XGIA 2J8YA 3IXDA 2D01A 3JVVA 2K31A 2QJ5A 1ODVA 2EFUA 1S0WA 4PKYA 5E2FA 1OTDA 5TFQA 4EUVA 3KSFA 1YLTA 1NJ4A 4KZAA 3LIFA 2B95A 2HGVA 3PBOA 4HBUA 3A3EA 1G6AA 3Q1FA 1W7FA 5G4YA 1OTAA 4U0TA 3WRZA 3Q7VB 4RVAA 4E3JA 2WUQA 4KG6A 4WZ5C 1SHVA 2Y79A 4ETXA 5L09A 3HUMA 4HEFA 3RXWA 2WK0A 4B9OA 5DFYA 2BTFP 2Y8HA 3B3XA 4HJ6A 1LSWA 2YKHA 1PRQA 1X0OA 4GW9A 5GLCA 2Y2GA 2R9WA 3A3IA 4WM9A 1CK3A 3NOTC 3R7WA 4DRTA 5A8BA 2ZM2A 3IT9A 3W2ZA 4UA6A 2XR0A 1Y54A 1XFNA 5JYPA 1GCEA 4LRZE 5CGXA 2IWBA 3S7NA 3T1XA 1F9IA 3M6HA 2FFYA 3UMDA 5GLBA 3L9KA 1VHMA 4JXVA 3FZCA 3DTKA 3PBRA 2NUTC 2BG1A 1FILA 1EI5A 1D1JA 4OP8A 1HD8A 1MBLA 5EOEA 2W27A 1TS6A 2EX2A 4EEPA 3KYQA 5A91A 4HJ4A 3UO9A 3CLOA 3SH9A 4OOLA 3E0YA 4QY5A 4PPRA 1E3UA 1PW8A 3OPHA 4KUOA 4QY6A 4Y2FA 1LSXA 3LR3A 3UDFA 4N1XA 3PXPA 4JF5A 5FDHA 4I5SA 1VEUA 2O9BA 4E6WA 1PWGA 4L9EA 5CHJA 3SS4A 2JC7A 1SKOB 3U2AA 2X71A 4S2KA 3S4XA 3EWKA 2D02A 1N9BA 4ID4A 3ZCZA 2E8JA 4WYYA 2HP6A 4CLCD 3O86A 3VSKA 4WF0A 3C4OA 4Q0IA 3BJNA 1I2SA 2A24A 4BBTA 3ZNTA 2EX6A 2WAEA 1XJ3A 2VJWA 2H28A 3SS3A 2R78A 1BZAA 2H10A 3ZVWA 3DBAA 4JLFA 5EECA 3A0SA 1IYSA 4YOFA 1MC0A 3PBNA 2WKEA 4HBTA 2XK1A 5L10A 2J9PA 2OOLA 4GOGA 1VETA 2WKPA 3IF6C 5J8XA 1YMXA 2ZM0A 4IUKA 1OTIA 1XXMA 3BQ8A 1ONGA 1KDWA 5EM1A 1PWDA 3EQVA 1K56D 4MMNA 2V2FF 4S2LA 1RGYA 3NI9A 4HESA 5GL9A 3O88A 4MLLA 3BW6A 3T4SA 3TG9A 4EWFA 4UQIS 2W3DA 3ZDJA 3T1SA 5KSCA 3IXGA 3RH8B 4CLCB 3HLCA 1AXBA 5FQ9A 2PHYA 1M40A 3LR0A 2KLIA 1XPBA 3MZEA 1LI9A 1MWUA 5GLAA 3E4OA 2O9AA 2L4RA 1S4SA 3DTIA 4OONA 4ZAMA 3ZYTA 4PKYG 4Q0JA 3LI9A 3G32A 3HLFA 1K57A 5CTMA 3BWLA 1T1AA 2VA0A 2V0UA 4OP5A 1YAXA 2J3WA 3HJIA 5HWTA 4RYEA 2GNXA 2DMWA 3E98A 2PBDP 1DJAA 3BYDA 3M2KA 4N92A 4OPZA 2Q9MA 2QPNA 1GSXA 5FAQA 3MMHA 3LIBA 3MBZA 2W3HA 2Y91A 2ZQCA 4GB7A 3IS2A 5AQ9A 5CEBA 1MPLA 4HNBA 2XA7M 1ES3A 4HHDA 4BENA 5J7EA 4LFUA 3SW1A 2Y55A 2VX8A 2J7VA 1PWCA 2LB9A 4R6LA 2OAP1 1ZTUA 4B88A 4XUZA 3LR4A 2QKPA 1Q2PA 5M19A 1IYQA 2QZ6A 4WEJA 3ZHHA 5A90A 3A0VA 2ZC5B 2ZM8A 4S2OA 3QP4A 5M1AA 1NLZA 3T1RA 2HJ9C 1NRFA 5HL6A 1NLYA 2Y2JA 3K3DA 4HP4A 3L7HA 5FATA 2Z6DA 4PM6A 4DF6A 1WYBA 2WGWA 1G6OA 4CPKA 5KMWA 4GS9A 3H7WA 5HL1A 3DW0A 3VP2A 4WZ5A 4PM8A 4DJ2A 5DKLA 1MWSA 2ZC7A 2WGIA 4LENA 2PAVP 1EWZA 5CGWA 5DTTA 2ZMFA 4Y0OA 2P74A 1STZA 1IYPA 3U4LP 5MC7A 1ZC2A 4WLAA 1OT6A 1PW1A 3ZG5A 2OLVA 3CG5A 2XROA 4I3AA 3VFFA 4FH4A 4OVDA 2OAQ1 2HDQA 2KOIA 3QP1A 3MKFA 2V0WA 3O87A 2HP5A 3HUNA 2CMNA 2W1TA 4DDYA 4GNUA 4LGWA 3IBJA 3NC8A 2EXAA 3T4OA 1OPXA 3SZTA 2IWDA 2VLGA 5FAPA 3T4TA 4DE1A 1W63M 5FI7A 2PDRA 2ZL1A 3VP4A 5JYOA 1XJ2A 5EVIC 1TEMA 2I72A 3E2LA 4BBUA 2Y2MA 2QWSA 5AQAA 2H5SA 1ONHA 4U0XA 2PT7A 4QWOA 4R0QA 3HLGA 3P01A 2WKQA 4JGOA 3KSIA 4M4XA 3HREA 1E3UD 3FG8A 2I9VA 5FDSA 5TGFA 4OOYA 5CTNA 1IKIA 1J9MA 3ZG9B 1TDGA 1KGFA 2K7SA 1H8ZA 1NWZA 3R7WB 5FAOA 3IH8A 3OBFA 3W8KA 4BD0A 1F5MA 5G18A 1ESIA 5M18A 4MBKA 4PM5A 4OQ0A 3HJKA 4JF4A 2H0TA 4ARZA 1IKGA 4FUWA 4EW7A 3NOPC 4KZ3A 1YLYA 3FWLA
chains in the Genus database with same CATH topology
3GQZA 5CGXA 2IWBA 1KGEA 2ZQ7A 5F82A 4OH0A 3ITBA 5AQBA 1BSGA 4UHUA 3WRTA 1XA1A 4JKTA 3IF6B 1ZG4A 4MBFA 3SH7A 2WZZA 3M6HA 2OSUA 4DXBA 2Y2IA 2FFYA 2VGJA 5HFOA 1RGZA 5GLBA 3FKVA 4PMAA 2Y2KA 1ES5A 1NZOA 2XFSA 4JXVA 4EUZA 3FZCA 4C3QA 1NZUA 3G2YA 3S1YA 3PBRA 3C7VA 4LV1A 3VOYA 1OMEA 3IF6A 2OV5A 3NY4A 2BG1A 1EI5A 4OPRA 4DE0A 4S2IA 1LL5A 1W79A 3DTMA 4NETA 4UA9A 1YLJA 4OP8A 1HD8A 1MBLA 4S2MA 1BUEA 5EOEA 1HZOA 3BLMA 2EX2A 3G31A 3NCKA 4WZ4A 3HLWA 5A91A 3UO9A 3BFDA 3V5MA 2EXBA 1L2SA 3SH9A 1LI0A 2V1ZA 4BLMA 4IBRA 1KVLA 4F94A 5FSRA 5I94A 2BLSA 4OOLA 5EPHA 4QY5A 3TOIA 3CMZA 4PPRA 4QJGA 1PYYA 1E3UA 1PW8A 3OPHA 4LV2A 4JXSA 3AGEA 3N7WA 2ZQ9A 4RX2A 4QY6A 1XKZA 1W5DA 1ERQA 5CHUA 3MKEA 3UDFA 1WYCA 2X02A 3ZG7B 4YINA 4N1XA 1SDEA 4BJPA 4R1GA 3HL9A 2WAFA 4JF5A 5FDHA 2XD1A 5GHYA 3ZG8B 4E6WA 4C6YA 1PWGA 3Q7ZA 5CERA 2ZMAA 5CHJA 3SS4A 2JC7A 4GZBA 3NBLA 2X71A 4S2KA 1HTZA 3S4XA 4R4SA 2G2UA 4X69A 5EE8A 4ZDXA 3VMAA 5FQIA 2R9XA 1JWVA 1N9BA 4ID4A 2RCXA 3NDGA 3ZCZA 3CJMA 3Q82A 4PM7A 1YQSA 4WYYA 2HP6A 4E6XA 3O86A 4KENB 3VSKA 3VFHA 2ZC4B 3C4OA 1I2SA 2Z2LB 3OPPA 3A3DA 4S2JA 3C5AA 3UDIA 1M6KA 2HDSA 1KVMA 3GRJA 4K0WA 3TSGA 3ZNTA 5CXWA 2EX6A 1FR6A 2WAEA 4S2NA 4BQMA 1GA9A 4H8RA 3OCLA 4ZJ3A 3SS3A 4FSFA 3V39A 4E3IA 1BZAA 5TR7A 4OQIA 1H8YA 2H10A 3ZVWA 4GN2A 4KQQA 3SH8A 3FWLA 4JLFA 5EECA 4B4XA 1RCJA 5L2FA 1EROA 1IYSA 1E25A 1QMEA 1S6RA 2XH9A 4Y7PA 1K6RA 1DJBA 3PBNA 2WKEA 2WKHA 1FSYA 3V3RA 1CEFA 4HBTA 2XK1A 3UY6A 2J9PA 5A92A 4GOGA 1NYYA 3IF6C 5J8XA 1YMXA 3UPOA 2ZM0A 1U60A 4N9LA 1XXMA 4XXRA 3PBSA 4A5RA 3ZVTA 4E3OA 4P6BA 4R23A 3O3VA 3PBQA 3IHAA 1Z6FA 4FCFA 3P09A 5DVAA 5DTSA 2QMIA 1SCWA 4XUXA 5HAQA 1K6SA 1ONGA 4MBHA 1KDWA 1FR1A 3UDXA 3BECA 1PWDA 1SDNA 1FCMA 5F1FA 3EQVA 1JWZA 1K56D 5U47A 4KG5A 3C7UA 2V2FF 3QNCA 4RA7A 4S2LA 2JE5A 1RGYA 3NI9A 3G35A 1PZPA 4HESA 1I2WA 3BRMA 3LCEA 4LCMA 1YLPA 3O88A 3BFEA 5GL9A 5CEDA 1K25A 4MLLA 1BTLA 1KE3A 3TG9A 1NXYA 4EWFA 2WADA 3WS5A 4DE3A 3ZDJA 4FD8A 4Z9QA 1CEGA 1FCNA 3AGFA 3UE0A 2OLUA 1LL9A 3G4PA 5KSCA 4E3KA 1ESUA 3IXGA 1DY6A 4WEKA 4KZ5A 2Z2MB 4C75A 2Y2LA 4KZ4A 1NY0A 2FFFB 1SKFA 5EOOA 3HLCA 3W4QA 1AXBA 5FQ9A 4GD6A 1PIOA 1M40A 3N8RA 3UE3A 3HLEA 1XPBA 1XGJA 3MZEA 4JXGA 2HDUA 1K38A 1ES4A 4L0LA 4QU3A 3S22A 1LI9A 1MWUA 5GLAA 3DWZA 4QD4A 1LHYA 5HAPA 1WE4A 5EVID 3Q07A 4OONA 4ZAMA 3E2KA 1PI5A 5GHXA 4IBXA 4KZ7A 4EQIA 4ZJ1A 1L0DA 5FA7A 3G32A 3HLFA 4P0MA 1K57A 5BOHA 5CTMA 1XP4A 2ZD8A 3IWIA 2WYXA 3LEZA 3OPLA 4S2NC 5E2HA 1BLHA 3UE1A 4X6TA 1JTDA 4OP5A 2Y2PA 1W8QA 2PU4A 2ZC6B 4IVKA 3VP3A 2WKIA 4OKPA 1L0EA 3VOZA 4E3NA 3OC2A 3G34A 2DRWA 2DNSA 4RYEA 2XLNA 3OPRA 1H5XA 3GR2A 3G2ZA 4O7DA 3MZDA 1GHMA 2XEPA 1DJAA 3BYDA 3UPPA 2WGVA 3M2KA 4N92A 4OPZA 3WS1A 2Q9MA 3BFGA 3GSGA 4UA7A 2QPNA 3LY3A 5EUAA 2ZQDA 3SS5A 4IEDA 5KZHA 5FAQA 1XX2A 5CECA 4GDNA 3WWXA 5FI2A 4ZJ2A 3MBZA 4Q8IA 2HPBA 2Y2HA 4RX3A 2Y91A 2ZQCA 4GB7A 2PBYA 4BD1A 4OOMA 1YLZA 4M3KA 5AQ9A 5CEBA 1MPLA 2Q9NA 3IXHA 5CGSA 3QNBA 4D2OA 4EBPA 4JBFA 3WS0A 1K56A 1ES3A 4BENA 3LY4A 3BEBA 4S2PA 2ZJ9A 3HLBA 2EX8A 2Y55A 1ALQA 1KDSA 1BLCA 2J7VA 2E8IA 1PI4A 3GVBA 4JXWA 2Y2NA 2A3UA 3PBTA 1G68A 1TVFA 2XQZA 1PWCA 3AGDA 1DJCA 1KE0A 3FV7A 3A3JA 3M6BA 4Y0UA 3HBRA 2ZLYA 2EX9A 4DKIA 3C4PA 2HP9A 3VSLA 5HW3A 4B88A 1NYMA 4XUZA 2RL3A 1Q2PA 2IWCA 5EVIB 3I7JA 5M19A 3HUOA 3NDEA 1TDLA 3D4FA 1IYQA 3QHYA 1VM1A 3RXXA 2QZ6A 1KE4A 4WEJA 3ZHHA 5A90A 3VP0A 2ZC5B 2ZM8A 4S2OA 3MZFA 4X53A 3FYZA 1JWPA 1C3BA 1MY8A 1YLWA 5M1AA 2WGWB 3EQUA 4OLGA 3W4OA 2P9VB 1ERMA 5CRFA 2Y59A 2UWXA 4U3TA 5EVIA 3ZNYA 3VP1A 4YFMA 1NRFA 5F83A 4OQGA 4X68A 5FQQA 2Y2JA 4QHCA 4LV3A 3GTCA 5FATA 2XD5A 4KG2A 3WS4A 1W8YA 5IHVA 1K57C 1ES2A 4PM6A 5HARA 4DF6A 4GDBA 1WYBA 4DE2A 2WGWA 5DTKA 1CI8A 1QMFA 3UNWA 2P9VA 1BULA 3UN7A 3PAGA 1K55A 4OPYA 4CPKA 2CC1A 4BL3A 3MFDA 5KMWA 3HLDA 4KZ8A 2XDMA 4ZTKA 4R4RA 3UPNA 5GLDA 1GHIA 1PZOA 3OCNA 4N1HA 5FQMA 5HL1A 3IF5A 3ITAA 2JCHA 1K4EA 3DW0A 5FQJA 3A3FA 1GA0A 1ZKJA 1O07A 4X56A 2VGKA 1BLPA 2Y2OA 3VP2A 2B5RA 1ZG6A 4WZ5A 4PM8A 1MWSA 2ZC7A 5AQ7A 1L0GA 4UAAA 4DDSA 2WGIA 3WS2A 4GD8A 2HDRA 5FASA 2A49A 3V50A 4OQHA 3IH9A 4LENA 1VQQA 2PU2A 4KQRA 3Q81A 4NK3A 5KSHA 1EWZA 3P98A 4ZBEA 3ZFZA 5CGWA 3V3SA 3DWKA 5DTTA 2C5WB 5CHMA 1GHPA 4Y0OA 1JVJA 2P74A 2XGNA 3ZG0A 1IYPA 3RJUA 1IEMA 5DF9A 4IVIA 1ZC2A 4LV0A 3JYIA 3N6IA 2JBFA 1PW1A 3ZG5A 2OLVA 1XA7A 2GDNA 3CG5A 4P87A 4Y0TA 5A93A 4EV4A 1CI9A 3VFFA 5E2EA 1Q2QA 4FH4A 4WELA 3PAEA 4OVDA 3FKWA 2XF3A 4WBGA 1BT5A 5D3OA 4WMCD 2HDQA 3IHBA 1L0FA 3MKFA 3BFCA 3O87A 1N4OA 3GMWA 3HVFA 3CZDA 2HP5A 1YM1A 1O7EA 5DF8A 3HUNA 3M2JA 3BLSA 4DDYA 2C6WB 4LCLA 4EBLA 4K0XA 4MNRA 4GNUA 3NC8A 2EXAA 1K54C 4QB8A 3N8SA 5HAIA 2IWDA 4KQOA 3SOIA 4R3JA 5FI6A 1LLBA 4OLDA 2ZQ8A 4JPMA 5FAPA 3GV9A 3LO7A 4DE1A 5E43A 2H0YA 5FI7A 3BM6A 1JTGA 3PTEA 3VP4A 3OZHA 2WZXA 3BFFA 5JYOA 1XGIA 1MXOA 5EVIC 1IYOA 4FH2A 1TEMA 2I72A 3E2LA 1MWTA 2J8YA 3IXDA 1E4DA 4EBNA 2Y2MA 5AQAA 2V20A 2EFUA 4CJNA 2H5SA 1S0WA 2Y4AA 4DXCA 1I5QA 2X01A 3NIAA 1ONHA 4U0XA 1FQGA 5E2FA 4R0QA 5TFQA 1YLTA 1HVBA 1NJ4A 3HLGA 4HBUA 3PBOA 2ZC3B 4KZAA 1K55C 5EVLA 3A3EA 1G6AA 3HREA 1FOFA 4KZ9A 3MXRA 1E3UD 3Q1FA 1W7FA 5TGFA 4OOYA 1KGGA 2XFTA 3IXBA 1K54A 4U0TA 5CTNA 3W4PA 1IKIA 1J9MA 3N8LA 4P85A 4K91A 3WRZA 3ZG9B 1TDGA 3Q7VB 4RVAA 4E3JA 3N4IA 2WUQA 1KGFA 3ZGAB 2EFXA 1FCOA 1YMSA 4JF6A 1MKIA 1SHVA 1H8ZA 4KG6A 4KZ6A 4WZ5C 3HUMA 4HEFA 3IWOA 2WK0A 3RXWA 4B4ZA 5FAOA 3IQAA 5E2GA 4N9KA 3B3XA 4R3BA 2Y2QA 1K4FA 3IH8A 5DF7A 5FQKA 3W8KA 4BD0A 2J9OA 4KZBA 2DCFA 5GLCA 4PM9A 2Y2GA 5G18A 2R9WA 4E3LA 1ESIA 3Q7VA 3A3IA 3ISGA 5M18A 1RP5A 4MBKA 4PM5A 4OQ0A 4JF4A 4WM9A 4BL2A 1CK3A 2H0TA 4MEZA 5GHZA 1IELA 1IKGA 4DRTA 3IWQA 2ZM2A 5F1GA 1BLSA 3IT9A 3MXSA 5HX9A 4UA6A 2XR0A 1Y54A 1YT4A 1FSWA 1MWRA 2G2WA 3G30A 4KZ3A 1YLYA 4X55A 4GKUA 4E3MA 5JYPA 4OPQA 4WMCA 1GCEA 2ZQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQZ A;  5CGX A;  2IWB A;  1KGE A;  2ZQ7 A;  5F82 A;  4OH0 A;  3ITB A;  5AQB A;  1BSG A;  4UHU A;  3WRT A;  1XA1 A;  4JKT A;  3IF6 B;  1ZG4 A;  4MBF A;  3SH7 A;  2WZZ A;  3M6H A;  2OSU A;  4DXB A;  2Y2I A;  2FFY A;  2VGJ A;  5HFO A;  1RGZ A;  5GLB A;  3FKV A;  4PMA A;  2Y2K A;  1ES5 A;  1NZO A;  2XFS A;  4JXV A;  4EUZ A;  3FZC A;  4C3Q A;  1NZU A;  3G2Y A;  3S1Y A;  3PBR A;  3C7V A;  4LV1 A;  3VOY A;  1OME A;  3IF6 A;  2OV5 A;  3NY4 A;  2BG1 A;  1EI5 A;  4OPR A;  4DE0 A;  4S2I A;  1LL5 A;  1W79 A;  3DTM A;  4NET A;  4UA9 A;  1YLJ A;  4OP8 A;  1HD8 A;  1MBL A;  4S2M A;  1BUE A;  5EOE A;  1HZO A;  3BLM A;  2EX2 A;  3G31 A;  3NCK A;  4WZ4 A;  3HLW A;  5A91 A;  3UO9 A;  3BFD A;  3V5M A;  2EXB A;  1L2S A;  3SH9 A;  1LI0 A;  2V1Z A;  4BLM A;  4IBR A;  1KVL A;  4F94 A;  5FSR A;  5I94 A;  2BLS A;  4OOL A;  5EPH A;  4QY5 A;  3TOI A;  3CMZ A;  4PPR A;  4QJG A;  1PYY A;  1E3U A;  1PW8 A;  3OPH A;  4LV2 A;  4JXS A;  3AGE A;  3N7W A;  2ZQ9 A;  4RX2 A;  4QY6 A;  1XKZ A;  1W5D A;  1ERQ A;  5CHU A;  3MKE A;  3UDF A;  1WYC A;  2X02 A;  3ZG7 B;  4YIN A;  4N1X A;  1SDE A;  4BJP A;  4R1G A;  3HL9 A;  2WAF A;  4JF5 A;  5FDH A;  2XD1 A;  5GHY A;  3ZG8 B;  4E6W A;  4C6Y A;  1PWG A;  3Q7Z A;  5CER A;  2ZMA A;  5CHJ A;  3SS4 A;  2JC7 A;  4GZB A;  3NBL A;  2X71 A;  4S2K A;  1HTZ A;  3S4X A;  4R4S A;  2G2U A;  4X69 A;  5EE8 A;  4ZDX A;  3VMA A;  5FQI A;  2R9X A;  1JWV A;  1N9B A;  4ID4 A;  2RCX A;  3NDG A;  3ZCZ A;  3CJM A;  3Q82 A;  4PM7 A;  1YQS A;  4WYY A;  2HP6 A;  4E6X A;  3O86 A;  4KEN B;  3VSK A;  3VFH A;  2ZC4 B;  3C4O A;  1I2S A;  2Z2L B;  3OPP A;  3A3D A;  4S2J A;  3C5A A;  3UDI A;  1M6K A;  2HDS A;  1KVM A;  3GRJ A;  4K0W A;  3TSG A;  3ZNT A;  5CXW A;  2EX6 A;  1FR6 A;  2WAE A;  4S2N A;  4BQM A;  1GA9 A;  4H8R A;  3OCL A;  4ZJ3 A;  3SS3 A;  4FSF A;  3V39 A;  4E3I A;  1BZA A;  5TR7 A;  4OQI A;  1H8Y A;  2H10 A;  3ZVW A;  4GN2 A;  4KQQ A;  3SH8 A;  3FWL A;  4JLF A;  5EEC A;  4B4X A;  1RCJ A;  5L2F A;  1ERO A;  1IYS A;  1E25 A;  1QME A;  1S6R A;  2XH9 A;  4Y7P A;  1K6R A;  1DJB A;  3PBN A;  2WKE A;  2WKH A;  1FSY A;  3V3R A;  1CEF A;  4HBT A;  2XK1 A;  3UY6 A;  2J9P A;  5A92 A;  4GOG A;  1NYY A;  3IF6 C;  5J8X A;  1YMX A;  3UPO A;  2ZM0 A;  1U60 A;  4N9L A;  1XXM A;  4XXR A;  3PBS A;  4A5R A;  3ZVT A;  4E3O A;  4P6B A;  4R23 A;  3O3V A;  3PBQ A;  3IHA A;  1Z6F A;  4FCF A;  3P09 A;  5DVA A;  5DTS A;  2QMI A;  1SCW A;  4XUX A;  5HAQ A;  1K6S A;  1ONG A;  4MBH A;  1KDW A;  1FR1 A;  3UDX A;  3BEC A;  1PWD A;  1SDN A;  1FCM A;  5F1F A;  3EQV A;  1JWZ A;  1K56 D;  5U47 A;  4KG5 A;  3C7U A;  2V2F F;  3QNC A;  4RA7 A;  4S2L A;  2JE5 A;  1RGY A;  3NI9 A;  3G35 A;  1PZP A;  4HES A;  1I2W A;  3BRM A;  3LCE A;  4LCM A;  1YLP A;  3O88 A;  3BFE A;  5GL9 A;  5CED A;  1K25 A;  4MLL A;  1BTL A;  1KE3 A;  3TG9 A;  1NXY A;  4EWF A;  2WAD A;  3WS5 A;  4DE3 A;  3ZDJ A;  4FD8 A;  4Z9Q A;  1CEG A;  1FCN A;  3AGF A;  3UE0 A;  2OLU A;  1LL9 A;  3G4P A;  5KSC A;  4E3K A;  1ESU A;  3IXG A;  1DY6 A;  4WEK A;  4KZ5 A;  2Z2M B;  4C75 A;  2Y2L A;  4KZ4 A;  1NY0 A;  2FFF B;  1SKF A;  5EOO A;  3HLC A;  3W4Q A;  1AXB A;  5FQ9 A;  4GD6 A;  1PIO A;  1M40 A;  3N8R A;  3UE3 A;  3HLE A;  1XPB A;  1XGJ A;  3MZE A;  4JXG A;  2HDU A;  1K38 A;  1ES4 A;  4L0L A;  4QU3 A;  3S22 A;  1LI9 A;  1MWU A;  5GLA A;  3DWZ A;  4QD4 A;  1LHY A;  5HAP A;  1WE4 A;  5EVI D;  3Q07 A;  4OON A;  4ZAM A;  3E2K A;  1PI5 A;  5GHX A;  4IBX A;  4KZ7 A;  4EQI A;  4ZJ1 A;  1L0D A;  5FA7 A;  3G32 A;  3HLF A;  4P0M A;  1K57 A;  5BOH A;  5CTM A;  1XP4 A;  2ZD8 A;  3IWI A;  2WYX A;  3LEZ A;  3OPL A;  4S2N C;  5E2H A;  1BLH A;  3UE1 A;  4X6T A;  1JTD A;  4OP5 A;  2Y2P A;  1W8Q A;  2PU4 A;  2ZC6 B;  4IVK A;  3VP3 A;  2WKI A;  4OKP A;  1L0E A;  3VOZ A;  4E3N A;  3OC2 A;  3G34 A;  2DRW A;  2DNS A;  4RYE A;  2XLN A;  3OPR A;  1H5X A;  3GR2 A;  3G2Z A;  4O7D A;  3MZD A;  1GHM A;  2XEP A;  1DJA A;  3BYD A;  3UPP A;  2WGV A;  3M2K A;  4N92 A;  4OPZ A;  3WS1 A;  2Q9M A;  3BFG A;  3GSG A;  4UA7 A;  2QPN A;  3LY3 A;  5EUA A;  2ZQD A;  3SS5 A;  4IED A;  5KZH A;  5FAQ A;  1XX2 A;  5CEC A;  4GDN A;  3WWX A;  5FI2 A;  4ZJ2 A;  3MBZ A;  4Q8I A;  2HPB A;  2Y2H A;  4RX3 A;  2Y91 A;  2ZQC A;  4GB7 A;  2PBY A;  4BD1 A;  4OOM A;  1YLZ A;  4M3K A;  5AQ9 A;  5CEB A;  1MPL A;  2Q9N A;  3IXH A;  5CGS A;  3QNB A;  4D2O A;  4EBP A;  4JBF A;  3WS0 A;  1K56 A;  1ES3 A;  4BEN A;  3LY4 A;  3BEB A;  4S2P A;  2ZJ9 A;  3HLB A;  2EX8 A;  2Y55 A;  1ALQ A;  1KDS A;  1BLC A;  2J7V A;  2E8I A;  1PI4 A;  3GVB A;  4JXW A;  2Y2N A;  2A3U A;  3PBT A;  1G68 A;  1TVF A;  2XQZ A;  1PWC A;  3AGD A;  1DJC A;  1KE0 A;  3FV7 A;  3A3J A;  3M6B A;  4Y0U A;  3HBR A;  2ZLY A;  2EX9 A;  4DKI A;  3C4P A;  2HP9 A;  3VSL A;  5HW3 A;  4B88 A;  1NYM A;  4XUZ A;  2RL3 A;  1Q2P A;  2IWC A;  5EVI B;  3I7J A;  5M19 A;  3HUO A;  3NDE A;  1TDL A;  3D4F A;  1IYQ A;  3QHY A;  1VM1 A;  3RXX A;  2QZ6 A;  1KE4 A;  4WEJ A;  3ZHH A;  5A90 A;  3VP0 A;  2ZC5 B;  2ZM8 A;  4S2O A;  3MZF A;  4X53 A;  3FYZ A;  1JWP A;  1C3B A;  1MY8 A;  1YLW A;  5M1A A;  2WGW B;  3EQU A;  4OLG A;  3W4O A;  2P9V B;  1ERM A;  5CRF A;  2Y59 A;  2UWX A;  4U3T A;  5EVI A;  3ZNY A;  3VP1 A;  4YFM A;  1NRF A;  5F83 A;  4OQG A;  4X68 A;  5FQQ A;  2Y2J A;  4QHC A;  4LV3 A;  3GTC A;  5FAT A;  2XD5 A;  4KG2 A;  3WS4 A;  1W8Y A;  5IHV A;  1K57 C;  1ES2 A;  4PM6 A;  5HAR A;  4DF6 A;  4GDB A;  1WYB A;  4DE2 A;  2WGW A;  5DTK A;  1CI8 A;  1QMF A;  3UNW A;  2P9V A;  1BUL A;  3UN7 A;  3PAG A;  1K55 A;  4OPY A;  4CPK A;  2CC1 A;  4BL3 A;  3MFD A;  5KMW A;  3HLD A;  4KZ8 A;  2XDM A;  4ZTK A;  4R4R A;  3UPN A;  5GLD A;  1GHI A;  1PZO A;  3OCN A;  4N1H A;  5FQM A;  5HL1 A;  3IF5 A;  3ITA A;  2JCH A;  1K4E A;  3DW0 A;  5FQJ A;  3A3F A;  1GA0 A;  1ZKJ A;  1O07 A;  4X56 A;  2VGK A;  1BLP A;  2Y2O A;  3VP2 A;  2B5R A;  1ZG6 A;  4WZ5 A;  4PM8 A;  1MWS A;  2ZC7 A;  5AQ7 A;  1L0G A;  4UAA A;  4DDS A;  2WGI A;  3WS2 A;  4GD8 A;  2HDR A;  5FAS A;  2A49 A;  3V50 A;  4OQH A;  3IH9 A;  4LEN A;  1VQQ A;  2PU2 A;  4KQR A;  3Q81 A;  4NK3 A;  5KSH A;  1EWZ A;  3P98 A;  4ZBE A;  3ZFZ A;  5CGW A;  3V3S A;  3DWK A;  5DTT A;  2C5W B;  5CHM A;  1GHP A;  4Y0O A;  1JVJ A;  2P74 A;  2XGN A;  3ZG0 A;  1IYP A;  3RJU A;  1IEM A;  5DF9 A;  4IVI A;  1ZC2 A;  4LV0 A;  3JYI A;  3N6I A;  2JBF A;  1PW1 A;  3ZG5 A;  2OLV A;  1XA7 A;  2GDN A;  3CG5 A;  4P87 A;  4Y0T A;  5A93 A;  4EV4 A;  1CI9 A;  3VFF A;  5E2E A;  1Q2Q A;  4FH4 A;  4WEL A;  3PAE A;  4OVD A;  3FKW A;  2XF3 A;  4WBG A;  1BT5 A;  5D3O A;  4WMC D;  2HDQ A;  3IHB A;  1L0F A;  3MKF A;  3BFC A;  3O87 A;  1N4O A;  3GMW A;  3HVF A;  3CZD A;  2HP5 A;  1YM1 A;  1O7E A;  5DF8 A;  3HUN A;  3M2J A;  3BLS A;  4DDY A;  2C6W B;  4LCL A;  4EBL A;  4K0X A;  4MNR A;  4GNU A;  3NC8 A;  2EXA A;  1K54 C;  4QB8 A;  3N8S A;  5HAI A;  2IWD A;  4KQO A;  3SOI A;  4R3J A;  5FI6 A;  1LLB A;  4OLD A;  2ZQ8 A;  4JPM A;  5FAP A;  3GV9 A;  3LO7 A;  4DE1 A;  5E43 A;  2H0Y A;  5FI7 A;  3BM6 A;  1JTG A;  3PTE A;  3VP4 A;  3OZH A;  2WZX A;  3BFF A;  5JYO A;  1XGI A;  1MXO A;  5EVI C;  1IYO A;  4FH2 A;  1TEM A;  2I72 A;  3E2L A;  1MWT A;  2J8Y A;  3IXD A;  1E4D A;  4EBN A;  2Y2M A;  5AQA A;  2V20 A;  2EFU A;  4CJN A;  2H5S A;  1S0W A;  2Y4A A;  4DXC A;  1I5Q A;  2X01 A;  3NIA A;  1ONH A;  4U0X A;  1FQG A;  5E2F A;  4R0Q A;  5TFQ A;  1YLT A;  1HVB A;  1NJ4 A;  3HLG A;  4HBU A;  3PBO A;  2ZC3 B;  4KZA A;  1K55 C;  5EVL A;  3A3E A;  1G6A A;  3HRE A;  1FOF A;  4KZ9 A;  3MXR A;  1E3U D;  3Q1F A;  1W7F A;  5TGF A;  4OOY A;  1KGG A;  2XFT A;  3IXB A;  1K54 A;  4U0T A;  5CTN A;  3W4P A;  1IKI A;  1J9M A;  3N8L A;  4P85 A;  4K91 A;  3WRZ A;  3ZG9 B;  1TDG A;  3Q7V B;  4RVA A;  4E3J A;  3N4I A;  2WUQ A;  1KGF A;  3ZGA B;  2EFX A;  1FCO A;  1YMS A;  4JF6 A;  1MKI A;  1SHV A;  1H8Z A;  4KG6 A;  4KZ6 A;  4WZ5 C;  3HUM A;  4HEF A;  3IWO A;  2WK0 A;  3RXW A;  4B4Z A;  5FAO A;  3IQA A;  5E2G A;  4N9K A;  3B3X A;  4R3B A;  2Y2Q A;  1K4F A;  3IH8 A;  5DF7 A;  5FQK A;  3W8K A;  4BD0 A;  2J9O A;  4KZB A;  2DCF A;  5GLC A;  4PM9 A;  2Y2G A;  5G18 A;  2R9W A;  4E3L A;  1ESI A;  3Q7V A;  3A3I A;  3ISG A;  5M18 A;  1RP5 A;  4MBK A;  4PM5 A;  4OQ0 A;  4JF4 A;  4WM9 A;  4BL2 A;  1CK3 A;  2H0T A;  4MEZ A;  5GHZ A;  1IEL A;  1IKG A;  4DRT A;  3IWQ A;  2ZM2 A;  5F1G A;  1BLS A;  3IT9 A;  3MXS A;  5HX9 A;  4UA6 A;  2XR0 A;  1Y54 A;  1YT4 A;  1FSW A;  1MWR A;  2G2W A;  3G30 A;  4KZ3 A;  1YLY A;  4X55 A;  4GKU A;  4E3M A;  5JYP A;  4OPQ A;  4WMC A;  1GCE A;  2ZQA A; 
#chains in the Genus database with same CATH topology
 4IHQ A;  5IT5 A;  3F1O A;  3NJA A;  5F82 A;  3ITB A;  1XA1 A;  4JKT A;  1J3W A;  2OSU A;  4DXB A;  2Y2I A;  5HFO A;  2A2L A;  3FKV A;  4PMA A;  2JKF A;  1NZO A;  2XFS A;  3G2Y A;  3S1Y A;  3IF6 A;  3NY4 A;  3EOI A;  2W3F A;  4OPR A;  4S2I A;  3DTM A;  3NOU C;  4MDZ A;  1BUE A;  1HZO A;  3BLM A;  3NCK A;  3G31 A;  4WZ4 A;  3HLW A;  3V5M A;  2EXB A;  2M1C A;  4F94 A;  4IBR A;  2BLS A;  3A0R A;  3G6O A;  3AGE A;  4MN5 A;  1VEU B;  4RX2 A;  5IU1 A;  1XKZ A;  4I3I A;  3UB6 A;  2BAS A;  5HDD A;  4G3V A;  4YIN A;  3TJZ C;  2ZOH A;  1SDE A;  4BJP A;  3CIT A;  2WAF A;  2XD1 A;  5DFX A;  5I5L A;  4C6Y A;  3S7Q A;  3Q7Z A;  3NBL A;  1HTZ A;  2J3T D;  5FQI A;  2JHE A;  2RCX A;  3NDG A;  3CJM A;  4Y15 A;  3VFH A;  4DN0 A;  3OPP A;  3A3D A;  4S2J A;  4K0W A;  4DJ3 A;  5CXW A;  4NXE A;  4Y3I A;  4BQM A;  1GA9 A;  3CPT A;  4H8R A;  1D7E A;  5TBM A;  3OCL A;  1VET B;  3V39 A;  1WA9 A;  3SH8 A;  1Y28 A;  3MF0 A;  1ERO A;  1QME A;  4Q0H A;  1DJB A;  1W63 Q;  3UY6 A;  1NYY A;  5F6A A;  4N9L A;  3CUE C;  3PBS A;  4A5R A;  3ZVT A;  1P9W A;  3IHA A;  3D9Y A;  1Z6F A;  2JN7 A;  5KIZ A;  5DVA A;  1K6S A;  5HWV A;  3UDX A;  5AVF A;  1FCM A;  3RFB A;  3LUQ A;  3C2W A;  4KG5 A;  3C7U A;  4RA7 A;  1G5U A;  2JE5 A;  5AJG A;  1I2W A;  1YLP A;  5CED A;  1KE3 A;  1NXY A;  5C5K A;  3UE0 A;  1LL9 A;  4HH3 A;  1S4R A;  4E3K A;  2Z2M B;  3PR6 A;  3MQQ A;  3NEC A;  1ACF A;  1K38 A;  1ES4 A;  3MSH A;  4QU3 A;  4HI4 A;  4EU0 A;  1A0K A;  4NXF A;  1PI5 A;  4BMW A;  4KZ7 A;  4ZJ1 A;  3C8C A;  1L0D A;  5TJJ A;  2GX5 A;  5BOH A;  2V1A A;  2ZD8 A;  2WYX A;  3OPL A;  3DAV A;  4S2N C;  3OOV A;  2Y2P A;  2PU4 A;  2ZC6 B;  2HF6 A;  1TD5 A;  2WKI A;  3VOZ A;  5EVE A;  2DRW A;  2DNS A;  2EA9 A;  3MQO A;  4FTX A;  4Z1W A;  3G2Z A;  2NUP C;  3FPW A;  2HV1 A;  3IS2 B;  2WGV A;  3UPP A;  1FIK A;  3BFG A;  4UA7 A;  5EUA A;  5FEG A;  2ZQD A;  4GDN A;  4ZJ2 A;  4Q8I A;  2HPB A;  3BQA A;  5HDC A;  4BD1 A;  1YLZ A;  4M3K A;  3IXH A;  5CGS A;  4JBF A;  2KX6 A;  2ZJ9 A;  3HLB A;  4NXB A;  2EX8 A;  1KDS A;  3GVB A;  2A3U A;  1TVF A;  1XJ4 A;  3AGD A;  1DJC A;  3M6B A;  4Y0U A;  2EX9 A;  3MJQ A;  2HP9 A;  5HW3 A;  2UV0 E;  3F1N A;  3I7J A;  1TDL A;  3D4F A;  1ZHH B;  1VM1 A;  1T1B A;  1KE4 A;  3VP0 A;  4R70 A;  1C3B A;  1YLW A;  2WGW B;  3EQU A;  3W4O A;  1ERM A;  5EVI A;  3VP1 A;  5F83 A;  4X68 A;  4GS9 B;  3GTC A;  2XD5 A;  4KG2 A;  1W8Y A;  2FZ0 A;  5DTK A;  1QMF A;  2B02 A;  3PAG A;  4OPY A;  4G3W A;  4ZTK A;  4R4R A;  5F68 A;  1GHI A;  1PZO A;  3ITA A;  3TW8 A;  5FQJ A;  1GA0 A;  2B5R A;  4HOI A;  4NXG A;  4R3A A;  4PAU A;  1L0G A;  4UAA A;  2HJE A;  3WS2 A;  3V50 A;  2PU2 A;  3P98 A;  4ZBE A;  3V3S A;  1JVJ A;  5HD3 A;  3T1Q B;  2G7U A;  4Y0T A;  1H0M A;  2ZOI A;  3QP8 A;  4ESP A;  4EV4 A;  1CI9 A;  2W1T B;  1Q2Q A;  4WEL A;  5E2E A;  3P7N A;  2XSS A;  2QHK A;  2XF3 A;  1BT5 A;  5F69 A;  3IX3 A;  4JGR A;  1L0F A;  4F3L A;  1YM1 A;  2P7J A;  2ZL1 B;  5DF8 A;  2M7U A;  3M2J A;  4EBL A;  4LCL A;  4MNR A;  3VV4 A;  5DKK A;  4DMZ A;  3N8S A;  5HAI A;  3C30 A;  3SOI A;  4R3J A;  4OLD A;  2OWJ A;  2ZQ8 A;  3GV9 A;  5E43 A;  5L8M A;  2H0Y A;  1GSV A;  1XJ6 A;  4P6Z M;  3OZH A;  4GHI A;  2WZX A;  3UB7 A;  3LIA A;  3BFF A;  1MXO A;  1IYO A;  4EES A;  1YPR A;  1MWT A;  2PYR A;  4EBN A;  2Q0O A;  2V20 A;  2Y4A A;  5DJU A;  4DXC A;  3NIA A;  1FQG A;  2VV6 A;  5J4E A;  1K55 C;  5EVL A;  4KZ9 A;  3MXR A;  5HWW A;  3HCY A;  1KGG A;  2XFT A;  3IXB A;  1K54 A;  3N8L A;  4P85 A;  4K91 A;  1H3Q A;  1DP9 A;  3N4I A;  3ZGA B;  2EFX A;  1YMS A;  1MKI A;  4KZ6 A;  2L0W A;  3IWO A;  3IQA A;  4ARZ B;  4R3B A;  1K4F A;  5DF7 A;  2J9O A;  4KZB A;  2DCF A;  3PHY A;  4E3L A;  1N9O A;  3ISG A;  4I3J A;  1RP5 A;  4BL2 A;  3F1O B;  5GHZ A;  4Y17 A;  4X1L A;  1VB6 A;  1BLS A;  2QJ7 A;  3MXS A;  3MS6 A;  1FSW A;  3G30 A;  4X55 A;  4GKU A;  1LT0 A;  4WMC A;  2ZQ7 A;  4OH0 A;  4LPZ A;  1CJF A;  3IF6 B;  4CQH A;  4MBF A;  2P08 A;  4HQA A;  2WZZ A;  3R4K A;  3TRC A;  2VGJ A;  1RGZ A;  5DJT A;  3T50 A;  1ES5 A;  4EUZ A;  3EEH A;  4P6Z S;  1NZU A;  3C7V A;  4LV1 A;  2PR6 A;  3KX0 X;  4JGQ A;  3CUE A;  2XA7 S;  4Y5F A;  4UA9 A;  3MR0 A;  5FL3 A;  4MN7 A;  1L2S A;  2VV8 A;  1LI0 A;  1KVL A;  1OTB A;  5EPH A;  3TOI A;  2ZMV A;  4QJG A;  1PYY A;  4JXS A;  3N7W A;  1ERQ A;  2QYB A;  4JGP A;  3LIE A;  5CHU A;  3MKE A;  1WYC A;  3ZG7 B;  2OWH A;  4R1G A;  3LEQ A;  5GHY A;  3ZG8 B;  2KDK A;  4GZB A;  4X69 A;  5EE8 A;  3VMA A;  1TS7 A;  3F1P A;  1G28 A;  3Q82 A;  4HY8 A;  4PM7 A;  5TBM B;  4D60 A;  2Z2L B;  2ACG A;  3C5A A;  3UDI A;  2HDS A;  1KVM A;  1TF1 A;  1FR6 A;  4S2N A;  4PHT A;  4KQD A;  4ZJ3 A;  2L1M A;  4FSF A;  4E3I A;  5IS1 A;  4NKP A;  4OQI A;  4GN2 A;  4WL9 A;  5L2F A;  1RCJ A;  1E25 A;  3OLO A;  4Y7P A;  2WKH A;  1P9R A;  1CEF A;  3UPO A;  3K2N A;  1U60 A;  4P6B A;  2HZ5 A;  5EM0 A;  3O3V A;  4EQ1 A;  2FH5 A;  4FCF A;  3P09 A;  5DTS A;  1SCW A;  1UWN X;  4FOF A;  5HAQ A;  4MBH A;  2VEA A;  1FR1 A;  2PD7 A;  4HH2 A;  1SDN A;  3D3O A;  3JPU A;  1UWP X;  4UEY A;  3G35 A;  4LCM A;  3BFE A;  1K25 A;  1MZU A;  2PYP A;  3WS5 A;  4FD8 A;  1FCN A;  3AGF A;  4HP9 A;  3QP5 A;  1ESU A;  1DY6 A;  4C75 A;  4KZ4 A;  1NY0 A;  2FFF B;  1SKF A;  5EOO A;  3W4Q A;  2PD8 A;  1T19 A;  4GD6 A;  5G4Z A;  1PIO A;  3N8R A;  3HLE A;  1XGJ A;  3NHQ A;  1P97 A;  4L0L A;  1AWI A;  1S67 L;  3DWZ A;  4QD4 A;  1LHY A;  5HAP A;  1WE4 A;  5EVI D;  3Q07 A;  5GHX A;  4CLC E;  3CHW P;  2V8F A;  4P0M A;  1XP4 A;  3KSG A;  1BLH A;  2YKF A;  1L0E A;  2XLN A;  3OPR A;  1H5X A;  3GR2 A;  4GJ4 A;  4O7D A;  1GHM A;  2A24 B;  2WKR A;  3GSG A;  4XT2 A;  3SS5 A;  5KZH A;  1T18 A;  1XX2 A;  4H6J A;  5AVE A;  5FI2 A;  2Y2H A;  3QP2 A;  1CF0 A;  4RX3 A;  2W3E A;  5K5B A;  4OOM A;  5LBR A;  2V1B A;  2Q9N A;  4EEU A;  3QNB A;  4D2O A;  1S66 L;  4AFI A;  3EGX C;  3BEB A;  4S2P A;  1OJG A;  3F1N B;  5HSQ A;  1OTE A;  3CI6 A;  1PI4 A;  4I39 A;  1G68 A;  1PNE A;  4IJG A;  1KE0 A;  1F98 A;  3A3J A;  2O0Y A;  4DKI A;  3VSL A;  1NYM A;  2RL3 A;  2IWC A;  5EVI B;  3NDE A;  3QHY A;  2VK3 A;  3FYZ A;  1JWP A;  2W1R A;  1D06 A;  5CRF A;  3ZNY A;  2UWX A;  1V9Y A;  4YFM A;  1K0K A;  4CLC C;  5FQQ A;  4QHC A;  2XRN A;  3B42 A;  1OJ5 A;  3S7P A;  5HAR A;  4X1M A;  2P9V A;  1BUL A;  1DP6 A;  3T12 B;  1K55 A;  1YKD A;  2CC1 A;  3MFD A;  4HIA A;  1IOU A;  4X25 A;  3OCN A;  5FQM A;  2JCH A;  1K4E A;  1YSQ A;  3GEC A;  3A3F A;  4QPR A;  4X56 A;  1O07 A;  1BLP A;  1ZG6 A;  2HDR A;  5FAS A;  5EV0 A;  4OQH A;  1VQQ A;  4NK3 A;  5KSH A;  2B18 A;  4WN5 A;  3ZFZ A;  1PFL A;  3DWK A;  5CHM A;  3H82 A;  1GHP A;  3KO6 A;  2EWW A;  4O0P A;  2XGN A;  3ZG0 A;  3RJU A;  2GJ3 A;  4IVI A;  4LV0 A;  2W3G A;  3JYI A;  3N6I A;  4F3L B;  1LSV A;  1XA7 A;  2GDN A;  3K3C A;  5A93 A;  3FKW A;  4WBG A;  5D3O A;  4WMC D;  1L3L A;  4B93 A;  4NG2 A;  3BFC A;  1N9N A;  2INW A;  4ETZ A;  1N4O A;  3GMW A;  3HVF A;  3ICY A;  3ZQ5 A;  4GHI B;  2C6W B;  4II7 A;  4QB8 A;  3MXQ A;  3VE3 A;  3KYE A;  4UQI M;  1LL8 A;  3LO7 A;  3BM6 A;  3PTE A;  3MQ0 A;  4FH2 A;  2IA2 A;  1E4D A;  4CJN A;  4R38 A;  1I5Q A;  2X01 A;  4MCW A;  1HVB A;  2ZC3 B;  1P0Z A;  1S1Z A;  1FOF A;  3BY8 A;  1DRM A;  3W4P A;  1YSP A;  4I38 A;  3RTY A;  3DTE A;  3TE8 A;  1FCO A;  4JF6 A;  4B4Z A;  4NEE D;  5E2G A;  4N9K A;  4GCZ A;  2Y2Q A;  5FQK A;  4PM9 A;  3Q7V A;  3H7W B;  4G3K A;  4MEZ A;  1IEL A;  3IX4 A;  3IWQ A;  1GSW A;  3EEA A;  5F1G A;  5HX9 A;  1UGU A;  1YT4 A;  2M7V A;  1MWR A;  2G2W A;  5HPI A;  4E3M A;  4GLQ A;  4OPQ A;  5HDS A;  2ZQA A;  3GQZ A;  1KGE A;  2JKR I;  3FPV A;  5AQB A;  4KUK A;  1BSG A;  4UHU A;  3WRT A;  1ZG4 A;  3SH7 A;  4LRY C;  4WUJ A;  3E4Q A;  2Y2K A;  2K2N A;  2VZW A;  3FC7 A;  4HJ3 A;  4C3Q A;  2JKT I;  3T4L A;  3VOY A;  1OME A;  2OV5 A;  4DE0 A;  1LL5 A;  1W79 A;  4NET A;  3VOL A;  1YLJ A;  4S2M A;  3BFD A;  2V1Z A;  4BLM A;  5I94 A;  5FSR A;  3CMZ A;  4LV2 A;  2ZQ9 A;  1W5D A;  1N9L A;  2GZA A;  2X02 A;  5L07 A;  3T4J A;  3F1P B;  3HL9 A;  2VGL M;  5CER A;  3KYZ A;  2ZMA A;  4MN6 A;  4R4S A;  2G2U A;  4ZDX A;  1MKM A;  2R9X A;  1JWV A;  1XFQ A;  1YQS A;  4E6X A;  4KEN B;  2ZC4 B;  4Y13 A;  1SKO A;  1M6K A;  3GRJ A;  3TSG A;  4RQ9 A;  2J80 A;  1V9Z A;  5TR7 A;  1H8Y A;  4K08 A;  4KQQ A;  1S1Y A;  4B4X A;  4BWI A;  2XH9 A;  1S6R A;  3E4P A;  1K6R A;  1FSY A;  2P04 A;  3V3R A;  3LIC A;  3UB9 A;  5A92 A;  2ZBB A;  4XXR A;  4E3O A;  3CWF A;  2JKR M;  4R23 A;  3PBQ A;  3LYX A;  2QMI A;  3NUL A;  5FEF A;  4XUX A;  3C38 A;  3KSH A;  3BEC A;  5F1F A;  1JWZ A;  5U47 A;  3QNC A;  2JKT M;  1PZP A;  4ME4 A;  3BRM A;  3LCE A;  1Z09 A;  5HPF A;  1BTL A;  4O8G A;  2WAD A;  4DE3 A;  2V9A A;  4Z9Q A;  3S7O A;  1CEG A;  2OLU A;  3G4P A;  4WEK A;  4KZ5 A;  2Y2L A;  3EGD C;  2VGL S;  1BYW A;  1TS0 A;  3UE3 A;  4JXG A;  2HDU A;  3S22 A;  3UE6 A;  2VKS A;  5EFW A;  5HZH A;  3IX8 A;  4LRX C;  4CLC A;  3E2K A;  1Y4O A;  4IBX A;  4EQI A;  3LR5 A;  5FA7 A;  3IWI A;  3LEZ A;  5E2H A;  1H8M A;  2JKG A;  3UE1 A;  3D72 A;  3QP6 A;  4X6T A;  1JTD A;  1W8Q A;  4XT2 B;  5F5Y A;  4IVK A;  3VP3 A;  2W0N A;  1SZV A;  4OKP A;  4E3N A;  3OC2 A;  3G34 A;  4H6J B;  3CAX A;  2O9C A;  3MZD A;  1JNU A;  3PYP A;  2XEP A;  1CQA A;  1TS8 A;  3WS1 A;  3LY3 A;  4L9F A;  4IED A;  3CPT B;  5CEC A;  3WWX A;  3H9W A;  2PBY A;  2PR5 A;  1T1C A;  4EBP A;  2PRF A;  3T4K A;  1K56 A;  3WS0 A;  3LY4 A;  4L9G A;  5J3W A;  1ALQ A;  1BLC A;  2E8I A;  4JXW A;  2Y2N A;  3PBT A;  2XQZ A;  1IFQ A;  3FV7 A;  3HBR A;  2EWV A;  2ZLY A;  2MJ6 A;  3C4P A;  4YNR A;  3O5Y A;  2VV7 A;  3HUO A;  4YWZ A;  3RXX A;  3MZF A;  4X53 A;  3GDI A;  1MY8 A;  2J3T C;  4OLG A;  2P9V B;  3LGO A;  4O01 A;  1HLU P;  3ULF A;  2Y59 A;  4U3T A;  3UME A;  4OQG A;  4LV3 A;  3LID A;  3IBR A;  3WS4 A;  5IHV A;  1K57 C;  1ES2 A;  4EXO A;  4GDB A;  4DE2 A;  4EET B;  3UNW A;  1CI8 A;  3UN7 A;  3UB8 A;  5CX7 A;  2O99 A;  2Z6C A;  4BL3 A;  3HLD A;  4KZ8 A;  2XDM A;  1F2K A;  3UPN A;  5GLD A;  4N1H A;  3IF5 A;  3B33 A;  1ZKJ A;  2VGK A;  2Y2O A;  3UB5 P;  3H82 B;  4ZRR A;  4LLO B;  3BY9 A;  1OT9 A;  5AQ7 A;  4DDS A;  4GD8 A;  3LI8 A;  2A49 A;  3IH9 A;  4E04 A;  1KOU A;  4KQR A;  3Q81 A;  3VE4 A;  1DP8 A;  4EER A;  2C5W B;  5DF9 A;  1IEM A;  3MFX A;  2JBF A;  4P87 A;  3LFV A;  3PAE A;  3V67 A;  3IHB A;  3T4Q A;  5HD5 A;  3CZD A;  1O7E A;  3BLS A;  4K0X A;  3B47 A;  4IUH A;  1K54 C;  4BBV A;  4KQO A;  2AVX A;  5FI6 A;  1LLB A;  4JPM A;  2V8C A;  3JVU A;  1EW0 A;  1JTG A;  2LB5 A;  1NRJ A;  1XGI A;  2J8Y A;  3IXD A;  2D01 A;  3JVV A;  2K31 A;  2QJ5 A;  1ODV A;  2EFU A;  1S0W A;  4PKY A;  5E2F A;  1OTD A;  5TFQ A;  4EUV A;  3KSF A;  1YLT A;  1NJ4 A;  4KZA A;  3LIF A;  2B95 A;  2HGV A;  3PBO A;  4HBU A;  3A3E A;  1G6A A;  3Q1F A;  1W7F A;  5G4Y A;  1OTA A;  4U0T A;  3WRZ A;  3Q7V B;  4RVA A;  4E3J A;  2WUQ A;  4KG6 A;  4WZ5 C;  1SHV A;  2Y79 A;  4ETX A;  5L09 A;  3HUM A;  4HEF A;  3RXW A;  2WK0 A;  4B9O A;  5DFY A;  2BTF P;  2Y8H A;  3B3X A;  4HJ6 A;  1LSW A;  2YKH A;  1PRQ A;  1X0O A;  4GW9 A;  5GLC A;  2Y2G A;  2R9W A;  3A3I A;  4WM9 A;  1CK3 A;  3NOT C;  3R7W A;  4DRT A;  5A8B A;  2ZM2 A;  3IT9 A;  3W2Z A;  4UA6 A;  2XR0 A;  1Y54 A;  1XFN A;  5JYP A;  1GCE A;  4LRZ E;  5CGX A;  2IWB A;  3S7N A;  3T1X A;  1F9I A;  3M6H A;  2FFY A;  3UMD A;  5GLB A;  3L9K A;  1VHM A;  4JXV A;  3FZC A;  3DTK A;  3PBR A;  2NUT C;  2BG1 A;  1FIL A;  1EI5 A;  1D1J A;  4OP8 A;  1HD8 A;  1MBL A;  5EOE A;  2W27 A;  1TS6 A;  2EX2 A;  4EEP A;  3KYQ A;  5A91 A;  4HJ4 A;  3UO9 A;  3CLO A;  3SH9 A;  4OOL A;  3E0Y A;  4QY5 A;  4PPR A;  1E3U A;  1PW8 A;  3OPH A;  4KUO A;  4QY6 A;  4Y2F A;  1LSX A;  3LR3 A;  3UDF A;  4N1X A;  3PXP A;  4JF5 A;  5FDH A;  4I5S A;  1VEU A;  2O9B A;  4E6W A;  1PWG A;  4L9E A;  5CHJ A;  3SS4 A;  2JC7 A;  1SKO B;  3U2A A;  2X71 A;  4S2K A;  3S4X A;  3EWK A;  2D02 A;  1N9B A;  4ID4 A;  3ZCZ A;  2E8J A;  4WYY A;  2HP6 A;  4CLC D;  3O86 A;  3VSK A;  4WF0 A;  3C4O A;  4Q0I A;  3BJN A;  1I2S A;  2A24 A;  4BBT A;  3ZNT A;  2EX6 A;  2WAE A;  1XJ3 A;  2VJW A;  2H28 A;  3SS3 A;  2R78 A;  1BZA A;  2H10 A;  3ZVW A;  3DBA A;  4JLF A;  5EEC A;  3A0S A;  1IYS A;  4YOF A;  1MC0 A;  3PBN A;  2WKE A;  4HBT A;  2XK1 A;  5L10 A;  2J9P A;  2OOL A;  4GOG A;  1VET A;  2WKP A;  3IF6 C;  5J8X A;  1YMX A;  2ZM0 A;  4IUK A;  1OTI A;  1XXM A;  3BQ8 A;  1ONG A;  1KDW A;  5EM1 A;  1PWD A;  3EQV A;  1K56 D;  4MMN A;  2V2F F;  4S2L A;  1RGY A;  3NI9 A;  4HES A;  5GL9 A;  3O88 A;  4MLL A;  3BW6 A;  3T4S A;  3TG9 A;  4EWF A;  4UQI S;  2W3D A;  3ZDJ A;  3T1S A;  5KSC A;  3IXG A;  3RH8 B;  4CLC B;  3HLC A;  1AXB A;  5FQ9 A;  2PHY A;  1M40 A;  3LR0 A;  2KLI A;  1XPB A;  3MZE A;  1LI9 A;  1MWU A;  5GLA A;  3E4O A;  2O9A A;  2L4R A;  1S4S A;  3DTI A;  4OON A;  4ZAM A;  3ZYT A;  4PKY G;  4Q0J A;  3LI9 A;  3G32 A;  3HLF A;  1K57 A;  5CTM A;  3BWL A;  1T1A A;  2VA0 A;  2V0U A;  4OP5 A;  1YAX A;  2J3W A;  3HJI A;  5HWT A;  4RYE A;  2GNX A;  2DMW A;  3E98 A;  2PBD P;  1DJA A;  3BYD A;  3M2K A;  4N92 A;  4OPZ A;  2Q9M A;  2QPN A;  1GSX A;  5FAQ A;  3MMH A;  3LIB A;  3MBZ A;  2W3H A;  2Y91 A;  2ZQC A;  4GB7 A;  3IS2 A;  5AQ9 A;  5CEB A;  1MPL A;  4HNB A;  2XA7 M;  1ES3 A;  4HHD A;  4BEN A;  5J7E A;  4LFU A;  3SW1 A;  2Y55 A;  2VX8 A;  2J7V A;  1PWC A;  2LB9 A;  4R6L A;  2OAP 1;  1ZTU A;  4B88 A;  4XUZ A;  3LR4 A;  2QKP A;  1Q2P A;  5M19 A;  1IYQ A;  2QZ6 A;  4WEJ A;  3ZHH A;  5A90 A;  3A0V A;  2ZC5 B;  2ZM8 A;  4S2O A;  3QP4 A;  5M1A A;  1NLZ A;  3T1R A;  2HJ9 C;  1NRF A;  5HL6 A;  1NLY A;  2Y2J A;  3K3D A;  4HP4 A;  3L7H A;  5FAT A;  2Z6D A;  4PM6 A;  4DF6 A;  1WYB A;  2WGW A;  1G6O A;  4CPK A;  5KMW A;  4GS9 A;  3H7W A;  5HL1 A;  3DW0 A;  3VP2 A;  4WZ5 A;  4PM8 A;  4DJ2 A;  5DKL A;  1MWS A;  2ZC7 A;  2WGI A;  4LEN A;  2PAV P;  1EWZ A;  5CGW A;  5DTT A;  2ZMF A;  4Y0O A;  2P74 A;  1STZ A;  1IYP A;  3U4L P;  5MC7 A;  1ZC2 A;  4WLA A;  1OT6 A;  1PW1 A;  3ZG5 A;  2OLV A;  3CG5 A;  2XRO A;  4I3A A;  3VFF A;  4FH4 A;  4OVD A;  2OAQ 1;  2HDQ A;  2KOI A;  3QP1 A;  3MKF A;  2V0W A;  3O87 A;  2HP5 A;  3HUN A;  2CMN A;  2W1T A;  4DDY A;  4GNU A;  4LGW A;  3IBJ A;  3NC8 A;  2EXA A;  3T4O A;  1OPX A;  3SZT A;  2IWD A;  2VLG A;  5FAP A;  3T4T A;  4DE1 A;  1W63 M;  5FI7 A;  2PDR A;  2ZL1 A;  3VP4 A;  5JYO A;  1XJ2 A;  5EVI C;  1TEM A;  2I72 A;  3E2L A;  4BBU A;  2Y2M A;  2QWS A;  5AQA A;  2H5S A;  1ONH A;  4U0X A;  2PT7 A;  4QWO A;  4R0Q A;  3HLG A;  3P01 A;  2WKQ A;  4JGO A;  3KSI A;  4M4X A;  3HRE A;  1E3U D;  3FG8 A;  2I9V A;  5FDS A;  5TGF A;  4OOY A;  5CTN A;  1IKI A;  1J9M A;  3ZG9 B;  1TDG A;  1KGF A;  2K7S A;  1H8Z A;  1NWZ A;  3R7W B;  5FAO A;  3IH8 A;  3OBF A;  3W8K A;  4BD0 A;  1F5M A;  5G18 A;  1ESI A;  5M18 A;  4MBK A;  4PM5 A;  4OQ0 A;  3HJK A;  4JF4 A;  2H0T A;  4ARZ A;  1IKG A;  4FUW A;  4EW7 A;  3NOP C;  4KZ3 A;  1YLY A;  3FWL A; 
#chains in the Genus database with same CATH homology
 3GQZ A;  5CGX A;  2IWB A;  1KGE A;  2ZQ7 A;  5F82 A;  4OH0 A;  3ITB A;  5AQB A;  1BSG A;  4UHU A;  3WRT A;  1XA1 A;  4JKT A;  3IF6 B;  1ZG4 A;  4MBF A;  3SH7 A;  2WZZ A;  3M6H A;  2OSU A;  4DXB A;  2Y2I A;  2FFY A;  2VGJ A;  5HFO A;  1RGZ A;  5GLB A;  3FKV A;  4PMA A;  2Y2K A;  1ES5 A;  1NZO A;  2XFS A;  4JXV A;  4EUZ A;  3FZC A;  4C3Q A;  1NZU A;  3G2Y A;  3S1Y A;  3PBR A;  3C7V A;  4LV1 A;  3VOY A;  1OME A;  3IF6 A;  2OV5 A;  3NY4 A;  2BG1 A;  1EI5 A;  4OPR A;  4DE0 A;  4S2I A;  1LL5 A;  1W79 A;  3DTM A;  4NET A;  4UA9 A;  1YLJ A;  4OP8 A;  1HD8 A;  1MBL A;  4S2M A;  1BUE A;  5EOE A;  1HZO A;  3BLM A;  2EX2 A;  3G31 A;  3NCK A;  4WZ4 A;  3HLW A;  5A91 A;  3UO9 A;  3BFD A;  3V5M A;  2EXB A;  1L2S A;  3SH9 A;  1LI0 A;  2V1Z A;  4BLM A;  4IBR A;  1KVL A;  4F94 A;  5FSR A;  5I94 A;  2BLS A;  4OOL A;  5EPH A;  4QY5 A;  3TOI A;  3CMZ A;  4PPR A;  4QJG A;  1PYY A;  1E3U A;  1PW8 A;  3OPH A;  4LV2 A;  4JXS A;  3AGE A;  3N7W A;  2ZQ9 A;  4RX2 A;  4QY6 A;  1XKZ A;  1W5D A;  1ERQ A;  5CHU A;  3MKE A;  3UDF A;  1WYC A;  2X02 A;  3ZG7 B;  4YIN A;  4N1X A;  1SDE A;  4BJP A;  4R1G A;  3HL9 A;  2WAF A;  4JF5 A;  5FDH A;  2XD1 A;  5GHY A;  3ZG8 B;  4E6W A;  4C6Y A;  1PWG A;  3Q7Z A;  5CER A;  2ZMA A;  5CHJ A;  3SS4 A;  2JC7 A;  4GZB A;  3NBL A;  2X71 A;  4S2K A;  1HTZ A;  3S4X A;  4R4S A;  2G2U A;  4X69 A;  5EE8 A;  4ZDX A;  3VMA A;  5FQI A;  2R9X A;  1JWV A;  1N9B A;  4ID4 A;  2RCX A;  3NDG A;  3ZCZ A;  3CJM A;  3Q82 A;  4PM7 A;  1YQS A;  4WYY A;  2HP6 A;  4E6X A;  3O86 A;  4KEN B;  3VSK A;  3VFH A;  2ZC4 B;  3C4O A;  1I2S A;  2Z2L B;  3OPP A;  3A3D A;  4S2J A;  3C5A A;  3UDI A;  1M6K A;  2HDS A;  1KVM A;  3GRJ A;  4K0W A;  3TSG A;  3ZNT A;  5CXW A;  2EX6 A;  1FR6 A;  2WAE A;  4S2N A;  4BQM A;  1GA9 A;  4H8R A;  3OCL A;  4ZJ3 A;  3SS3 A;  4FSF A;  3V39 A;  4E3I A;  1BZA A;  5TR7 A;  4OQI A;  1H8Y A;  2H10 A;  3ZVW A;  4GN2 A;  4KQQ A;  3SH8 A;  3FWL A;  4JLF A;  5EEC A;  4B4X A;  1RCJ A;  5L2F A;  1ERO A;  1IYS A;  1E25 A;  1QME A;  1S6R A;  2XH9 A;  4Y7P A;  1K6R A;  1DJB A;  3PBN A;  2WKE A;  2WKH A;  1FSY A;  3V3R A;  1CEF A;  4HBT A;  2XK1 A;  3UY6 A;  2J9P A;  5A92 A;  4GOG A;  1NYY A;  3IF6 C;  5J8X A;  1YMX A;  3UPO A;  2ZM0 A;  1U60 A;  4N9L A;  1XXM A;  4XXR A;  3PBS A;  4A5R A;  3ZVT A;  4E3O A;  4P6B A;  4R23 A;  3O3V A;  3PBQ A;  3IHA A;  1Z6F A;  4FCF A;  3P09 A;  5DVA A;  5DTS A;  2QMI A;  1SCW A;  4XUX A;  5HAQ A;  1K6S A;  1ONG A;  4MBH A;  1KDW A;  1FR1 A;  3UDX A;  3BEC A;  1PWD A;  1SDN A;  1FCM A;  5F1F A;  3EQV A;  1JWZ A;  1K56 D;  5U47 A;  4KG5 A;  3C7U A;  2V2F F;  3QNC A;  4RA7 A;  4S2L A;  2JE5 A;  1RGY A;  3NI9 A;  3G35 A;  1PZP A;  4HES A;  1I2W A;  3BRM A;  3LCE A;  4LCM A;  1YLP A;  3O88 A;  3BFE A;  5GL9 A;  5CED A;  1K25 A;  4MLL A;  1BTL A;  1KE3 A;  3TG9 A;  1NXY A;  4EWF A;  2WAD A;  3WS5 A;  4DE3 A;  3ZDJ A;  4FD8 A;  4Z9Q A;  1CEG A;  1FCN A;  3AGF A;  3UE0 A;  2OLU A;  1LL9 A;  3G4P A;  5KSC A;  4E3K A;  1ESU A;  3IXG A;  1DY6 A;  4WEK A;  4KZ5 A;  2Z2M B;  4C75 A;  2Y2L A;  4KZ4 A;  1NY0 A;  2FFF B;  1SKF A;  5EOO A;  3HLC A;  3W4Q A;  1AXB A;  5FQ9 A;  4GD6 A;  1PIO A;  1M40 A;  3N8R A;  3UE3 A;  3HLE A;  1XPB A;  1XGJ A;  3MZE A;  4JXG A;  2HDU A;  1K38 A;  1ES4 A;  4L0L A;  4QU3 A;  3S22 A;  1LI9 A;  1MWU A;  5GLA A;  3DWZ A;  4QD4 A;  1LHY A;  5HAP A;  1WE4 A;  5EVI D;  3Q07 A;  4OON A;  4ZAM A;  3E2K A;  1PI5 A;  5GHX A;  4IBX A;  4KZ7 A;  4EQI A;  4ZJ1 A;  1L0D A;  5FA7 A;  3G32 A;  3HLF A;  4P0M A;  1K57 A;  5BOH A;  5CTM A;  1XP4 A;  2ZD8 A;  3IWI A;  2WYX A;  3LEZ A;  3OPL A;  4S2N C;  5E2H A;  1BLH A;  3UE1 A;  4X6T A;  1JTD A;  4OP5 A;  2Y2P A;  1W8Q A;  2PU4 A;  2ZC6 B;  4IVK A;  3VP3 A;  2WKI A;  4OKP A;  1L0E A;  3VOZ A;  4E3N A;  3OC2 A;  3G34 A;  2DRW A;  2DNS A;  4RYE A;  2XLN A;  3OPR A;  1H5X A;  3GR2 A;  3G2Z A;  4O7D A;  3MZD A;  1GHM A;  2XEP A;  1DJA A;  3BYD A;  3UPP A;  2WGV A;  3M2K A;  4N92 A;  4OPZ A;  3WS1 A;  2Q9M A;  3BFG A;  3GSG A;  4UA7 A;  2QPN A;  3LY3 A;  5EUA A;  2ZQD A;  3SS5 A;  4IED A;  5KZH A;  5FAQ A;  1XX2 A;  5CEC A;  4GDN A;  3WWX A;  5FI2 A;  4ZJ2 A;  3MBZ A;  4Q8I A;  2HPB A;  2Y2H A;  4RX3 A;  2Y91 A;  2ZQC A;  4GB7 A;  2PBY A;  4BD1 A;  4OOM A;  1YLZ A;  4M3K A;  5AQ9 A;  5CEB A;  1MPL A;  2Q9N A;  3IXH A;  5CGS A;  3QNB A;  4D2O A;  4EBP A;  4JBF A;  3WS0 A;  1K56 A;  1ES3 A;  4BEN A;  3LY4 A;  3BEB A;  4S2P A;  2ZJ9 A;  3HLB A;  2EX8 A;  2Y55 A;  1ALQ A;  1KDS A;  1BLC A;  2J7V A;  2E8I A;  1PI4 A;  3GVB A;  4JXW A;  2Y2N A;  2A3U A;  3PBT A;  1G68 A;  1TVF A;  2XQZ A;  1PWC A;  3AGD A;  1DJC A;  1KE0 A;  3FV7 A;  3A3J A;  3M6B A;  4Y0U A;  3HBR A;  2ZLY A;  2EX9 A;  4DKI A;  3C4P A;  2HP9 A;  3VSL A;  5HW3 A;  4B88 A;  1NYM A;  4XUZ A;  2RL3 A;  1Q2P A;  2IWC A;  5EVI B;  3I7J A;  5M19 A;  3HUO A;  3NDE A;  1TDL A;  3D4F A;  1IYQ A;  3QHY A;  1VM1 A;  3RXX A;  2QZ6 A;  1KE4 A;  4WEJ A;  3ZHH A;  5A90 A;  3VP0 A;  2ZC5 B;  2ZM8 A;  4S2O A;  3MZF A;  4X53 A;  3FYZ A;  1JWP A;  1C3B A;  1MY8 A;  1YLW A;  5M1A A;  2WGW B;  3EQU A;  4OLG A;  3W4O A;  2P9V B;  1ERM A;  5CRF A;  2Y59 A;  2UWX A;  4U3T A;  5EVI A;  3ZNY A;  3VP1 A;  4YFM A;  1NRF A;  5F83 A;  4OQG A;  4X68 A;  5FQQ A;  2Y2J A;  4QHC A;  4LV3 A;  3GTC A;  5FAT A;  2XD5 A;  4KG2 A;  3WS4 A;  1W8Y A;  5IHV A;  1K57 C;  1ES2 A;  4PM6 A;  5HAR A;  4DF6 A;  4GDB A;  1WYB A;  4DE2 A;  2WGW A;  5DTK A;  1CI8 A;  1QMF A;  3UNW A;  2P9V A;  1BUL A;  3UN7 A;  3PAG A;  1K55 A;  4OPY A;  4CPK A;  2CC1 A;  4BL3 A;  3MFD A;  5KMW A;  3HLD A;  4KZ8 A;  2XDM A;  4ZTK A;  4R4R A;  3UPN A;  5GLD A;  1GHI A;  1PZO A;  3OCN A;  4N1H A;  5FQM A;  5HL1 A;  3IF5 A;  3ITA A;  2JCH A;  1K4E A;  3DW0 A;  5FQJ A;  3A3F A;  1GA0 A;  1ZKJ A;  1O07 A;  4X56 A;  2VGK A;  1BLP A;  2Y2O A;  3VP2 A;  2B5R A;  1ZG6 A;  4WZ5 A;  4PM8 A;  1MWS A;  2ZC7 A;  5AQ7 A;  1L0G A;  4UAA A;  4DDS A;  2WGI A;  3WS2 A;  4GD8 A;  2HDR A;  5FAS A;  2A49 A;  3V50 A;  4OQH A;  3IH9 A;  4LEN A;  1VQQ A;  2PU2 A;  4KQR A;  3Q81 A;  4NK3 A;  5KSH A;  1EWZ A;  3P98 A;  4ZBE A;  3ZFZ A;  5CGW A;  3V3S A;  3DWK A;  5DTT A;  2C5W B;  5CHM A;  1GHP A;  4Y0O A;  1JVJ A;  2P74 A;  2XGN A;  3ZG0 A;  1IYP A;  3RJU A;  1IEM A;  5DF9 A;  4IVI A;  1ZC2 A;  4LV0 A;  3JYI A;  3N6I A;  2JBF A;  1PW1 A;  3ZG5 A;  2OLV A;  1XA7 A;  2GDN A;  3CG5 A;  4P87 A;  4Y0T A;  5A93 A;  4EV4 A;  1CI9 A;  3VFF A;  5E2E A;  1Q2Q A;  4FH4 A;  4WEL A;  3PAE A;  4OVD A;  3FKW A;  2XF3 A;  4WBG A;  1BT5 A;  5D3O A;  4WMC D;  2HDQ A;  3IHB A;  1L0F A;  3MKF A;  3BFC A;  3O87 A;  1N4O A;  3GMW A;  3HVF A;  3CZD A;  2HP5 A;  1YM1 A;  1O7E A;  5DF8 A;  3HUN A;  3M2J A;  3BLS A;  4DDY A;  2C6W B;  4LCL A;  4EBL A;  4K0X A;  4MNR A;  4GNU A;  3NC8 A;  2EXA A;  1K54 C;  4QB8 A;  3N8S A;  5HAI A;  2IWD A;  4KQO A;  3SOI A;  4R3J A;  5FI6 A;  1LLB A;  4OLD A;  2ZQ8 A;  4JPM A;  5FAP A;  3GV9 A;  3LO7 A;  4DE1 A;  5E43 A;  2H0Y A;  5FI7 A;  3BM6 A;  1JTG A;  3PTE A;  3VP4 A;  3OZH A;  2WZX A;  3BFF A;  5JYO A;  1XGI A;  1MXO A;  5EVI C;  1IYO A;  4FH2 A;  1TEM A;  2I72 A;  3E2L A;  1MWT A;  2J8Y A;  3IXD A;  1E4D A;  4EBN A;  2Y2M A;  5AQA A;  2V20 A;  2EFU A;  4CJN A;  2H5S A;  1S0W A;  2Y4A A;  4DXC A;  1I5Q A;  2X01 A;  3NIA A;  1ONH A;  4U0X A;  1FQG A;  5E2F A;  4R0Q A;  5TFQ A;  1YLT A;  1HVB A;  1NJ4 A;  3HLG A;  4HBU A;  3PBO A;  2ZC3 B;  4KZA A;  1K55 C;  5EVL A;  3A3E A;  1G6A A;  3HRE A;  1FOF A;  4KZ9 A;  3MXR A;  1E3U D;  3Q1F A;  1W7F A;  5TGF A;  4OOY A;  1KGG A;  2XFT A;  3IXB A;  1K54 A;  4U0T A;  5CTN A;  3W4P A;  1IKI A;  1J9M A;  3N8L A;  4P85 A;  4K91 A;  3WRZ A;  3ZG9 B;  1TDG A;  3Q7V B;  4RVA A;  4E3J A;  3N4I A;  2WUQ A;  1KGF A;  3ZGA B;  2EFX A;  1FCO A;  1YMS A;  4JF6 A;  1MKI A;  1SHV A;  1H8Z A;  4KG6 A;  4KZ6 A;  4WZ5 C;  3HUM A;  4HEF A;  3IWO A;  2WK0 A;  3RXW A;  4B4Z A;  5FAO A;  3IQA A;  5E2G A;  4N9K A;  3B3X A;  4R3B A;  2Y2Q A;  1K4F A;  3IH8 A;  5DF7 A;  5FQK A;  3W8K A;  4BD0 A;  2J9O A;  4KZB A;  2DCF A;  5GLC A;  4PM9 A;  2Y2G A;  5G18 A;  2R9W A;  4E3L A;  1ESI A;  3Q7V A;  3A3I A;  3ISG A;  5M18 A;  1RP5 A;  4MBK A;  4PM5 A;  4OQ0 A;  4JF4 A;  4WM9 A;  4BL2 A;  1CK3 A;  2H0T A;  4MEZ A;  5GHZ A;  1IEL A;  1IKG A;  4DRT A;  3IWQ A;  2ZM2 A;  5F1G A;  1BLS A;  3IT9 A;  3MXS A;  5HX9 A;  4UA6 A;  2XR0 A;  1Y54 A;  1YT4 A;  1FSW A;  1MWR A;  2G2W A;  3G30 A;  4KZ3 A;  1YLY A;  4X55 A;  4GKU A;  4E3M A;  5JYP A;  4OPQ A;  4WMC A;  1GCE A;  2ZQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...