2ZQ8A

Apo structure of class a beta-lactamase toho-1 r274n/r276n double mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
261
structure length
261
Chain Sequence
b'NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
molecule tags Hydrolase
source organism Escherichia coli
publication title Improvement of crystal quality by surface mutations of beta-lactamase Toho-1
pubmed doi rcsb
total genus 94
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zq8A00
1S0WA 1H5XA 3V3RA 3I7JA 4H8RA 4MBFA 3ZFZA 5IHVA 1ZC2A 1IYQA 1MXOA 2H5SA 2G2UA 1TVFA 1EWZA 1XA7A 3IT9A 1L0FA 3OPRA 4R1GA 3UN7A 3DW0A 4E3IA 3UPOA 4E3NA 5CTNA 3GTCA 5A91A 3AGFA 1ERQA 2WKIA 2WGWA 1PWCA 3IXGA 4N1HA 5EECA 4N9LA 2ZM0A 3ISGA 1YLWA 3G32A 2C6WB 1NY0A 3SS5A 1HTZA 3TOIA 5M18A 3GSGA 1IKGA 3UPPA 3GV9A 1SHVA 3FZCA 1JTGA 2JC7A 4PM8A 4DDSA 4JLFA 1YLPA 1FR1A 3PBOA 3WS0A 1JWPA 1BT5A 5GLCA 2IWCA 3BLMA 2JE5A 4IVIA 1EI5A 2P9VA 4D2OA 4KZ3A 3OZHA 3TSGA 3BFCA 5AQBA 4HBTA 1FQGA 4ID4A 4JXSA 3DWKA 1YQSA 3A3DA 1SKFA 3HL9A 4EWFA 4FD8A 3ZNTA 1NXYA 4C6YA 1ES2A 5G18A 4FSFA 3M6HA 1C3BA 2H0TA 4BD0A 1PI4A 3G2ZA 4YINA 1PIOA 1K6SA 1K56A 2WAEA 3QNBA 3W4OA 1FR6A 3Q82A 3UO9A 3WWXA 1GA0A 2WGVA 3Q1FA 5A92A 3HLBA 2RCXA 2CC1A 3BFDA 1RP5A 1XP4A 2XFSA 2OV5A 3NBLA 3NDEA 3OPLA 4NETA 4OQHA 1KE4A 1KVLA 4OOLA 2DCFA 4JKTA 1PYYA 4N1XA 4BL2A 4R4SA 5FASA 3IF5A 1N9BA 4P6BA 2HP5A 3FWLA 3IXHA 3GMWA 3N7WA 5HX9A 4EBNA 2X02A 2A49A 1BLSA 5F83A 4QY6A 2V1ZA 1G68A 3DWZA 4MEZA 4MNRA 3BYDA 3O88A 1ES3A 3E2LA 3PBTA 2WKEA 1YMXA 4WZ5A 4PM9A 4DKIA 5HFOA 1KGGA 3BFGA 3A3IA 4GD6A 1LI9A 4QHCA 2ZM8A 4O7DA 1DJBA 2Z2MB 5CRFA 2J9PA 3Q07A 2EFXA 4GOGA 3HLFA 3SH7A 4IVKA 3WRZA 1YT4A 1ESIA 1XGJA 1XPBA 2XDMA 3S1YA 1PW8A 3WS2A 5CGSA 3FV7A 4WZ5C 5L2FA 3ZG9B 1ALQA 3G2YA 1K57A 4PM7A 4WBGA 4X55A 4Z9QA 1FCNA 2Y55A 4E6WA 2H0YA 4RYEA 3N6IA 4OQ0A 3PBRA 5F1GA 3OCLA 5EVID 2B5RA 5F82A 1PI5A 3UDIA 1BLCA 1NZUA 1Y54A 3ZDJA 3CMZA 5KMWA 1XA1A 4BQMA 5GHZA 1SDNA 2EXBA 4X56A 2Y2PA 3W8KA 4DE2A 2HPBA 5FI2A 2ZD8A 1KGFA 3SS4A 1J9MA 3AGEA 3LCEA 4DXCA 4R4RA 4R23A 4OVDA 1LL5A 1ONHA 2WADA 4B88A 5E2HA 2P9VB 4A5RA 4KQRA 3UDXA 5CHUA 1LL9A 4DE1A 4KG2A 2Y59A 4M3KA 1YLTA 3G35A 4PMAA 1MWTA 3VOYA 3QHYA 3G30A 4PM5A 1RCJA 3IHAA 5A93A 2I72A 1PW1A 4OQIA 1KDSA 3LEZA 4LENA 4OOMA 5GL9A 5J8XA 3OPPA 2ZMAA 3DTMA 1K55C 1HD8A 2QPNA 4U0TA 5FQKA 5HAPA 4JBFA 4R0QA 3NCKA 4GKUA 3IHBA 3UDFA 1HZOA 1GHIA 3ZG7B 5CGWA 4BLMA 3WS5A 3IH8A 5FI6A 1YLZA 1BLHA 2WK0A 1BUEA 2XFTA 1E3UA 4P0MA 3ZVWA 2Y2QA 4DXBA 3PBQA 4DRTA 1FCOA 1FOFA 2QMIA 5E2FA 5HARA 4B4ZA 5JYPA 2HDSA 2PU4A 5DTTA 4F94A 3W4QA 2XLNA 4QY5A 1MWRA 2A3UA 1HVBA 1SCWA 4DDYA 4GNUA 4OPYA 3W4PA 1K54A 2Q9MA 4JPMA 1LI0A 2J9OA 5EVIC 1N4OA 1IELA 4JF5A 5I94A 3O3VA 3VFHA 1W7FA 5FQJA 1JVJA 4B4XA 2P74A 2ZQAA 3M6BA 3MFDA 3VP4A 3Q7VB 5FAPA 1KVMA 3OCNA 3BECA 4XXRA 3VFFA 3VMAA 1NYMA 2WKHA 4ZBEA 4KZ4A 4X53A 2WZXA 3VSLA 1ZG4A 4N92A 4EUZA 1IYOA 4GDNA 2ZQ7A 4WMCA 3ZG0A 4MBKA 3ZGAB 5BOHA 3HLGA 1BULA 3HBRA 2GDNA 4FH2A 5TR7A 5DTSA 1GHPA 4OONA 2FFFB 3M2KA 4OH0A 4S2KA 3PAEA 2Z2LB 1GHMA 4WYYA 1PWGA 2HP6A 2XD1A 4PM6A 1TDLA 4BD1A 3HREA 3VP1A 1XKZA 4E3JA 1MKIA 4PPRA 4GD8A 3WS4A 4HBUA 2XD5A 2EFUA 2BG1A 4S2JA 4WEJA 2Y4AA 1DJCA 1K4EA 4KZ6A 1H8YA 4S2NC 3RXXA 3VP2A 1JWZA 3NY4A 3Q81A 4P85A 3BFEA 2PBYA 1FSYA 2JBFA 4E3MA 3CZDA 5M1AA 1JWVA 5FAQA 2EX6A 5GHYA 3C7UA 2IWDA 4EBLA 2JCHA 1L0EA 4MBHA 3GVBA 5E43A 5U47A 4UA6A 3V39A 3IF6C 1NYYA 5FQMA 3CJMA 1PZPA 1MY8A 3ZG8B 4Y7PA 4GDBA 1K6RA 4KZ5A 1M6KA 3S4XA 4WEKA 1MBLA 4KZ7A 4XUZA 2Y2MA 1W5DA 3LY4A 2EX9A 3V3SA 4E6XA 2XGNA 3CG5A 3MBZA 3P98A 3MXSA 3MKEA 4S2OA 3FKVA 4KG6A 3NDGA 1BSGA 2XR0A 1K56D 3HUNA 1IEMA 1MPLA 4GN2A 4R3BA 3ZHHA 4CPKA 2X71A 4P87A 4EV4A 4DE0A 1KDWA 4KZBA 3S22A 3GQZA 4WM9A 4FCFA 3RJUA 3IWIA 1I2WA 5FATA 1W79A 5AQ9A 4GB7A 1CK3A 5GHXA 4EQIA 4OQGA 1G6AA 4LV1A 4KQQA 5FA7A 2ZM2A 1KGEA 2WYXA 4QJGA 4FH4A 4X68A 4UAAA 4E3KA 1S6RA 4QD4A 2Y2NA 1FSWA 2V2FF 2Q9NA 3BM6A 4ZTKA 4UHUA 5HAIA 4BJPA 2WAFA 1QMEA 2HP9A 4K91A 5HAQA 5HL1A 3MZDA 1Z6FA 3ZNYA 5KZHA 4OPZA 4QB8A 1WYBA 1WE4A 2VGJA 3HLEA 4X6TA 3V50A 4IBXA 1YMSA 2OLUA 1LHYA 2Y91A 1Q2PA 1W8QA 4N9KA 3SOIA 4RX3A 5FSRA 2XH9A 2ZLYA 4K0WA 4LCMA 4IBRA 3UNWA 2ZQ8A 1NRFA 2VGKA 3NI9A 3C4PA 1ESUA 1CEGA 2Y2GA 3A3JA 3HUMA 4ZJ2A 3VSKA 3BLSA 3G34A 5M19A 1E25A 4JF6A 2EX2A 2BLSA 1O7EA 1K55A 4OP5A 4S2LA 4ZAMA 3ZVTA 1K57C 2XQZA 3GR2A 1K4FA 4HEFA 3BFFA 3C4OA 3VOZA 3IWQA 2ZC5B 4OP8A 2HDQA 4S2IA 5AQAA 4JXVA 4U3TA 3SH8A 3IF6B 1ONGA 3O86A 2V20A 5DVAA 3FKWA 3V5MA 3IWOA 1ZKJA 3E2KA 2RL3A 3EQVA 2Y2HA 2FFYA 3TG9A 2Y2IA 1RGYA 5GLBA 3HLWA 2EXAA 2ZC3B 2ZJ9A 3IXDA 5DTKA 5FQIA 5CHMA 2ZQCA 1M40A 4JXWA 5E2EA 5A90A 5KSCA 4GZBA 5DF8A 3SS3A 1K25A 1PWDA 4OPRA 1YLJA 3PBNA 4KZAA 4Y0OA 1AXBA 2WGWB 1TEMA 3UE3A 1QMFA 4HESA 4ZDXA 2R9XA 5E2GA 1BLPA 1NJ4A 5FQ9A 5CERA 1MWSA 5DF7A 3UY6A 1CI9A 2QZ6A 3BRMA 3C7VA 1W8YA 1E3UD 5GLDA 1DJAA 2ZQDA 4OLGA 5EUAA 1O07A 5FDHA 2ZC6B 2OLVA 4KENB 3HLCA 4KQOA 1ES4A 4L0LA 3ZCZA 5D3OA 1XX2A 3M2JA 1E4DA 3BEBA 2Y2KA 3IXBA 5CXWA 4MLLA 3WRTA 3MKFA 4CJNA 5DF9A 4LV0A 2DNSA 4XUXA 5CGXA 1WYCA 3PBSA 3WS1A 3IF6A 1JTDA 2UWXA 3IH9A 3Q7ZA 3QNCA 4UA9A 5FAOA 3D4FA 1ZG6A 1ERMA 2ZC4B 4JF4A 3C5AA 3NC8A 1TDGA 1IYPA 2OSUA 1GCEA 5CEBA 1CI8A 2DRWA 5CTMA 4S2PA 2G2WA 2Y2JA 5EPHA 2WUQA 2E8IA 5TGFA 4S2NA 5JYOA 4OLDA 4X69A 1CEFA 2C5WB 4Y0UA 3P09A 3MXRA 1EROA 3G4PA 1PZOA 2XEPA 5CEDA 5KSHA 4KZ9A 3HLDA 4OPQA 4RVAA 4EBPA 3RXWA 2R9WA 4K0XA 4LV2A 4ZJ3A 5HW3A 4KG5A 4DF6A 2ZQ9A 4RX2A 3UPNA 4BENA 2XF3A 3B3XA 3AGDA 3ITAA 4U0XA 1H8ZA 1I5QA 4IEDA 2WGIA 5F1FA 2XK1A 3PAGA 2EX8A 3GRJA 5CHJA 1BZAA 4UA7A 1GA9A 3N8LA 1IYSA 2WZZA 2X01A 1BTLA 3MZFA 4QU3A 3MZEA 4WZ4A 2IWBA 4DE3A 1U60A 1VQQA 1KE0A 3UE1A 4Q8IA 1DY6A 5EOEA 1K38A 4LV3A 4R3JA 1FCMA 2J8YA 3N4IA 5EE8A 3N8SA 1L0GA 4BL3A 1SDEA 4RA7A 1K54C 5EVIA 3LO7A 1RGZA 1VM1A 3Q7VA 1LLBA 3N8RA 3G31A 3NIAA 1L2SA 4S2MA 4OOYA 3IQAA 2Y2OA 4YFMA 5EOOA 1IKIA 4C75A 3OPHA 5EVIB 1XXMA 5EVLA 3UE0A 3VP3A 4OKPA 2ZC7A 2J7VA 2HDRA 4ZJ1A 5TFQA 2HDUA 2H10A 4C3QA 3HUOA 1L0DA 3OC2A 3SH9A 4LCLA 3FYZA 1XGIA 1OMEA 1NZOA 3ITBA 4E3OA 5FI7A 3HVFA 3A3FA 1ES5A 1I2SA 2PU2A 3PTEA 2Y2LA 3LY3A 3A3EA 3JYIA 5FQQA 1KE3A 3VP0A 4WMCD 4Y0TA 3O87A 3ZG5A 4WELA 5AQ7A 4E3LA 1MWUA 1Q2QA 1YLYA 1YM1A 4JXGA 4NK3A 3EQUA 4KZ8A 5CECA 5GLAA
chains in the Genus database with same CATH superfamily
4H8RA 4G3WA 3MSHA 4R70A 1ZC2A 1IYQA 1MXOA 2G2UA 3NOTC 1L0FA 3DW0A 3E4QA 4E3NA 1S67L 3C30A 4L9EA 3E98A 3ISGA 1IKGA 3FZCA 1LT0A 3FG8A 2JC7A 4PM8A 4DDSA 4JLFA 3RTYA 3PBOA 4R6LA 3BLMA 2V8CA 4IVIA 2XA7S 4D2OA 3LIDA 1FQGA 1PFLA 4ID4A 3W2ZA 4JXSA 4EEUA 1YQSA 2P04A 3A3DA 1SKFA 4WN5A 3L9KA 3ZNTA 1ES2A 2H0TA 4BD0A 4YINA 4KUOA 3WWXA 3S7QA 3Q1FA 2IA2A 2Q0OA 3BFDA 3NDEA 1KVLA 2DCFA 3NOUC 3OLOA 1PYYA 5FASA 3DBAA 2X02A 2PRFA 1G68A 3DWZA 3H82A 3E2LA 5AVFA 2WKEA 4WZ5A 5L09A 3H9WA 5HFOA 1KGGA 2EFXA 3T4SA 1YT4A 4G3VA 1ESIA 1XGJA 1XPBA 2XDMA 4H6JB 3WS2A 5EM1A 3ZG9B 5J7EA 4PM7A 4UQIS 5EM0A 2VKSA 1UWPX 1FCNA 5EVID 1PI5A 3CMZA 5KMWA 2PR5A 3SS4A 3DTEA 1J9MA 4DXCA 4R23A 1MZUA 2YKFA 1LL5A 1ONHA 2WADA 2P08A 1OJGA 4A5RA 1LL9A 3CITA 2EWVA 2JKRI 4KG2A 4DE1A 5FL3A 4F3LB 2PR6A 5EV0A 4PMAA 3VOYA 4LRXC 4OQIA 3LEZA 3R7WA 1OTIA 3DTMA 2OAQ1 1HD8A 2XRNA 5HSQA 4JBFA 1GHIA 3MXQA 3WS5A 5FI6A 1P97A 2XFTA 3LR0A 3KYZA 5JYPA 2BTFP 2PU4A 3W4QA 1HVBA 4JPMA 1IELA 5I94A 3LI9A 3M6BA 2O9CA 4GS9B 3VP4A 3OCNA 3BECA 2J80A 3T4TA 3VMAA 4ETXA 2DMWA 4EUZA 1N9NA 3ZG0A 2B02A 1BULA 4FH2A 4CLCD 2FFFB 2PBDP 4BD1A 1XKZA 5K5BA 1VETA 3L7HA 1FILA 4ETZA 5TJJA 3NHQA 1DP6A 4E3MA 1JWVA 4EBLA 1L0EA 2OOLA 3DAVA 5FQMA 1NYYA 3CJMA 1PZPA 4JGQA 2W3HA 5HPIA 4WEKA 5AJGA 2VGLM 2OWHA 3LY4A 3V3SA 5HDSA 4E6XA 3MXSA 3MKEA 1V9YA 2XR0A 3HUNA 1IEMA 4CPKA 2X71A 3RJUA 3IWIA 4GB7A 4LV1A 5G4ZA 5L10A 1S6RA 3KYEA 1FSWA 2V2FF 2O9AA 3BM6A 3LR3A 5HAIA 2QJ7A 2WAFA 3MZDA 4LFUA 1T1CA 1Z6FA 3ZNYA 3T4KA 5KZHA 4WLAA 2VGJA 4IBXA 3T1XA 3K2NA 1LHYA 4X25A 2GX5A 1Q2PA 1W8QA 4N9KA 4Y15A 4Y17A 5C5KA 3MR0A 4HJ3A 3NI9A 1Y4OA 1ESUA 1CEGA 4ZJ2A 3BLSA 3C38A 3BQ8A 1E25A 4HEFA 1KOUA 4HY8A 3IF6B 3O86A 4MCWA 3FKWA 4JGOA 1TS0A 4E04A 2FFYA 3IXDA 5CHMA 2ZQCA 5E2EA 5KSCA 3SS3A 3LIFA 3HJKA 2WKPA 3H7WB 4Y0OA 2R9XA 5E2GA 5FQ9A 1MKMA 1MWSA 3UY6A 1W8YA 5GLDA 1DJAA 1P9WA 2G7UA 3CPTA 5FDHA 2ZC6B 4L0LA 2OLVA 1XX2A 1ZHHB 2ZBBA 3F1OB 3MKFA 4CJNA 4DN0A 4ZRRA 3D4FA 5DKKA 4JF4A 3C5AA 2OSUA 1CI8A 4S2PA 3C2WA 4OLDA 2ACGA 2K7SA 3P09A 1PZOA 3F1NB 1VEUA 4OPQA 3UB9A 2R9WA 4LV2A 4ZJ3A 5HW3A 4BENA 4RX2A 2W1TA 1H8ZA 3UB7A 4IUHA 2VV7A 1P9RA 2XK1A 2EX8A 1BZAA 3IBRA 3N8LA 3T1QB 3MQQA 4KUKA 5HL6A 3MZEA 4WZ4A 3UE1A 3F1PA 5EOEA 1TS6A 4EETB 3MFXA 2OAP1 1K54C 3LO7A 1RGZA 1VM1A 2Y79A 3N8RA 4ESPA 4OOYA 5L07A 5EOOA 3QP8A 1XXMA 1OPXA 1V9ZA 3UE0A 1YSQA 1ODVA 4OKPA 5I5LA 3PR6A 2H10A 4C3QA 4LCLA 2OWJA 2HV1A 1NZOA 3ITBA 4E3OA 2HJEA 1I2SA 2Y2LA 3A3EA 3JYIA 4Y3IA 3QP2A 4M4XA 4Y0TA 3QP4A 3O87A 2PYPA 4LRZE 4E3LA 1Q2QA 1YM1A 3LIBA 4HH2A 3P7NA 2JN7A 3I7JA 3A0SA 5DFYA 1TVFA 3UN7A 2PHYA 2V8FA 1Z09A 5CTNA 5KIZA 3AGFA 1ERQA 2WKIA 2WGWA 3BWLA 4N1HA 1CF0A 4N9LA 3TOIA 5J3WA 3BJNA 4EU0A 3BW6A 2J3TC 3A0RA 5TBMA 2JE5A 2O9BA 3CUEA 3CI6A 4K08A 3TSGA 4HQAA 4HBTA 1VHMA 4EWFA 1C3BA 1VETB 3G2ZA 4HJ6A 1K56A 1FR6A 3Q82A 1GA0A 2WGVA 1TS8A 2CC1A 1RP5A 1XP4A 2OV5A 3OPLA 4OQHA 1KE4A 4OOLA 4I3AA 4NG2A 4N1XA 2AVXA 5HWWA 2HP5A 4IJGA 3GMWA 3N7WA 5HX9A 4EBNA 3KYQA 3GECA 3TW8A 3IX8A 4MNRA 1ES3A 1LI9A 2HGVA 3SH7A 4IVKA 3WRZA 4WZ5C 4WBGA 4X55A 4GHIB 1LL8A 4Q0IA 3OCLA 1LSVA 1F98A 1BLCA 1NZUA 5F6AA 2EXBA 4X56A 1W63Q 5FI2A 2ZD8A 1KGFA 4OVDA 3E4OA 4B88A 4DMZA 2P9VB 4NXGA 2VV6A 2Y59A 4M3KA 3UE6A 1MWTA 3F1OA 4PM5A 4EEPA 2I72A 1KDSA 4OOMA 4LENA 4HP9A 1HLUP 2V9AA 4X1LA 2QPNA 2HF6A 4R0QA 1TS7A 4BWIA 1HZOA 5F68A 4BLMA 3IH8A 1YLZA 1BLHA 1BUEA 2VZWA 4P0MA 2WKQA 2Y2QA 1FCOA 2QMIA 5HARA 4B4ZA 2UV0E 2HDSA 4F94A 2XLNA 4WL9A 1MWRA 4CLCB 4EESA 4GNUA 4GS9A 4OPYA 1K54A 1LI0A 4FUWA 3O3VA 4HHDA 4B4XA 1PRQA 4QPRA 5FAPA 1KVMA 1NYMA 4ZBEA 1FIKA 2WZXA 3VSLA 1ZG4A 1IYOA 3F1PB 4GDNA 2ZQ7A 2JKTM 2W1RA 5HWTA 3T12B 5DTSA 4LRYC 3M2KA 1YAXA 2Z2LB 1GHMA 4WYYA 2XD1A 1TDLA 3EWKA 3HREA 1XJ3A 4E3JA 4PPRA 3F1NA 4WEJA 2P7JA 2EA9A 3B33A 3EGDC 1EW0A 3CAXA 2JKRM 3C7UA 1DP8A 2IWDA 3KX0X 3U4LP 3V39A 3CHWP 1MY8A 4GDBA 1K6RA 4NXEA 2NUTC 3UMEA 4EQ1A 3LGOA 4KZ7A 2PD8A 3KSGA 2EX9A 4EW7A 2XGNA 3MBZA 4S2OA 3NDGA 1MPLA 4GN2A 4R3BA 4DE0A 3S22A 4FCFA 3U2AA 5FATA 5HWVA 4KQQA 5FA7A 3KSHA 2ZM2A 1KGEA 2WYXA 4QJGA 4FH4A 4X68A 1IOUA 4E3KA 4YNRA 5DJTA 4I3IA 3LEQA 4Z1WA 1QMEA 3BQAA 2I9VA 4DJ2A 1T18A 2VJWA 4OPZA 2ZMFA 1G5UA 3V50A 4I3JA 3SOIA 4O01A 4RX3A 5FSRA 3EOIA 2XH9A 3D72A 3OBFA 3HUMA 3VSKA 3G34A 2PT7A 2EX2A 4OP5A 1K55A 4ZAMA 3GR2A 1K4FA 3VOZA 3C4OA 3QP5A 2ZC5B 1T1BA 2HDQA 1SZVA 3SH8A 1GSVA 5DVAA 1ZKJA 2Y2IA 5FQIA 2EXAA 2ZC3B 4JXWA 2FZ0A 3PBNA 4L9GA 2WGWB 1TEMA 4HESA 4ZDXA 1BLPA 1CI9A 1N9OA 2L0WA 4I5SA 5EFWA 1Y28A 2ZQDA 3NOPC 3ZCZA 1ES4A 5HD3A 2V1BA 3M2JA 2Y2KA 5CXWA 3A0VA 3S7NA 3WRTA 4LV0A 5CGXA 1WYCA 3PBSA 1XJ2A 3WS1A 3ULFA 1JTDA 2ZOHA 4YWZA 4I39A 1TDGA 1G6OA 3KSIA 2G2WA 3TE8A 4PAUA 2E8IA 3UB5P 4BBVA 4LGWA 2C5WB 4GLQA 3JPUA 3MXRA 5CEDA 2XEPA 3HLDA 4HIAA 4EBPA 4K0XA 4KG5A 4DF6A 2ZQ9A 2XF3A 3ITAA 3RH8B 2QYBA 2WGIA 1OTBA 3PAGA 2W1TB 3GRJA 3IX3A 3JVVA 2V0UA 2LB5A 4UA7A 3NJAA 3MZFA 1U60A 4Q8IA 4P6ZM 2K31A 4AFIA 2J8YA 5EE8A 2O99A 3N8SA 1SDEA 3PYPA 4I38A 3R4KA 3G31A 2K2NA 2Y2OA 3LFVA 1IKIA 3OPHA 3VV4A 2ZC7A 5TFQA 1S1YA 2HDUA 5DFXA 3FYZA 1UWNX 5FI7A 5F5YA 1ES5A 2W3GA 2PU2A 2QWSA 5FQQA 1STZA 3VP0A 3CLOA 3CUEC 4NK3A 1MC0A 5CECA 1XJ6A 5GLAA 3V3RA 4MBFA 5IHVA 3T4OA 1EWZA 1XA7A 3UPOA 2HJ9C 2XSSA 5A91A 3B47A 2C6WB 1NY0A 3SS5A 1HTZA 1OT9A 4HJ4A 4ME4A 3UPPA 3GV9A 1NLZA 1JTGA 2M7VA 1H3QA 2NUPC 2IWCA 3D3OA 1EI5A 3V67A 5AQBA 4F3LA 3DWKA 3PXPA 3HL9A 4FD8A 5G18A 2ZMVA 4FSFA 3M6HA 1PI4A 1PIOA 1K6SA 2QHKA 2WAEA 3QNBA 3W4OA 3UO9A 5A92A 3ZQ5A 3HLBA 2RCXA 3NBLA 4NETA 4R4SA 3IF5A 1N9BA 5AVEA 3IXHA 1DRMA 2E8JA 2A49A 5F83A 1DP9A 4MEZA 4MN5A 3O88A 3PBTA 5DJUA 1YMXA 4PM9A 3BFGA 4QHCA 2ZM8A 4O7DA 1DJBA 2J9PA 3E4PA 2M7UA 2W0NA 3MQ0A 3HLFA 2MJ6A 2W27A 3LI8A 2JKGA 1PW8A 5CGSA 4XT2A 2W3EA 1ALQA 1K57A 3SZTA 2Y55A 2VLGA 3LICA 4RYEA 3PBRA 2B5RA 3CPTB 3UDIA 3ZDJA 1NRJA 1SDNA 2Y2PA 3W8KA 4DE2A 2HPBA 3LCEA 2PD7A 2B95A 4KQRA 1YLTA 3G35A 3H82B 3QHYA 4P6ZS 3G30A 3EEAA 1RCJA 3IHAA 5A93A 5GL9A 2ZMAA 5IT5A 1K55C 4U0TA 5FQKA 4Y5FA 3ZG7B 4R3AA 2BASA 2PYRA 4NXFA 2A24B 1E3UA 3ZVWA 1UGUA 4DRTA 1FOFA 5DTTA 4QY5A 1SCWA 4DDYA 2Q9MA 2J9OA 3LR4A 4G3KA 1OT6A 4YOFA 3VFHA 5FQJA 4MN7A 1JVJA 2P74A 2ZQAA 3PHYA 3T4JA 5HD5A 4L9FA 2WKHA 2VV8A 2CMNA 4X53A 4Y2FA 3IS2B 4N92A 3IBJA 3UMDA 4WMCA 4MBKA 3ZGAB 5TR7A 2GDNA 4OONA 2H28A 3PAEA 3TRCA 2A2LA 2ZOIA 4H6JA 3VP1A 4BBUA 2JKFA 2Y8HA 4GD8A 1XJ4A 4HH3A 2XD5A 2EFUA 1OTEA 1DJCA 1K4EA 4KZ6A 1H8YA 3RXXA 2JHEA 2GNXA 1JWZA 4P85A 2ZL1B 1FSYA 3B42A 1S4RA 2JBFA 4FTXA 3CZDA 5M1AA 4MN6A 1YSPA 5FAQA 2EX6A 5GHYA 2JCHA 4MBHA 3GVBA 4UQIM 5E43A 5U47A 4QWOA 1IFQA 3IF6C 3ZG8B 1NWZA 1M6KA 2QKPA 3S4XA 4Q0HA 4O8GA 4JGRA 1W5DA 4Q0JA 5LBRA 3EEHA 3MF0A 3P98A 3BY9A 1BSGA 2KLIA 2R78A 3VE4A 1I2WA 1W79A 5AQ9A 1CK3A 1NLYA 4EQIA 4OQGA 1G6AA 4DJ3A 2Y2NA 1GSXA 2LB9A 1CJFA 3LUQA 3K3DA 5HL1A 3IX4A 2L4RA 4QB8A 4X6TA 3DTKA 2OLUA 4JGPA 5HDCA 2ZLYA 4K0WA 4LCMA 3TJZC 2ZQ8A 1NRFA 2VGKA 3A3JA 2Y2GA 1TD5A 5M19A 1X0OA 4JF6A 2BLSA 3ZVTA 1K57C 3BFFA 3IWQA 4OP8A 4S2IA 5AQAA 1W63M 4U3TA 3V5MA 3IWOA 4Y13A 1RGYA 4X1MA 3MJQA 5A90A 1D1JA 4GZBA 5DF8A 1K25A 4OPRA 1YLJA 3MQOA 4KZAA 2XA7M 1NJ4A 5DF7A 2QZ6A 3C7VA 1E3UD 4OLGA 5EUAA 2B18A 3HLCA 4KQOA 5D3OA 1OTAA 3BEBA 3IXBA 2M1CA 5DF9A 2DNSA 1AWIA 4PKYA 3T4LA 3IH9A 1ZG6A 3NC8A 4CLCC 1IYPA 1GCEA 5CTMA 2Y2JA 2WUQA 5TGFA 4S2NA 4X69A 4BMWA 4Y0UA 3G6OA 3G4PA 5KSHA 4KZ9A 4RVAA 2XROA 3B3XA 3AGDA 1I5QA 4IEDA 5F1FA 5CHJA 2WZZA 1YKDA 4WUJA 4KQDA 5HDDA 4IHQA 4DE3A 1VQQA 1DY6A 1K38A 3C8CA 3N4IA 1OTDA 1SKOB 4BL3A 5EVIA 1LLBA 2VX8A 3NIAA 1L2SA 5J4EA 1OJ5A 4RQ9A 2HDRA 4ZJ1A 3D9YA 4GJ4A 3HUOA 3SH9A 2GJ3A 4EUVA 3A3FA 3H7WA 1JNUA 1VEUB 3LY3A 2A24A 2KX6A 4WELA 1MWUA 3EQUA 3TG9A 4KZ8A 2HZ5A 1S0WA 1H5XA 3ZFZA 2H5SA 3OPRA 3IT9A 4HOIA 4R1GA 4E3IA 3GTCA 1PWCA 3IXGA 1S66L 3MS6A 5EECA 2ZM0A 1YLWA 3G32A 1LSWA 5M18A 3GSGA 5CX7A 3FPWA 1SHVA 1YLPA 1FR1A 4ARZA 3WS0A 1JWPA 1BT5A 1L3LA 5GLCA 4GHIA 2P9VA 1XFNA 4KZ3A 3OZHA 3BFCA 3OOVA 1NXYA 4C6YA 3P01A 1BYWA 3UB8A 2D01A 5A8BA 1YPRA 3T50A 2XFSA 4JKTA 3ZYTA 1P0ZA 4BL2A 4P6BA 3FWLA 4PHTA 3O5YA 1BLSA 4QY6A 2V1ZA 3BYDA 4DKIA 3T4QA 3A3IA 4GD6A 4MDZA 2Z2MB 5CRFA 3Q07A 2VA0A 4GOGA 4EXOA 5TBMB 1D06A 5HZHA 2J3TD 4MMNA 3S1YA 3FV7A 3K3CA 5L2FA 3G2YA 4Z9QA 4E6WA 2H0YA 3N6IA 4OQ0A 5F1GA 2Z6DA 5F82A 3RFBA 1Y54A 1XA1A 4BQMA 1PNEA 5GHZA 3CWFA 3VE3A 3AGEA 3EGXC 4R4RA 4O0PA 5E2HA 3UDXA 5CHUA 5DKLA 3GDIA 1PW1A 5J8XA 3OPPA 4B93A 1A0KA 5HAPA 3UDFA 2QJ5A 3NCKA 3IHBA 4GKUA 2W3DA 5CGWA 2WK0A 4HP4A 4GCZA 4DXBA 3PBQA 1D7EA 4PKYG 5E2FA 3NECA 4HI4A 2EWWA 2A3UA 3FPVA 3W4PA 5EVIC 1ACFA 2KDKA 5EVEA 1F2KA 1N4OA 4JF5A 1W7FA 4BBTA 3MFDA 3Q7VB 1H8MA 3HCYA 4XXRA 3VFFA 4KZ4A 1VB6A 5BOHA 3HLGA 3HBRA 1GHPA 4OH0A 4R38A 4II7A 4S2KA 3IS2A 1PWGA 2HP6A 4PM6A 2WKRA 1MKIA 3WS4A 4HBUA 5IS1A 2BG1A 2V0WA 4S2JA 1CQAA 2YKHA 2Y4AA 3QP1A 4S2NC 3LIAA 3VP2A 3LR5A 3NY4A 3Q81A 3BFEA 2PBYA 4CLCA 3MMHA 4UA6A 2ZL1A 2VEAA 4NEED 4Y7PA 4KZ5A 3E0YA 3LIEA 1MBLA 4XUZA 2Y2MA 1F5MA 3CG5A 3FKVA 4KG6A 2V1AA 1K56D 3ZHHA 4EV4A 4P87A 1KDWA 4KZBA 3GQZA 4WM9A 1S4SA 3T1SA 5GHXA 4WF0A 3DTIA 4CQHA 4UAAA 4QD4A 5IU1A 5L8MA 2Q9NA 3VOLA 4ZTKA 4UHUA 4BJPA 2HP9A 4K91A 5HAQA 3R7WB 4IUKA 1WYBA 1WE4A 3HLEA 1YMSA 4CLCE 2PAVP 2Y91A 5FDSA 5FEGA 1LSXA 4IBRA 3UNWA 3C4PA 1ZTUA 4ARZB 3SW1A 1O7EA 4S2LA 5G4YA 2XQZA 2VGLS 3QP6A 4JXVA 2O0YA 1ONGA 4XT2B 1J3WA 2V20A 5MC7A 3E2KA 2RL3A 3EQVA 2Y2HA 1T1AA 5GLBA 3HLWA 3JVUA 2ZJ9A 5DTKA 1M40A 3LYXA 3UB6A 1PWDA 2L1MA 4HNBA 1AXBA 3UE3A 1QMFA 5CERA 3BRMA 4D60A 3KO6A 3ICYA 4FOFA 2PDRA 1O07A 4KENB 2INWA 2J3WA 3HJIA 1E4DA 1GSWA 4MLLA 4XUXA 2D02A 4LLOB 3IF6A 2UWXA 3Q7ZA 3QNCA 4UA9A 5FAOA 1ERMA 2ZC4B 2VK3A 5CEBA 2DRWA 4NXBA 1F9IA 3BY8A 5EPHA 1SKOA 5F69A 5JYOA 1CEFA 4NKPA 1EROA 3T1RA 1S1ZA 3RXWA 5FEFA 3KSFA 1N9LA 3UPNA 4U0XA 1TF1A 3S7PA 2GZAA 4EERA 2Z6CA 1GA9A 1IYSA 2X01A 1BTLA 4QU3A 2IWBA 1KE0A 4LV3A 4R3JA 1FCMA 1L0GA 4RA7A 3S7OA 1WA9A 3Q7VA 3FC7A 4B9OA 4S2MA 3IQAA 3NULA 2KOIA 4LPZA 4YFMA 4C75A 1H0MA 5EVIB 5EVLA 4UEYA 3VP3A 2J7VA 4GW9A 1L0DA 3OC2A 2FH5A 1XGIA 1OMEA 1T19A 1XFQA 3HVFA 2W3FA 3PTEA 5HPFA 1KE3A 4WMCD 3ZG5A 1G28A 5AQ7A 1YLYA 4JXGA 1K0KA 2JKTI
chains in the Genus database with same CATH topology
1S0WA 1H5XA 3V3RA 3I7JA 4H8RA 4MBFA 3ZFZA 5IHVA 1ZC2A 1IYQA 1MXOA 2H5SA 2G2UA 1TVFA 1EWZA 1XA7A 3IT9A 1L0FA 3OPRA 4R1GA 3UN7A 3DW0A 4E3IA 3UPOA 4E3NA 5CTNA 3GTCA 5A91A 3AGFA 1ERQA 2WKIA 2WGWA 1PWCA 3IXGA 4N1HA 5EECA 4N9LA 2ZM0A 3ISGA 1YLWA 3G32A 2C6WB 1NY0A 3SS5A 1HTZA 3TOIA 5M18A 3GSGA 1IKGA 3UPPA 3GV9A 1SHVA 3FZCA 1JTGA 2JC7A 4PM8A 4DDSA 4JLFA 1YLPA 1FR1A 3PBOA 3WS0A 1JWPA 1BT5A 5GLCA 2IWCA 3BLMA 2JE5A 4IVIA 1EI5A 2P9VA 4D2OA 4KZ3A 3OZHA 3TSGA 3BFCA 5AQBA 4HBTA 1FQGA 4ID4A 4JXSA 3DWKA 1YQSA 3A3DA 1SKFA 3HL9A 4EWFA 4FD8A 3ZNTA 1NXYA 4C6YA 1ES2A 5G18A 4FSFA 3M6HA 1C3BA 2H0TA 4BD0A 1PI4A 3G2ZA 4YINA 1PIOA 1K6SA 1K56A 2WAEA 3QNBA 3W4OA 1FR6A 3Q82A 3UO9A 3WWXA 1GA0A 2WGVA 3Q1FA 5A92A 3HLBA 2RCXA 2CC1A 3BFDA 1RP5A 1XP4A 2XFSA 2OV5A 3NBLA 3NDEA 3OPLA 4NETA 4OQHA 1KE4A 1KVLA 4OOLA 2DCFA 4JKTA 1PYYA 4N1XA 4BL2A 4R4SA 5FASA 3IF5A 1N9BA 4P6BA 2HP5A 3FWLA 3IXHA 3GMWA 3N7WA 5HX9A 4EBNA 2X02A 2A49A 1BLSA 5F83A 4QY6A 2V1ZA 1G68A 3DWZA 4MEZA 4MNRA 3BYDA 3O88A 1ES3A 3E2LA 3PBTA 2WKEA 1YMXA 4WZ5A 4PM9A 4DKIA 5HFOA 1KGGA 3BFGA 3A3IA 4GD6A 1LI9A 4QHCA 2ZM8A 4O7DA 1DJBA 2Z2MB 5CRFA 2J9PA 3Q07A 2EFXA 4GOGA 3HLFA 3SH7A 4IVKA 3WRZA 1YT4A 1ESIA 1XGJA 1XPBA 2XDMA 3S1YA 1PW8A 3WS2A 5CGSA 3FV7A 4WZ5C 5L2FA 3ZG9B 1ALQA 3G2YA 1K57A 4PM7A 4WBGA 4X55A 4Z9QA 1FCNA 2Y55A 4E6WA 2H0YA 4RYEA 3N6IA 4OQ0A 3PBRA 5F1GA 3OCLA 5EVID 2B5RA 5F82A 1PI5A 3UDIA 1BLCA 1NZUA 1Y54A 3ZDJA 3CMZA 5KMWA 1XA1A 4BQMA 5GHZA 1SDNA 2EXBA 4X56A 2Y2PA 3W8KA 4DE2A 2HPBA 5FI2A 2ZD8A 1KGFA 3SS4A 1J9MA 3AGEA 3LCEA 4DXCA 4R4RA 4R23A 4OVDA 1LL5A 1ONHA 2WADA 4B88A 5E2HA 2P9VB 4A5RA 4KQRA 3UDXA 5CHUA 1LL9A 4DE1A 4KG2A 2Y59A 4M3KA 1YLTA 3G35A 4PMAA 1MWTA 3VOYA 3QHYA 3G30A 4PM5A 1RCJA 3IHAA 5A93A 2I72A 1PW1A 4OQIA 1KDSA 3LEZA 4LENA 4OOMA 5GL9A 5J8XA 3OPPA 2ZMAA 3DTMA 1K55C 1HD8A 2QPNA 4U0TA 5FQKA 5HAPA 4JBFA 4R0QA 3NCKA 4GKUA 3IHBA 3UDFA 1HZOA 1GHIA 3ZG7B 5CGWA 4BLMA 3WS5A 3IH8A 5FI6A 1YLZA 1BLHA 2WK0A 1BUEA 2XFTA 1E3UA 4P0MA 3ZVWA 2Y2QA 4DXBA 3PBQA 4DRTA 1FCOA 1FOFA 2QMIA 5E2FA 5HARA 4B4ZA 5JYPA 2HDSA 2PU4A 5DTTA 4F94A 3W4QA 2XLNA 4QY5A 1MWRA 2A3UA 1HVBA 1SCWA 4DDYA 4GNUA 4OPYA 3W4PA 1K54A 2Q9MA 4JPMA 1LI0A 2J9OA 5EVIC 1N4OA 1IELA 4JF5A 5I94A 3O3VA 3VFHA 1W7FA 5FQJA 1JVJA 4B4XA 2P74A 2ZQAA 3M6BA 3MFDA 3VP4A 3Q7VB 5FAPA 1KVMA 3OCNA 3BECA 4XXRA 3VFFA 3VMAA 1NYMA 2WKHA 4ZBEA 4KZ4A 4X53A 2WZXA 3VSLA 1ZG4A 4N92A 4EUZA 1IYOA 4GDNA 2ZQ7A 4WMCA 3ZG0A 4MBKA 3ZGAB 5BOHA 3HLGA 1BULA 3HBRA 2GDNA 4FH2A 5TR7A 5DTSA 1GHPA 4OONA 2FFFB 3M2KA 4OH0A 4S2KA 3PAEA 2Z2LB 1GHMA 4WYYA 1PWGA 2HP6A 2XD1A 4PM6A 1TDLA 4BD1A 3HREA 3VP1A 1XKZA 4E3JA 1MKIA 4PPRA 4GD8A 3WS4A 4HBUA 2XD5A 2EFUA 2BG1A 4S2JA 4WEJA 2Y4AA 1DJCA 1K4EA 4KZ6A 1H8YA 4S2NC 3RXXA 3VP2A 1JWZA 3NY4A 3Q81A 4P85A 3BFEA 2PBYA 1FSYA 2JBFA 4E3MA 3CZDA 5M1AA 1JWVA 5FAQA 2EX6A 5GHYA 3C7UA 2IWDA 4EBLA 2JCHA 1L0EA 4MBHA 3GVBA 5E43A 5U47A 4UA6A 3V39A 3IF6C 1NYYA 5FQMA 3CJMA 1PZPA 1MY8A 3ZG8B 4Y7PA 4GDBA 1K6RA 4KZ5A 1M6KA 3S4XA 4WEKA 1MBLA 4KZ7A 4XUZA 2Y2MA 1W5DA 3LY4A 2EX9A 3V3SA 4E6XA 2XGNA 3CG5A 3MBZA 3P98A 3MXSA 3MKEA 4S2OA 3FKVA 4KG6A 3NDGA 1BSGA 2XR0A 1K56D 3HUNA 1IEMA 1MPLA 4GN2A 4R3BA 3ZHHA 4CPKA 2X71A 4P87A 4EV4A 4DE0A 1KDWA 4KZBA 3S22A 3GQZA 4WM9A 4FCFA 3RJUA 3IWIA 1I2WA 5FATA 1W79A 5AQ9A 4GB7A 1CK3A 5GHXA 4EQIA 4OQGA 1G6AA 4LV1A 4KQQA 5FA7A 2ZM2A 1KGEA 2WYXA 4QJGA 4FH4A 4X68A 4UAAA 4E3KA 1S6RA 4QD4A 2Y2NA 1FSWA 2V2FF 2Q9NA 3BM6A 4ZTKA 4UHUA 5HAIA 4BJPA 2WAFA 1QMEA 2HP9A 4K91A 5HAQA 5HL1A 3MZDA 1Z6FA 3ZNYA 5KZHA 4OPZA 4QB8A 1WYBA 1WE4A 2VGJA 3HLEA 4X6TA 3V50A 4IBXA 1YMSA 2OLUA 1LHYA 2Y91A 1Q2PA 1W8QA 4N9KA 3SOIA 4RX3A 5FSRA 2XH9A 2ZLYA 4K0WA 4LCMA 4IBRA 3UNWA 2ZQ8A 1NRFA 2VGKA 3NI9A 3C4PA 1ESUA 1CEGA 2Y2GA 3A3JA 3HUMA 4ZJ2A 3VSKA 3BLSA 3G34A 5M19A 1E25A 4JF6A 2EX2A 2BLSA 1O7EA 1K55A 4OP5A 4S2LA 4ZAMA 3ZVTA 1K57C 2XQZA 3GR2A 1K4FA 4HEFA 3BFFA 3C4OA 3VOZA 3IWQA 2ZC5B 4OP8A 2HDQA 4S2IA 5AQAA 4JXVA 4U3TA 3SH8A 3IF6B 1ONGA 3O86A 2V20A 5DVAA 3FKWA 3V5MA 3IWOA 1ZKJA 3E2KA 2RL3A 3EQVA 2Y2HA 2FFYA 3TG9A 2Y2IA 1RGYA 5GLBA 3HLWA 2EXAA 2ZC3B 2ZJ9A 3IXDA 5DTKA 5FQIA 5CHMA 2ZQCA 1M40A 4JXWA 5E2EA 5A90A 5KSCA 4GZBA 5DF8A 3SS3A 1K25A 1PWDA 4OPRA 1YLJA 3PBNA 4KZAA 4Y0OA 1AXBA 2WGWB 1TEMA 3UE3A 1QMFA 4HESA 4ZDXA 2R9XA 5E2GA 1BLPA 1NJ4A 5FQ9A 5CERA 1MWSA 5DF7A 3UY6A 1CI9A 2QZ6A 3BRMA 3C7VA 1W8YA 1E3UD 5GLDA 1DJAA 2ZQDA 4OLGA 5EUAA 1O07A 5FDHA 2ZC6B 2OLVA 4KENB 3HLCA 4KQOA 1ES4A 4L0LA 3ZCZA 5D3OA 1XX2A 3M2JA 1E4DA 3BEBA 2Y2KA 3IXBA 5CXWA 4MLLA 3WRTA 3MKFA 4CJNA 5DF9A 4LV0A 2DNSA 4XUXA 5CGXA 1WYCA 3PBSA 3WS1A 3IF6A 1JTDA 2UWXA 3IH9A 3Q7ZA 3QNCA 4UA9A 5FAOA 3D4FA 1ZG6A 1ERMA 2ZC4B 4JF4A 3C5AA 3NC8A 1TDGA 1IYPA 2OSUA 1GCEA 5CEBA 1CI8A 2DRWA 5CTMA 4S2PA 2G2WA 2Y2JA 5EPHA 2WUQA 2E8IA 5TGFA 4S2NA 5JYOA 4OLDA 4X69A 1CEFA 2C5WB 4Y0UA 3P09A 3MXRA 1EROA 3G4PA 1PZOA 2XEPA 5CEDA 5KSHA 4KZ9A 3HLDA 4OPQA 4RVAA 4EBPA 3RXWA 2R9WA 4K0XA 4LV2A 4ZJ3A 5HW3A 4KG5A 4DF6A 2ZQ9A 4RX2A 3UPNA 4BENA 2XF3A 3B3XA 3AGDA 3ITAA 4U0XA 1H8ZA 1I5QA 4IEDA 2WGIA 5F1FA 2XK1A 3PAGA 2EX8A 3GRJA 5CHJA 1BZAA 4UA7A 1GA9A 3N8LA 1IYSA 2WZZA 2X01A 1BTLA 3MZFA 4QU3A 3MZEA 4WZ4A 2IWBA 4DE3A 1U60A 1VQQA 1KE0A 3UE1A 4Q8IA 1DY6A 5EOEA 1K38A 4LV3A 4R3JA 1FCMA 2J8YA 3N4IA 5EE8A 3N8SA 1L0GA 4BL3A 1SDEA 4RA7A 1K54C 5EVIA 3LO7A 1RGZA 1VM1A 3Q7VA 1LLBA 3N8RA 3G31A 3NIAA 1L2SA 4S2MA 4OOYA 3IQAA 2Y2OA 4YFMA 5EOOA 1IKIA 4C75A 3OPHA 5EVIB 1XXMA 5EVLA 3UE0A 3VP3A 4OKPA 2ZC7A 2J7VA 2HDRA 4ZJ1A 5TFQA 2HDUA 2H10A 4C3QA 3HUOA 1L0DA 3OC2A 3SH9A 4LCLA 3FYZA 1XGIA 1OMEA 1NZOA 3ITBA 4E3OA 5FI7A 3HVFA 3A3FA 1ES5A 1I2SA 2PU2A 3PTEA 2Y2LA 3LY3A 3A3EA 3JYIA 5FQQA 1KE3A 3VP0A 4WMCD 4Y0TA 3O87A 3ZG5A 4WELA 5AQ7A 4E3LA 1MWUA 1Q2QA 1YLYA 1YM1A 4JXGA 4NK3A 3EQUA 4KZ8A 5CECA 5GLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0W A;  1H5X A;  3V3R A;  3I7J A;  4H8R A;  4MBF A;  3ZFZ A;  5IHV A;  1ZC2 A;  1IYQ A;  1MXO A;  2H5S A;  2G2U A;  1TVF A;  1EWZ A;  1XA7 A;  3IT9 A;  1L0F A;  3OPR A;  4R1G A;  3UN7 A;  3DW0 A;  4E3I A;  3UPO A;  4E3N A;  5CTN A;  3GTC A;  5A91 A;  3AGF A;  1ERQ A;  2WKI A;  2WGW A;  1PWC A;  3IXG A;  4N1H A;  5EEC A;  4N9L A;  2ZM0 A;  3ISG A;  1YLW A;  3G32 A;  2C6W B;  1NY0 A;  3SS5 A;  1HTZ A;  3TOI A;  5M18 A;  3GSG A;  1IKG A;  3UPP A;  3GV9 A;  1SHV A;  3FZC A;  1JTG A;  2JC7 A;  4PM8 A;  4DDS A;  4JLF A;  1YLP A;  1FR1 A;  3PBO A;  3WS0 A;  1JWP A;  1BT5 A;  5GLC A;  2IWC A;  3BLM A;  2JE5 A;  4IVI A;  1EI5 A;  2P9V A;  4D2O A;  4KZ3 A;  3OZH A;  3TSG A;  3BFC A;  5AQB A;  4HBT A;  1FQG A;  4ID4 A;  4JXS A;  3DWK A;  1YQS A;  3A3D A;  1SKF A;  3HL9 A;  4EWF A;  4FD8 A;  3ZNT A;  1NXY A;  4C6Y A;  1ES2 A;  5G18 A;  4FSF A;  3M6H A;  1C3B A;  2H0T A;  4BD0 A;  1PI4 A;  3G2Z A;  4YIN A;  1PIO A;  1K6S A;  1K56 A;  2WAE A;  3QNB A;  3W4O A;  1FR6 A;  3Q82 A;  3UO9 A;  3WWX A;  1GA0 A;  2WGV A;  3Q1F A;  5A92 A;  3HLB A;  2RCX A;  2CC1 A;  3BFD A;  1RP5 A;  1XP4 A;  2XFS A;  2OV5 A;  3NBL A;  3NDE A;  3OPL A;  4NET A;  4OQH A;  1KE4 A;  1KVL A;  4OOL A;  2DCF A;  4JKT A;  1PYY A;  4N1X A;  4BL2 A;  4R4S A;  5FAS A;  3IF5 A;  1N9B A;  4P6B A;  2HP5 A;  3FWL A;  3IXH A;  3GMW A;  3N7W A;  5HX9 A;  4EBN A;  2X02 A;  2A49 A;  1BLS A;  5F83 A;  4QY6 A;  2V1Z A;  1G68 A;  3DWZ A;  4MEZ A;  4MNR A;  3BYD A;  3O88 A;  1ES3 A;  3E2L A;  3PBT A;  2WKE A;  1YMX A;  4WZ5 A;  4PM9 A;  4DKI A;  5HFO A;  1KGG A;  3BFG A;  3A3I A;  4GD6 A;  1LI9 A;  4QHC A;  2ZM8 A;  4O7D A;  1DJB A;  2Z2M B;  5CRF A;  2J9P A;  3Q07 A;  2EFX A;  4GOG A;  3HLF A;  3SH7 A;  4IVK A;  3WRZ A;  1YT4 A;  1ESI A;  1XGJ A;  1XPB A;  2XDM A;  3S1Y A;  1PW8 A;  3WS2 A;  5CGS A;  3FV7 A;  4WZ5 C;  5L2F A;  3ZG9 B;  1ALQ A;  3G2Y A;  1K57 A;  4PM7 A;  4WBG A;  4X55 A;  4Z9Q A;  1FCN A;  2Y55 A;  4E6W A;  2H0Y A;  4RYE A;  3N6I A;  4OQ0 A;  3PBR A;  5F1G A;  3OCL A;  5EVI D;  2B5R A;  5F82 A;  1PI5 A;  3UDI A;  1BLC A;  1NZU A;  1Y54 A;  3ZDJ A;  3CMZ A;  5KMW A;  1XA1 A;  4BQM A;  5GHZ A;  1SDN A;  2EXB A;  4X56 A;  2Y2P A;  3W8K A;  4DE2 A;  2HPB A;  5FI2 A;  2ZD8 A;  1KGF A;  3SS4 A;  1J9M A;  3AGE A;  3LCE A;  4DXC A;  4R4R A;  4R23 A;  4OVD A;  1LL5 A;  1ONH A;  2WAD A;  4B88 A;  5E2H A;  2P9V B;  4A5R A;  4KQR A;  3UDX A;  5CHU A;  1LL9 A;  4DE1 A;  4KG2 A;  2Y59 A;  4M3K A;  1YLT A;  3G35 A;  4PMA A;  1MWT A;  3VOY A;  3QHY A;  3G30 A;  4PM5 A;  1RCJ A;  3IHA A;  5A93 A;  2I72 A;  1PW1 A;  4OQI A;  1KDS A;  3LEZ A;  4LEN A;  4OOM A;  5GL9 A;  5J8X A;  3OPP A;  2ZMA A;  3DTM A;  1K55 C;  1HD8 A;  2QPN A;  4U0T A;  5FQK A;  5HAP A;  4JBF A;  4R0Q A;  3NCK A;  4GKU A;  3IHB A;  3UDF A;  1HZO A;  1GHI A;  3ZG7 B;  5CGW A;  4BLM A;  3WS5 A;  3IH8 A;  5FI6 A;  1YLZ A;  1BLH A;  2WK0 A;  1BUE A;  2XFT A;  1E3U A;  4P0M A;  3ZVW A;  2Y2Q A;  4DXB A;  3PBQ A;  4DRT A;  1FCO A;  1FOF A;  2QMI A;  5E2F A;  5HAR A;  4B4Z A;  5JYP A;  2HDS A;  2PU4 A;  5DTT A;  4F94 A;  3W4Q A;  2XLN A;  4QY5 A;  1MWR A;  2A3U A;  1HVB A;  1SCW A;  4DDY A;  4GNU A;  4OPY A;  3W4P A;  1K54 A;  2Q9M A;  4JPM A;  1LI0 A;  2J9O A;  5EVI C;  1N4O A;  1IEL A;  4JF5 A;  5I94 A;  3O3V A;  3VFH A;  1W7F A;  5FQJ A;  1JVJ A;  4B4X A;  2P74 A;  2ZQA A;  3M6B A;  3MFD A;  3VP4 A;  3Q7V B;  5FAP A;  1KVM A;  3OCN A;  3BEC A;  4XXR A;  3VFF A;  3VMA A;  1NYM A;  2WKH A;  4ZBE A;  4KZ4 A;  4X53 A;  2WZX A;  3VSL A;  1ZG4 A;  4N92 A;  4EUZ A;  1IYO A;  4GDN A;  2ZQ7 A;  4WMC A;  3ZG0 A;  4MBK A;  3ZGA B;  5BOH A;  3HLG A;  1BUL A;  3HBR A;  2GDN A;  4FH2 A;  5TR7 A;  5DTS A;  1GHP A;  4OON A;  2FFF B;  3M2K A;  4OH0 A;  4S2K A;  3PAE A;  2Z2L B;  1GHM A;  4WYY A;  1PWG A;  2HP6 A;  2XD1 A;  4PM6 A;  1TDL A;  4BD1 A;  3HRE A;  3VP1 A;  1XKZ A;  4E3J A;  1MKI A;  4PPR A;  4GD8 A;  3WS4 A;  4HBU A;  2XD5 A;  2EFU A;  2BG1 A;  4S2J A;  4WEJ A;  2Y4A A;  1DJC A;  1K4E A;  4KZ6 A;  1H8Y A;  4S2N C;  3RXX A;  3VP2 A;  1JWZ A;  3NY4 A;  3Q81 A;  4P85 A;  3BFE A;  2PBY A;  1FSY A;  2JBF A;  4E3M A;  3CZD A;  5M1A A;  1JWV A;  5FAQ A;  2EX6 A;  5GHY A;  3C7U A;  2IWD A;  4EBL A;  2JCH A;  1L0E A;  4MBH A;  3GVB A;  5E43 A;  5U47 A;  4UA6 A;  3V39 A;  3IF6 C;  1NYY A;  5FQM A;  3CJM A;  1PZP A;  1MY8 A;  3ZG8 B;  4Y7P A;  4GDB A;  1K6R A;  4KZ5 A;  1M6K A;  3S4X A;  4WEK A;  1MBL A;  4KZ7 A;  4XUZ A;  2Y2M A;  1W5D A;  3LY4 A;  2EX9 A;  3V3S A;  4E6X A;  2XGN A;  3CG5 A;  3MBZ A;  3P98 A;  3MXS A;  3MKE A;  4S2O A;  3FKV A;  4KG6 A;  3NDG A;  1BSG A;  2XR0 A;  1K56 D;  3HUN A;  1IEM A;  1MPL A;  4GN2 A;  4R3B A;  3ZHH A;  4CPK A;  2X71 A;  4P87 A;  4EV4 A;  4DE0 A;  1KDW A;  4KZB A;  3S22 A;  3GQZ A;  4WM9 A;  4FCF A;  3RJU A;  3IWI A;  1I2W A;  5FAT A;  1W79 A;  5AQ9 A;  4GB7 A;  1CK3 A;  5GHX A;  4EQI A;  4OQG A;  1G6A A;  4LV1 A;  4KQQ A;  5FA7 A;  2ZM2 A;  1KGE A;  2WYX A;  4QJG A;  4FH4 A;  4X68 A;  4UAA A;  4E3K A;  1S6R A;  4QD4 A;  2Y2N A;  1FSW A;  2V2F F;  2Q9N A;  3BM6 A;  4ZTK A;  4UHU A;  5HAI A;  4BJP A;  2WAF A;  1QME A;  2HP9 A;  4K91 A;  5HAQ A;  5HL1 A;  3MZD A;  1Z6F A;  3ZNY A;  5KZH A;  4OPZ A;  4QB8 A;  1WYB A;  1WE4 A;  2VGJ A;  3HLE A;  4X6T A;  3V50 A;  4IBX A;  1YMS A;  2OLU A;  1LHY A;  2Y91 A;  1Q2P A;  1W8Q A;  4N9K A;  3SOI A;  4RX3 A;  5FSR A;  2XH9 A;  2ZLY A;  4K0W A;  4LCM A;  4IBR A;  3UNW A;  2ZQ8 A;  1NRF A;  2VGK A;  3NI9 A;  3C4P A;  1ESU A;  1CEG A;  2Y2G A;  3A3J A;  3HUM A;  4ZJ2 A;  3VSK A;  3BLS A;  3G34 A;  5M19 A;  1E25 A;  4JF6 A;  2EX2 A;  2BLS A;  1O7E A;  1K55 A;  4OP5 A;  4S2L A;  4ZAM A;  3ZVT A;  1K57 C;  2XQZ A;  3GR2 A;  1K4F A;  4HEF A;  3BFF A;  3C4O A;  3VOZ A;  3IWQ A;  2ZC5 B;  4OP8 A;  2HDQ A;  4S2I A;  5AQA A;  4JXV A;  4U3T A;  3SH8 A;  3IF6 B;  1ONG A;  3O86 A;  2V20 A;  5DVA A;  3FKW A;  3V5M A;  3IWO A;  1ZKJ A;  3E2K A;  2RL3 A;  3EQV A;  2Y2H A;  2FFY A;  3TG9 A;  2Y2I A;  1RGY A;  5GLB A;  3HLW A;  2EXA A;  2ZC3 B;  2ZJ9 A;  3IXD A;  5DTK A;  5FQI A;  5CHM A;  2ZQC A;  1M40 A;  4JXW A;  5E2E A;  5A90 A;  5KSC A;  4GZB A;  5DF8 A;  3SS3 A;  1K25 A;  1PWD A;  4OPR A;  1YLJ A;  3PBN A;  4KZA A;  4Y0O A;  1AXB A;  2WGW B;  1TEM A;  3UE3 A;  1QMF A;  4HES A;  4ZDX A;  2R9X A;  5E2G A;  1BLP A;  1NJ4 A;  5FQ9 A;  5CER A;  1MWS A;  5DF7 A;  3UY6 A;  1CI9 A;  2QZ6 A;  3BRM A;  3C7V A;  1W8Y A;  1E3U D;  5GLD A;  1DJA A;  2ZQD A;  4OLG A;  5EUA A;  1O07 A;  5FDH A;  2ZC6 B;  2OLV A;  4KEN B;  3HLC A;  4KQO A;  1ES4 A;  4L0L A;  3ZCZ A;  5D3O A;  1XX2 A;  3M2J A;  1E4D A;  3BEB A;  2Y2K A;  3IXB A;  5CXW A;  4MLL A;  3WRT A;  3MKF A;  4CJN A;  5DF9 A;  4LV0 A;  2DNS A;  4XUX A;  5CGX A;  1WYC A;  3PBS A;  3WS1 A;  3IF6 A;  1JTD A;  2UWX A;  3IH9 A;  3Q7Z A;  3QNC A;  4UA9 A;  5FAO A;  3D4F A;  1ZG6 A;  1ERM A;  2ZC4 B;  4JF4 A;  3C5A A;  3NC8 A;  1TDG A;  1IYP A;  2OSU A;  1GCE A;  5CEB A;  1CI8 A;  2DRW A;  5CTM A;  4S2P A;  2G2W A;  2Y2J A;  5EPH A;  2WUQ A;  2E8I A;  5TGF A;  4S2N A;  5JYO A;  4OLD A;  4X69 A;  1CEF A;  2C5W B;  4Y0U A;  3P09 A;  3MXR A;  1ERO A;  3G4P A;  1PZO A;  2XEP A;  5CED A;  5KSH A;  4KZ9 A;  3HLD A;  4OPQ A;  4RVA A;  4EBP A;  3RXW A;  2R9W A;  4K0X A;  4LV2 A;  4ZJ3 A;  5HW3 A;  4KG5 A;  4DF6 A;  2ZQ9 A;  4RX2 A;  3UPN A;  4BEN A;  2XF3 A;  3B3X A;  3AGD A;  3ITA A;  4U0X A;  1H8Z A;  1I5Q A;  4IED A;  2WGI A;  5F1F A;  2XK1 A;  3PAG A;  2EX8 A;  3GRJ A;  5CHJ A;  1BZA A;  4UA7 A;  1GA9 A;  3N8L A;  1IYS A;  2WZZ A;  2X01 A;  1BTL A;  3MZF A;  4QU3 A;  3MZE A;  4WZ4 A;  2IWB A;  4DE3 A;  1U60 A;  1VQQ A;  1KE0 A;  3UE1 A;  4Q8I A;  1DY6 A;  5EOE A;  1K38 A;  4LV3 A;  4R3J A;  1FCM A;  2J8Y A;  3N4I A;  5EE8 A;  3N8S A;  1L0G A;  4BL3 A;  1SDE A;  4RA7 A;  1K54 C;  5EVI A;  3LO7 A;  1RGZ A;  1VM1 A;  3Q7V A;  1LLB A;  3N8R A;  3G31 A;  3NIA A;  1L2S A;  4S2M A;  4OOY A;  3IQA A;  2Y2O A;  4YFM A;  5EOO A;  1IKI A;  4C75 A;  3OPH A;  5EVI B;  1XXM A;  5EVL A;  3UE0 A;  3VP3 A;  4OKP A;  2ZC7 A;  2J7V A;  2HDR A;  4ZJ1 A;  5TFQ A;  2HDU A;  2H10 A;  4C3Q A;  3HUO A;  1L0D A;  3OC2 A;  3SH9 A;  4LCL A;  3FYZ A;  1XGI A;  1OME A;  1NZO A;  3ITB A;  4E3O A;  5FI7 A;  3HVF A;  3A3F A;  1ES5 A;  1I2S A;  2PU2 A;  3PTE A;  2Y2L A;  3LY3 A;  3A3E A;  3JYI A;  5FQQ A;  1KE3 A;  3VP0 A;  4WMC D;  4Y0T A;  3O87 A;  3ZG5 A;  4WEL A;  5AQ7 A;  4E3L A;  1MWU A;  1Q2Q A;  1YLY A;  1YM1 A;  4JXG A;  4NK3 A;  3EQU A;  4KZ8 A;  5CEC A;  5GLA A; 
#chains in the Genus database with same CATH topology
 4H8R A;  4G3W A;  3MSH A;  4R70 A;  1ZC2 A;  1IYQ A;  1MXO A;  2G2U A;  3NOT C;  1L0F A;  3DW0 A;  3E4Q A;  4E3N A;  1S67 L;  3C30 A;  4L9E A;  3E98 A;  3ISG A;  1IKG A;  3FZC A;  1LT0 A;  3FG8 A;  2JC7 A;  4PM8 A;  4DDS A;  4JLF A;  3RTY A;  3PBO A;  4R6L A;  3BLM A;  2V8C A;  4IVI A;  2XA7 S;  4D2O A;  3LID A;  1FQG A;  1PFL A;  4ID4 A;  3W2Z A;  4JXS A;  4EEU A;  1YQS A;  2P04 A;  3A3D A;  1SKF A;  4WN5 A;  3L9K A;  3ZNT A;  1ES2 A;  2H0T A;  4BD0 A;  4YIN A;  4KUO A;  3WWX A;  3S7Q A;  3Q1F A;  2IA2 A;  2Q0O A;  3BFD A;  3NDE A;  1KVL A;  2DCF A;  3NOU C;  3OLO A;  1PYY A;  5FAS A;  3DBA A;  2X02 A;  2PRF A;  1G68 A;  3DWZ A;  3H82 A;  3E2L A;  5AVF A;  2WKE A;  4WZ5 A;  5L09 A;  3H9W A;  5HFO A;  1KGG A;  2EFX A;  3T4S A;  1YT4 A;  4G3V A;  1ESI A;  1XGJ A;  1XPB A;  2XDM A;  4H6J B;  3WS2 A;  5EM1 A;  3ZG9 B;  5J7E A;  4PM7 A;  4UQI S;  5EM0 A;  2VKS A;  1UWP X;  1FCN A;  5EVI D;  1PI5 A;  3CMZ A;  5KMW A;  2PR5 A;  3SS4 A;  3DTE A;  1J9M A;  4DXC A;  4R23 A;  1MZU A;  2YKF A;  1LL5 A;  1ONH A;  2WAD A;  2P08 A;  1OJG A;  4A5R A;  1LL9 A;  3CIT A;  2EWV A;  2JKR I;  4KG2 A;  4DE1 A;  5FL3 A;  4F3L B;  2PR6 A;  5EV0 A;  4PMA A;  3VOY A;  4LRX C;  4OQI A;  3LEZ A;  3R7W A;  1OTI A;  3DTM A;  2OAQ 1;  1HD8 A;  2XRN A;  5HSQ A;  4JBF A;  1GHI A;  3MXQ A;  3WS5 A;  5FI6 A;  1P97 A;  2XFT A;  3LR0 A;  3KYZ A;  5JYP A;  2BTF P;  2PU4 A;  3W4Q A;  1HVB A;  4JPM A;  1IEL A;  5I94 A;  3LI9 A;  3M6B A;  2O9C A;  4GS9 B;  3VP4 A;  3OCN A;  3BEC A;  2J80 A;  3T4T A;  3VMA A;  4ETX A;  2DMW A;  4EUZ A;  1N9N A;  3ZG0 A;  2B02 A;  1BUL A;  4FH2 A;  4CLC D;  2FFF B;  2PBD P;  4BD1 A;  1XKZ A;  5K5B A;  1VET A;  3L7H A;  1FIL A;  4ETZ A;  5TJJ A;  3NHQ A;  1DP6 A;  4E3M A;  1JWV A;  4EBL A;  1L0E A;  2OOL A;  3DAV A;  5FQM A;  1NYY A;  3CJM A;  1PZP A;  4JGQ A;  2W3H A;  5HPI A;  4WEK A;  5AJG A;  2VGL M;  2OWH A;  3LY4 A;  3V3S A;  5HDS A;  4E6X A;  3MXS A;  3MKE A;  1V9Y A;  2XR0 A;  3HUN A;  1IEM A;  4CPK A;  2X71 A;  3RJU A;  3IWI A;  4GB7 A;  4LV1 A;  5G4Z A;  5L10 A;  1S6R A;  3KYE A;  1FSW A;  2V2F F;  2O9A A;  3BM6 A;  3LR3 A;  5HAI A;  2QJ7 A;  2WAF A;  3MZD A;  4LFU A;  1T1C A;  1Z6F A;  3ZNY A;  3T4K A;  5KZH A;  4WLA A;  2VGJ A;  4IBX A;  3T1X A;  3K2N A;  1LHY A;  4X25 A;  2GX5 A;  1Q2P A;  1W8Q A;  4N9K A;  4Y15 A;  4Y17 A;  5C5K A;  3MR0 A;  4HJ3 A;  3NI9 A;  1Y4O A;  1ESU A;  1CEG A;  4ZJ2 A;  3BLS A;  3C38 A;  3BQ8 A;  1E25 A;  4HEF A;  1KOU A;  4HY8 A;  3IF6 B;  3O86 A;  4MCW A;  3FKW A;  4JGO A;  1TS0 A;  4E04 A;  2FFY A;  3IXD A;  5CHM A;  2ZQC A;  5E2E A;  5KSC A;  3SS3 A;  3LIF A;  3HJK A;  2WKP A;  3H7W B;  4Y0O A;  2R9X A;  5E2G A;  5FQ9 A;  1MKM A;  1MWS A;  3UY6 A;  1W8Y A;  5GLD A;  1DJA A;  1P9W A;  2G7U A;  3CPT A;  5FDH A;  2ZC6 B;  4L0L A;  2OLV A;  1XX2 A;  1ZHH B;  2ZBB A;  3F1O B;  3MKF A;  4CJN A;  4DN0 A;  4ZRR A;  3D4F A;  5DKK A;  4JF4 A;  3C5A A;  2OSU A;  1CI8 A;  4S2P A;  3C2W A;  4OLD A;  2ACG A;  2K7S A;  3P09 A;  1PZO A;  3F1N B;  1VEU A;  4OPQ A;  3UB9 A;  2R9W A;  4LV2 A;  4ZJ3 A;  5HW3 A;  4BEN A;  4RX2 A;  2W1T A;  1H8Z A;  3UB7 A;  4IUH A;  2VV7 A;  1P9R A;  2XK1 A;  2EX8 A;  1BZA A;  3IBR A;  3N8L A;  3T1Q B;  3MQQ A;  4KUK A;  5HL6 A;  3MZE A;  4WZ4 A;  3UE1 A;  3F1P A;  5EOE A;  1TS6 A;  4EET B;  3MFX A;  2OAP 1;  1K54 C;  3LO7 A;  1RGZ A;  1VM1 A;  2Y79 A;  3N8R A;  4ESP A;  4OOY A;  5L07 A;  5EOO A;  3QP8 A;  1XXM A;  1OPX A;  1V9Z A;  3UE0 A;  1YSQ A;  1ODV A;  4OKP A;  5I5L A;  3PR6 A;  2H10 A;  4C3Q A;  4LCL A;  2OWJ A;  2HV1 A;  1NZO A;  3ITB A;  4E3O A;  2HJE A;  1I2S A;  2Y2L A;  3A3E A;  3JYI A;  4Y3I A;  3QP2 A;  4M4X A;  4Y0T A;  3QP4 A;  3O87 A;  2PYP A;  4LRZ E;  4E3L A;  1Q2Q A;  1YM1 A;  3LIB A;  4HH2 A;  3P7N A;  2JN7 A;  3I7J A;  3A0S A;  5DFY A;  1TVF A;  3UN7 A;  2PHY A;  2V8F A;  1Z09 A;  5CTN A;  5KIZ A;  3AGF A;  1ERQ A;  2WKI A;  2WGW A;  3BWL A;  4N1H A;  1CF0 A;  4N9L A;  3TOI A;  5J3W A;  3BJN A;  4EU0 A;  3BW6 A;  2J3T C;  3A0R A;  5TBM A;  2JE5 A;  2O9B A;  3CUE A;  3CI6 A;  4K08 A;  3TSG A;  4HQA A;  4HBT A;  1VHM A;  4EWF A;  1C3B A;  1VET B;  3G2Z A;  4HJ6 A;  1K56 A;  1FR6 A;  3Q82 A;  1GA0 A;  2WGV A;  1TS8 A;  2CC1 A;  1RP5 A;  1XP4 A;  2OV5 A;  3OPL A;  4OQH A;  1KE4 A;  4OOL A;  4I3A A;  4NG2 A;  4N1X A;  2AVX A;  5HWW A;  2HP5 A;  4IJG A;  3GMW A;  3N7W A;  5HX9 A;  4EBN A;  3KYQ A;  3GEC A;  3TW8 A;  3IX8 A;  4MNR A;  1ES3 A;  1LI9 A;  2HGV A;  3SH7 A;  4IVK A;  3WRZ A;  4WZ5 C;  4WBG A;  4X55 A;  4GHI B;  1LL8 A;  4Q0I A;  3OCL A;  1LSV A;  1F98 A;  1BLC A;  1NZU A;  5F6A A;  2EXB A;  4X56 A;  1W63 Q;  5FI2 A;  2ZD8 A;  1KGF A;  4OVD A;  3E4O A;  4B88 A;  4DMZ A;  2P9V B;  4NXG A;  2VV6 A;  2Y59 A;  4M3K A;  3UE6 A;  1MWT A;  3F1O A;  4PM5 A;  4EEP A;  2I72 A;  1KDS A;  4OOM A;  4LEN A;  4HP9 A;  1HLU P;  2V9A A;  4X1L A;  2QPN A;  2HF6 A;  4R0Q A;  1TS7 A;  4BWI A;  1HZO A;  5F68 A;  4BLM A;  3IH8 A;  1YLZ A;  1BLH A;  1BUE A;  2VZW A;  4P0M A;  2WKQ A;  2Y2Q A;  1FCO A;  2QMI A;  5HAR A;  4B4Z A;  2UV0 E;  2HDS A;  4F94 A;  2XLN A;  4WL9 A;  1MWR A;  4CLC B;  4EES A;  4GNU A;  4GS9 A;  4OPY A;  1K54 A;  1LI0 A;  4FUW A;  3O3V A;  4HHD A;  4B4X A;  1PRQ A;  4QPR A;  5FAP A;  1KVM A;  1NYM A;  4ZBE A;  1FIK A;  2WZX A;  3VSL A;  1ZG4 A;  1IYO A;  3F1P B;  4GDN A;  2ZQ7 A;  2JKT M;  2W1R A;  5HWT A;  3T12 B;  5DTS A;  4LRY C;  3M2K A;  1YAX A;  2Z2L B;  1GHM A;  4WYY A;  2XD1 A;  1TDL A;  3EWK A;  3HRE A;  1XJ3 A;  4E3J A;  4PPR A;  3F1N A;  4WEJ A;  2P7J A;  2EA9 A;  3B33 A;  3EGD C;  1EW0 A;  3CAX A;  2JKR M;  3C7U A;  1DP8 A;  2IWD A;  3KX0 X;  3U4L P;  3V39 A;  3CHW P;  1MY8 A;  4GDB A;  1K6R A;  4NXE A;  2NUT C;  3UME A;  4EQ1 A;  3LGO A;  4KZ7 A;  2PD8 A;  3KSG A;  2EX9 A;  4EW7 A;  2XGN A;  3MBZ A;  4S2O A;  3NDG A;  1MPL A;  4GN2 A;  4R3B A;  4DE0 A;  3S22 A;  4FCF A;  3U2A A;  5FAT A;  5HWV A;  4KQQ A;  5FA7 A;  3KSH A;  2ZM2 A;  1KGE A;  2WYX A;  4QJG A;  4FH4 A;  4X68 A;  1IOU A;  4E3K A;  4YNR A;  5DJT A;  4I3I A;  3LEQ A;  4Z1W A;  1QME A;  3BQA A;  2I9V A;  4DJ2 A;  1T18 A;  2VJW A;  4OPZ A;  2ZMF A;  1G5U A;  3V50 A;  4I3J A;  3SOI A;  4O01 A;  4RX3 A;  5FSR A;  3EOI A;  2XH9 A;  3D72 A;  3OBF A;  3HUM A;  3VSK A;  3G34 A;  2PT7 A;  2EX2 A;  4OP5 A;  1K55 A;  4ZAM A;  3GR2 A;  1K4F A;  3VOZ A;  3C4O A;  3QP5 A;  2ZC5 B;  1T1B A;  2HDQ A;  1SZV A;  3SH8 A;  1GSV A;  5DVA A;  1ZKJ A;  2Y2I A;  5FQI A;  2EXA A;  2ZC3 B;  4JXW A;  2FZ0 A;  3PBN A;  4L9G A;  2WGW B;  1TEM A;  4HES A;  4ZDX A;  1BLP A;  1CI9 A;  1N9O A;  2L0W A;  4I5S A;  5EFW A;  1Y28 A;  2ZQD A;  3NOP C;  3ZCZ A;  1ES4 A;  5HD3 A;  2V1B A;  3M2J A;  2Y2K A;  5CXW A;  3A0V A;  3S7N A;  3WRT A;  4LV0 A;  5CGX A;  1WYC A;  3PBS A;  1XJ2 A;  3WS1 A;  3ULF A;  1JTD A;  2ZOH A;  4YWZ A;  4I39 A;  1TDG A;  1G6O A;  3KSI A;  2G2W A;  3TE8 A;  4PAU A;  2E8I A;  3UB5 P;  4BBV A;  4LGW A;  2C5W B;  4GLQ A;  3JPU A;  3MXR A;  5CED A;  2XEP A;  3HLD A;  4HIA A;  4EBP A;  4K0X A;  4KG5 A;  4DF6 A;  2ZQ9 A;  2XF3 A;  3ITA A;  3RH8 B;  2QYB A;  2WGI A;  1OTB A;  3PAG A;  2W1T B;  3GRJ A;  3IX3 A;  3JVV A;  2V0U A;  2LB5 A;  4UA7 A;  3NJA A;  3MZF A;  1U60 A;  4Q8I A;  4P6Z M;  2K31 A;  4AFI A;  2J8Y A;  5EE8 A;  2O99 A;  3N8S A;  1SDE A;  3PYP A;  4I38 A;  3R4K A;  3G31 A;  2K2N A;  2Y2O A;  3LFV A;  1IKI A;  3OPH A;  3VV4 A;  2ZC7 A;  5TFQ A;  1S1Y A;  2HDU A;  5DFX A;  3FYZ A;  1UWN X;  5FI7 A;  5F5Y A;  1ES5 A;  2W3G A;  2PU2 A;  2QWS A;  5FQQ A;  1STZ A;  3VP0 A;  3CLO A;  3CUE C;  4NK3 A;  1MC0 A;  5CEC A;  1XJ6 A;  5GLA A;  3V3R A;  4MBF A;  5IHV A;  3T4O A;  1EWZ A;  1XA7 A;  3UPO A;  2HJ9 C;  2XSS A;  5A91 A;  3B47 A;  2C6W B;  1NY0 A;  3SS5 A;  1HTZ A;  1OT9 A;  4HJ4 A;  4ME4 A;  3UPP A;  3GV9 A;  1NLZ A;  1JTG A;  2M7V A;  1H3Q A;  2NUP C;  2IWC A;  3D3O A;  1EI5 A;  3V67 A;  5AQB A;  4F3L A;  3DWK A;  3PXP A;  3HL9 A;  4FD8 A;  5G18 A;  2ZMV A;  4FSF A;  3M6H A;  1PI4 A;  1PIO A;  1K6S A;  2QHK A;  2WAE A;  3QNB A;  3W4O A;  3UO9 A;  5A92 A;  3ZQ5 A;  3HLB A;  2RCX A;  3NBL A;  4NET A;  4R4S A;  3IF5 A;  1N9B A;  5AVE A;  3IXH A;  1DRM A;  2E8J A;  2A49 A;  5F83 A;  1DP9 A;  4MEZ A;  4MN5 A;  3O88 A;  3PBT A;  5DJU A;  1YMX A;  4PM9 A;  3BFG A;  4QHC A;  2ZM8 A;  4O7D A;  1DJB A;  2J9P A;  3E4P A;  2M7U A;  2W0N A;  3MQ0 A;  3HLF A;  2MJ6 A;  2W27 A;  3LI8 A;  2JKG A;  1PW8 A;  5CGS A;  4XT2 A;  2W3E A;  1ALQ A;  1K57 A;  3SZT A;  2Y55 A;  2VLG A;  3LIC A;  4RYE A;  3PBR A;  2B5R A;  3CPT B;  3UDI A;  3ZDJ A;  1NRJ A;  1SDN A;  2Y2P A;  3W8K A;  4DE2 A;  2HPB A;  3LCE A;  2PD7 A;  2B95 A;  4KQR A;  1YLT A;  3G35 A;  3H82 B;  3QHY A;  4P6Z S;  3G30 A;  3EEA A;  1RCJ A;  3IHA A;  5A93 A;  5GL9 A;  2ZMA A;  5IT5 A;  1K55 C;  4U0T A;  5FQK A;  4Y5F A;  3ZG7 B;  4R3A A;  2BAS A;  2PYR A;  4NXF A;  2A24 B;  1E3U A;  3ZVW A;  1UGU A;  4DRT A;  1FOF A;  5DTT A;  4QY5 A;  1SCW A;  4DDY A;  2Q9M A;  2J9O A;  3LR4 A;  4G3K A;  1OT6 A;  4YOF A;  3VFH A;  5FQJ A;  4MN7 A;  1JVJ A;  2P74 A;  2ZQA A;  3PHY A;  3T4J A;  5HD5 A;  4L9F A;  2WKH A;  2VV8 A;  2CMN A;  4X53 A;  4Y2F A;  3IS2 B;  4N92 A;  3IBJ A;  3UMD A;  4WMC A;  4MBK A;  3ZGA B;  5TR7 A;  2GDN A;  4OON A;  2H28 A;  3PAE A;  3TRC A;  2A2L A;  2ZOI A;  4H6J A;  3VP1 A;  4BBU A;  2JKF A;  2Y8H A;  4GD8 A;  1XJ4 A;  4HH3 A;  2XD5 A;  2EFU A;  1OTE A;  1DJC A;  1K4E A;  4KZ6 A;  1H8Y A;  3RXX A;  2JHE A;  2GNX A;  1JWZ A;  4P85 A;  2ZL1 B;  1FSY A;  3B42 A;  1S4R A;  2JBF A;  4FTX A;  3CZD A;  5M1A A;  4MN6 A;  1YSP A;  5FAQ A;  2EX6 A;  5GHY A;  2JCH A;  4MBH A;  3GVB A;  4UQI M;  5E43 A;  5U47 A;  4QWO A;  1IFQ A;  3IF6 C;  3ZG8 B;  1NWZ A;  1M6K A;  2QKP A;  3S4X A;  4Q0H A;  4O8G A;  4JGR A;  1W5D A;  4Q0J A;  5LBR A;  3EEH A;  3MF0 A;  3P98 A;  3BY9 A;  1BSG A;  2KLI A;  2R78 A;  3VE4 A;  1I2W A;  1W79 A;  5AQ9 A;  1CK3 A;  1NLY A;  4EQI A;  4OQG A;  1G6A A;  4DJ3 A;  2Y2N A;  1GSX A;  2LB9 A;  1CJF A;  3LUQ A;  3K3D A;  5HL1 A;  3IX4 A;  2L4R A;  4QB8 A;  4X6T A;  3DTK A;  2OLU A;  4JGP A;  5HDC A;  2ZLY A;  4K0W A;  4LCM A;  3TJZ C;  2ZQ8 A;  1NRF A;  2VGK A;  3A3J A;  2Y2G A;  1TD5 A;  5M19 A;  1X0O A;  4JF6 A;  2BLS A;  3ZVT A;  1K57 C;  3BFF A;  3IWQ A;  4OP8 A;  4S2I A;  5AQA A;  1W63 M;  4U3T A;  3V5M A;  3IWO A;  4Y13 A;  1RGY A;  4X1M A;  3MJQ A;  5A90 A;  1D1J A;  4GZB A;  5DF8 A;  1K25 A;  4OPR A;  1YLJ A;  3MQO A;  4KZA A;  2XA7 M;  1NJ4 A;  5DF7 A;  2QZ6 A;  3C7V A;  1E3U D;  4OLG A;  5EUA A;  2B18 A;  3HLC A;  4KQO A;  5D3O A;  1OTA A;  3BEB A;  3IXB A;  2M1C A;  5DF9 A;  2DNS A;  1AWI A;  4PKY A;  3T4L A;  3IH9 A;  1ZG6 A;  3NC8 A;  4CLC C;  1IYP A;  1GCE A;  5CTM A;  2Y2J A;  2WUQ A;  5TGF A;  4S2N A;  4X69 A;  4BMW A;  4Y0U A;  3G6O A;  3G4P A;  5KSH A;  4KZ9 A;  4RVA A;  2XRO A;  3B3X A;  3AGD A;  1I5Q A;  4IED A;  5F1F A;  5CHJ A;  2WZZ A;  1YKD A;  4WUJ A;  4KQD A;  5HDD A;  4IHQ A;  4DE3 A;  1VQQ A;  1DY6 A;  1K38 A;  3C8C A;  3N4I A;  1OTD A;  1SKO B;  4BL3 A;  5EVI A;  1LLB A;  2VX8 A;  3NIA A;  1L2S A;  5J4E A;  1OJ5 A;  4RQ9 A;  2HDR A;  4ZJ1 A;  3D9Y A;  4GJ4 A;  3HUO A;  3SH9 A;  2GJ3 A;  4EUV A;  3A3F A;  3H7W A;  1JNU A;  1VEU B;  3LY3 A;  2A24 A;  2KX6 A;  4WEL A;  1MWU A;  3EQU A;  3TG9 A;  4KZ8 A;  2HZ5 A;  1S0W A;  1H5X A;  3ZFZ A;  2H5S A;  3OPR A;  3IT9 A;  4HOI A;  4R1G A;  4E3I A;  3GTC A;  1PWC A;  3IXG A;  1S66 L;  3MS6 A;  5EEC A;  2ZM0 A;  1YLW A;  3G32 A;  1LSW A;  5M18 A;  3GSG A;  5CX7 A;  3FPW A;  1SHV A;  1YLP A;  1FR1 A;  4ARZ A;  3WS0 A;  1JWP A;  1BT5 A;  1L3L A;  5GLC A;  4GHI A;  2P9V A;  1XFN A;  4KZ3 A;  3OZH A;  3BFC A;  3OOV A;  1NXY A;  4C6Y A;  3P01 A;  1BYW A;  3UB8 A;  2D01 A;  5A8B A;  1YPR A;  3T50 A;  2XFS A;  4JKT A;  3ZYT A;  1P0Z A;  4BL2 A;  4P6B A;  3FWL A;  4PHT A;  3O5Y A;  1BLS A;  4QY6 A;  2V1Z A;  3BYD A;  4DKI A;  3T4Q A;  3A3I A;  4GD6 A;  4MDZ A;  2Z2M B;  5CRF A;  3Q07 A;  2VA0 A;  4GOG A;  4EXO A;  5TBM B;  1D06 A;  5HZH A;  2J3T D;  4MMN A;  3S1Y A;  3FV7 A;  3K3C A;  5L2F A;  3G2Y A;  4Z9Q A;  4E6W A;  2H0Y A;  3N6I A;  4OQ0 A;  5F1G A;  2Z6D A;  5F82 A;  3RFB A;  1Y54 A;  1XA1 A;  4BQM A;  1PNE A;  5GHZ A;  3CWF A;  3VE3 A;  3AGE A;  3EGX C;  4R4R A;  4O0P A;  5E2H A;  3UDX A;  5CHU A;  5DKL A;  3GDI A;  1PW1 A;  5J8X A;  3OPP A;  4B93 A;  1A0K A;  5HAP A;  3UDF A;  2QJ5 A;  3NCK A;  3IHB A;  4GKU A;  2W3D A;  5CGW A;  2WK0 A;  4HP4 A;  4GCZ A;  4DXB A;  3PBQ A;  1D7E A;  4PKY G;  5E2F A;  3NEC A;  4HI4 A;  2EWW A;  2A3U A;  3FPV A;  3W4P A;  5EVI C;  1ACF A;  2KDK A;  5EVE A;  1F2K A;  1N4O A;  4JF5 A;  1W7F A;  4BBT A;  3MFD A;  3Q7V B;  1H8M A;  3HCY A;  4XXR A;  3VFF A;  4KZ4 A;  1VB6 A;  5BOH A;  3HLG A;  3HBR A;  1GHP A;  4OH0 A;  4R38 A;  4II7 A;  4S2K A;  3IS2 A;  1PWG A;  2HP6 A;  4PM6 A;  2WKR A;  1MKI A;  3WS4 A;  4HBU A;  5IS1 A;  2BG1 A;  2V0W A;  4S2J A;  1CQA A;  2YKH A;  2Y4A A;  3QP1 A;  4S2N C;  3LIA A;  3VP2 A;  3LR5 A;  3NY4 A;  3Q81 A;  3BFE A;  2PBY A;  4CLC A;  3MMH A;  4UA6 A;  2ZL1 A;  2VEA A;  4NEE D;  4Y7P A;  4KZ5 A;  3E0Y A;  3LIE A;  1MBL A;  4XUZ A;  2Y2M A;  1F5M A;  3CG5 A;  3FKV A;  4KG6 A;  2V1A A;  1K56 D;  3ZHH A;  4EV4 A;  4P87 A;  1KDW A;  4KZB A;  3GQZ A;  4WM9 A;  1S4S A;  3T1S A;  5GHX A;  4WF0 A;  3DTI A;  4CQH A;  4UAA A;  4QD4 A;  5IU1 A;  5L8M A;  2Q9N A;  3VOL A;  4ZTK A;  4UHU A;  4BJP A;  2HP9 A;  4K91 A;  5HAQ A;  3R7W B;  4IUK A;  1WYB A;  1WE4 A;  3HLE A;  1YMS A;  4CLC E;  2PAV P;  2Y91 A;  5FDS A;  5FEG A;  1LSX A;  4IBR A;  3UNW A;  3C4P A;  1ZTU A;  4ARZ B;  3SW1 A;  1O7E A;  4S2L A;  5G4Y A;  2XQZ A;  2VGL S;  3QP6 A;  4JXV A;  2O0Y A;  1ONG A;  4XT2 B;  1J3W A;  2V20 A;  5MC7 A;  3E2K A;  2RL3 A;  3EQV A;  2Y2H A;  1T1A A;  5GLB A;  3HLW A;  3JVU A;  2ZJ9 A;  5DTK A;  1M40 A;  3LYX A;  3UB6 A;  1PWD A;  2L1M A;  4HNB A;  1AXB A;  3UE3 A;  1QMF A;  5CER A;  3BRM A;  4D60 A;  3KO6 A;  3ICY A;  4FOF A;  2PDR A;  1O07 A;  4KEN B;  2INW A;  2J3W A;  3HJI A;  1E4D A;  1GSW A;  4MLL A;  4XUX A;  2D02 A;  4LLO B;  3IF6 A;  2UWX A;  3Q7Z A;  3QNC A;  4UA9 A;  5FAO A;  1ERM A;  2ZC4 B;  2VK3 A;  5CEB A;  2DRW A;  4NXB A;  1F9I A;  3BY8 A;  5EPH A;  1SKO A;  5F69 A;  5JYO A;  1CEF A;  4NKP A;  1ERO A;  3T1R A;  1S1Z A;  3RXW A;  5FEF A;  3KSF A;  1N9L A;  3UPN A;  4U0X A;  1TF1 A;  3S7P A;  2GZA A;  4EER A;  2Z6C A;  1GA9 A;  1IYS A;  2X01 A;  1BTL A;  4QU3 A;  2IWB A;  1KE0 A;  4LV3 A;  4R3J A;  1FCM A;  1L0G A;  4RA7 A;  3S7O A;  1WA9 A;  3Q7V A;  3FC7 A;  4B9O A;  4S2M A;  3IQA A;  3NUL A;  2KOI A;  4LPZ A;  4YFM A;  4C75 A;  1H0M A;  5EVI B;  5EVL A;  4UEY A;  3VP3 A;  2J7V A;  4GW9 A;  1L0D A;  3OC2 A;  2FH5 A;  1XGI A;  1OME A;  1T19 A;  1XFQ A;  3HVF A;  2W3F A;  3PTE A;  5HPF A;  1KE3 A;  4WMC D;  3ZG5 A;  1G28 A;  5AQ7 A;  1YLY A;  4JXG A;  1K0K A;  2JKT I; 
#chains in the Genus database with same CATH homology
 1S0W A;  1H5X A;  3V3R A;  3I7J A;  4H8R A;  4MBF A;  3ZFZ A;  5IHV A;  1ZC2 A;  1IYQ A;  1MXO A;  2H5S A;  2G2U A;  1TVF A;  1EWZ A;  1XA7 A;  3IT9 A;  1L0F A;  3OPR A;  4R1G A;  3UN7 A;  3DW0 A;  4E3I A;  3UPO A;  4E3N A;  5CTN A;  3GTC A;  5A91 A;  3AGF A;  1ERQ A;  2WKI A;  2WGW A;  1PWC A;  3IXG A;  4N1H A;  5EEC A;  4N9L A;  2ZM0 A;  3ISG A;  1YLW A;  3G32 A;  2C6W B;  1NY0 A;  3SS5 A;  1HTZ A;  3TOI A;  5M18 A;  3GSG A;  1IKG A;  3UPP A;  3GV9 A;  1SHV A;  3FZC A;  1JTG A;  2JC7 A;  4PM8 A;  4DDS A;  4JLF A;  1YLP A;  1FR1 A;  3PBO A;  3WS0 A;  1JWP A;  1BT5 A;  5GLC A;  2IWC A;  3BLM A;  2JE5 A;  4IVI A;  1EI5 A;  2P9V A;  4D2O A;  4KZ3 A;  3OZH A;  3TSG A;  3BFC A;  5AQB A;  4HBT A;  1FQG A;  4ID4 A;  4JXS A;  3DWK A;  1YQS A;  3A3D A;  1SKF A;  3HL9 A;  4EWF A;  4FD8 A;  3ZNT A;  1NXY A;  4C6Y A;  1ES2 A;  5G18 A;  4FSF A;  3M6H A;  1C3B A;  2H0T A;  4BD0 A;  1PI4 A;  3G2Z A;  4YIN A;  1PIO A;  1K6S A;  1K56 A;  2WAE A;  3QNB A;  3W4O A;  1FR6 A;  3Q82 A;  3UO9 A;  3WWX A;  1GA0 A;  2WGV A;  3Q1F A;  5A92 A;  3HLB A;  2RCX A;  2CC1 A;  3BFD A;  1RP5 A;  1XP4 A;  2XFS A;  2OV5 A;  3NBL A;  3NDE A;  3OPL A;  4NET A;  4OQH A;  1KE4 A;  1KVL A;  4OOL A;  2DCF A;  4JKT A;  1PYY A;  4N1X A;  4BL2 A;  4R4S A;  5FAS A;  3IF5 A;  1N9B A;  4P6B A;  2HP5 A;  3FWL A;  3IXH A;  3GMW A;  3N7W A;  5HX9 A;  4EBN A;  2X02 A;  2A49 A;  1BLS A;  5F83 A;  4QY6 A;  2V1Z A;  1G68 A;  3DWZ A;  4MEZ A;  4MNR A;  3BYD A;  3O88 A;  1ES3 A;  3E2L A;  3PBT A;  2WKE A;  1YMX A;  4WZ5 A;  4PM9 A;  4DKI A;  5HFO A;  1KGG A;  3BFG A;  3A3I A;  4GD6 A;  1LI9 A;  4QHC A;  2ZM8 A;  4O7D A;  1DJB A;  2Z2M B;  5CRF A;  2J9P A;  3Q07 A;  2EFX A;  4GOG A;  3HLF A;  3SH7 A;  4IVK A;  3WRZ A;  1YT4 A;  1ESI A;  1XGJ A;  1XPB A;  2XDM A;  3S1Y A;  1PW8 A;  3WS2 A;  5CGS A;  3FV7 A;  4WZ5 C;  5L2F A;  3ZG9 B;  1ALQ A;  3G2Y A;  1K57 A;  4PM7 A;  4WBG A;  4X55 A;  4Z9Q A;  1FCN A;  2Y55 A;  4E6W A;  2H0Y A;  4RYE A;  3N6I A;  4OQ0 A;  3PBR A;  5F1G A;  3OCL A;  5EVI D;  2B5R A;  5F82 A;  1PI5 A;  3UDI A;  1BLC A;  1NZU A;  1Y54 A;  3ZDJ A;  3CMZ A;  5KMW A;  1XA1 A;  4BQM A;  5GHZ A;  1SDN A;  2EXB A;  4X56 A;  2Y2P A;  3W8K A;  4DE2 A;  2HPB A;  5FI2 A;  2ZD8 A;  1KGF A;  3SS4 A;  1J9M A;  3AGE A;  3LCE A;  4DXC A;  4R4R A;  4R23 A;  4OVD A;  1LL5 A;  1ONH A;  2WAD A;  4B88 A;  5E2H A;  2P9V B;  4A5R A;  4KQR A;  3UDX A;  5CHU A;  1LL9 A;  4DE1 A;  4KG2 A;  2Y59 A;  4M3K A;  1YLT A;  3G35 A;  4PMA A;  1MWT A;  3VOY A;  3QHY A;  3G30 A;  4PM5 A;  1RCJ A;  3IHA A;  5A93 A;  2I72 A;  1PW1 A;  4OQI A;  1KDS A;  3LEZ A;  4LEN A;  4OOM A;  5GL9 A;  5J8X A;  3OPP A;  2ZMA A;  3DTM A;  1K55 C;  1HD8 A;  2QPN A;  4U0T A;  5FQK A;  5HAP A;  4JBF A;  4R0Q A;  3NCK A;  4GKU A;  3IHB A;  3UDF A;  1HZO A;  1GHI A;  3ZG7 B;  5CGW A;  4BLM A;  3WS5 A;  3IH8 A;  5FI6 A;  1YLZ A;  1BLH A;  2WK0 A;  1BUE A;  2XFT A;  1E3U A;  4P0M A;  3ZVW A;  2Y2Q A;  4DXB A;  3PBQ A;  4DRT A;  1FCO A;  1FOF A;  2QMI A;  5E2F A;  5HAR A;  4B4Z A;  5JYP A;  2HDS A;  2PU4 A;  5DTT A;  4F94 A;  3W4Q A;  2XLN A;  4QY5 A;  1MWR A;  2A3U A;  1HVB A;  1SCW A;  4DDY A;  4GNU A;  4OPY A;  3W4P A;  1K54 A;  2Q9M A;  4JPM A;  1LI0 A;  2J9O A;  5EVI C;  1N4O A;  1IEL A;  4JF5 A;  5I94 A;  3O3V A;  3VFH A;  1W7F A;  5FQJ A;  1JVJ A;  4B4X A;  2P74 A;  2ZQA A;  3M6B A;  3MFD A;  3VP4 A;  3Q7V B;  5FAP A;  1KVM A;  3OCN A;  3BEC A;  4XXR A;  3VFF A;  3VMA A;  1NYM A;  2WKH A;  4ZBE A;  4KZ4 A;  4X53 A;  2WZX A;  3VSL A;  1ZG4 A;  4N92 A;  4EUZ A;  1IYO A;  4GDN A;  2ZQ7 A;  4WMC A;  3ZG0 A;  4MBK A;  3ZGA B;  5BOH A;  3HLG A;  1BUL A;  3HBR A;  2GDN A;  4FH2 A;  5TR7 A;  5DTS A;  1GHP A;  4OON A;  2FFF B;  3M2K A;  4OH0 A;  4S2K A;  3PAE A;  2Z2L B;  1GHM A;  4WYY A;  1PWG A;  2HP6 A;  2XD1 A;  4PM6 A;  1TDL A;  4BD1 A;  3HRE A;  3VP1 A;  1XKZ A;  4E3J A;  1MKI A;  4PPR A;  4GD8 A;  3WS4 A;  4HBU A;  2XD5 A;  2EFU A;  2BG1 A;  4S2J A;  4WEJ A;  2Y4A A;  1DJC A;  1K4E A;  4KZ6 A;  1H8Y A;  4S2N C;  3RXX A;  3VP2 A;  1JWZ A;  3NY4 A;  3Q81 A;  4P85 A;  3BFE A;  2PBY A;  1FSY A;  2JBF A;  4E3M A;  3CZD A;  5M1A A;  1JWV A;  5FAQ A;  2EX6 A;  5GHY A;  3C7U A;  2IWD A;  4EBL A;  2JCH A;  1L0E A;  4MBH A;  3GVB A;  5E43 A;  5U47 A;  4UA6 A;  3V39 A;  3IF6 C;  1NYY A;  5FQM A;  3CJM A;  1PZP A;  1MY8 A;  3ZG8 B;  4Y7P A;  4GDB A;  1K6R A;  4KZ5 A;  1M6K A;  3S4X A;  4WEK A;  1MBL A;  4KZ7 A;  4XUZ A;  2Y2M A;  1W5D A;  3LY4 A;  2EX9 A;  3V3S A;  4E6X A;  2XGN A;  3CG5 A;  3MBZ A;  3P98 A;  3MXS A;  3MKE A;  4S2O A;  3FKV A;  4KG6 A;  3NDG A;  1BSG A;  2XR0 A;  1K56 D;  3HUN A;  1IEM A;  1MPL A;  4GN2 A;  4R3B A;  3ZHH A;  4CPK A;  2X71 A;  4P87 A;  4EV4 A;  4DE0 A;  1KDW A;  4KZB A;  3S22 A;  3GQZ A;  4WM9 A;  4FCF A;  3RJU A;  3IWI A;  1I2W A;  5FAT A;  1W79 A;  5AQ9 A;  4GB7 A;  1CK3 A;  5GHX A;  4EQI A;  4OQG A;  1G6A A;  4LV1 A;  4KQQ A;  5FA7 A;  2ZM2 A;  1KGE A;  2WYX A;  4QJG A;  4FH4 A;  4X68 A;  4UAA A;  4E3K A;  1S6R A;  4QD4 A;  2Y2N A;  1FSW A;  2V2F F;  2Q9N A;  3BM6 A;  4ZTK A;  4UHU A;  5HAI A;  4BJP A;  2WAF A;  1QME A;  2HP9 A;  4K91 A;  5HAQ A;  5HL1 A;  3MZD A;  1Z6F A;  3ZNY A;  5KZH A;  4OPZ A;  4QB8 A;  1WYB A;  1WE4 A;  2VGJ A;  3HLE A;  4X6T A;  3V50 A;  4IBX A;  1YMS A;  2OLU A;  1LHY A;  2Y91 A;  1Q2P A;  1W8Q A;  4N9K A;  3SOI A;  4RX3 A;  5FSR A;  2XH9 A;  2ZLY A;  4K0W A;  4LCM A;  4IBR A;  3UNW A;  2ZQ8 A;  1NRF A;  2VGK A;  3NI9 A;  3C4P A;  1ESU A;  1CEG A;  2Y2G A;  3A3J A;  3HUM A;  4ZJ2 A;  3VSK A;  3BLS A;  3G34 A;  5M19 A;  1E25 A;  4JF6 A;  2EX2 A;  2BLS A;  1O7E A;  1K55 A;  4OP5 A;  4S2L A;  4ZAM A;  3ZVT A;  1K57 C;  2XQZ A;  3GR2 A;  1K4F A;  4HEF A;  3BFF A;  3C4O A;  3VOZ A;  3IWQ A;  2ZC5 B;  4OP8 A;  2HDQ A;  4S2I A;  5AQA A;  4JXV A;  4U3T A;  3SH8 A;  3IF6 B;  1ONG A;  3O86 A;  2V20 A;  5DVA A;  3FKW A;  3V5M A;  3IWO A;  1ZKJ A;  3E2K A;  2RL3 A;  3EQV A;  2Y2H A;  2FFY A;  3TG9 A;  2Y2I A;  1RGY A;  5GLB A;  3HLW A;  2EXA A;  2ZC3 B;  2ZJ9 A;  3IXD A;  5DTK A;  5FQI A;  5CHM A;  2ZQC A;  1M40 A;  4JXW A;  5E2E A;  5A90 A;  5KSC A;  4GZB A;  5DF8 A;  3SS3 A;  1K25 A;  1PWD A;  4OPR A;  1YLJ A;  3PBN A;  4KZA A;  4Y0O A;  1AXB A;  2WGW B;  1TEM A;  3UE3 A;  1QMF A;  4HES A;  4ZDX A;  2R9X A;  5E2G A;  1BLP A;  1NJ4 A;  5FQ9 A;  5CER A;  1MWS A;  5DF7 A;  3UY6 A;  1CI9 A;  2QZ6 A;  3BRM A;  3C7V A;  1W8Y A;  1E3U D;  5GLD A;  1DJA A;  2ZQD A;  4OLG A;  5EUA A;  1O07 A;  5FDH A;  2ZC6 B;  2OLV A;  4KEN B;  3HLC A;  4KQO A;  1ES4 A;  4L0L A;  3ZCZ A;  5D3O A;  1XX2 A;  3M2J A;  1E4D A;  3BEB A;  2Y2K A;  3IXB A;  5CXW A;  4MLL A;  3WRT A;  3MKF A;  4CJN A;  5DF9 A;  4LV0 A;  2DNS A;  4XUX A;  5CGX A;  1WYC A;  3PBS A;  3WS1 A;  3IF6 A;  1JTD A;  2UWX A;  3IH9 A;  3Q7Z A;  3QNC A;  4UA9 A;  5FAO A;  3D4F A;  1ZG6 A;  1ERM A;  2ZC4 B;  4JF4 A;  3C5A A;  3NC8 A;  1TDG A;  1IYP A;  2OSU A;  1GCE A;  5CEB A;  1CI8 A;  2DRW A;  5CTM A;  4S2P A;  2G2W A;  2Y2J A;  5EPH A;  2WUQ A;  2E8I A;  5TGF A;  4S2N A;  5JYO A;  4OLD A;  4X69 A;  1CEF A;  2C5W B;  4Y0U A;  3P09 A;  3MXR A;  1ERO A;  3G4P A;  1PZO A;  2XEP A;  5CED A;  5KSH A;  4KZ9 A;  3HLD A;  4OPQ A;  4RVA A;  4EBP A;  3RXW A;  2R9W A;  4K0X A;  4LV2 A;  4ZJ3 A;  5HW3 A;  4KG5 A;  4DF6 A;  2ZQ9 A;  4RX2 A;  3UPN A;  4BEN A;  2XF3 A;  3B3X A;  3AGD A;  3ITA A;  4U0X A;  1H8Z A;  1I5Q A;  4IED A;  2WGI A;  5F1F A;  2XK1 A;  3PAG A;  2EX8 A;  3GRJ A;  5CHJ A;  1BZA A;  4UA7 A;  1GA9 A;  3N8L A;  1IYS A;  2WZZ A;  2X01 A;  1BTL A;  3MZF A;  4QU3 A;  3MZE A;  4WZ4 A;  2IWB A;  4DE3 A;  1U60 A;  1VQQ A;  1KE0 A;  3UE1 A;  4Q8I A;  1DY6 A;  5EOE A;  1K38 A;  4LV3 A;  4R3J A;  1FCM A;  2J8Y A;  3N4I A;  5EE8 A;  3N8S A;  1L0G A;  4BL3 A;  1SDE A;  4RA7 A;  1K54 C;  5EVI A;  3LO7 A;  1RGZ A;  1VM1 A;  3Q7V A;  1LLB A;  3N8R A;  3G31 A;  3NIA A;  1L2S A;  4S2M A;  4OOY A;  3IQA A;  2Y2O A;  4YFM A;  5EOO A;  1IKI A;  4C75 A;  3OPH A;  5EVI B;  1XXM A;  5EVL A;  3UE0 A;  3VP3 A;  4OKP A;  2ZC7 A;  2J7V A;  2HDR A;  4ZJ1 A;  5TFQ A;  2HDU A;  2H10 A;  4C3Q A;  3HUO A;  1L0D A;  3OC2 A;  3SH9 A;  4LCL A;  3FYZ A;  1XGI A;  1OME A;  1NZO A;  3ITB A;  4E3O A;  5FI7 A;  3HVF A;  3A3F A;  1ES5 A;  1I2S A;  2PU2 A;  3PTE A;  2Y2L A;  3LY3 A;  3A3E A;  3JYI A;  5FQQ A;  1KE3 A;  3VP0 A;  4WMC D;  4Y0T A;  3O87 A;  3ZG5 A;  4WEL A;  5AQ7 A;  4E3L A;  1MWU A;  1Q2Q A;  1YLY A;  1YM1 A;  4JXG A;  4NK3 A;  3EQU A;  4KZ8 A;  5CEC A;  5GLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...