2ZQKA

Crystal structure of intimin-tir68 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
183
Chain Sequence
b'FFDELKIDNKVDIIGNNVRGELPNIWLQYGQFKLKASGGDGTYSWYSENTSIATVDASGKVTLNGKGSVVIKATSGDKQTVSYTIKAPSYMIKVDKQAYYADAMSICKNLLPSTQTVLSDIYDSWGAANKYSHYSSMNSITAWIKQTSSEQRSGVSSTYNLITQNPLPGVNVNTPNVYAVCVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intimin
publication title Structural insight into the interaction between intimin and Tir of enterohaemorrhagic E coli: evidence for a dynamic sequential clustering-aggregating-reticulating model
rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 47
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
A PF07979 Intimin_C Intimin C-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zqkA01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 2zqkA02
1J34B 1BCJ1 1BJ3B 2KV3A 3NCWA 1RTM1 1YPOA 2ORKA 3FD4A 1RJHA 1PWBA 1YPQA 1IXXA 4QKJA 4C9FA 1T8CA 1UEXA 3P5FA 1H8UA 3FF9A 2LS8A 1KX0A 1X2TA 1DY0A 3UBUB 1U0OB 1WMYA 5LGKE 4J6QA 4AQ1C 3VYKA 1KWZA 1G1SA 1OZ7B 1RDO1 1BCH1 1IODB 3P5HA 1E5UI 3CDGE 3P7HA 4PP8A 3M9ZA 3CDGF 1HYRA 1JWIB 3NCXA 3PARA 3T3AA 1F00I 2VRPB 1KZA1 1KX1A 1KWXA 3KMB1 4GJ0A 3WWKC 2PY2A 1MUQA 1AFB1 1SB2A 1WT9A 4UWWA 1KG0C 1G1TA 5M62A 1JZNA 1JA3A 3WBQA 1PW9A 1BNLA 4WREA 4DN8A 1IJKC 2RIEA 1GZ2A 4WRCA 1U0NC 1RDJ1 1BUUA 3G83A 3BX4A 5FFRA 1UKMA 1IJKB 1DY1A 1EGGA 4J6PA 1J35A 3WWKA 1YXJA 1ESLA 3GPRC 3C8JA 1RDI1 2GGXA 4GJXA 4IOPB 2C6UA 4WUXA 3CFWA 4ZRVA 4QKHA 1HQ8A 4J6KA 1F02I 4GK1A 1X2WB 2BRSA 3IKPA 4UXMA 3GPRA 2MTIA 1UOSA 1UEXB 1UMRA 1KCGA 5B1WA 1X2TB 1V7PA 4GI0A 1KWVA 1DY2A 4N34A 4N33A 1T8DA 2YHFA 1RDN1 1XPHA 1SL4A 1YPUA 1FVUA 4EZMG 1Y17B 5B1RA 1YTTA 2BPHA 3IKQA 2BPDA 1TN3A 1TDQB 2GGUA 1J34A 2ZWKA 4WRFA 4ZRWA 3G84A 2MQGA 2E3XC 2N7SA 2OX8A 3PBFA 1P1ZD 5J6GG 1KZE1 1V4LA 1SB2B 1WT9B 3WH2A 4S0UA 1KOEA 3DBZA 5B1XA 3P7FA 3P7GA 4GKOG 3UBUA 1HTNA 1K9IA 4J6JA 1U0OA 3VPPA 2OX9A 4M1GA 3C8KD 4HU8A 4LQFA 3HUPA 4C16A 1FIHA 1OZ7A 1UKMB 3BDWA 3FF7C 3WHDA 2XR6A 1P4LD 1J35B 4LU5A 4N36A 3WWKB 3RS1A 1O7BT 1AFA1 5F2QA 1IODA 1R14A 1FIFA 4WUWA 2KMB1 1MPUA 1LITA 3C22A 1YXKA 2OS9A 1U0NB 4J6LA 1BV4A 1KZB1 4M17A 3P5GA 1QO3C 1UMRC 3ZHGD 4YLIA 3ALTA 2IT6A 3GPRB 1UOSB 1WK1A 4KMB1 3IKNA 1V7PB 1IXXB 1KMB1 4WCOA 3PAKA 1FVUB 4KZWA 1FM5A 1XARA 2CL8A 3WBPA 1MSBA 2MOGA 1E8IA 1G1RA 2PF5A 4N32A 4IOPA 1UV0A 2IT5A 4AK8A 3ALUA 2RIBA 2XR5A 2I83A 3WSRA 3CADA 3CCKA 4MTHA 2GO0A 3G8LA 1X2WA 4G9AA 4KI1E 1C3AA 4E52A 1BJ3A 1V4LB 4N37A 4KZVA 3P5IA 4CSYA 1CWVA 4ZETA 1BYFA 4ZESA 2AFPA 1RDK1 2ZIBA 4M18A 2H2TB 5KTHA 2VUVA 1KZC1 2N40A 2E3XB 1RDM1 1EGIA 4N35A 4PDCA 3BDWB 3GPRD 1Y17A 3P5EA 3ZHGA 2M94A 1KWTA 1AFD1 2RIAA 3IKRA 1HUPA 5FFSA 2H2RA 3BX4B 4QKGA 2MH4A 4J6NA 4N38A 4AQ1A 4QKIA 1KWWA 5K8YA 2RIDA 2L04A 4WR9A 3WH3A 1KWYA 2RICA 2ORJA 1JWIA 1SL6A 1E87A 2VRPA 3KQGA 3G8KA 5KTIA 3G81A 1TLGA 1KZD1 3FF8C 3L9JC 3VLGA 2BPEA 1RDL1 1K9JA 1WMZA 1O7CT 3WBRA 3PAQA 1B08A 1KWUA 2VUZA 3P5DA 2ZQKA 1B6EA 3K7BA 4G96A 1DV8A 1SL5A 4CAJA 4YMDA 1G1QA 4WQQA 3VYJA 1QDDA 4J6MA 2MSBA 3ALSA 5FFTA 1R13A 1C3AB
chains in the Genus database with same CATH superfamily
1PZ5B 4LL1A 2Y22A 1EZSA 2L7UA 4XN9A 4UZGA 4FQLL 3QRLA 5GSVB 1L9MA 4JJHA 3L3KB 2J6EA 3MV8D 1A8JH 1H5BA 4NJAH 3MFFB 4UNUA 4BCXA 1AKJA 3MRRA 1CFTB 3DJZA 4YFDB 4Z7WA 4F9PA 5L2KD 3WNLA 2QQKL 4HALA 1UWFA 2W9EL 2GAZB 2WP3T 3OJMB 4IMLA 2OI9C 4Y16A 3GZOA 5EIQA 2DQDH 1CI3M 1UEXA 3DTXB 1FYTE 3CFMA 1X2TA 3IS0X 1PLCA 4MCYA 4ONFH 4GW5A 3U0PB 3BUYB 4DAGL 1KLGA 1TF4A 2O6DA 1WMYA 4KUCD 1SVBA 3SDYH 3MYZA 1DN0A 4OFVA 1QFUH 3W82A 3TBBA 4N85A 2YD5A 1BX2A 4IBSA 3MAWA 1TEYA 3CVBA 3X1NA 1I75A 4ZPVB 3JV0A 2ZWYA 1G1SA 4A6YB 4KTEL 4ODTL 3PREA 1UWEH 2BVEA 4G82A 2VDRB 5AYTA 1RSFA 4YN3A 1EVUA 2EADA 3ETSA 5SWSE 1NCNA 3HKZA 1RIVL 5HI3C 1T20B 3O2DL 4A7UA 4PTTA 5DHDA 2R29A 1OAKH 2ZSWB 3AM8A 2XZZA 4JFWA 3DJ9A 2FSDA 3BP5B 3O9WC 3U2SA 4PWHA 2IMNA 4P4KA 3U6RB 2O5XL 4JMNA 5AW3B 4FFZL 5DK3A 5HXMA 3QDJD 2VE6A 3T3AA 3WD5H 1AD9A 2QDWA 3I50L 2OZ4A 1OGTB 4NUGH 1FIGH 3I9IA 3U9UA 1KJ3L 1EA9C 2DQGH 2EXSA 4HQQH 1MH5A 5EIVA 5D2LA 1A9EA 3F7QA 3IDXL 5D7EA 5F3FA 3TH2T 1MUQA 5C0CE 3ZBMA 3PV6B 3OZKA 1T0MA 3LDBB 4Q89A 3WBQA 2RQEA 3HOGA 4S0TD 3DPDA 5I0XA 2FQFA 2IFGA 4MRCA 1ADQH 2YC1A 5TF0A 4N6RB 4ODXB 3S35X 5ID1B 5JPMB 3IFOA 3I02A 1I8IB 1BFVH 1CDIA 3IDMA 3BQUD 4A7GF 3ZUCA 1RXLA 1G9MC 3AWFA 1HXMB 4Z7WE 3MUY1 3OLDA 1NBZA 4DQOL 2HUHA 5L6YH 4KXBA 5C09D 4PGBA 3IDJA 3UTTD 3GXIA 3C5XA 4HJUA 4P5MA 1YXJA 4FQPA 4FG6C 4UILH 5ALCH 1B3JA 1F58L 1FVEB 4WWKB 1OCCB 3T6WA 1IRAY 4L3EB 3JQOB 1NINA 3ABMB 4KZ0A 3C5SA 2OMXB 2Z31B 1KCKA 4EI5D 2YA1A 4HS8L 5BUAA 3MOAL 2W9LA 2YMXH 3FFCA 3RILA 4PRDB 1XD0A 5E1GA 2EXWC 1ZHNB 3C08H 1FNGB 3EIFA 3L4TA 4ZW7A 2OMVB 1HQ8A 1ZGLA 4DWHA 1YDPA 3Q0HA 5CN2A 2YA0A 1OM9A 1QTSA 4P5TD 3EKCA 2JQZA 3ELQA 3HPLA 4XP1L 1D5BA 1U3YA 2FYVA 4LQ1A 4X0KA 5HY9B 5DRXA 5CJQL 1OCRB 1FFNA 2XV6B 4AENA 2QKSA 4J2XA 4ZQTA 5EFIB 5KANG 5CSBA 2YQ3A 4IKNA 4Z95H 1OSPL 4DEPC 1I9IH 1WZ1H 4AUUA 4Z3FA 4KY2A 4Y5YA 4ZUSA 4ISVB 5DS2A 2OMZA 2IPUG 3PGCB 1XH0A 4J3BA 4WFGD 1RPKA 2VH5H 2DL9A 1MREL 3MJ9L 5KYXA 2HG5A 1RZGB 1CICC 1P4BH 3HS0A 1YEIH 3J8F7 1HCVA 1JHLL 3CJJA 4LGRB 1X3DA 2UX6A 3QWRD 3FN0H 5D2LE 4PY8I 1QSEB 3VJ6B 4APQC 5IM7A 2PF6A 1C5CH 4KI5E 5GS2D 4EZMG 2P5WB 2CJ3A 1F4YL 1KYDA 3A22A 3GRBA 1LJMA 1LXMA 2ZYSA 2BFVH 2A83B 5GGSY 1R3JB 2AP2A 4OY9A 3B8YA 2IXQB 3PF2A 1TN3A 5D4QA 5C3LD 1CD1B 1W8OA 3NSDA 2AW2A 2VN5A 1JMXA 3P4OA 4XVTH 2X0UA 3NIDF 5L7XH 5HJBA 2AQ3A 4MA8H 4L3CA 1RZPA 4Z7IA 1QWNA 1UT9A 3H3BC 4KKPA 3KYOB 3L6FA 4MXWL 2XPYA 3HC0A 4XCCL 5C3IA 2I7OA 2QGCA 5JIIA 3RUGB 4YHZH 2PABA 4F7CA 3MUGA 1AGBB 3GK8H 1BVLB 1KCSH 3PXJA 4B3EA 2YOCA 3GI9L 4A2EA 1SB2B 1JZ3A 1JPGA 1ES0A 2C7FA 2VQUA 5CLYA 3P7FA 3FFCE 1G9NC 3MYJA 4RESB 4GIPD 3UCRA 5L9DH 1U3JA 4K8RH 3RKDD 3QUHA 4M1GA 5GGSA 1JXKA 3JWNC 4HS6A 4DKFH 1W15A 1ZPLA 3REWA 2AJXL 5TH2B 5FO8A 4IEFA 4HAGA 1BF5A 1BQLH 3SKUD 2GJZB 3WFDL 4R7XA 3HE6D 2AV1B 4JDZB 1M9WA 4Q9CA 1T7XA 2WINB 1DVFB 5DRZA 9CGTA 1O7BT 5FUOH 1WBZB 1KBWA 3V0WH 3WLWC 1BQ5A 5L4IA 1UVQA 5C0GB 3NJMA 3QI9D 2N56A 1XEUA 3TZVB 1I9EA 3TF4A 2AITA 1K8IA 1UEYA 3CDFA 4ES8A 4YGAB 2Z7ZA 5F88A 4PJDB 4X6DB 2YPLD 4BELD 3CLFH 2E47A 3QXUA 2M83A 3M8OH 1ZJAA 5H2BB 4WGKA 3VXUD 4D3CH 1I7RB 1NPJA 1FE8L 1T7YA 1YMMA 2WAQA 2IH1A 3FU9A 4IOSA 5ISZA 3LIZH 4AYGA 5KS9B 4X8GA 5L4MA 1S7WB 3R0NA 1JVKA 3GS7A 1DQDL 1O6SA 2J3SA 2XXCB 3ROOA 4Z7OB 1GCFA 2A6IB 4EZLA 5EBMB 3NIFF 2AC0A 1SXNA 2FVNA 2QVKA 3L3GA 5D96B 3OXSA 5C0RL 1WK1A 1CXFA 2F58H 5AKTA 3U4KA 4AEHH 2PWGA 4KMB1 1MRDH 3ERXA 4MMXA 3S36X 4AG4H 1IGCH 4I3SL 3OM3B 1FRGL 4LSVH 1SY6A 3QUMB 3APNA 5J7CC 4KDTC 4QXUH 1JWSA 4N2EA 1IM3D 1X5FA 3X12B 1IKNA 3CPLB 4IOFD 5CFAA 1CDGA 5DYFA 3TL5A 3HRZB 3R4DA 3MRCB 3MACL 2IEPA 12E8L 1XCWA 1FVUB 2FD6H 2GBAA 4LCWA 2JJTC 2CL8A 1D9KD 3ARBD 2HLFD 2QL1A 4J4PD 3UL4A 1S5IH 3WBPA 3MLRH 4RZCB 1XSOA 4I85A 4AYFB 4WLCA 4DVBB 4OLWH 4J3XA 4N32A 1G7LB 3CC1A 3GBNH 1OF2B 4HJGA 4AK8A 1BM3H 5I1EL 1FFOA 4PQXA 3QCUH 4XH2A 2HRPH 4S0SD 2ZXBA 3R8BB 1L9TA 2CHXA 4K94C 3OAYH 3FTYA 1EXUB 1KDJA 1JF1A 3LQAH 3SE8L 3I6KA 5B4MC 3NPSB 1GPOL 3D18B 5AVXB 1CR9L 3GSNA 4HIPA 3GSRB 4KZCA 1R47A 3OLIA 2IWGA 1USZA 2BY1A 3ARQA 3KGUA 1W2KT 3L3KA 4RA3A 4RETB 4UNIA 5CHNB 4M7JH 1K6QL 5I24A 4M18A 5IJCC 2V2XB 4FZ8L 3MFFA 1PD6A 4Y89A 3OJDB 3ULUH 2JKSA 1T03L 1ET7A 3ZE2B 4ICXA 3RGBA 2NNCA 3OZLA 4LSPL 3WFCH 5C2BL 1YMME 5C6WH 2FH8A 3Q2CA 3F58L 1I1RA 4ETQB 5A1AA 3IDIA 3MA9H 4Z7AA 3DTXA 1N64H 4UT7H 4PJXB 5IHLB 4JW3A 3U0PA 3BUYA 5E8NB 4RVBA 4JQXC 4U49A 4CDHA 4KAQL 2VNCA 4FHKA 4F8TA 2C26A 3D85D 2WSKA 3WUWB 4U4BA 1BAWA 2BCKB 5HDRA 2YPKB 4CAGA 1IBFA 4B27A 2VGLM 2RD0A 4ZPVA 4BFGA 4A6YA 1A1NB 4KROC 4RH4A 1MFCL 3FUDA 1P5UB 2HYMA 4EZKA 4KZEH 1BSIA 3AY2A 1MN4A 4NO5B 1OK8A 4KNTA 3L7FA 1LEIB 1MJ7L 1F3JB 5AVUB 3VXMD 3NA4A 1FORH 2EE2A 3IWUA 4G80B 1CXEA 5AOMA 1T20A 1JVOA 1S7RB 1ACZA 4PJ8B 4LCWE 5HVHB 1GJIA 1EHAA 2ZSWA 4WKZB 1DSYA 4BZ1L 1ZTXL 5JXEC 4IK6A 4Q9QH 1L7TH 3BP5A 3U25A 5KJ7E 2DBLL 1NAMH 1IQWL 3G9AB 3U6RA 4HUCA 1KJ2B 3AQZA 1NFIA 5EEWA 3HC3L 4P3WA 2WUBH 5LBSL 3DURB 4KX7A 1JGLL 2F9BT 5DMKA 1OGTA 3SO3C 1NFAA 3WTXA 1OQXA 4U1GC 4LIQE 4RGNB 1VGEH 1G7PA 4XPGH 1TLGA 2DQ6A 3WFHB 1S9VB 3JZYA 4LK4A 4TSCH 1WSST 5EV7A 5DHYB 5BVPL 2CXKA 4YGVB 3S97C 4GNKB 3UXFA 3TURA 1MELA 4FLOA 3JTSB 4N6RA 4ODXA 2CCVA 1P1ZB 3MU3A 4JQVC 3QORC 1I8IA 1WRFA 3MREB 1R0AH 5JO5B 3NYKA 4N0YH 5FFOA 4Q74A 4FKHA 2Q2EB 4RMVA 4K9EL 2W65A 4OZIF 1DV8A 1YEFH 1HXMA 2ZTBA 4YH6A 5ANHA 5HDOA 2F5BL 3QJVB 3VYJA 4FA8A 1E4HA 2A38A 3EZJB 3P0VH 4HUUA 4LLUB 1JK8B 2XA8H 4G6MH 4L3EA 3LTVA 2IALB 3ZTNH 2OMXA 2Z31A 1XVSA 2E7HA 3K2UL 3RS1A 3KL5A 4WJ5B 2VL4A 4OV6F 5HVWA 1BXUA 2WO3B 4PRDA 4ODHH 3WXVH 4Y5VC 4LPVA 2V8MA 4P0DA 1ZHNA 1OP5H 2NOYA 3PCYA 4ZAKD 3CH8A 3T3PB 4AJVA 32C2B 3H56A 2DZEA 4IU3A 1WD8A 3P40A 5EHFA 3X1BA 2BDNH 4XNAA 5AYUL 1DSFL 3PXLA 2FEEL 2NYKA 1YEKL 3DJTA 5IESL 1J10A 3FYIB 4JB9L 1YPQA 5HY9A 3ZRFC 2X1PA 2FBJL 4H7VA 5T3ZE 2IADB 2Y1YA 5EFIA 2PCXA 4XNYH 1T8CA 1CGUA 1XZWA 1U41A 5ABZA 1SN2A 4Y19A 3JWNG 2LS8A 1NGYB 3PGCA 3KDMA 2C1OB 5D71L 4X99B 4M1CC 4R7NB 2LAGB 4UT6L 5DD0L 4JPVH 2RFXB 3FU7B 2WY3B 3ES6B 1ZDQA 3QEQE 3ZMRA 5A16B 2AFNA 4R96A 3LZLA 2IH3B 2OS7A 1QSEA 3VJ6A 2J88H 2GJPA 2L4OA 1SJVA 1QLEL 4CMHC 4P4RB 3A0OA 3H9SA 4M5ZH 1CD9B 5AB2A 3WFBH 2C9XA 4MMZB 2DKMA 1R3JA 3E2HC 2IXQA 5IEHB 5J8OA 2ODIA 2WV3A 2NSQA 3NJVA 4NZ8A 3DHJA 5IW1B 5C6TL 4BIKA 2VITB 3PDOA 3SIKA 1CD1A 1VCBC 2EXWD 4N5ED 5E2WH 2EVJA 1FFRA 3ME0B 1RJLB 4GFXA 1URZA 3COOA 4K8RD 2F74B 3U9PL 4PJEB 3GHBH 3FUKA 2D31B 4HWNA 1JV5A 4QJ4B 4F7TA 1ODAA 3KYOA 5I0WA 3V6OA 3RUGA 2QHLA 3OKEB 1EJ8A 2ESVB 1BVKB 3C60D 1AGBA 1DVSA 4OJCA 3DECA 1BVLA 4L3EE 4E9SA 5D70L 5JHLL 1SB2A 3TBVA 1DTUA 3ARWA 4G8EB 3PWPB 3SD5A 4IRSB 2X6VA 3DUSB 1JA3A 4EN3D 2YKLL 1DEEB 3MV7D 1Z0MA 3AGVA 5AZ2L 3FB8A 2D7NA 2OV0A 2DWDA 3IMWA 4YC2B 3FU6A 1KZQA 4NC0B 3VXTA 4JJOA 1KGYE 2IANB 1RZKC 1DQTA 3VSUA 3ILPB 2GJZA 2IDTA 4PH8A 1NUDA 1MLBB 3LZQA 4OLVH 1BUUA 2JNZA 4FNLH 3G83A 3E1ZA 1I53A 2AV1A 2B1HL 1UA7A 3LN4B 4JDZA 1B0GB 4PLOB 1LD9B 5IHUL 4Y19E 5E8DL 1LWJA 2WINA 1DVFA 2QZQA 1LLAA 3KPRD 4NZFA 3RG1C 2D2OA 2X09A 2UXVA 3GPRC 1WBZA 2LR4A 3V4PH 2XWEA 3LB6D 4TN9A 5C0GA 3C8HA 2RBLA 2VJXA 2ZAGA 4XVUD 1KTLB 1MFEL 4YPGB 4PGDB 5FYLH 4PJDA 4X6DA 3GDCA 1H3XA 1IBHA 1RMFH 3DO3A 5C0NC 3DYPA 1BVNP 1DJZA 1QRND 5GRJL 4PG2A 5H2BA 3QFDB 4QHMB 1DFBH 5LCVH 3U0WH 5KS9A 5ETUA 4XTRD 1S7WA 2H41A 3VFNA 2EVIA 5C07B 4BE6A 3H9SE 1HSAB 4GKZB 4MWFB 5EBMA 3NCJL 4BRJA 3KWXA 1FFTB 4K15A 1RUMH 4Z7VF 3CCHB 4IKIA 3WG7B 3FCGA 3EJSA 2XI9A 3T3ME 5E1AB 4PV8B 3QH3B 4B41A 4J3UA 4WUUE 3S48A 3BSHA 1AD0B 5I1HL 1QNZL 1N26A 4LLWB 4NOBA 4NN6C 4OJFH 5KVDL 4BRVA 3B2UC 5EU6D 5FYJH 3V6OE 3CPLA 3RUGE 4CADA 5DR5H 4AZ8B 4OGYH 1W6LA 2ARWA 4AMWA 3HRZA 3MRCA 4NRYB 1FVUA 5K9QG 4MZ3A 1RK7A 3VQMA 2VXQH 1I8AA 1E2ZA 1KENH 3P73B 5CD3B 5ITBH 3BAIA 3E0GA 3GXNA 4RZCA 4W70A 4AEFA 1JZ8A 4UF7C 2BJML 2WTOA 4C83A 1KCWA 4QIRA 5IBTL 4DVBA 4Z7UB 2VDLL 5CSZA 3VD9A 1G7LA 1EWHA 3TT1L 2YUVA 1OF2A 1H3WM 1JFQL 2DPKA 2R1XA 3K2IA 3KNBB 4OF0A 1JNJA 5A3IC 1G9ML 2MEJB 4B96A 4PWGA 2PCPB 4KXZI 1WCBB 2KMWA 1EXUA 2O5NA 4UT9L 3ILQC 1Z5YD 2F5AL 2JB5H 4DP7X 4QJ5B 5D72H 5PAZA 4FMFA 3FN3A 4YXKH 3D18A 1KZE1 3GSRA 2QSCL 3MRLB 4HGWA 2N7BA 4Z3IA 1QBLL 1RZ8B 4BFFA 5KVFH 2OL3L 4PJDE 5CHNA 4X6DE 1XF5B 4XPFH 3U4AA 3U2JA 1TJGH 2NXZB 4ZMOA 1U8OA 2LTQC 5KS9E 3S3JA 1T0PB 1QWUA 4ZX6A 3R4RA 4Z7OE 4ETQA 3ECQA 3BLPX 4IKJA 5D6CB 4D9RD 1YHPA 2OW6A 4QRPD 3HUPA 3BAYA 1MFDH 4PJXA 1RHHB 5E9NA 5DZOA 2GJ6D 5F9OL 5BW7C 1N7ML 4IS6B 1TTGA 3T1WA 1G7MB 3WWKB 1M3IA 2R7EA 3ZTJG 1EGJA 3WUWA 2BCKA 4GB9A 4X9IA 5L2KB 4I4WB 3A5VA 5HTSA 4CJ1A 2MSPA 1A1NA 1PLGH 2EDRA 35C8H 4ONGL 5BMFL 5I8CB 2AEQH 2C1PA 2CJSA 1N5YH 5B4MD 5K59E 3Q06A 1F3JA 5GZOD 1LEIA 1RY7B 1XB8A 3AROA 4JZJB 1D2OA 3S35H 4J6LA 4G80A 1GZHC 1S7RA 1IEHA 1QO3C 3MROB 3AS1A 4WKZA 1F5WA 2ZCHL 2B0SL 1SF3A 1FG9C 2XN9D 4WHCA 3L9RB 4YLIA 4W4NA 5FIEA 3C75A 3WXWH 4BKLB 3H85A 4HHAB 4NEHB 1KJ2A 3A6OA 3BVNB 5DI8B 3UO8B 4Q0XL 3T1FB 3DURA 4DFHA 4X50A 3EUDA 2E7LC 4PRPD 3K6DA 2F2HA 1VFMA 4JCMA 4XN8A 4HA1A 1E8WA 5LKNA 1NM4A 2P8PA 3G6JE 1QSFD 4MS6A 1F4HA 4NBXB 2NY6D 5FW6A 4HD5A 5KVGE 1QPKA 4O02L 5DHYA 5AW2B 2B5IC 4PG9B 1MFMA 2K9UA 1EPFA 1FM5A 1D5ZB 4LVHB 4RMTA 3JTSA 1QR4A 2H45A 4XCNB 2A9DA 4GKOA 1P1ZA 5DC9B 1E9QB 1G9NL 3EXJA 4UQCA 1FNHA 2CIKB 2ZXWB 2AABL 3ZE2E 3L81A 4OZHB 4LFHD 2N1KA 1OHZA 5D1XB 2P47B 5KVEL 1L0PA 3LZOA 1A1OB 2CRYA 1E6OH 4F92B 3TS8A 4M7KL 2D7TL 1E4KC 4PJXE 1HH9B 3WUZA 3CZLA 1KC5L 4LLUA 3SPHA 3RJOA 5JXED 2BRQA 3Q8BA 4LHUG 4C47A 2DBJA 3EGDB 1TZ8A 3WSRA 1EJ6A 4RRPM 5FKAB 2IALA 4GKSB 4GMTL 1WWAX 3K8LA 4IDJL 1ZCRA 3GLAA 4QY8B 4XRCB 4RFEB 4WJ5A 4Q6IA 3L5HA 2XIIA 4EVNB 4KK6C 3GXPA 4M5YH 2JJWA 5CINL 3F6IA 2P5EA 1T5KA 3OMIB 32C2A 2C9VA 3F7YA 1QYGL 4QTIH 4W1TA 1IX2A 5FA3B 4F9LC 2ZIBA 5EO0B 1U92B 4YE4H 4R4FL 5KSBB 1K4DB 4G7QB 4HOXA 3AXIA 2ZSVA 4EI5B 2CPCA 3R06B 1JZGA 3RVXC 3W0WD 1KCRL 1NANH 3KE0A 4KK5D 4PJGA 3W9DB 5B8CB 1QBBA 2VL5B 2C1OA 2ZYHA 4X99A 2CWRA 2YRLA 4DGIL 5EOTB 5IHHA 2ZXGA 4G6AD 1ASQA 2RFXA 1WS7A 3FU7A 4W4OC 1Q8MA 3ES6A 4PJIF 4KOBA 2DL2A 5A16A 5JIDA 3IKRA 1WF5A 3SGKC 2R0WH 5KOVC 1MAKA 3D4GA 3RJQB 5C0FB 2IH3A 3QNYB 4NN7C 1J0KA 4R5TA 1BBDH 3TCLA 1F90L 5JMRA 4TYUA 2VXSH 4P4RA 1C12A 1FPTL 2C3XA 2B4CC 3UJJH 3WN6A 1LDPH 4AYID 1MCDA 4MMZA 2XKNB 3CZEA 2VM9A 2G5BB 5EMYA 5F6HJ 1U91B 3FTWA 4DHLA 5J12B 5KW9L 3SKNB 1GZPB 5EH1A 2AJUL 2KPWA 4QHNB 4UB0H 1KBBA 2HPTA 2XWCA 3FHQA 3ME0A 4G7VL 1RJLA 1W0YT 1QFWM 3G6DL 3O3EB 4NHUA 2ADFH 3NGBC 4FXKC 4TNEA 4PJEA 3FONB 5D55A 2D31A 2NY1C 4V1DB 1OK0A 3UZEC 3L9EA 3ARGD 3Q9QA 1N59B 4LSSH 2DD8H 2D03L 1O75A 1MIMH 4K94L 3SDXF 2F1AA 3OKEA 4L29B 2ESVA 1BVKA 3GRWH 4KX9A 2PCYA 3EG9B 3G81A 1JCVA 2ICEB 2AHIA 1SEQL 3WNMA 1S7XB 4JFDE 3L3HB 2MNWA 1SLVA 3HC4L 2VMEA 2FX7H 4G8EA 4OBSA 3PWPA 3GJFK 4IRSA 5IY5B 4HZAA 3DUSA 2R0ZH 1NMAL 1DEEA 3ELAT 3GDBA 5DMIH 2P5EE 2XG5B 5FGSA 2EE0A 2AEIT 2ZP9A 1DBBL 3H0TB 2G9KA 5EEXA 5D4JA 2IANA 1R33A 2X9YA 3NFPB 5E95B 3GBML 1CF1A 1L9OA 4QRRD 5F9DC 4KZDH 2EVGA 4FZEH 1LD9A 2BS71 5EZIL 2OR9H 3QHFL 4PJGE 5IW6A 4XPAH 1WE5A 1N9PA 2HFGH 3GLDA 4FCHA 5LWYL 1WHPA 2PO6C 3OKYA 1T1YA 3U7WH 3WTYA 5IJKC 1KF9B 3BAEL 3L2NA 5I75B 3X11A 3C2AL 5DEGB 3FQNB 3I2CH 1Q72L 3VTAA 1KTLA 4P3CH 4XC1L 4YPGA 4XMPL 3PIQB 4PGDA 5BO0D 5CBEB 1C3AB 1MCQA 3IGAB 1IILE 2BERA 2HKAA 3QXDB 2DWEB 5C08B 2R4SL 3P30H 4LPTA 4BQBA 2WOYA 3QFDA 4QHMA 4BWUA 3VSQA 1KJVA 2GABA 5FO2A 2BP5M 5FYJD 4FFZA 2V9QA 4GUOA 5AG9A 1PTZA 1HSAA 2XQBH 3QI9B 4GKZA 3VCLB 4XBGA 3QVAA 4XMVA 4OJAA 3QIBD 1WJ3A 1OCWL 2Q86B 4LHJB 2X1QA 2J12B 2YR3A 3BD5A 2AZAA 4R3SB 4B9JA 4DN4L 5E1AA 2KKQA 3MA7A 2OX5B 1CTOA 1J0YA 4PJEE 3PP4L 1V05A 1PAZA 4LLWA 4BQ8A 3RA7L 4FFWD 4U1HA 1WGVA 4N2IA 3HAEG 1TMQA 1L6XA 2I24N 1H0DA 4GEJA 5JMOC 4F2MB 2ESVE 5C0JB 5HYJD 1AYRA 3CMOH 3WIHL 3LXAA 3C5JB 3PWPE 1ZE3C 3SKJL 1CFNB 3EF7A 3P73A 4LGPB 4MCMA 5CD3A 5CR8A 1TQSA 4PS4H 1JYNA 3OV6A 4CBPA 3EYUL 4CILA 2O5YL 5SWZE 5J5EA 1E5UI 1TG8A 3CH1B 3KNBA 2IANE 3NRPA 3UJTL 1GJWA 3MX0B 1MFBL 3PPEA 2ITEA 5K9KB 2E6PA 4JZOA 4HXBL 1CGTA 1HNYA 1NJ9B 2XIDA 1FVDA 3T0AA 4ENZA 2XKSA 4N2HA 2GYSA 5FW8A 4TSAL 1CLYL 2V7HA 3V2AR 3MRLA 2A2QT 1BPLB 4P48A 2ZE0A 2BX5A 3IBEA 1RZ8A 1OWRM 4M93B 1G6RH 2CBOA 1XF5A 5E5MA 4PS3A 3EZ8A 3RVWD 2R0LL 3MRFB 5JNYA 1GYUA 2F6AA 1NGPL 2ZUWA 2OYKA 1PW9A 4QAMB 5C0IA 1VGKB 3B2UD 1OL0A 2AQ1A 1OAJA 3BGFC 5ADPH 1JNHA 3HN8A 3UO1L 2DKSA 1KG0B 5CEYB 5DUMH 1G9EA 3UTOA 3TV3H 1Q1JL 4KMQA 5HYEA 3PHQB 2VN7A 3O4LD 2XRAL 3QQ3A 3S34H 3HB3C 1FZKB 3WWKA 5JR1L 1A3RL 2JKWA 4AWJC 2FATL 2E9GA 2WCSA 3FZUD 1DJXA 4GY4A 1QLEB 3FF7A 3KLHC 5AW5B 3CVHH 1TQVA 4LOFA 4CW1A 5L2KA 2BW5A 3ILDA 4MAUL 3BVVA 3LEYH 4N0CC 5M7QA 3WOVA 4JRFA 4W9GC 3ILQD 1QBML 2YGVA 4JZJA 5PCYA 4G6JL 3FQTB 1ASPA 1YN6B 4X5LA 4JO8A 3ZRCC 1SN5A 3D85B 1ACCA 2EILB 3MROA 3IRPX 2EDJA 4GSXA 2BP8B 2I60L 5HGGS 15C8H 3Q44A 2BRSA 3IKPA 3LX9A 3UC2A 3V5KB 4WF7A 2H1PH 4PWFA 4XI5C 5EB9A 2WB7A 3BKCL 5ELIA 4KKNA 2UXGA 4MFHA 4ZPTB 3T1FA 3CN4A 3P3RA 3VXMB 1MG2C 3BKJH 2WZ0A 3X2QB 2IPTH 1DJIA 1H6TA 2OMNA 4ZMZA 5E9DE 2QR0B 2WLYA 2K3HA 4CC4A 2IIJA 2XV0A 2ROYA 4N3UA 4XP9H 4NZUH 2AJYH 3B4NA 2Q3XA 4OKVB 3ML8A 4ERSL 3QDJA 3TFKD 1A7RH 1KXHA 5DWUL 1XPHA 3J07A 1YPUA 5G55A 3K4ZA 1D5ZA 4XCNA 4JFEB 2TSAA 3ZLQC 4BFOA 3AT8A 1FZOB 4UM8B 4MAYD 2G60L 2OI9B 2GTQA 2YPVA 1TLKA 4OZHA 5ERWB 3DO4A 1KXVC 4PCKA 3GMMB 3GGWB 2A6JB 1V7ML 2WVSA 3MRJB 3L4VA 4U6YB 5D1XA 3SQBB 1J34A 3BDYH 4IJ3B 1RZKL 1U8IB 1A1OA 4R7DA 2ZP8A 3RFRA 4S1DD 3RAJL 4KO7A 3VXPB 1HH9A 2WGNB 3PGDB 4MDIA 4BGLA 2UUDK 2XTLA 4BFKA 4HT1L 5GJTH 2WKLA 3DX6B 2J55A 3V7AE 3BQUA 3FO1B 1N4XH 5SWQB 3UCQA 4GKSA 3CFCH 4RMUA 3VA6A 3WJJA 4QY8A 5DHEA 4XRCA 1MCNA 2ENSA 3ARDC 5L2KE 3LNIA 2WNKA 2PPEA 4EVNA 1NAKL 4OCMC 4PYGA 2A4CA 1D5XB 5TDNB 3UG4A 4JRYB 3WH2A 2H5UA 3ULVC 2VR4A 3IU3B 2XDHA 5FA3A 1H6UA 1EXHA 4FCAA 3FAXA 4N6QA 3QO1A 5EO0A 3WL9B 3ZDWA 4R8WL 3V0JA 1I31A 4RWYL 1K9IA 4ZX3A 3MRQA 5KSBA 3P0YL 4P9ML 1KTKE 5H4ZA 3FCSA 5DC2A 4EI5A 2Y2WA 4ZS7H 2MNJB 4NERA 3IFPA 3Q01A 2MNUA 5DGQA 3C12A 3NIDB 2FGWL 3P2TA 2IQAA 3W9DA 1CL7L 5B8CA 3HTLX 1UKMB 1PIGA 4UZUA 3UAJC 2VL5A 2X2HA 3IMTA 4ORZC 4PMEA 4YHKH 1YECL 2WGXA 3TJPA 5EOTA 4P5TA 1ZK5A 4R26L 3WIIL 3VNZA 2X41A 1E4JA 3X3FH 4JZNB 5K93A 4XC3L 3ZL4H 1IODA 1FGNH 3NCEB 3A6BH 2W38A 1FC2D 3NQIA 4JL1A 1LE9B 5BO1L 3ZL2A 2JCCF 4PGEA 1FGVL 1ZJBA 3GMPB 3QNYA 4XMUA 3RGVD 1HDMA 1Y1UA 2VDLB 1RU9L 3JV5A 1YNLL 5IQOA 1ORSB 2VSMB 3QDJE 5D7LB 4MRBA 2YLHA 4APXB 3S88H 4DCQB 2NDFA 1BV4A 4AQEB 2XKNA 3ZGIA 3MGOB 1PNDA 4ELMF 1XIWC 2Y7SA 4HZLB 2D0HA 1U91A 1EEQA 2IOMA 4WJG3 3AUWB 4B3VA 3QWRA 1GZPA 4UTBL 2BS9A 2VABB 4QHNA 1AQHA 4E0RB 1YPZF 2G2PA 4M5SA 4QRSB 4J8QA 2CSPA 2FRGP 4OZHE 5EPMB 3O6KL 3O3EA 2HG0A 1KZYA 3M7OA 4YNYB 3FONA 1BV8A 1UOSB 2MWCA 4BFBD 4XMTA 1EZVY 3VDCA 2Q5BA 2EDMA 3IKNA 1N59A 1WAAA 2VZOA 3SOBH 2EH8H 4L29A 4U4IA 4Z77B 5T1KB 3EG9A 2DB8A 4J6RL 2ICEA 2J4WH 4G43B 1AACA 2DLFL 3M46A 4LVNB 1NGQL 2DJUA 1S7XA 2A77L 4M3HA 3BVDB 2ZX8A 4HJIA 3MLUH 4FQQB 2APWA 3CFTA 5C09E 2ZG3A 4D7PA 4MA7L 2XG5A 4PP2B 3UTTE 2EH7H 2KQMA 5HPOA 1I7UA 4BK5A 3NIFB 4UTAH 5F0LB 3HZKA 3KD4A 5KSBE 2QADC 3C60B 5FK9B 4OGAD 4DEPB 4OGZA 3SE3A 4BYHA 3WDIA 3NFPA 1CQKA 5ADOL 3OD3A 1MEXL 3V0VB 2GQHA 1UXWB 1A6AB 3V0FA 1CGXA 4KRNA 2GC7C 2BPBA 3MV7B 1CICB 4W9FC 5I16B 2RIBA 4HIIB 2DV6A 2MQ3A 4LMQI 2VLJB 3I84A 3QZWG 4KY1H 4NO3B 4K23H 4OM1H 3LEVH 1X2WA 5CBEA 3UBHA 4P06A 5I8EB 3PIQA 4EDXB 4K3JL 1C3AA 5MP6H 1P84J 3IGAA 3ULVF 2ZXDA 2FE0A 3KVQA 5T33H 3LN9A 3QXDA 3S98A 4BZ1A 5D7JD 5C08A 4ADGA 4JJ5B 2UZIL 4D0DB 1UENA 2CBTA 3NSYA 1UT1A 4JFUA 4P04A 3KPRB 5HHPB 2Q0ZX 4JFOB 2AANA 4CKVX 3VW3H 5LLIC 4H13C 3GXDA 4WFGE 1XGTB 1ROCA 3QI9A 2LOEA 5LBSA 2HTLD 3WKQA 1KWKA 1KFAH 4PVLA 1UC6A 3QUXC 2YD8A 4HC1H 2DAVA 4ZXBC 3SD2A 3OMZA 3JV6A 1A14H 2Q86A 3EJRA 2OMWB 4E9VA 4DKTA 2DQIH 2E86A 3EXLA 4GSDL 4YSAA 2O93L 5CKAA 1BYOA 2VXVH 4R3SA 2NW2B 1JF5A 2QVTA 3FFDA 2OX5A 3GJFH 2AF2A 3FRUA 3AG4B 4O02B 4Q7DA 4A38A 2DWYA 1O9VA 1AR2A 3KYNB 4PD4J 3QJXA 1NLDH 1WAAE 1GC1H 2DEWX 4JFHD 2W8CA 2YGNA 1AFD1 5DJ2B 4F2MA 5CGYC 2YO3A 4GRMB 2BHYA 3V4LA 3TWCH 2IC2A 2FDBP 3QWOB 4JG1H 2Y36L 3BX4B 2PO6D 3C5JA 4UI2A 1GGBH 5GPRA 4M8QB 1CFNA 1KYOJ 2GHZA 3UG3A 3WLWD 2H26B 4HLZH 2DQTH 1IM3A 5EU6B 2VZ3A 5KJ4A 4B60A 2LFGA 1M6UA 4PLKD 3OKNB 1E4XL 1NBCA 3PXHA 4F91B 4X7SH 3MX0A 2Y5TB 3MXVH 3NJFA 3LXUX 4U1SA 4XVJL 1XGUB 4Y2OB 3IEAA 3ETTA 3ARBA 4EZMA 5AW6B 3F12B 3CQFA 4J4PA 4PJHF 5IQNA 4OIAA 5JDSB 3H42H 3HZ3A 5F1SA 2XU9A 5AW0B 1FL5B 4ACTA 3LHPH 4BXVA 1DQQB 4JO4L 4NJ9H 1NCDL 4XCFL 4LSRH 1A7NH 3TM6A 1K9JA 1YQ2A 3WBRA 3I9PA 5I19L 1A6UH 1MCLA 2R0KH 3AGWA 3BXNB 3MRFA 1B08A 4ZUUB 5C08E 2FL5B 4P2RB 1TSRA 2HX8A 1VADB 3D30A 5EZJA 2QHRL 1BEXA 3CSGA 3QIWD 4OD2B 4NLAA 2C4XA 1KG0A 4H8HA 3VTMA 2HVBA 5CEYA 1XGPB 5TGBB 2YQGA 2FJSA 5FHAH 4UT6A 5TF1L 1KACB 3SGJA 5J56B 2EDKA 3PHQA 1NCWL 1SL5A 4UINL 1B4TA 1G1QA 1GTFA 4I87A 3UEQA 5HDBF 2YPLE 3DROB 4M43H 4KVCH 3VXUE 3US0A 3S36L 3S3PA 1VZHA 2Q3ZA 2CR3A 4XNBA 3SBWA 3MNZB 4GUQA 4HJTA 3IK2A 4HDIB 5IQMA 3K81A 5E6ZA 4UM9D 4O4YL 1VEPA 2XC8A 2XWJA 4NZDA 4F2ME 3HA0A 3PHAA 2ADGB 3CBKB 4Z9KB 4B7LA 2CM5A 2UWEF 2GI0A 2C4FU 1U36A 3D1MC 2R56L 1YN6A 3FQTA 4N1EA 2VAAB 4NCC2 1WITA 2VR3A 3D85A 4Y4KC 4YBQC 2NSXA 1KELH 4LRNH 2B4CL 3A4DA 3GT6A 4ZW8A 2BP8A 2P26A 3HIZA 4OZIB 3FW6A 1GGTA 5BOPA 2ZOUA 4ZW6A 5F7LB 5IOPB 5IR1B 4F58L 2VZ1A 2MKWA 2Z91B 2F68X 4C9FA 4UAHA 4OFQA 4NUJB 4HWBL 4F1SA 5IGXH 5J3HD 3LAFA 4ZPTA 3VXMA 1ZPUA 4FQ2H 2KH2B 3FHAA 2RHEA 1L9PA 3M1BA 1A5FH 2UY6B 5E6SB 2OPCA 4HD9A 5FR3A 3SY0A 4LLQA 2AJ3A 5KSAD 4PIRF 4L8BB 3H7BA 4MJ5B 4J1UB 1ZHKB 4AQ1C 2QTVA 4YX2H 5I1KL 1BF2A 3SJVD 4OKVA 5L4JA 3CK0H 5T1DH 1J7VR 2EC9T 2XV2A 3NABH 3V4UH 1WDAA 5K9OB 5JHDB 3UTQB 1DJHA 3DDGA 4OQTL 1I1CA 3DVNA 4YHOL 1FZOA 4UM8A 4UV7H 5E4AA 4AXWB 2EDFA 2PKDA 2M2DA 2X44D 4MYPA 5ERWA 1XHHA 2C9QA 3BQVA 3GMMA 4HX1B 1LK3L 1E8ZA 1NA8A 4ATWA 2A6JA 3MRJA 4U6YA 3SQBA 4X7EC 3EYVB 4XP6H 1IKFH 5E08L 3EF4A 2QTEA 3NCXA 3VXPA 2KERA 1HEJC 3GKZA 1THAA 5GGUB 3QEGH 4K7PH 4POYA 3FO1A 4KROB 3TH3T 2VRPB 4KO6A 1UJ3C 2G3ZA 1HIMH 2VIRA 3GZQA 3VI3F 4AC2A 4BFEA 5KN5B 5AZEL 3EDFA 3BEVA 3HE7C 5TDNA 3T0XA 1D5XA 2R9HC 3O11B 4JRYA 2AJZB 2D9QB 5E51A 3IU3A 1MDTA 4LPXA 3GO1L 3O0RH 2ALWA 4H5SB 1OXYA 3WL9A 1A7PH 2XACC 4ZD3H 1RVFH 3Q8EA 2JJSC 3ULUC 2FO1A 1BNLA 4RLDA 2H2SD 4R90L 4BZYA 1PEWA 2GG1A 3RWHB 2O61B 5H8DA 1IJKC 3FT1A 4WI9A 1A4BA 1B0IA 1MRCH 4H1LH 4ANWA 1I8KB 2HT4C 4W6YB 5I1GL 3JWDH 1IGMH 1NBQA 1H8LA 2YAEA 1NCAL 2KZBA 4XNMB 1X5AA 3SO3B 3TJEH 1UKMA 4U1GB 2HMID 4QXGH 4F57L 2J2ZB 1YCSA 3RPIB 3Q3GB 1DY1A 3NA9H 3VXME 5AENA 1KEGH 3D34A 4JZNA 1UACH 3BGMB 1N5AA 4I18C 1LE9A 3L1OH 1Q94B 3W0WB 4ZZKA 2Y06L 2DM4A 3OJVC 1F42A 1YG9A 5B39B 2H32B 3OAZK 1ORSA 3EDDA 1T0NB 3W38A 2NY4C 3OB0K 4DCQA 2FQDA 1LNUB 4AQEA 1BOGA 3VO0A 4CSTA 4HZLA 3B2VL 2BZDA 4X4ZA 4YL4A 4GK1A 1LQSR 5DJDA 3T0ED 1RURH 3ULVD 4QRSA 4E0RA 2HH0L 1JOIA 4GFTB 5EPMA 4LU5H 1HOCA 2CHNA 4C55A 2HTKD 4I77H 4YNYA 2DW5A 4MMYB 1UOSA 4UOW0 2X3BA 2IGFL 3D0LB 1XGQB 4P59H 2BNRD 5C8JB 4H88H 5DRNB 5EF3A 1PD0A 3Q2LA 2L7EA 4JEGB 4Z77A 2FX9H 3N04A 5T1KA 4CMMB 4G43A 4Y5VB 1PD1A 3W5NA 3GSUA 4I7ZC 4DUWA 1BAGA 3OSKA 2H9GA 3AU0A 4O58H 4WTZG 1HEZB 3FTGB 4FQQA 5F9WC 1U8PB 4I2XB 1YY9C 4JDTL 1IGJB 1RI8A 3ARGB 4EQ3A 1FAKT 2A99A 1LTXA 3J2PA 4PP2A 4WU5B 4P2OD 1T66C 2F19L 3BIAX 3G5YA 2Q76B 1PCSA 5E6UB 4B9YA 5AD0A 4HOMA 1INDL 3FB5B 2Z0UA 3C60A 4OFIA 3DOIA 4Z7VB 3Q1SL 4FFVD 5FK9A 5I23A 1YEHL 1II4E 2GY5A 1TDQB 1F86A 1UXWA 3FUIA 1A6AA 2ZWKA 2CKBH 3NIDE 1Q9LB 5KVDE 3MV7A 1CICA 1K3ZA 5I16A 1DN2A 4HIIA 4KKBD 2N7SA 3KHQA 5FDYA 5GHWH 2VLJA 2WB1A 1NTDA 4NO3A 2YBGA 3IU4H 4Q6YA 4GS7C 4C56D 4U7SA 2ALAA 4Z5RA 1RP8A 5I8EA 1VEOA 2C8NA 4CMHB 5ANMB 4GKLA 5J6GG 4JHAH 2MIZA 2QLVB 2MPVA 1ZSDA 4FJYA 3F6JA 1SVCP 5FHBL 4D0DA 3GMNB 4JJ5A 3E2HB 1KXTB 1IC7L 3KPRA 4S10A 3APMA 4JFOA 4MQXC 1TYRA 1S46A 3UJIH 3L3OC 1XGTA 3ZPDA 4LHUB 4QTFA 4DPRA 1NFKA 3D4ZA 3H1ZA 1NCGA 2OMWA 4IMKA 4N9OB 1A6PA 1ACXA 2I07B 1U8CB 2Z4TA 3REVB 1UUSA 1FIHA 2NW2A 2WXNA 2V5YA 4PRAB 3N9GL 5EOQL 3EBHA 2ZCKH 4O02A 2YSSA 1J8KA 1ZMYA 4FQXD 2XNAB 1R6VA 5HHOB 1G1YA 2AAVA 4PJ9D 3N1PC 2ZOLB 3WKML 4GRMA 2NUPA 1E7VA 3IN0A 5E1IA 2AS5M 1U21A 4WUWA 2IWEA 3RY4A 1DYZA 4F8QA 1ZEAH 3EOBA 4IU2A 1BJMA 3PWUB 3O41A 2EYSA 4M8QA 2PPDA 2SEBA 4L2YA 2X28A 1SOXA 1RHFA 3VD3A 1N8ZA 3MV11 1SXCA 4XNUH 4QHKI 2H26A 2VDNL 4M17A 5EU6A 4Y4FC 2R4RH 1NIDA 1TZAA 1TZOA 3V6FB 2WXLA 3OKNA 5HYJB 5MEOB 2BIQA 4I5BB 4AV5A 2Y5TA 4PGZA 1ZLUK 2E7MA 5E5RB 1NEZB 2HWZL 3GPRB 2W60B 1OAXH 3EJYC 3HVNA 5CWSB 3F12A 3KWWB 4LLVA 3MV7E 5JDSA 3QUXD 3KJ4C 3N43F 1LK2B 4TV3A 4NQCD 4ZXBD 1FL5A 1V7PB 3QDGD 3RX9A 1YYLL 2FTAA 4N3TA 5G5DB 4U7MA 4OCSL 1DQQA 4KQ3L 5KOMC 1C8PA 1G4RA 2K78A 1E8YA 1EFXD 3ZKMD 4UQIM 2F54D 5E2TL 5EN3A 3RZCD 1CLOL 1KN2H 2W9DH 2WOBA 3BXNA 5FC9A 3ZQWA 5C9JB 1ORQB 2OMUB 3A3YB 2FL5A 4P2RA 3ULVL 2ZONA 2Y6SC 4AKQA 1E7UA 3KPRE 5CGYD 4OD2A 3GIZH 1DQLL 1XGPA 4P46D 4TNFA 5TGBA 3A4FA 5LUMA 1QACA 5FF6A 3QE5A 1ANUA 1XV8A 3A4AA 4GSQA 5AL8A 1IIIA 3K6IA 4OTXL 4KDTA 3U4BL 3DROA 4E9YA 3IGUA 3GLZA 4NN6B 4N2MA 3RY6A 4MB4A 4DUXA 1C7SA 3BRDA 1IZKA 2X1WL 4ONFL 4Y7OC 1IFHL 1F1GA 4ADJA 3PWJA 4OFKA 2HPOA 3CCKA 3VWJC 3G8LA 3PQYD 4HDIA 4DGWC 3JVFC 3FT4A 1MLCB 4F20A 4KXDA 2WQWA 2WIIB 3TP4A 1EUTA 2GJ6A 4JO2L 1NMBH 2ADGA 4TLKA 4KZVA 1DLHB 3SPIA 1J1OH 3L3DA 5L4FA 1AHWC 4A7QA 3S3BB 2YBRB 2VAAA 3DYOA 3WGVB 5GRVL 2F53B 3D05A 5LQBH 2RCSH 5E8OA 4LOVA 5EU7C 2N40A 5IOPA 2ZXAA 5IR1A 5EU6E 2Z91A 3CDCA 1LEKB 4NUJA 1OAKL 2W81C 2DQUH 1O7VA 4IBVA 1F18A 5HHMD 1J12A 1SHXA 1S8DB 3X1FA 2UY6A 2I9TA 2BZCA 1C16B 3G08B 3LVEA 4WEBH 4L8BA 1E9OB 4MJ5A 4H40A 4CC0A 2VMJA 3ZZLA 4J1UA 4NUGL 4JKPH 4P3DB 1ZHKA 3RWEA 1WFJA 1GS7A 2BNQD 2RIAA 1KYAA 1DVXA 2DQGL 3EH5B 3IXTB 4HQQL 3V55A 2J6EH 1WVZA 3W39B 2MH4A 5K9OA 1OARH 2LTQB 2R1YB 2W0LA 3HFFA 3UTQA 4PRPA 3ZYZA 1K9TA 3US9A 3MUHL 3JTTB 1SZNA 5A2IH 3EDJA 4AXWA 1T2QL 3TT3L 4CSSA 5I82A 5GSRB 3VWKD 3FXIC 4OV5A 4HX1A 3CN0A 4KKRA 1B0RA 1N6UA 1BFVL 2E76C 1SRDA 4WFHD 2X05A 3HAEB 4JQXA 4H0LC 1IL1A 1CFMA 3EYVA 5HYQB 3I6LD 3BX7C 4PN6A 4NAQA 4YBQD 3SYPA 4K07A 4HH8A 1UWXK 1MHHB 5GGUA 4PJIB 4U1MB 5HVGB 4DZ8B 2XETA 2VRPA 4AKPA 4UILL 3OLEA 5ALCL 3WIFB 5I6PA 2CO6B 3W3BA 5KN5A 1GAFH 4JM2F 1GSKA 3LH8A 4JKWA 4RFOL 2J57A 4Z0BH 4ZMXA 1RDL1 3O11A 4QRPE 1HXYA 1WC7A 2AJZA 2YXWA 5JLZB 4AIZB 1IUZA 1OKEA 5FV2A 1O7CT 1QO3B 2YMXL 2GJ6E 1BZ8A 2LQRA 2XG4B 4R2GD 4S1SL 2LLLA 5JXEA 3S5ZA 4NYLB 3C08L 3FRPB 3RWHA 2AVGA 2O61A 2BXZA 4MXVF 3I6SA 1CLVA 2BP0A 4AI7A 4OJDH 2X7LB 3QWNA 4AE1A 1B6EA 1I8KA 1AHMA 3O3BA 4DGVH 1FV1B 2B39A 3JUZA 2OZ4H 4XNMA 4P9HH 5HHVL 1N6QL 1BAFL 2J2ZA 3RPIA 3HHSB 2X4SB 3ARFC 1WZ1L 3SDXB 2LHAA 1ZSHA 3EYSH 4UOJA 3WCYA 3WIHA 3P9MB 5CR1A 3KR3L 3Q1EA 1MOEA 5IEKB 2B5IB 5B3SB 1L4IA 2AMUA 3LXBA 1DBAH 5ILTL 1Q94A 5A43C 3W0WA 2VR7A 1P4BL 3SDCC 2B1AL 3VMPA 4M8VA 5BS0D 3EFOB 2NNAB 2A9ML 4JQVA 5B39A 2ENJA 2GEEA 3FN0L 3IRCA 2FEDC 1T0NA 1WBYB 1MNNA 2WCGA 4Y2DC 1DBKH 3O4OC 1RTM1 1LNUA 1LQBC 4XO4A 1J86A 4PRPE 5AYQA 2ATAA 3H2WA 4JM0A 3HE7D 1TQBB 4G8GD 2R9HD 3EDKA 3KEHA 4N2DA 4W9JC 5MEND 1QSFE 1SOQA 1OQOA 5DHVB 3DX1A 3CN1A 4MMYA 1B4JH 3P5FA 5C8JA 1E5BA 1XGQA 1CVSC 4DK5A 3QQDB 4XVTL 3E1F1 3KYKL 4KFZC 5DRNA 1DY0A 4MA8L 2O6FA 1RUKH 3T6QC 3FH7A 4JPQA 1HYRC 2IGLA 4CMMA 4Y5VA 2CO3A 1TETH 2HUEA 2NY0C 2SODB 3AVEA 3EOYG 3FT0A 3X1GA 5DC4B 4YHZL 2IDCA 5D7HA 4WFFD 3HR6A 1KCSL 1U8PA 4I2XA 3VFRB 3AY4C 4X4MA 2NXYD 3ARGA 3G5VA 2DIEA 4QD2E 3Q6GH 2Q76A 3UC0H 3FB5A 1MCSA 2XQYK 4ZUTB 3HI5H 5L9DL 4Z7VA 2V3EA 1VA9A 4PCSA 4RDBA 4HUKB 3DK0A 1TDQA 4TQEH 2ZUQC 4DKFL 5GRWA 5A2LH 1NWOA 5EWIH 1Q9LA 1QLRB 1S78C 1CE1H 5LN4A 1KGUA 1MI5D 2DYPD 2KQNA 1BQLL 2XZCH 2DQJL 4DN3L 4TQHA 3HG3A 2Y3AA 1UZ6F 4BSVA 3GMRB 5IIEB 4XP5L 1JPTH 3FKUS 2VN6A 3OB0H 4NN7B 4MHHG 2WKOF 3DO7B 4WNJA 1KZA1 1R5IA 4EIBA 5IB1B 1JBJA 3TO4C 1DQKA 4ZTPL 4L8CB 3V0WL 4M62H 4HKXB 1HHIB 3GMNA 2YA2A 5E4OA 3W0WE 1KXTA 4LDEB 1J8HD 3HHMA 1NPNA 4P07A 3CLFL 5JIPA 3CZNA 4LSUL 3MRPA 4FQ1H 1UFUA 3TBTB 3PAVA 4LHUA 3EDEA 4DGUA 4P23C 1JPFA 3BIBX 1U6AH 3DBXA 3HCVB 3NGBB 4FXKB 4LEBA 5IT2L 2Z34A 2V37A 1YY9D 3NJJA 4X4KA 3NAAL 3KGTA 1U8CA 1D6EA 3ZE0E 3REVA 3RJDA 1QRKA 3FQYA 3JT2A 3VFUB 4PRAA 1U33A 4ZOEA 4HFWA 4AEHL 3SYQA 1SDDB 1J0HA 2GSGA 2XNAA 3O6MH 1IGCL 2YUZA 3E7JA 1XWVA 4KJQC 3QIBA 4LSVL 1CD0A 1AY1L 3DC0A 4IDLA 1JZDC 2ZOLA 2J25A 2YEQA 4JFZL 5B1JA 5KJRL 3LPFA 4U6XA 2Q7YA 3KS0H 2X2YA 3WFEL 4R5VA 4X80H 2DTSA 3PWUA 4KJPD 4M1GH 3T04D 1CDBA 2HJLA 3MI6A 3WN5C 2NYZA 1QVOB 4I2XE 4X4ME 2Z6FA 4TUKH 3V4VA 3QRFM 5AB9A 3QDMD 4Z3TA 5IB2A 4J6KA 3OF6D 4XWOC 3X1EA 1UD3A 3STLB 1AOHA 3V6FA 4AVKA 4Z7VE 5HYJA 4LLYB 4I5BA 4MLSA 5T1JA 2VZVA 2PO6B 1NEZA 1MHCA 3GPRA 4NP4H 1BM3L 2W60A 5CWSA 3EOTL 2BOBA 3K72B 1PG7W 4NI6A 5B1WA 3KWWA 3E9TA 1UD4A 3ZY7A 4MD0B 1LK2A 1V7PA 1Q9KB 4E2OA 4NQXB 1T5WB 3U46A 1WH0A 2BLFA 1BWMA 5G5DA 5EU3A 1SJEA 2UVEA 2Z93B 3QXAB 4EOWL 1VHPA 2NMSA 1KWVA 4Y5XC 1G7QB 3WE1A 4M4RB 3HZMB 4URKA 1DUYB 2IV8A 4QRRE 3NCYS 4X9HA 4RSYA 4B9ZA 3SB3A 5C9JA 1ORQA 3FSVA 3INUL 5J11C 1RP9A 1EHKB 4RMQA 4ZO7A 4AMKH 1KTDB 5JQ6H 4M7JL 4GT7A 2FHFA 1INEH 4L0ZA 1OGAD 1XTMA 2Y1ZA 3MUUA 3OHXC 1TJIH 1ZGLP 3WFCL 5HI5C 2V7NA 1R4XA 3WNKA 3D0AA 2BSED 2QQQA 1B2WL 3OZ9H 4QOKD 1SY6H 1MFAH 3MA9L 1ADWA 1FLRH 2WW8A 4CU6A 2P48B 4F27A 3JVGA 3UEZA 2I32A 3ECUA 1U4FA 5E2JA 5IFHH 1TJHH 2WTPA 4F7PA 4H8UA 1G7JB 1X44A 3VGHA 1T21B 1MLCA 3K80A 2LU5A 5GJSH 2UZXB 1KBPA 2J1YA 2WIIA 2WHVA 4HAKA 2V9UA 1CTNA 4FQHB 4UTBA 1DLHA 4QYAA 1UKQA 1ZIBA 2XYCA 2YBRA 1GHFH 1HNGA 1ZLUH 4O2EB 4Q4IA 3UBUA 4DETA 2WXIA 4XXDB 5E9AA 4DTGH 1FORL 4KHXH 3GNMH 3QZWB 1AGEB 1UCTA 2P8MB 4JM2D 4AGPA 5LXVA 4KWUA 4B5ZA 4B9FA 4MA3B 1LEKA 3VU1A 4UM9B 3KLLA 4Q9QL 1L7TL 2Y6SD 4LIQH 5HYJE 1RPUA 1G84A 2FX8L 1NAML 1OZ7A 1ZV9A 1ETB1 5I28A 3G08A 4TQPA 3WEMA 3GSNH 1MNUH 2WUBL 2W0KA 2LV4A 3FUJA 4NX0A 5BRPA 4P3DA 3AFLA 1YTTA 5DJ6B 5MI0C 2ZKMX 2C9PA 3FC8A 4ICWA 1VGEL 4RGOH 4KMLB 1FFPB 1JDDA 1SBSL 3Q6FA 4Y4HC 4HK0B 5DJXB 3W39A 4NQTA 4YDKH 2IG2H 3KPLB 2R1YA 1C1EL 2VR5A 3JTTA 1S3RA 3VGDA 2OP4H 1N0XL 4KQ4H 3KM1A 4YHMH 2VC2H 2Y2TA 3AG3B 4KHTH 3PGFH 3Q8CA 1HAWA 2OSLB 4XBMA 2W92A 3BSZL 4OCLC 5AW1B 2NNXA 1R0AL 4NQUA 1JD9A 3HAEA 3P11H 2QMJA 4OUOA 5HYQA 1TITA 3IFLH 2JB6B 4PHXA 1CLCA 2YAFA 3IFNH 3ZDXF 3SSGA 2PN5A 1FJ1A 1NDGB 2E59A 4KDVA 4MJ2A 1EEYB 5GGQL 1MHHA 4PJIA 4U1MA 1XCXA 4MAYA 3QCVH 4DZ8A 1VEMA 2X53A 1WT5A 1AQKL 5I73C 2OAAA 2J8UA 2JCCB 3P0VL 4A6YH 1SJMA 2J5LC 3WIFA 3D08A 2VDRH 1SFDA 4HUVA 3AU1A 1AI1H 2P9RA 2CO6A 3I74A 3DHMA 3EBGA 1IFGA 4QLWA 5ICZA 1UYWL 4JHWH 3ZTNL 4PP1C 1GZHA 3QJQB 4AIZA 3EYOB 1QO3A 5GGTL 5DQJA 1NQBA 2XG4A 1ASOA 3N06B 4ELMB 4KZWA 3M45A 2X5PA 1CT8B 5AAMC 4NYLA 5HYFA 1X5ZA 3FRPA 4KKLD 4MBOA 2H1LM 3ARUA 4NZRH 1YPZB 5LG6A 5TFSH 2X7LA 1Z3GH 1KCUH 1G1RA 3AITA 1FV1A 1AKPA 4PJ7F 2NNFA 5IKCB 2NZ9D 2W95A 4M9OA 3WO3B 2Y07H 1MY7A 5FWQA 3MBXH 2OSWA 2X4SA 3BCDA 1DDHA 3MOBH 2EO7A 2XR5A 3P9MA 3F7KA 1P0SE 3VXNB 1CFQB 4FYSA 4XHJC 5IEKA 4Q9RH 3EHBD 4R84A 5KG9B 3S2CA 4QRBA 4ZX4A 1WA1X 5J6SA 2VDNB 4Q4EA 4UUJB 3EFOA 4XWGH 4C8XA 3KH3A 3ZDYF 3M86A 5F97E 1CL7I 3B43A 3HMWH 5CEZD 4O2FB 2BCMA 2WBJD 3ABKB 5I6KA 4OI7A 2J88L 1AH1A 1BYFA 4GRLC 5E2VH 2X4PA 1L9QA 1ZT7B 2X1OA 2X4OB 2ZX7A 3CIAA 1A47A 1BQHA 3A6CL 3LJ3A 4HBCH 4M6MH 4IBUA 3EFDH 5I1CL 3OAUH 4M5ZL 2B2XL 4AE0A 5FYJU 2P1YA 3QARA 1E4KA 5DHVA 2WNWA 2D7PA 3QJHA 3U0TB 1YJDH 1A3ZA 3MNVB 5EN2B 3QQDA 4DO5A 1S3KH 5C0BD 1Y17A 1TFPA 3ARDB 3GHBL 3M07A 1CDUA 7PAZA 3LKQB 4UV4L 4WRLA 4PJIE 1MCEA 3MRNB 4XMKL 2VN3A 4JG0H 4F7EA 2J8UE 2JELH 4F9LA 2XKUA 4X7CC 4HVBA 2QV2A 4DOHB 4HUMB 1F3RB 3PJSB 3VFRA 1MCBA 4J6NA 2N0KA 1HKLL 1M7XA 4N38A 4JR9H 2EABA 1UOLA 3I6GB 3VD2A 1T2XA 2YZ8A 3P1VA 3GPSA 2N0MA 2AQ2A 4ZUTA 5DFWH 1WA2X 1IC5L 3S3CB 1F8TH 4NIKB 4RAHA 4LKXB 4QMEA 3HUJF 1WAEA 1I8UA 1OSEA 2NTFB 3HKFA 1RJZB 4Y2DD 4JS7A 1QLRA 2RICA 4FAAB 2A0LD 4URTB 2QFPA 4OLVL 1IC4H 3ZR6A 4FNLL 4KXZH 1S5HB 3DHUA 3E9UA 4LCYB 3SGKA 5B7FA 4UIMB 3ZSTA 2VW7A 5LGYA 5IIEA 3EADA 3RTQC 1I8LC 4NKDB 4Q8BA 1WIUA 2ZAIA 5IB1A 1PNCA 3G6AB 3THMH 2YMTA 4L8CA 1HQRB 3H8NA 3DBSA 3QRGH 2VM4A 4HKXA 3L16A 1S9WA 3F00A 2HJFB 3EBIA 4QUOA 5FYLL 3PAQA 4ZT1A 1RMFL 4HWBA 1JJUA 4MJHA 1UM5H 1KGCD 4C56B 5E0QA 1B6DA 3K0YA 1FN4B 4OAWB 3JWOH 1OV8A 5LCVL 4JREC 3H9HA 4OR1A 4E5XB 3B1UA 1ED3B 2CDEB 1OB1B 2R1WB 3IDGA 3LH2L 3PG2A 5BOZG 1DFXA 1M7IB 4ZQKB 1ZV2A 5LBGA 1RUML 4PJHB 4A2GA 4HCRA 1JPSL 2IQ9H 4GAJH 3VFUA 4DP6X 3T2QA 5IQ7H 1KB3A 4ORGB 4AM0Q 2QSTA 4MJID 2JKNA 4FF9A 2WPGA 3VGGA 3S8GB 2XFXB 2QKIC 3QQ9D 3U83A 1L0XA 5FV1L 4OQTA 3FDWA 4XVSH 4OCXH 4OJFL 3GBLA 1YLBB 2ICWJ 2RQ8A 4RAVB 5IMMA 4F8NA 2X2UA 2VKWA 4OGYL 5IMKA 1YQVH 4U1JB 1BW8A 1CLZL 1E50A 4HUNB 3V95A 1T7VA 3NCWA 1QVOA 4K2UH 1NANI 1QZNA 2PETA 4NRZB 2UVFA 3AREC 1H9DA 1UOVA 3MO1B 3SZ6A 2YN3A 4NC1C 4QRFA 1PF3A 4LCUB 4N2BA 1OEZW 4Z7QF 2ZG1A 1TFHA 3STLA 4K4KA 3MLWL 3MLZL 5DU7A 1QHPA 1XSIA 4I3RL 4LLYA 2X2IA 5ISZD 3MZTA 5HDBB 5A2CA 1FIEA 2PO6A 2WLIA 1A0QH 1L9NA 4WNSA 4AEEA 2FGZA 4N4YB 3DK2A 5IMLA 5IJKA 3K72A 4PJAA 2HJKB 2TRHA 3UADA 4UU9B 4LEEA 1A6VH 3RKPA 1Q9KA 1WTGT 1T5WA 1LO3H 4L1SA 5DDHB 4O5LL 2Z93A 3VYPA 3V0EA 5CEZL 5D72L 4NI3A 1G7QA 4YXKL 1MJ8L 4WDIB 3O3AB 1D7BA 1DUYA 2UWEB 2F1BA 4UWQB 3MLVH 3RE0A 3RGHA 3UPRB 2CK2A 3HI6L 3VVVA 5FUCE 2XVKA 4U3SA 1BJ8A 3QUXB 4G9DB 4ZXBB 4ZFZB 1KTDA 2FJFB 3VRIB 3QDGB 1YSOA 4XPFL 2WMPB 5L0QC 1K5NA 1SOSA 1GL4B 1WO2A 3K91A 1U30A 1EFXB 1BIIB 2H47C 1IGIH 1D5IH 4F33B 3SCMC 1OM3L 4G6KH 4AYBA 1EZVX 4BCYA 5MEQB 1D2PA 1MFDL 2Z64C 5EUOF 2MTAA 3M1OA 3QIWA 4OLUL 4K71C 3AJ7A 3ZTCC 7FABL 2DF3A 2VUYA 5IFAL 1M05A 3DSNB 1MCKA 1T21A 2Y72A 4LVEA 3CN3A 1CPUA 5MERB 4AY0A 3QNZA 2DWSA 4FQHA 3T77B 5ECGA 35C8L 1O5PA 3HG0A 5EA0H 3VYOA 4O2EA 1MCPL 4TL4A 4X5WB 4XXDA 2DTMH 4PAZA 3PQYB 5B22A 1P53A 2CJTA 4N90D 1W0VB 2P8MA 4JFHE 1XL4A 1JGUH 1E4WH 1JG9A 4MA3A 4UM9A 1U0NC 3BWZA 1IARB 4NENB 5GS0D 1X5LA 4Q52A 5J6GB 4PVNA 2WXKA 3LZNA 4JBSA 1GIGH 3WXWL 5I30H 4X5XB 3MLSH 3KXFB 5KVGH 4HKJB 4PJAE 4X5PA 3VI3B 3V8CA 1GC1C 5I9QC 5DJ6A 1X6NA 2PXYC 3ZVVA 2HA1A 4JDVB 1QKZH 2P80A 2QZ5A 3LRSB 3MPCA 4HK0A 2G9HB 5DJXA 1Z32X 5CEXA 3KPLA 1J5OL 1T6VN 4Z1PA 5EZOL 1OAQH 2APSA 4YDIH 3I75B 3V5DB 3QISA 4N2KA 3MBEC 2WN3A 5KSAA 4E41D 1CD8A 1H8OA 4D2NA 1M53A 4CVZB 4ZMWA 5AG8A 2XCMC 1V27A 2BNQB 3L4UA 3HEIB 4GW1A 4HGKC 3N44F 1H3PH 5LNEA 5F6IC 1ESOA 4H8QA 1NDGA 2ITDB 3QCTH 1EGJH 1IM9B 2GVYA 3UTSB 4L2LA 2ZWSA 1IAKB 5EBWA 2ED6A 1CK0H 2PWDA 1E3ZA 1QI4A 5EO9B 1L7IL 4DERA 1P69B 1QI3A 3LS4L 4A2DA 4XBEH 3QHZH 4UQ2A 4XN5A 4Y4KB 4OZFG 1EJFA 4C58B 2EDQA 3S5YA 6PCYA 1T8DA 4YSOA 5IJVB 1IQDA 3QNFA 2MPAH 4ELMA 1JFHA 4ATTA 1CT8A 2YWZA 3ZIYA 1H15B 1YPZA 4U1LB 3LZFH 2QPEB 1MIEH 1FUNA 3NRQA 1YN7B 5DQ9A 2OR7A 3FO2B 1KJ2H 5HD8C 4LCCC 1NCTA 3T65B 3VU2A 2R69A 3CAFA 1M71B 4WRFA 1IBZA 1KGIA 3ZHKA 4JPIB 4AQ1B 4EPSA 5LAXB 5T3XD 3BP6B 3RX5A 3VXNA 1T22B 2OYMA 2ZCZA 5D8JH 3TIDB 4ZI8A 5KG9A 5GRYA 2Z4QB 3BW9B 1UATA 2HKHH 3O2WL 3VDAA 4LASH 1NIAA 4WWKD 4A2MA 4H26A 4UUJA 2OR8A 1OGSA 4L3ED 4C4KO 2R0WL 1P4UA 2MQ0A 1EO8H 4C54A 4DKEH 2MJWA 2LLNA 2GUYA 4XPHL 2KLRA 1U3HC 1ZT7A 1KXVA 2X4OA 4YUEH 1UJTA 3FO0L 2C9UA 2VXSL 5CGBA 1PKOA 4FP8H 5HYSG 1U0OA 5IMOA 3Q7JA 4PP1D 3GRGA 1T83C 4ZO9A 3F7RA 5BZXA 4ZO6A 2IH8A 4LQFA 3OKOA 5BS0B 3DX3A 4L48A 1LP9F 2K4WA 2NTSP 1WD9A 4NQED 4UB0L 4NNXA 2HLEB 2X4RB 3MNVA 1UJ3B 5EN2A 1H19A 4LEXH 4AJWA 1UCBH 2GK2A 3SYOA 4PVMA 1ILUA 2ADFL 3WKNA 4A37A 4HBQA 3DOSB 5H94B 3ARDA 3O6FC 2ZOKA 5FCUH 1P4LD 2NT0A 1EEZB 3LKQA 4LOUD 3IJEB 2D0GA 3HE7B 5FOJA 3BWSA 4LSSL 2DD8L 1KCLA 3FMGH 5MENB 1PY4A 4ZDHB 2CA3A 3WMQA 3GRWL 4YWGH 1OGPA 4NKIH 3PJSA 4KFMA 3ASOB 5CD5D 2BNRA 1BQUA 3CHQA 4MSWB 1BZDA 1AYOA 3QFGA 3I6GA 4M6NL 4LOEA 1QSED 4NNPL 1YXKA 2HAZA 4W9IC 2DICA 4ELME 2P5WD 4FLHA 3TCXA 1KNOA 1FNSL 5CN3A 4X7FC 1MJJB 1ETJA 2AJVH 3D4CA 5E1HB 4FA7B 2D2CC 2OULB 4LKXA 2A9AA 1DL7H 4ZUVA 3UAJA 4ADIA 1XB3A 4IOIB 1RJZA 2NY5H 5CJ5A 5AB1A 1QUNB 4Y8AA 4GP4B 4MB3A 5KUMA 3AS2A 2VO5A 1S5HA 4LCYA 2O6EA 4I18B 4ODSL 3BZ4B 4P2OA 4GPVA 4UIMA 4FZEL 1LO2L 3OSVA 4NKDA 3K5SA 2OR9L 3ISWA 1S9YB 4XPAL 2Z8SA 1A4AA 5DVLA 4M6OL 3A67H 2YK1L 4DJMA 4PWKA 5I1LA 1AO7B 1XGRB 4LAQL 1HQRA 4KRPD 2NY4B 2IBZX 5TQ0H 1JYXA 5AALA 3I2CL 1X9RA 1MI5B 4CGUB 3SPVB 2HJFA 1BXXA 1MPAH 4JCLA 3RNKB 3NQKA 1MCWW 2UXFA 4NWUL 4ODUA 2VWEE 5GRUH 5DEFA 4WI4A 4C56A 1ZLSL 4OAWA 1FN4A 6TAAA 1FDLH 1NAMB 2FSEB 1LO0H 2OQJB 4IKLA 4E5XA 2ZPKH 4PSPA 1RJYB 2J20A 1RIHH 2XWRA 2CDEA 2R1WA 1OTUC 4UBDC 2XQBL 5DZNA 1M7IA 4ZQKA 1ETZB 2AGJL 4WNQB 4FQLH 4JPKH 3NK4A 4PJHA 1J8HB 3QZLA 3D33A 4ORGA 2FZ3B 3N43B 3DYMA 5ACMA 2LT9A 5TJWK 4HWZB 4JQIA 4ZMYA 2XFXA 1QFWL 3RWJB 3VXSB 4OLXH 5GQBA 1YUHA 4BJLA 2BZ7A 2XOTA 2DQEH 1M57B 1SXAA 1UZ8B 2NQ3A 5F9WB 3CADA 5F8QC 2WYHA 1DVFD 3TVMC 1BQRA 4YHNB 1NCCH 1YRKA 2QQKH 3T0EE 4HWEL 3ULVE 2W9EH 1HHJB 2DM7A 2YD0A 1PSKL 1RUAL 2GT9A 3CBJB 3VQ1C 1PPIA 1N0LA 4DOHE 3QZNA 1LYQA 3TZVD 1CWVA 3LMJH 5E0FA 4NRZA 1Q90A 1FBIL 1JZFA 2BNRE 4ZTOH 4DAGH 4FQXA 3F04A 3MO1A 4YBLC 5FCSH 2ZUTA 2DJ4A 4LP4A 3KPTA 1PZ3A 5KTHA 2V9TA 4PS4L 3PL6C 4H8PA 1F4XL 3MJ6A 1RDM1 3G04B 4H8WC 3IJ7A 3L54A 4YMPA 4KTEH 5D7SL 2WVVB 4XCEB 2VDML 4LZKA 4GS7B 2HJKA 3LOWA 1EZUA 5HJ3B 3LV3A 4UU9A 3F6LA 1RIVH 1FL3B 5DDHA 2K4AA 2N01B 4UIKH 3WS6A 5AVZB 4WDIA 1DJSA 4OFPA 5DUPL 2UWEA 1BG1A 2ODHA 3L3OB 3NZSA 2O5XH 4OQ1A 4FFZH 4ZRGA 1FVCB 2K70A 3OGOE 3QUXA 3I50H 1G6RL 4G9DA 1TZGL 4ZXBA 2MCAA 1PX3A 1FWXA 2FJFA 2MMXA 3QDGA 3SDAC 2WMPA 3FSAA 2BHZA 2JTYA 3STBA 3CLEL 1AXTL 1KJ3H 3SQRA 3BRFA 1GGYA 4JPSA 4RBPH 2AI0H 2IFFL 4C56E 1KB5L 4R4ND 1EFXA 1BIIA 1KCVL 1WZKA 2KUTA 1VSCA 3IDXH 1BZ9B 3K0WA 2JQMA 3NIGE 1G1KA 4HLZG 5DUML 1DLFH 1J11A 1TEFA 3TV3L 3BLKA 4WTZA 4KTDL 3C6SA 5D1ZC 4OFYD 4PJHE 3SBRA 1AJ7L 5GGVL 1CF8L 3WLBA 2QDVA 1E87A 1OGAB 4P46A 5LGKA 4LLMB 5G4OA 1S7UA 4HCIA 2A9NH 3V9EA 4BH8A 3T0DA 3DSNA 1EX0A 4NZTL 1RUQL 3CVHL 3D50A 1S4IA 3UACA 4DQOH 3SKMB 2XN0A 3LEYL 3NZ8B 4Y4FB 5FFLA 3R1GH 5IVZB 4X5WA 5BV7C 1T3FB 3AG1B 1TZIB 3ZKNC 4WHYH 3PQYA 4PLJD 4QXTB 1W0VA 1CXHA 4TRPL 1AS6A 4MJ6A 3BKMH 4AGQA 4HS8H 1IJ9A 4F93B 2BINA 2M26A 3KJ4B 4I0CC 2FQGA 1WFUA 5HDBE 4PY8J 3ZK0A 4X5XA 3DI3B 1X7TA 5J1SC 1JUFB 3KXFA 5DJ8B 2CO4A 1ZKAA 4HKJA 3UBXI 3VI3A 4N0FA 1PU0A 5CGMA 2WAHA 3TNNB 1JZ4A 2IPTL 4Z7NE 4XP1H 4JM2B 1YNKL 2HT2D 4FEMA 5CZXD 1W8EA 3RDTC 4YDMA 2RJMA 1YNTF 1JI2A 3LRSA 4WSKA 5DUJA 4Y9CA 2G9HA 1OB0A 4NZUL 3VXOA 4B6ZA 5DJ0B 1OSPH 1JTOA 4HG4K 4Z7UF 2G2NA 3I75A 3V5DA 1WFIA 4FFYA 2Z3FA 2R8SL 3BN9C 4AW7A 1E2WA 5JIMA 3H3PH 1MREH 1T1XB 4YHLH 2BNQA 5TPWH 3QDGE 4JAMB 2JQAA 4X9BA 3N1QC 1PWBA 1JWMB 2DLTA 3AB0C 4PJ8D 1LL1A 4HIJB 5EZLB 2H3KA 5GGRB 2ITDA 3K8KA 3GXFA 1F4YH 3QIUC 1GYCA 1N3NB 3BDYL 3VWJB 1IAKA 1HYSD 3GZPA 3V6ZB 3H4FA 1P6AB 2OKMA 3VWKA 5EO9A 5GZND 5J13C 4N0UB 1BFTA 1IAIM 4BQ6A 4M7LT 4PY7B 3ZMNA 1QPPA 5LGKE 4J6QA 5FM5M 1AHWB 1N4XL 2WWMD 3CC5B 3IKCB 1Q38A 4MS8D 4R4BB 4Y4KA 4RGND 4ZJ9A 3VVWA 1MVUB 4LARL 5LGHL 5IJVA 1FL6B 3ABLB 3ZSSA 4IGBC 2CMRH 4OUUB 4Z78B 3IF1B 4HJSA 1C5BH 2K7QA 4MXWH 3KPNB 4XCCH 1H15A 5E4IA 5G4NA 3PYCA 4E42B 3FO2A 2CK0L 2VMCA 4ZMAT 5T5NG 3PQYE 5CMAB 3B83A 1IGTB 3GI9H 1RK1A 5E2UL 4HJ0D 1M71A 4WW2C 3MBED 3FUMA 4IRJC 4WFED 4FNTA 5EF2A 5TE6L 4JPIA 2CIIA 3L3JB 2VZUA 5IREA 5LAXA 1ZLWH 3QDHA 1ZWIB 2YRPA 1T22A 1WG3A 3AS0A 4AIXA 4PJCB 1F00I 4K73A 4R0LC 4L9DA 4QT5B 2Z4QA 3BW9A 3TIDA 4EUPA 2VQ1A 3K6SA 2AK4D 3B6SB 4PCTA 1Y07A 2AJXH 4M7LH 3C5ZD 4RFNC 4I1PA 1FGNL 1MHEB 4FXLA 4JRWA 5E8EA 3VD5A 5TD4A 3WFDH 4QJ3B 2ZWZA 1BZQK 2ZKXA 1DQML 1AR1D 3E3QE 5HHME 3KPMA 4M03A 4FQIL 2YPVH 5EC2A 4XAWL 4MASA 4G11A 2J44A 4NN5C 5H37A 1K3IA 2FECI 3T6VA 5ESQB 3S88L 4BSWA 2ZZUT 3FFOA 3FAWA 4ZMPA 2B9BA 4LNVA 4XOEA 3S9DB 1CU4L 5H35B 5BS0A 2BNQE 2DMBA 4RQQA 5C7XL 2ZWNA 4ZW3A 3ZGHA 4Z0XA 1A7QL 4IQHA 4IW4C 2X4RA 1QLFA 4H1LG 1UJ3A 3O3DB 1DJYA 5JORA 5HI4C 1FE8H 1PG7X 5H94A 2A74C 1DE4B 1J87A 3OVUB 1EEZA 3IJEA 3HE7A 2P52A 3MHZA 4G8GA 4P8QA 5FUZL 1DQDH 2VQ4A 1FC1A 5MENA 4MQSB 5I5RA 4LBAA 4ZDHA 2V2WB 3MV9D 2J4WL 4IOPB 4WFHE 2JJSA 1RZJL 3QS3A 2DEYX 1H5BC 1NIBA 3I6LE 4MSWA 3CFWA 4DVRH 4I3SH 1FRGH 1Y6NR 4WI0B 4L37B 1MJJA 5IWLC 4Y16C 3IJYA 1GMIA 4UTAL 2VXTH 4TMPA 1W16A 4IOIA 1BEYL 3ARFB 4CNIA 2RACA 3S8WA 1NBVH 4G9FD 1DP0A 1K2DB 12E8H 3UYRH 5DD6A 3F2LA 1UMRA 5F7DB 4I18A 1Z9PA 3BZ4A 5DA0B 4OIBA 4DSYA 2DLHA 4L3AA 2ZP0T 4HJJH 4BZ2L 3L45A 3OHMB 3SDCB 3WI9A 4GXFA 3MV01 5DO2C 5AW7B 3H55A 1Z5HA 1AO7A 1XGRA 4W81A 4K23L 4Y2DB 1VZIA 3O4OB 3S6CA 5IV2B 1O0VA 5I1EH 1T1WB 1MI5A 2DYPA 3SPVA 2ESVD 2LU3A 3UGUA 5IZ7A 3RNKA 4R6UA 4JRXD 3INOA 4WO0A 1SL4A 1AAJA 3B8SA 3L7EB 3GUTB 1DSWA 3AM8C 4OZ4B 2FJGB 2RH0A 4S2SB 1MW3A 2FSEA 2OQJA 3SE8H 3VE0B 3VFGH 1GPOH 5IBLD 5GS2H 1X5GA 4N20A 1X4YA 4PI2A 1CR9H 4CU7A 2WWKO 3D69B 2X4NA 1U93B 1ZOXA 2FUQA 4PMFA 2XJLA 5FYKD 4NPJA 4HC1L 4F24A 5BS0E 1AZNA 1J8HA 4MKTA 4GH7B 2IAND 2FZ3A 3BN3B 2DQIL 3KS0J 4ABVA 4AYEC 1K6QH 2GFBB 5F3HB 3RWJA 1A1MB 1T03H 3RBGA 4KI5C 4LSPH 1UZ8A 5C2BH 4HSCX 3VI4F 4XPTL 1MQKL 1UASA 3F58H 4YHNA 4G8GE 1NLDL 1GC1L 1HHJA 5MENE 2R2HA 3TEZA 1IVTA 2IWKA 3DHPA 4WI6A 3BSZA 5SV3A 4N8VG 4NKMB 4MJIB 4M1DL 3VX1A 5B1XA 3JYBA 1E43A 2EP6A 2ZUQB 1CCZA 2W0FB 4WZ9A 3LVTA 4ABQA 2EAEA 2Y69B 3VD7A 1G0YR 3CHRA 2DQTL 3G04A 5C07D 2P5PA 1MFCH 4XCEA 2GK0B 2APFA 2CR0A 2FWOB 3NH7L 1F6FB 4WFFE 3WKYA 3TEUA 4LXFA 5HJ3A 5AVWB 3TO4B 3OAYK 4DZBA 3QDMA 1PX4A 1HT6A 3P0GB 4M3JA 3V5HB 1FL3A 4DO6A 1J05A 1G4MA 2V17H 1HI6A 4ZSOA 5GGTA 3UH8A 1JRHL 3H42L 5SX5K 1OT4A 4BZ1H 5KTEH 4KKZA 3LHPL 3ZHDA 1AO7E 1YAIA 2DBLH 2A73B 4ONHB 5HSFA 1IQWH 3O3UN 3L3OA 4LSRL 4G7SB 1AMYA 1FVCA 4LDOB 3RL2B 1MI5E 3HC3H 1MPUA 4Z7WF 4P23B 5LBSH 2OS9A 1L9SA 4QKXB 2J6WA 2JKIS 4PTUB 1AG0A 4JANB 3M1CA 4POUB 4Y5YC 4GRWF 1M9SA 3SE6A 5CXPA 5FHAL 2ADJB 3ZDZF 5BVPH 4P5SA 2AMGA 5CU9A 2EC9U 4PBVC 2APVA 1NFDA 4FQJH 4PU2A 2IT6A 1J8HE 1NDMB 3DVIA 1N68A 4WWOA 4M43L 3Q2WA 1SHSA 1OGAA 2ZXCA 4KVCL 4LLMA 1V3JA 1X9UA 1Z9NA 2K1MA 2Z7UA 4HSQA 3CFKB 5FLVA 1A3QA 1G1OA 1G7IB 4X4YB 1OZUA 1BG9A 4K9EH 1EHXA 5FGBA 3WN5B 4KGJA 1TLMA 2BSEA 4PGCB 4QOKA 3T0WA 3SKMA 1UQSB 4LNRB 3SN6N 5K69A 1C08B 2OLDA 2W1NA 3B2MA 4U0RB 4XX5A 4UNVA 4BDVA 5CFHA 5IVZA 3FF8A 3LRGA 1CXLA 2QVFB 1TZIA 2ID5A 1XTLA 1BDYA 2EKJA 2B3RA 4QXTA 3TIEB 5J1TC 4XXWA 1GGCL 1S7TA 4N68A 3ZYOA 5J0BA 3V7MA 2MOGA 3K2UH 3EYQD 3ZDXB