2ZQKA

Crystal structure of intimin-tir68 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
183
Chain Sequence
FFDELKIDNKVDIIGNNVRGELPNIWLQYGQFKLKASGGDGTYSWYSENTSIATVDASGKVTLNGKGSVVIKATSGDKQTVSYTIKAPSYMIKVDKQAYYADAMSICKNLLPSTQTVLSDIYDSWGAANKYSHYSSMNSITAWIKQTSSEQRSGVSSTYNLITQNPLPGVNVNTPNVYAVCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intimin
publication title Structural insight into the interaction between intimin and Tir of enterohaemorrhagic E coli: evidence for a dynamic sequential clustering-aggregating-reticulating model
rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 47
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
A PF07979 Intimin_C Intimin C-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zqkA01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 2zqkA02
3G8KA 1MSBA 4M17A 1UV0A 1FIFA 1J35B 1KWTA 2RIBA 3PAKA 1KMB1 2VRPB 2N7SA 3P5EA 1EGGA 2CL8A 3P7FA 1RDJ1 2VUZA 1YTTA 1E5UI 1IODB 1X2WB 3BX4B 4J6NA 2KV3A 1O7BT 4WCOA 3UBUB 1SB2A 4WREA 2BPHA 1G1SA 1Y17B 1E8IA 1HTNA 1V7PA 3IKPA 1KZC1 1R13A 3FF7C 5LGKE 4ZESA 4QKGA 1PWBA 4G9AA 5B1RA 1RDN1 3P5FA 4AQ1C 3PARA 2M94A 4LQFA 2C6UA 3DBZA 3IKRA 2MH4A 4GK1A 5F2QA 1KOEA 1IJKB 4YLIA 1UEXA 1V4LA 1RDL1 2I83A 1F02I 4J6MA 1J34A 3G81A 1BCJ1 3WHDA 3HUPA 2IT5A 1B08A 4N36A 1DY0A 1YPOA 1QO3C 1F00I 4UXMA 1P1ZD 2GGXA 1UOSB 1O7CT 3WWKA 4KI1E 1BJ3A 1GZ2A 3ZHGA 2ORKA 2ZQKA 1PW9A 4WUXA 3C8JA 1G1RA 5FFRA 5B1WA 3GPRD 1RTM1 1DY1A 4WRCA 1XPHA 1KWXA 1LITA 2XR6A 1OZ7A 3BDWB 1K9JA 1HYRA 3K7BA 3PBFA 4ZETA 4AQ1A 4N38A 1AFB1 2RIAA 3P7GA 1JWIB 1R14A 3G8LA 3KQGA 1IXXA 3ALTA 1WT9B 5K8YA 4N37A 4J6PA 4AK8A 4ZRVA 4WRFA 2IT6A 4ZRWA 3FD4A 2ZIBA 1IJKC 2GO0A 3PAQA 4GJ0A 1UMRC 2OS9A 1FM5A 3KMB1 1BCH1 3G84A 1FVUB 3NCXA 2VRPA 3C22A 1KZD1 1KX1A 1TN3A 3IKQA 2MOGA 2H2TB 2YHFA 1BV4A 1UEXB 1C3AB 3GPRB 4PP8A 1J34B 4J6KA 3C8KD 1QDDA 1IODA 3RS1A 1WMYA 5KTIA 1KWWA 1KX0A 3BX4A 3UBUA 1Y17A 1B6EA 1AFA1 3G83A 1U0OB 4KMB1 2LS8A 1G1TA 1RDI1 4J6LA 1X2TB 3WWKB 5FFSA 3WSRA 1UKMA 2GGUA 4GI0A 2PF5A 3T3AA 2MTIA 1KWVA 1KWUA 4WR9A 4IOPA 1EGIA 3WBPA 1BNLA 4DN8A 1KWYA 3P7HA 1KZA1 3P5HA 1YXKA 1RDO1 3WH2A 2E3XB 5FFTA 4M1GA 2VUVA 2OX8A 3ALUA 1IXXB 5KTHA 5B1XA 4KZWA 1WMZA 3ZHGD 4WQQA 4C16A 1KG0C 3CDGE 4EZMG 2OX9A 3FF8C 3CCKA 4YMDA 3GPRC 1WK1A 1RDM1 2ORJA 2BPDA 3VYKA 1KZB1 3IKNA 4QKJA 2H2RA 1SB2B 3BDWA 2BPEA 3P5GA 1V7PB 1U0NB 4HU8A 1MUQA 4WUWA 2ZWKA 1SL4A 3M9ZA 3CDGF 1T8CA 1H8UA 1J35A 1JWIA 3ALSA 3VPPA 1JZNA 2BRSA 4E52A 1JA3A 4MTHA 2MQGA 2XR5A 1WT9A 3WWKC 4PDCA 1E87A 1DV8A 1CWVA 1TDQB 1G1QA 1V4LB 1TLGA 2RIEA 1T8DA 2L04A 1FIHA 1X2WA 2MSBA 1YXJA 4J6QA 4QKHA 5M62A 1MPUA 1BYFA 4J6JA 1FVUA 3WBQA 2PY2A 1KZE1 1UKMB 4GJXA 3WBRA 3L9JC 2E3XC 4M18A 1BJ3B 1AFD1 4IOPB 4CSYA 4QKIA 1C3AA 3GPRA 1YPQA 1BUUA 1XARA 1ESLA 4UWWA 3P5DA 1RDK1 1UMRA 4CAJA 3WH3A 3VLGA 4N32A 1U0OA 1P4LD 2N40A 5J6GG 1OZ7B 4GKOG 1SL6A 3NCWA 1X2TA 1HQ8A 3VYJA 1K9IA 4N35A 4S0UA 4C9FA 2KMB1 4LU5A 1YPUA 4N34A 1U0NC 1SL5A 4N33A 3CFWA 1RJHA 1UOSA 1HUPA 3P5IA 1KWZA 1KCGA 4G96A 3CADA 1DY2A 2AFPA 3FF9A 2RICA 4KZVA 2RIDA
chains in the Genus database with same CATH superfamily
1KYFA 3WXVH 3MJ6A 4ELMB 3FTVA 4O02H 3VFPB 1Z0MA 1KWTA 5I6MA 5FYJU 1OM9A 1LDSA 1KGXA 3UIYA 5DJ2B 3GJFH 3V79C 4X83A 1ZT7A 1RH8A 1P7BA 2UYLA 3STZA 2JJSC 2XYCA 3WO4B 2WLZA 4FI6A 4MDRA 2EILB 4CVUA 1RSYA 4O51A 3QAZC 2FWLB 2YGQA 3VO0A 3INOA 2F8XC 3AREC 2W91A 4XI5C 5T1LD 2XA8H 1QKZH 2ITCB 4JPWL 3GSQA 4CNIB 2J1WA 2WVVA 3DVGB 3SCMD 2NCMA 4PJCF 3Q5OA 5EUKA 5BCAA 4LOUC 4U2ZA 2EAEA 4LEOA 4J7RA 2VDLB 3C6LA 2A1WH 4GEJA 4KTDH 4XC1H 2BSSB 2FEDD 1KGWA 4UINL 5HDWA 1BZDA 2AABL 2DL9A 4ZESA 3FU5A 4HUVB 2Y5TB 4UT6L 3V0IA 5FOBB 2YD4A 5AVUB 5EN3A 2VKXA 2LVEA 4HIJB 3N5AA 1F0LA 1MEXH 1WS8A 2A2QT 2AJXH 3A6BH 4Z0XA 2M94A 3R06B 4OGAD 3UAJD 5MI0B 2E75C 5D72L 3UX9B 1S9VA 1D6EB 2E7CA 4JQVA 3M7OA 1QHQA 4WO4B 3ALXA 1HZHH 2Z35B 4APQD 3DUUB 4GAJL 1DANU 2EH8L 2RALA 2AF2A 1EDYA 2X4TA 4LP5A 1CICB 4XMPL 2WLNA 2X6CA 1EO8L 3MXWL 3VRJA 3L3KB 3KWUA 3CXHJ 1UEXA 1XH3A 2MNWA 1WFTA 1BXXA 5EUOA 4J5VA 3FFOA 2CDGA 2BXYA 3K71B 1A02N 1B6DA 4MHHI 5CCKH 3ARUA 3PWJB 2F74B 4U1JB 1J0KA 1FJ1A 3HI5L 3AQYA 3LQMA 1N7ML 5LN4A 3QCTH 1AE6H 4L4TE 5C0AA 2YSSA 2OZ4A 1KJVB 3U36B 1J05A 2A3TA 2W9DL 3M07A 2L3BA 1OB0A 5FO9B 4H26A 5GJTH 1DBBL 3IMTA 1N59A 1NCDH 3D69A 2J8UF 1OAXH 4KXBA 1KN4L 5KVEH 1QFWH 1JL8A 3FQUA 3HEIB 1YPZF 5C71A 2P8PA 4LCWA 5JZ7C 3MNZB 1OP9A 2A9NL 1PLCA 1PNDA 1AO7B 3ZE1B 4OZIB 5E9DB 3MV9A 3H2QA 1KYDA 4NKMA 3RL1B 1AANA 3VWJD 5IUCA 4OIIL 3VD5A 1E9PB 1IEAB 4N0UA 3N1QC 2DM2A 4N0CC 3WO4C 4MMXB 1NIFA 2ZX8A 1ZLVK 1ACCA 1WK0A 3PIQB 2N3JA 5C70A 3SGDH 5EO1B 5GRUL 2VABA 3SO5A 4LKXA 2EE2A 1UM6L 4H8WL 1OOWA 3BZ4A 2DV6A 3R1GH 3PWUA 4YAQB 1NBZB 4PH8A 3L1OH 4ANKA 1M3JA 1VB9A 2AP2A 3S88L 1GZHC 1QSFE 3L3HA 4KXZH 4MQ7B 2XIIA 4AUJA 2YEZA 3MRGA 3W0WE 1HHKA 2OS7A 4AQ1A 4QRQA 1D3CA 5AQ0A 4GG6B 3RVUD 3MRIB 5BRZD 1M1XB 5EMYA 1N5AB 4ONHB 4ELKA 5H35A 4LOVA 1M1SA 1IAKB 5IREA 2YC1A 3FZUD 4XBEH 1R14A 3AY2A 1RJLA 4R4BA 3GMPA 1I53A 2Z31A 4G5ZH 4JZOA 2QFRA 4OLYL 5TF1H 1RVFL 2R8SH 1WT9B 2C9VA 4W9KC 5JQHC 1V3MA 4P3DB 1VPOH 3DTDA 6PAZA 5MI0C 2DQGH 5DHDA 4WO4C 2CHXA 1BZQK 1DE4A 4HSCX 1R19A 4JR9L 1EERB 1B88A 2IT6A 3UIZA 2R4RH 1CICC 4Q6IB 2EXYC 1U2CA 1K8IA 2J1ZA 3DX9A 3FH7A 4S1RH 2OS9A 3Q8CA 4WUUA 4HZLB 4PBXA 2CO3A 4OZHB 1CCZA 4WCYH 4Q9QH 1UXSB 2XIBA 1KSRA 4YPGB 4UM9B 1JN6B 1BMGA 1OZTG 2FQDA 1QLRB 2IWEA 4P2OD 9PCYA 4XE5B 1A47A 2KBGA 4OCSH 2E47A 4QYOA 2ZSVB 4Q7DA 4UOJA 4HUWA 2IDCA 3GJEA 1I4FB 2ZJSL 4A63A 2B15A 4PJBF 3CE1A 4XMLL 1UQSB 1T66C 2HJLA 1KG0B 4M43L 1H15B 3L5XH 4BKLB 4EOWH 4OJYA 4WQOA 1SDAB 2OXHA 3HAEA 1RIUL 3OXSB 1R75A 2EKSB 2IANE 1PFOA 2KDGA 3BT2H 4PVNA 2BNQB 1I1RA 1RCYA 3RGVA 4HV8A 5FS5A 4M3HA 4MMXC 5D2LB 1AFA1 2PPCA 4KRPB 4F15B 4DCQB 1CXKA 3P2TA 3IKCB 2GCYB 2DQCL 1CFNA 1JGDB 1DJYA 2ESVE 2VSMB 1OK8A 1TQUA 3HVDA 3BHBA 3WUWA 1G1TA 2Y1ZA 4G7YL 2D4FA 2J2ZB 1RJZB 1JOIA 1EDHA 4QTFA 3VYPA 1X2TB 3IB4A 2IBBA 3M45A 3DC0A 3V7AG 2EVIA 3QE5A 2H26A 5HYJA 3S5LA 4EDXA 5JHAA 3GMRB 5ECGA 3T3AA 2BHUA 3VM5A 1IEBB 1NCGA 2AJ3A 2L0DA 3RVWD 3H3PL 3MZTA 1BM3H 1KFAH 1QNIA 4OGYH 5IJVB 3O2VL 2WWNA 1YA5A 5I1GL 4PYGA 3S3PA 1XCQA 4NRXB 5KYYA 2WSPA 1E42A 4WUKH 1MHEA 3UTPE 4AGMA 4JVWA 1UWGL 1LK3H 1M7DB 1WFJA 5GRZA 3V5DA 2LU7A 3PXLA 1BNLA 1BIIA 1PQZA 2LLGA 3VX1A 5AW8B 1X7TA 4J4PC 3F64A 3WSQL 1GSKA 4G1MB 1KB5B 2NZIA 3O6FD 4QCIB 1SMAA 4Y8DC 2CO1A 3UERA 1HSBA 1TTCA 4Q6IC 2WO3B 5J12B 1TCRB 4HBQA 5CD5C 3TO4A 3V6BR 3WFCH 1H3TA 4HWNA 3GSOB 1JV5A 3PY9A 5B1JA 1GGIL 1XIWB 1QPPA 5I1LB 2GB2A 2F8IA 3QUYD 4WW2F 4RIRB 3WENA 1B3JA 3ARGD 5LN8A 3JQOB 3VYOA 4KZWA 4E42B 1ZT1A 2OL3A 3KG5A 2EC9U 4TRPL 3EZJB 2VLJB 2YD5A 3C8KB 1QP1A 3MLYL 4UQ3A 1GPOL 4CSSA 1JTPA 1SN0A 2ZUWA 3QWOA 1KG0C 2A83B 4UT9A 2ZCZA 4YMDA 2IO5A 1RDM1 3TWCL 5DMKA 4M1GH 4J12A 5BRQA 1XV8A 4MLIA 2YA0A 2G60H 3QDJE 1QSVA 2QJDA 4NWUH 4JY5L 5I18L 5AKVA 2Y0SA 1K4CA 5JOPD 1DVTA 1YNLH 2R0KH 2VN5A 4PJ5E 4Y16D 4PJCE 4AH2B 5C9JB 3V0HA 1OTSD 2G5BB 4KRPC 4F15C 3KPRB 4FD0A 1W91A 1SBSH 4UZSA 3MUUA 5D6CB 1WITA 1Q0EA 3DPBB 2R7EB 5EBLA 5IMLA 1IQWH 5HVFB 1BQSA 1U58A 5I1KH 4B60A 1QLFA 1FRGH 4M1CC 3CWGA 4UOZA 1HINH 2C1OA 2DIJA 3FO1B 5KYWB 3EFDH 3LZPA 3WEBA 3GXPA 4JRXE 4DKEH 2WXMA 1QLEH 3MXVH 4MWFB 3VDAA 5LBSH 1INEL 5JORA 1JZFA 1NL0H 1NCIA 4RRPM 2CKBL 3ZHFA 4JJ5A 1YEFH 3AABA 3O4LE 4UM8B 1P9MA 2K6ZA 4HKBA 2APVA 2BNRE 4AYEC 1E8YA 3BLPX 3JT0A 3CVHH 4PRIB 2F58H 4HA1A 2H9GB 5ELIA 1ZGLB 4XMWA 1DZBA 5AB2A 5D1ZB 2ZCLH 5AOZA 1NSNH 3NZUA 4CKQA 1RIVL 3HG1E 1JD7A 1HH9B 3O6KH 5ISZD 3VFGL 1USZA 3D07A 32C2A 3HZYB 3UMTA 3HNVH 3BLBA 3CFIC 3K7UA 3VJ6B 4HPOL 4JKPH 1B0GA 3T4AB 1F3DJ 4LCCA 3ZHLA 3GRWL 1NDTA 4PREA 5J12C 3OWEA 1E90A 4YBQC 4R97B 5L4IA 2JELH 4Y1AD 5D1QD 2C7FA 4ODXA 2FSEB 4K23H 3WJLC 1WIPA 3VXPA 3ZYZA 4LL9A 3OB8A 2C9PA 2XZCL 1WEJH 5SX4I 4CSYA 4QKIA 1CYWA 1D6VH 3M17A 4KITB 2OSLB 1XIWC 1WGVA 2VDOH 3CHSA 1CLOH 1YPZE 1ZLSH 3RJQB 4PWHA 1EXUA 4NZ8A 4G1EB 1KWKA 3TN0B 3IJ8A 3FS9A 3MLWL 4L8SA 4Z77A 1C8PA 3PGFL 3WELA 3UBXB 4PSRA 5CLWA 2H1LM 4POZC 1WH0A 3QDGA 1A0QH 1TYEB 2HX7A 1NGPL 1JPTL 5G2NA 1TVHA 3OAYH 4RFEA 1H0DA 2YD9A 3MBED 2KLTA 1N6UA 1MCRA 1J11A 1JZHA 2BM3A 4JRYA 4PJXB 5HXMA 4CC0A 1J7VR 1T21B 2P42B 1FWXA 3BYTA 4IOFC 4BFJA 5LUMA 2Q8BH 2FQEA 4HDIB 2E5EA 4QOKD 4G80B 5AOIA 3SYPA 4N33A 4MMYA 3HE7A 1MCOH 4IGBD 3KL0A 3HHSA 2WINB 1BAFL 3TEXA 1EXGA 3OKMB 2MPVA 2YAHA 3TF7C 3B2UC 3KBEA 4IHOB 4NQCE 4IJ3B 1KPVA 5JHLH 2NNCA 1FL6A 2WXKA 2Y7SA 3WLBB 1LEIA 1FO0L 3AGVA 2RACA 4YQXH 3SDDD 2IDUA 3OF6D 3GGWA 2PYEB 3AM8C 2ZXQA 4DEUA 3X3FL 1GOGA 3QZLA 4ONGH 5DS2A 5D7SL 3D39B 4FG4A 2HG5B 4XH2B 5FYKL 4D9LH 3GXIA 3FF9A 3QI9A 2RICA 4HXBH 2Z93A 4R4FH 5JXAH 2YZ1A 4JM4H 1MRCL 1QATA 1U8QA 3U7WL 2GK2A 4P0DA 1T2QH 1F45A 2C9AA 5D1ZC 1FVCB 3S34H 2YIHA 5CBAA 4OM0H 3QCVH 1F42A 3MRRB 4FLHA 4L1DA 3HBPA 1IGFH 3BVNB 3P3SA 1UD3A 1WZKA 2ZWZA 4NEHB 2ODHA 1N64L 5E2UL 5IMMA 4GUOA 3T4AC 2VZ3A 3GSWB 2B4CH 4PRBB 2NTSP 4IDJL 4IHBA 2XVGA 1GSMA 3IRCA 1N12A 1WT5C 4R97C 3CN3A 4ZSOA 3E9TA 1NIEA 3ESUF 4N68A 3P7FA 4CADA 4PJBE 15C8L 2FB4H 4GOSA 4MA7L 4JS7A 1RDJ1 1A1MB 2R69A 4OLEA 3RWDB 3MJWA 1C16B 1MCCA 2WLMA 3LTVA 1B0RB 1WIUA 5IROA 2BCKB 2GT9B 2W9EL 5IHUL 3KBFA 1OY3B 1YMMA 1SB2A 1OPGH 3MLSL 4ZODA 1IKFL 1DQMH 4JFXB 1ESOA 2DJSA 2E27H 1UENA 3AXIA 3TN0C 2NUTB 3MVSA 2PW1A 3D9AL 3S5ZA 2FUQA 1HQ4B 2GJ6D 3E8UL 4G9DB 4V1DB 2EIKB 5L8JB 3N06B 1S7VA 3RWFA 4DOHE 1FVEB 2Z1KA 2DTMH 1KIUB 2R1YA 1UXWA 2IFFH 1QR1B 4UILH 3LPGA 2IH1B 3ULUH 4DZBB 2NLJA 1P7QD 3RGHA 4N8VG 5I17B 2J6EA 3WNOA 2VL5A 1HTYA 3CBKB 2JSFA 3FO0L 5KJRH 4G43A 2EIBA 4G6FB 5IT2L 2PABA 4Y2LA 3VM7A 2NYYC 3GMQB 3WY3A 3MJGX 3LKOA 5LHDA 2P5ED 1SUJA 5TPWL 3TNNA 3P4MB 3VI3F 3LOWA 3TBYB 4IJ3C 1I85C 3C2AL 1A3QA 1T22A 3DX0A 4HUUA 3PNWB 2WCSA 3NPSB 1MHHB 5L2KA 1T0NA 1L0PA 5C09A 2HRPH 2IT5A 1I1AB 3VFOA 4EI0A 2VDKH 1IGMH 3T5WA 1QBLL 3SO3B 1HH6A 4RQQB 1YEGH 5ITFA 1FVDB 1F5WA 4N0FA 5EPMA 4HD9A 5GIRA 4WK0B 1FNSH 4YUEL 3SHSA 1Z9PA 1LNUA 4HGKC 4MX7A 4FNLL 3D33A 4NM4H 1MFMA 4OCWL 4PLJC 2J1YA 4KROB 4NC1E 3OR7B 5DUJA 1O7CT 3SDAB 1JFHA 1UA6L 2BRRL 1Z5LB 5CILL 3CFCL 2ERJB 3RZCA 2XQYA 3NSDA 4BXSV 3QIBA 4GRLD 5F9AC 1GXEA 1JP5A 3GSNH 2CBOA 3LKQA 5IBUG 2QPSA 1C7TA 2WO2B 3HAEG 2NR6C 1JTTA 1UD5A 1WZ1H 1BQLL 1JNHB 1FGNH 4BK8A 2XG4B 4R90H 4BQ6A 4Y2NA 1YYCA 3FNKA 3GSVA 3H4HA 1FFNA 1L9NA 1WC7A 3N42B 5BRZE 3SDCA 5J4MA 2ZG3A 3ZHDA 4KNSA 2EDDA 5H2BA 1HK6A 5ACZA 2AMGA 2ZONA 1NLBL 4KFZC 5GSVA 4AEIH 4HJGB 2P48B 5T5NF 1UD8A 2VQ4A 4X6EB 1QHOA 1AHWA 3QR0A 4DQAA 1KBVA 2QEJA 3GYRA 4U1LB 3RWGB 2OMWB 3ARSA 5D8JH 5E1IA 1U8CB 4ODVL 4DVRL 4TOYH 3X3GH 3MV7A 3GHEL 3UJJL 4NYLA 4ZX3A 5HY9A 5JW4M 3P7GA 1L7TH 3I9GL 1F13A 2FEEL 3LNIA 4TUJA 5DUML 1BF2A 1UXMA 2PNDA 4Y19A 4WO0A 3TJPA 2J71A 1QW9A 1FZKB 1MFDH 2CLRB 3H54A 3OPZH 1Y1DA 2JJWA 1SUHA 2H41A 3IU4H 5E23A 1MSPA 4N2LA 3KCPA 2Z65C 4DO4A 5ESAB 5J5EA 2ICWA 1PU0A 1BZEA 3KE0A 3QK0A 2ADIA 5HDBF 5K1JA 4H1LB 3MTXA 2MEJB 4ADIA 1F90L 1WUNT 5I1CL 3IAGC 3IDNB 1EEUA 1IBGH 1YG9A 4XOBA 5DHXB 5C07E 3BZFA 5KSAD 2QVMA 5C9KA 3KMB1 4U1NA 3MBXL 1EUUA 5BJTA 5IB1B 4K9EH 4Q97A 4EVNA 1FVUB 4OJDH 1IVTA 3NPSC 1LO2H 4OFKA 1J1XL 1G7MA 1I1AC 5JR1L 1P4BH 1R3HB 3MV8A 3PHQA 4OUUB 4PJ9A 4AGOA 5JIQA 5KYXA 2OQJB 4JFDB 4XO9A 3SO3C 4TTGA 4XN2A 5B21A 3BSGA 1TN3A 4H20L 3IKQA 1ADQL 1KDIA 2D0GA 2P7TB 1FGVH 4TQEH 3MRNA 3PE9A 5C0BD 4DN3L 4DVBB 4HK0B 4QO1A 1DFBL 4KROC 2NX5A 4X7DC 4RGND 4OJFL 4P4RA 3SDAC 1A6AA 2OMTA 4AGLA 1KOAA 2MWCA 2ERJC 4WHTA 5MERA 4NLHA 3FT4A 5E2VH 2NNRA 4NKDA 1FL5A 4FFYL 2BVEA 4FQQB 3NA9L 4YSCA 1UEYA 3ZT7A 1MVFA 2CJTA 5IIEA 1AQ8A 1L3WA 1I9JH 4PJGF 3U83A 2J1KA 1WCQA 5FM4A 5GZOA 3O3BA 4JHWL 5AW7B 1Y6NR 2LS8A 4KMB1 3K8KA 5DURB 1KFGA 4JM2B 2C3HA 4G6JH 3UTTB 3NBNA 4NNXB 4HJ0C 3UTOA 2JKJA 2WUCL 3FFCD 4WWKB 4I85A 1GVIA 1X6NA 4B3EA 4EDWL 1MCPL 1OAUH 3CZGA 2W07A 4Y9BA 2C3GA 5HTSA 3O8XB 1BYOA 2GSMB 2IF7A 3FB6A 4RESB 5F8RC 3PAVA 2OCCB 1IBFA 2A9AA 1SJHA 5BZZA 3SD5A 3P77A 1NFIB 4CN4A 5I8KH 1YLBB 4Y5XB 2A6KA 4JG1H 4PJFF 3Q06A 3EYUL 1QTYT 3VYNA 3ARZA 3U4BL 5DA0B 5AVXB 1CFVL 1A21A 2OI9B 1PX8A 5LCVH 5ITBH 2EVHA 2GJZB 1F4HA 5KWYC 4U1SA 4NZRH 3K2IA 1KBKA 1AIFB 1YRKA 1SDDB 2BSDA 1QAWA 3QUXD 1ETA1 1GMEA 5TGBA 3SGKC 4GW5B 1UCTA 5DSCB 5T33L 5C08A 4NZUH 3OKOA 5D70L 3QISA 2V2TA 4X7EC 2B1HH 1I1YA 4J6RH 4M7KH 4DUXA 2AZAA 1W72A 1ZIAA 2IWKA 5F0LB 1COBA 1Y18A 4TN9A 1MFAH 3MAWA 4LLVB 1W0VA 2YS4A 1N3NB 4Z0BH 2GK0B 1J5DA 1U93B 2VAAA 3QZMA 1E5ZA 4JHBA 2AXGA 3DO4A 3FU3A 4NLAA 1YECH 4UBDD 2FYYA 4QHUB 3ZHGD 4KK5D 5HHOD 1ID5I 3MRDA 5EG6C 1U3NA 3QCUL 1A8ZA 4AOFA 4K7FB 1MKFA 4AEHL 2C26A 1Y6MR 4ANUA 4CW1B 4ZXBA 4EZMG 2BOBA 5GZND 3HC0B 1B3IA 3KXFA 2Z8WC 3QIUD 2ZOWA 1AKJA 1AHMA 3RL2B 1ZSDB 3IPFA 2BVQA 4PYHA 1HOCA 1HXMA 1KJ2B 2HVBA 1NBVL 2VO5A 3UAFA 1HE7A 1A7RL 1Z9SA 7TAAA 3P5GA 1W72L 1FIEA 5KBMA 1KV7A 1TITA 1JZ4A 3QZOA 5C6PB 1A6UL 3EFFB 3RUGA 1WYJA 2Q76B 4GINA 4WIQA 5CEXA 2GJRA 3I6GB 5C0FA 4KHXH 4DGIL 4JM2C 2TAAA 2DD8L 1FNFA 1A7OL 1JA3A 1HAUA 3APNA 4ISVB 4RGOL 4WWKC 2DWTA 1LE5B 4XXWC 4AM0A 1E87A 1KJ3L 4LLWA 2KKQA 4FQXA 3CXDL 3IMRA 4L29A 1UM4H 3O8XC 4Y4HD 1C1EH 4U4BA 5E6IA 3IU3B 5JDSA 5CMAA 1QRNB 1FV1A 1Q9KA 4NNYB 3WV0A 3ULVH 5ISZE 2VLKA 2DQUH 2IBZX 3RWHA 4Y4KA 4M5ZH 1QA9A 3WY4A 1OALA 4F57H 4NUMA 3UAAA 2ILLA 4Y5XC 3T0WA 4JO1L 4F7TA 4Z7NB 2P28B 5AOKA 3EJYD 3MJ9L 2H1XA 1RHFA 4MZ3A 4ZMTA 4YN3A 4Y1AE 1SPDA 2OI9C 5D1QE 1MQKH 5CF3A 1JGVH 3IJ7A 1FPTH 3ELQA 5I2IB 2M1KA 3RP1A 2DQHH 1MRDL 3VXMB 4LLMA 5DEZA 2JIXB 5FK9B 2E7DA 2XYBA 1NC2D 4KZDH 1X4ZA 3J2PA 1T04A 4K7PY 3RWCB 3T4YA 5ALBH 3PPSA 1RAMA 5HPMB 2NNFA 1NAKL 1NINA 1QRKA 1S46A 4M1DL 4U1MA 1BJ3B 2V7NA 4Y9GA 3UCRA 3LKNA 4PJEA 3K0YA 3NACL 5F1NA 2CE6A 3N44F 4X6FA 1A7NH 2B1AL 5FW6A 1PF3A 4BSWA 4JFQB 1NCBL 2ZCHH 3O3UN 4PJDF 4GT0A 4PGDB 2XWEA 1K72A 3ARVA 3KJ6L 5FKPB 1KC5H 1WBXA 3FJTA 5JIIA 2K4AA 2ZKMX 1P4UA 3GXMA 3HUJB 3FC8A 4NSKB 4IRJB 4KJQD 3HBZA 4U1HB 5CBEA 4JFFB 2XN0A 4QOKE 1UB5B 3APMA 5E9AA 4BH7A 3WIHH 5C0RL 1BZOA 3CAFA 4TL5A 5L2JA 2VDQB 4HIXH 4M6OH 1RULL 2ATPA 1HQ8A 2J57A 3DX3A 2IADB 2WAHA 3GB7B 5HHPA 4S0UA 1AP2A 1ZTXE 5IM7A 2EZ0D 1ORQA 1XT5A 4LVHB 4CVXA 2XN1A 2ISDA 3RB5A 4WWNA 4YX2L 3IAPA 2WNKA 3MLVH 3WS6C 5E51A 1I3RB 3RU8H 2EE9A 3WHE1 3QNXB 1OPOA 1TTBA 4FE9A 5GRJL 1DYZA 3BGMB 2XFXA 4YHML 1KCGA 2ENYA 2F7OA 1A1OB 2UY7B 1LP9E 4XN1A 1S78C 5DO2C 2YLHA 2YN5A 5M94B 3BAKA 5C97A 2IQ9H 1NBQA 1RZKH 3BX7C 3KPNA 3KYMA 1NOLA 5GGTL 4YHZL 5IEHA 5IWLC 1JYXA 2LFGA 2VXQL 2P47B 3RDJA 2X88A 4XN5A 5F7HA 5IFAH 1WWWX 4H0GA 4I77H 5HDBE 4K4KA 4A7SA 4UF7C 4I18B 1GGUA 5DXWA 4RAUB 4XZ4A 1LLAA 3N40P 4QNPF 3QDMB 1KGCE 1WIOA 5B38G 1A9BA 3OSKA 1ZVHA 3CFJA 5FEBA 3VD9A 1L6XA 1EEZB 2PWEA 3BEWA 2FR4B 5KEZA 2BHZA 2EDXA 3G6AA 1OE1A 2X5PA 5B39G 3WEAA 1GYWA 1AGDA 4IOSD 3OVUB 4FKEA 2IGTA 2OMXB 3EYVB 3H85A 3I75B 4QHPA 5E4IA 4E9VA 5J6HA 1JNLL 4Y4FD 1AQMA 1S2EA 5ESQB 4C83B 3GXTA 2YBRA 1QSEA 2GSGA 3FL7A 3FHQA 4IEFA 4PRHA 3KEHA 3H3BC 2HPTA 2Q7YA 4FXGA 3NIDB 4IIQA 5DFVC 5T1MA 1EFXD 3C5SB 4QUOA 8FABB 1PX3A 2JB6B 3RY4A 2FX8L 2B3IA 2GJ6E 3O2WH 4W9JC 4IRZL 3U0PA 2KV3A 1QBML 3I50H 5C3LD 3RIFF 4N0RA 4O2CB 4G9FA 1R34A 3B43A 1ZD6A 2CR3A 4MDJA 5JO5A 4NJ9H 2SEBA 3HJEA 4Y2DA 1I7UB 5IFJB 3U9PL 5IW3A 1QWHA 3ABLB 1GZPA 4OU3A 1XCXA 1TJMA 4IRJC 4XBGA 3MV11 2BNUB 1U4FA 4PJ7F 3CFBB 1U8KA 4PJGE 3TP4A 4TUKL 4U6HB 3T2PA 4H25A 3DWTA 5DF0A 1MI5B 2VCOA 2HYMA 3MOAL 4IDLA 1ET5A 1U2YA 1E3FA 1S9WA 1ULVA 1ZWIB 2X4RB 2P5EE 5ES4B 1C12B 3U2SB 1HNFA 2BSCA 1J8SA 5C7XL 4H0IA 2XY1A 3V0GA 1M05B 1KOEA 4Z3JA 4LVHC 3MNWA 1BGXH 1X5HA 3SB3A 3RY6C 4FZ8L 1ZHKA 3R4DA 1M7IA 5JPMA 2WYTA 3ZTDC 1E4WL 2DLIA 2XWCA 3FB7A 3GUFA 5ILTH 1F02I 2HVKA 3ROLA 1AC6A 2Y1YA 1RZGA 3BP5B 3VI4B 4BQ9A 5KBPA 4GBXD 4J6MA 3MR9A 1CUOA 2BIHA 1E8ZA 3VQ1C 3V5HB 1RJYB 4BSVB 3OZ9H 3SKMB 4B9KC 3QORA 3K6IA 3QJHB 2AV7B 1RU9H 1S7TA 3QXTA 3LIZH 1F4WL 4NQXB 2AC0A 3D3VB 4S1SL 2WIIA 5DRZB 3S98A 4LPWA 3ECWA 5L9DL 4N2OA 1CF8L 1UURA 2WPGA 4I18C 3UZVB 3X13A 2KZKA 4R5VA 5IY5B 2GSIA 4JFED 4NHUA 4BFIA 3K6DA 4G5AA 3MNMA 5EZIH 3OC5A 5GQBA 1MIEL 2ED9A 3BI9X 3EGXB 4FNUA 3V55A 4RGMB 5K39B 5IB2B 3BP7B 4GLRH 1QACA 1QMUA 1X44A 5ICYA 1CDCA 3OR6A 1ASPA 3QNZA 3VXSA 4UQBA 4MS8C 1UM5L 2C9UA 2YGOA 3GPRD 4W6XB 3FT9A 1RTM1 5EZOL 4NQEE 2X2JA 1DY1A 4HUKB 1WAAF 3QDAA 4JB9L 1XCTA 4G71B 4GKZB 1HL5A 3BQUB 4QF1B 5C6TH 1LITA 1V54B 3FO9B 4HS6A 5AKTA 1IGCH 4LIQL 2ADYA 5ESVA 4ZFOB 5HYEA 1QFPA 1YEHH 1EBAA 4L3AA 2NRDA 2UY6B 3DXAD 3AS2A 4XVSL 4P23A 3QUKB 4JUTA 4HOMA 3H42H 2VDRH 1EO7A 2HFFB 1O7VA 25C8H 4MS6A 4NN5B 5IVZB 5EIQA 4U3SB 4XCCL 4L37B 5KG9A 3Q5TA 4PV1C 1KYUA 1UYWL 3QUMB 4NQDA 3SE4C 4ZX4A 3AU1A 4KH2A 4RMUA 4I0CC 2CIIA 4QR7A 4F3FA 3TT1H 1V27A 3ARYA 3KGUA 5J06A 4J6PA 4WF7A 3UBFA 1CE1H 1JFQH 2VL4A 3IBEA 4BBWA 4PJIF 1TYJA 2Q7AA 1V3KA 1HJBC 4KVCL 1T6VN 4KTGA 3L48A 3QS2A 4EN3A 5AW5B 3JTTB 4PP2B 3IM1A 5IHZA 1XGYH 4P4KD 1BPLB 1NJ9A 4DP1X 5E00B 2Q2EB 1YAIA 3HRZA 3UTSA 3QO1B 4L4TB 1O6TA 3VVWA 1OSPH 2HT4C 5C0BE 2ZX9A 1PNCA 3NCXA 3RIAF 2C4XA 1AZCA 1A3RL 4JAMA 1JE6A 1EJOH 4RGNE 4WI5A 1UA7A 1IFRA 2XG5A 3GBNL 3DTXB 3K1DA 4ZAKB 4YR6A 1EHKB 1XGUA 2VLRE 4QRTA 3I02A 4R4NC 4FLSA 4QRSA 5DUBA 5HHNB 3UTQB 1INDH 2YMOA 1OAKL 4K5MA 5AYUH 1JHLH 3B9KB 1Q9LA 1BQUA 1U41A 2VR3A 3TV3H 4DK6A 1C3AB 3RB7A 5F0PB 3MYJB 2EEFA 1FYTA 3BGAA 2G0LA 3I2CL 4PN6A 3A22A 5SWSA 4PEEA 4RGMC 3VFNA 5KTIA 4NBXB 1N26A 3H2PA 3WEOA 1AHKA 1WBZA 3C5ZB 4HQQH 2BVYA 3KVPA 4G7VH 4FYSA 5F9DC 1EHAA 1Q9WB 3FFCE 1A5FL 3DURB 3EHBD 4PJDE 1EFQA 2YJQA 4C55A 3GMMB 3RI5K 3HBGA 3O3EA 5CP3A 4IBWA 2PCFB 3QXDB 3MTRA 3BQUC 4NCC1 4OD3H 3TPUB 1DVSA 5EOQH 1CQKA 4FNRA 3RDTD 4NPYB 2H3NB 3BH9B 4OZGF 1SHXA 4LF3A 4XCEB 1QSFB 4FA6A 2HT2D 1CXLA 3W0WB 1J1OL 1UJTA 3HAEH 2JXMB 2AV1B 2PCYA 2X4SB 2BP8B 4W4OC 3TA3A 3SKJL 3ATBA 5HP5A 7CGTA 2P5WA 4I5BA 4AIZA 2OJEB 3M6DA 5FHAH 1SEQL 4BFBD 5ICZB 3WHXA 3CU7A 2XTSA 4F8TA 1KWUA 3BAYA 1T3FB 3ZIMA 4WWOA 4U33A 1EX0A 4PFEA 4NN5C 4AKOA 1EGIA 5KOVC 2LV4A 1JK8B 5CEZL 1JNNL 3MYZA 2IOMA 1BHGA 1BAWA 1KGIA 5KVDH 3HVNA 3O2DL 2NXZD 3O45B 2JCCE 5DJDB 1K5NB 4ERSL 1Y0LA 2B8OT 2YUVA 1YEKH 4UMSA 4XPBH 5KVFH 4FQ2L 5CU5A 3NCEB 2FECI 1CFQB 2EXWD 4JVPA 3EJSA 4YXKL 4PV8B 3QNYB 2KZBA 1YXKA 1A4AA 3SOBH 3WH2A 2E3XB 3T1FB 4M3KB 4QT5A 5BO1H 4RA0C 4ZYKB 2Y7LA 3UP1A 1SY6H 1NUFA 4RAVB 4LHUD 4HS8L 3BJLA 4R7LA 1P5UA 3VXNA 4QNPE 5C2UB 3S4SB 4QPEA 5LLIC 5E8NB 4NZTH 5E7BA 2YD7A 4NO0D 3SY6A 3FU8A 5J7CC 5DJYB 3WL9B 1ZJBA 2PPEA 2HKFL 1P0SE 3MU3A 4LCWD 4ZAKC 4X4YB 1OSEA 1KEGL 3K1KC 4S1DC 4E2OA 1T1ZB 1AYRA 1OM3L 3QQ9C 3MV9D 5TE6L 2ZAGA 5DUPH 3EJUA 1UB6B 3EADA 4R0LB 2OX9A 1SN2A 3L4XA 2PP7A 3B9KC 2C3WA 4ODBD 1B4RA 1ODAA 3HB3B 4G6KH 4M93B 1MCKA 1I3VA 2IANB 1C08A 1XAKA 4KVPA 1NC4D 1BVLA 2R1XB 4XWGL 1JPGA 3C5ZC 3DTUB 1KDJA 5TD4A 4F8NA 4PLNC 5JW3H 3HG2A 4LDCA 1AD9A 3NAAL 1F11B 1YY8A 1XH2A 4MQSB 5I5JA 4E9XA 4OD1H 3MRBA 4QRBA 2ESVB 2X42A 2VQTA 5HJ3A 1TQVA 2WZ0A 1OT2A 3WFZA 2CXKA 3VPPA 1W8EA 3VFVA 4OF0A 4PBVC 4IU3A 4KJYB 4DP6X 3KDPB 3ARFD 4UT9H 4K8RC 5MEPB 1OGAE 4NHCH 4MSWA 3F7LA 3TZVA 3C6SA 5HDQL 3QFJD 3QA3B 4FG0A 4OF6A 1RZ7L 2Q3XA 1U6AH 2F53D 3FTWA 4PI0A 2NY0D 2CJ3A 2MCAA 4BKSC 2BIMA 3N1GC 1BQHA 1QWNA 5F7AA 1UADC 1CN4A 1UH2A 2Y36L 1DJWA 3IDJA 2OX5B 1A7PL 4XPTL 3TBTB 3GF8A 3ABZA 4JFUA 4IM8A 4QDGA 5EN2B 3ME0A 4MMZA 4I2XA 3TT3L 4AIXA 5I1AA 4AXWB 4L8BA 4OZFA 4YS4A 2P4AB 1YXJA 2XKNA 1MCLA 2FHCA 5KS9F 5LKNA 2E4TA 3PGCB 1V55B 5JOFA 4MKTA 3M7FB 4RLDA 2WXNA 5F93C 3WBQA 1WUZA 2CCLA 2CA3A 4PP1D 2BK8A 2NW2B 1MLBB 4QTHB 1R24A 1W9XA 4WKXA 4ZW3A 3L95B 3BFOA 4YGVA 2E3XC 3RWJA 3V4PB 1J5HA 1XMEB 4OZ4B 4ODUB 1PSKL 1KJ2L 1P4IH 2CJUH 3PLYA 5ABDE 1A1NB 2WKOA 4IBVA 3PJSB 4FG6C 1AGCA 4MXWL 2H1PL 1IM9A 2GEEA 2VISA 1N0LB 1VADB 4I9XA 2FWOA 1YEJH 2VZVA 2O5XH 1J8HE 4JVUA 3RILA 4OM1H 4G70B 2A99A 5B8CA 2VIRA 1T83C 3VLGA 4ODSH 3QUGA 4R0LC 2Y22A 3DX6A 2FJUB 3ZMEA 4PGBB 3WMPA 5J6GG 3HLAB 3V0VA 4PGEA 3HB3C 1WAAE 2WVSA 4Z7VF 2D03H 4M93C 3QDJB 3ULSA 2I60H 3NYKA 3Q1SH 3IETA 1JGEA 5CLXA 1UCBL 5IMKA 2CRYA 4PJ5B 5EZJA 1SQ2N 3MRFA 3GIVA 4PJCB 3NCFB 5DGQA 2KMB1 3V5KB 4AV4A 3B37A 4N5UA 5A3ID 4TSAH 1SL5A 2XBDA 4GUQA 3FU7A 3I6KB 1P1VA 3OJDA 3ISYA 2G30A 4KMLB 5HYJD 1GAFH 1FIGL 4XO3A 1Q0XH 5IEKA 4KOCA 4YHOH 3N6YA 2HWZL 3DROB 3LQAC 4K3JL 2IEPA 3BGFB 2ICEA 3D4YA 1AZBA 4WK4B 2HP4A 3K74B 4LSRL 1OWRM 5EBGA 3NRPA 1KXVC 1U42A 2XXGA 5IK3A 3U9UB 1AGFB 3O3AA 2PTTB 4PB9L 1BFOB 1NGZA 3O4LB 5JW5A 1SEBB 2BNRB 1TZAA 3ESVF 4XPHH 1DLHB 4ZO8A 4LLYB 3AS3A 4UUJA 3VUAA 2V5SA 1MJ7L 1UV0A 3VFMA 4A2LA 1MJUL 1U91A 4AYMC 4JEGB 2XCMC 2YXVA 3I9AA 3HG1B 4EIBA 3QUZD 5AG8A 5JMOC 5IGXL 2ZWLT 5HJDA 1R9FA 4AGNA 4MJ2A 3OZKA 2JJUA 1R3LA 3KNBB 3TH2T 4R7DA 4JPVL 3OG6B 4RWYL 3BRGC 3OKLA 3TO4D 1OF2B 1OK0A 4HK3N 4MASA 2WK2A 3FQNA 4AMKL 1P6FA 2CRIA 1N67A 1IO4C 3HKFA 5IB4B 2O4EA 3MODL 3F01A 4ZZKA 3CDFA 1KIQB 4GRWF 1VZHA 2VDQL 3NEEA 3BE1H 2QQNL 4J1UA 5H4ZA 3S37L 1IC5L 3DOIA 3NFNB 3CLEL 3BUQA 1OT4A 1YPZB 4AG4H 1JPSL 2OCJA 3DK2A 1OB1B 1P5VB 2IAMA 3KDMA 1T1YB 3OKYA 4X42A 2YPLA 4RWHA 4AENB 2AEQH 1J18A 3ETBF 4ZDHA 3ENEA 4G6ML 2YKLL 1HTNA 1BG9A 3SJVA 2G2RB 4XB7A 2DH2A 5E6ZA 1R13A 3CBJB 1CD1A 4QHNB 4XP6L 3A6CH 3FF7C 4JBSA 3B7SA 1YAZA 4QJ4B 5E8EB 3WGUB 1T6BX 2OK0H 4CGUB 2ZUQB 2XQYK 4AVKA 4KNQA 3DJZA 1AI1H 3NZ8B 2ZOKA 5FGCE 4OZGE 4X9BA 5D7KD 4TVPL 3K6SA 1V10A 3GHBL 3HPJA 2Q3AA 5DS8A 1G9MH 1IC0A 4NGHH 3RG1C 3LD8B 3KL3A 1I7ZA 5D7EA 3PABB 1ZOXA 5JLZA 4CN6A 4JKKA 5C0DA 4Q89A 1RDL1 5HD8D 3Q2LA 2BPBA 4NQUA 2WBJB 1MCNA 3QIWB 4J8RB 1LD9A 2QDVA 4NQCB 4F5CA 1AMXA 4PMEA 1MREL 1WSST 2X0VA 3IFPB 3KGSA 3OLEA 3FN9A 5DD0L 4A6YB 1PZBA 3IJHA 4WGWB 3BGFC 5CLZA 3NCJL 2ALWA 2GC7C 4AQ8C 4JFEE 1BBDL 4J3OG 3D4CA 3AADB 2AQPA 4FMFA 4GNKB 2DDQH 5EFIA 1YCSA 2OJ1A 3I6LE 1JK9A 5CWSA 2HTKC 5GGRA 2O5ZL 3NRQA 3DX7B 5E99L 3T0XA 1S7SB 2KHAA 3L3DA 5F7FA 4ZJ9A 1QX1A 2P24B 2DBLL 3L3JB 1FYHB 3L2MA 4E41A 3X1BA 2B77A 2VDRB 4DZ8B 1HDMA 1EAPB 4HCRL 4N20A 5GGUA 2ITFA 5TQ0L 3VXQB 1DQLL 2WWKT 1XX9C 1BFSA 1N10A 4P5KB 5T1LB 5I0WA 5K9QG 1T5XA 5CZVH 4EI5D 1B4JH 2LU3A 2K6YA 1HL9A 1O9WA 2V3FA 4TVUA 4A39A 3NN8B 1IAMA 1L7IL 4DKDC 5E6SB 2K0RA 1MW3A 2J43A 3NQIA 3P4OB 4A1RA 1UH3A 4LKCA 4PJBB 3GMLB 3DJRA 1XO8A 1E27A 2V5RA 3PDDA 2E9WA 2MCPH 1MWOA 1UG9A 2Q6WA 3QEUA 1U92A 2G2NA 1T0MB 1J10A 2F68X 2X09A 4X6DA 4GAGH 5KYNA 5KVGL 4G72B 3VGFA 3TNMB 5C0JA 5BVPH 5EA0H 2IOIA 5LWYH 1GRWA 5IJBC 4H88H 3ROOA 1LK2B 2X7LB 2UZYA 4NUQA 4WI7A 3G9VA 1HSAB 2L8AA 3FB8B 4X7FC 4ZMXA 5I76A 5IJDC 4YE4L 3TBVA 4APQB 3UZQB 5T3ZH 4DOHB 3KHOA 5TDOA 3H1ZA 2XZAH 2IPTL 5FW8A 5IW6A 4P48A 3MLPA 5ABZA 3LRKA 3QXVA 4UTBL 4WWID 1U8LB 2ZUQC 4XVOA 5DJ6B 2IC2A 1K8DB 5FUOH 5EU4B 4G8AC 3MLRH 5DHYA 1LMIA 3N9GH 3K3QA 1BFTA 3D30A 5HGDB 1O9ZA 4MJID 4ZX6A 3VW3L 1BLNA 4NXKA 5GGQL 3AQZA 5GS1B 2H8PA 3LD8C 2PYFA 4UU9B 3RI5F 2FSDA 1QEXA 1ZVYA 5IUSA 3GO1L 1U8OB 3AWFA 3PAQA 4AYFB 3T04D 4LGPB 2I69A 1CBVH 5DT1H 3FT3B 2VSKB 2R1WB 2WBJC 4L1TA 3QIWC 2AAAA 4L48A 3KYNA 1MCIA 2AEPH 2W0KA 4Q2ZB 2FWSA 4M6MH 1J1PH 1XF2B 2OTWA 3ABMB 5A2AA 3D85D 2W60A 1IBHA 3JUYA 5HHQA 1I8KA 1A2YA 5KS9E 1PCXA 2V6HA 3OV6A 1RZPA 3WIFB 4R83A 2NY7H 3FCTB 1ZVSB 1BVNP 2HCZX 2QKIA 4QY8A 5J6SA 3WKML 3GSRA 3CMOH 4EKXA 2G3ZA 1IBYA 3PL6A 4K3EL 2MOGA 3P69A 1GC1H 4WEBL 4ZFOL 3KWTA 3W9DB 4CVWA 1H3PL 1XB6A 1NUNB 1SXBA 2J6WA 4DQOL 5JHDD 4M8QA 4K7PH 4DT2A 4I4WB 4PJHF 3UOAB 1S5IH 1PG7H 3V0JA 1IODA 4M61A 2GFBA 1NTDA 5K33A 4WW2B 1FN4B 1KLFA 3AQXA 3AAZB 1DEEA 1XSJA 1X5MA 1THAA 2HT3D 4MDIA 3E1ZA 4K3GA 1JXJA 5IROD 1VGEL 3LSOA 4ORGA 1KCKA 5BRZB 1YMMD 3D34A 1BCIA 5ERWB 3U7AA 4QGYA 2CPCA 4HPHA 1W2KT 3FUIA 2F54A 4TULL 5FUCE 3MJ7B 1A22B 4G8IA 5F3BA 5J9PB 1R1CA 4J3WA 4ZUVB 2P80A 1NCTA 5I8OL 5DRXA 5TQ2L 2XN9A 3P3RA 4Z7VE 3TJEL 1GZQA 3KS0H 3PPEA 3TYFB 3WS3B 3WKNA 3MOQA 5E08H 5DI8A 3UAJC 4JPIB 3PHOB 4M6NH 5D7LA 3CFNA 5A2CA 4Q0XL 3AG2B 1S9XA 4APQC 5JIMA 4B9IA 4WR9A 4LEEA 2W95A 1AFVL 4K94H 4PB0L 1RLBA 5EUOE 1QFHA 3WEXA 3KLQA 1KCRL 4HAKA 2C3VB 4KUCD 5JXEA 3CHRA 2WWKO 4BWUA 2KI6A 5KBDA 5GISH 4AYBA 3UADA 3TTYA 5F96H 1N8ZA 1BV8A 5GS1C 4OZFG 1WCBB 3G5XB 4HFUL 1JAEA 2D7TL 4QWWD 3PDOA 3D08A 4P2OB 5C07B 1CDJA 1TZGL 5E24E 2LABA 3L7FA 1BWMA 4EF3A 5C09D 2UZXB 5EWIL 2D7PA 3CFEA 3AT8A 1KXQA 4JE0A 3Q2CA 4LCWE 2X4PB 4HWUA 5BQ7B 5DJZB 4F7MA 3EO1B 3MV9E 2ZUUA 2WYZA 1NUGA 12E8L 1KMGA 1E28A 1UGKA 1ZT4B 4LHUG 1FDLL 4N0UE 5EOTA 3IMBA 1EGJL 4ABUA 1SJEA 2FATL 1FZMB 5E56A 5IFHH 2DMGA 2E0PA 4C16A 1I7RA 4K8RL 1FNLA 4G8GA 4HFWB 4NC1C 5I6XB 1B0IA 4GP5B 2VDNB 5EORL 5K9QI 2V37A 4YC2B 3PS6A 3VMNA 3BWAB 3VDBA 1PDKB 4GRWE 1OQOA 4KKQA 1P2CB 4GUPA 4O2FB 1AGBB 1NFKA 1MHCB 2WLHA 1S8DA 1EHNA 2XHNA 3A23A 2BFVH 4QHMA 4WW2C 2RD0A 2EYTA 2X41A 5GSRB 5JW4Q 4ZD3H 1RUQH 4UB0H 1T66D 2J72A 1F3RB 2F53E 2GC4C 2AJUH 4PUBL 5CJQH 4YXLH 3RVUC 3T77B 3ZL1A 1H8UA 1NEZG 5G4NA 4IU2A 4R7NB 3FB5B 4PY7B 1R3IH 5E9DD 3NP3A 5D55A 4PGJA 2OP4H 2XI9A 3DGDA 1WFUA 3MKKA 4P9MH 2DN7A 5J89A 2FNBA 4MD5B 5CJOL 4GQQA 3HFMH 5EIIB 2OPCA 4CC4C 1A64A 4FQ1H 4B27A 1V4LB 3ESOA 4KO6A 1GS7A 4OIAA 3RIKA 4S0HA 4KY1L 4WUUE 3O6FB 4P3CH 3DLQR 4TNWK 3BUIA 1GZHA 4MYPA 2AQ3A 3NJMA 4CNIA 3DVGA 1K2DB 5E0QA 4LK4A 2WSDA 4PS7A 4X9YA 4XNAA 4DP5X 4L1HA 3OQ3B 1H19A 2GTZB 2BSSA 1GH7A 4NM8H 2BY2A 4BFKA 3QUYB 4QRPA 1JVKA 1T1XB 3ARGB 3MO1B 1KT2B 3H9YA 4K5LA 4P2OC 4M7LL 1E4KC 2Y07H 3BAIA 2COQA 4XCYB 1FAIH 4A7VA 1D5BA 6PCYA 3RAJL 3L3OA 3PCYA 2AK1L 3BP6B 3R06A 4L3ED 3GUTB 1G7LB 3EFOB 1M7UA 1VACB 3LYRA 4CSTA 1MFCH 4M7JH 5AZ2L 4WO4A 4FYRA 2Z35A 4L1BA 2CUAA 4KAQL 4DN4H 1E30A 4K5PA 1G7PB 5I1DA 1CICA 1NAMB 3WXWH 5LXGH 3BSZA 1LXMA 4LRIC 1ZA3B 2XPGB 3VXUA 1U36A 3N3EA 4U49A 3WH3A 4JM0A 1TZIA 3QRBA 3B34A 3BWZA 2Z0UA 3AMKA 4AV5A 3F7YA 4L3FA 4U6VH 1S7RB 4Y16B 5DMIH 2V8LA 5CD5D 5I6XC 4OCRH 5I0XA 5AL8A 4ACPA 4N28A 4YC2C 3LQAL 3RX7A 1OZ7B 4HLEA 1GYCA 3F6IA 5HYSG 4YHPB 1SL6A 4JZJA 2APXA 2DQ6A 1H6UA 5I8CB 5KW9H 1M42A 1VSCA 5HYJE 4K3DH 4FQJL 4FFWD 1PZ5A 4KUCF 4LCYB 3VSTA 3G7TA 4XP4H 4N35A 1R6VA 1WWCA 3DOSB 2DI9A 1EHLH 1FBIL 3OKKB 2CQVA 5FO9A 4LU5A 3KPSA 4JY6B 3PG2A 4FA7B 4K71B 1NANI 1CVSC 3CDZA 2XWDA 3IDXH 1IC7L 5EV7A 1XWVA 1ZCRA 3BIBX 2Z8RA 3MFFB 2CXGA 3B1UA 5H37G 5A2KH 3P54A 4KK9C 5FCUH 3PXJA 3RVWC 1TEYA 5AVVB 4Y0GA 2UVFA 3TJHD 4BA8A 3KPPB 4POUB 3HG5A 5CFHA 3BVVA 3MLTB 3KWVA 1T4WA 2BNQD 3PIQA 3ARTA 3IVKB 4KXAA 2FCBA 1G6RB 4DIXA 5ISZB 3C8HA 4X8XA 1A14L 3WFEH 1MWAB 1KULA 3IFLH 2R83A 1AD0B 1ZHNA 3CUPA 2VC2B 4YAQA 2OA9A 2R56H 3EKCA 1DJSA 5CCHE 3O6FC 3PU7A 2OXGA 1UWEL 4M1CD 2RFXB 4U6YA 4OAWB 5A7EA 4Y1AB 5L88H 5D1QB 2RIBA 3EYSH 5EZPA 1IGJB 1VEOA 3U82B 4J27A 1A4JB 1M1XA 3LN5A 2FT6A 1S4IA 1N5AA 4ONHA 5EU3B 3QJOA 1GGTA 2RQEA 1IJ9A 4MNQA 3ARGC 1U2HA 3DVNB 4B9JA 4N2FA 3RVVD 3ABGA 2B9BA 3TBWA 1HHIB 4MB3A 3JVGC 3VXRD 2JLPA 2X4QB 4P3DA 4U2YA 2DLFH 5I26A 1KBGH 1N0XL 1WV7T 4GQ9L 4IMKC 4UT7H 3HR6A 3QS3A 2Q8AL 1BAGA 3ZE0E 3ZMRA 5HGHB 1BPVA 4J4PA 2XX0A 2YO3A 3MBEB 1WTGT 5CIPB 4M8VA 3UBUB 1Z3GH 4HU2A 4PJHE 1TQTA 5CU9A 3ZZQA 1KZYA 4Q6IA 2X2UA 3HS0A 4NPJA 3KXFD 4NX0A 5CJ8A 3TX4A 4PW4A 4MJ6B 2ZOLB 1OXYA 2DQEH 5CD3B 1JF1A 5D7KE 1PLGH 5H8DA 3WD5L 3BMVA 1OCOB 4RETB 4O5LH 4J3UA 4QOKB 1D5MB 2C9SA 4F93B 3V8OA 2IMMA 2A9MH 4OZHA 2DEXX 1OTSC 1TFHA 4P9HH 4UM9A 1WICA 4XBPB 1PKQB 4KV5F 1QLRA 1PY0A 1HT6A 3GK8L 3D2UD 1JZ8A 4YIQB 2XBTA 2OMYA 3IKRA 1X5GA 1I4FA 4A2EA 3MJ8B 3QPXL 4FNQA 4CU7A 3JYBA 1F3JA 1KG0A 5F7KC 1DO6A 5MP6L 5JPNB 1JMXA 4K71C 5JUEH 3QRGL 4POZD 3L3IA 3SDDB 4ANVA 1B2WH 4J3VA 5SWQB 2ENJA 1RMFH 3CZLA 1LO4H 3E6HA 1F4YH 2E6QA 2FJGA 4J28A 3OXSA 1LP9B 3LMJH 3UYRH 2EKSA 2IGLA 1CDHA 2C4FT 3BKYH 4FQHB 4DGVL 1BCJ1 3ZKNC 4IBZA 1SJVA 5KN5A 3P30H 3QQ3B 4LVOB 4WHCA 4GAFB 2YUWA 1RP9A 1UVQB 3WNKA 1YYML 4XNYH 1KN2L 1F00I 5K9JL 2WCGA 3IJSA 3L17A 1JGDA 1E4XL 4XCFL 5E6RB 5ICXB 4YPJA 3ATDA 3BZEA 3CFDB 5HDBB 1PJWA 3PNRB 2YOAA 2ZKHH 4WFED 1AR1B 2DI7A 1RFDH 3NH7L 1J5CA 2YXWA 3BPCA 2HKAA 3BQVA 2BXZA 2H0EA 1CDIA 3PP4L 5D1QC 1C5CL 1CLZL 3CQQA 1CFBA 3GMRA 2DKMA 4F7CB 5F44A 3ARDB 3KD4A 3V0FA 4X7CC 1R5WB 4TPRH 3U1SL 2Y9RT 3JWNG 5E6UB 2HSIA 4Y1TA 5F6HJ 1RURL 4UCFA 5DRNB 5IB5B 4ZNCD 2GJ6B 3P3YA 2Q3ZA 3O41A 4RZCB 4OB5H 4TNVF 2VO8A 1KB5A 1XEUA 3PBFA 3MBEC 3EH3B 2L7QA 2O30A 3LDBB 4PG2C 4HHAB 1WFMA 1P7QB 2AVFA 5GHWH 2ZE0A 3ZRFC 2CDFB 1QI4A 3IXAB 2VRQA 1JWIB 2FK9A 1KB3A 1EJ6A 5FIEA 2WQRA 4PJGB 3AXHA 3UG5A 1BZ9B 2W0FB 3GTVA 1XIWA 5IJCC 5I1LA 1GOHA 4YLBA 4RIRA 2UX7A 4YZWA 3NCCB 3MA9H 5B1BB 4AITA 3WFBH 1U8IA 4X4XB 2P5EB 3LPOA 2CDEB 3TEWA 2VLJA 3BFWA 1PYWA 2R51A 4X80L 1DUZB 3VRIB 3EO9L 4G82A 2Z92B 1ACYH 1YQVL 5BS0A 1H3XA 3Q0HA 2FX7L 2EJ1A 4CVZB 5JPNC 3DSNB 2Y5EA 4DF9A 2F08A 5I75B 4M6AA 2VSDA 4O00A 4OKDA 2ZPKL 3EO0B 5LXVA 3QSKB 5JIDA 5FB8B 2Z0BA 3SQBA 4JUSA 5DVOA 2ZSWB 3FRUB 4WVRA 4O58H 4JCMA 4HW6A 1UUSA 1XD1A 4ETQB 1F4XL 5C9JA 2WUBL 3QULA 1FFOB 2G5BA 4LVOC 5JHDE 3KPRA 2CGZA 5CSBA 3B3BA 4X8JA 4GRLB 3DPBA 2R7EA 1RLWA 3MRCB 4ZSOE 2ZAIA 2A9BA 5KUMA 3UO1H 4A2MA 1AR1C 1L9PA 4C8XA 5BV7B 4NENA 5KYWA 4QXTB 4MA3B 2I9TA 3QFDB 5CGBA 3ZTJG 4FZEH 2CH8A 4J3OH 4MWFA 2JNZA 3FT2B 4UV7L 2OMZA 3QQ4A 1K4DB 5IBLD 2VN3A 1J34B 4BZ2A 1YMME 3ARDC 4K15A 4JFHD 2OW6A 3ARBA 3UC0H 1XTLA 3RUGF 4CN1A 4GMSH 4W93A 1SQMA 1HI6A 3HOGA 2AQ1A 1KPUB 2RMNA 2XT1B 4PRAA 3T2QA 1WBYB 1BWWA 2FLRT 1AJ7L 1KBWA 2N0MA 5A1AA 3MZGB 4RDBA 4J2QA 1XFPA 4LCUB 1HH9A 5K1VA 1SFDA 2VXVH 2A73B 5DRWA 1DVQA 3TGXA 5IV2A 1E67A 4EIZC 2V3DA 2XZQH 2X9WA 3LDBC 1SYSA 5G4MA 2H5UA 2H47C 2ZTBA 4GAAA 3MRKB 1G1YA 2VR7A 2BIQA 4X99B 3O6LH 4E5XA 1O6SB 2VDPH 4JPKL 1UOLA 1F1AA 1I3GL 1CGXA 5TTRA 2LGNA 4UIMA 1YC7A 3FUDA 1E8WA 2CLVB 1MFBH 4IJTA 3WNNA 4E9TA 5F7BA 3TBCA 2AXWA 2KZWA 4YFLF 3TN0A 5HDOA 5E4OA 1VZIA 5C09E 1T7ZA 3IMUA 3FUKA 2VR6A 3BIKB 1T20B 1EEYB 2EDTA 3FTXA 3NZHH 4XNXH 3UBXA 5E2WL 3MRMA 3N2JA 3TONA 4F8PA 5JIPA 5I1JH 2BSEA 2NZ1A 1NMAH 3PWLA 3BKCH 3TC9A 3V4VB 4GXFA 1CR9H 3GRBA 3SGEI 1DHKA 2W94A 5DZPA 4HPYL 5FFTA 1G5GA 2DQJH 4HJJH 1INQB 1M57B 4FTVD 2AANA 2XKUA 4Q9RH 3C60B 5JNYB 2JKLA 5D6DC 5C0BB 1HXYB 2WOYA 4LBEB 2WY3B 2CMRL 2Z4TA 4B6ZA 4PD4J 4O02A 4UMGA 1WJ3A 3VACA 3VFTA 3WY2A 4RGNB 1T03H 1DDHB 2N59A 1DL7L 4G80A 2BSTB 4QTIL 1WLHA 5AUMA 5K59F 4OLWH 4PCYA 3VTMA 1NH6A 1YSOA 2WINA 3WMSA 3HC3L 4GRLC 5GXBB 5CEYA 1U8HB 2ZWSA 3OTTA 1QQDA 3KLLA 3TO2A 5BV7C 1PZSA 3MROA 1NDMB 2I24N 2ORJA 4C56A 1CPUA 3QP3A 1KZB1 2PYEA 4HG4K 4P05A 3NJHA 1MCWW 1BDYA 2R2BA 3HMXL 3N44B 1I1AD 3FFDA 4OGQC 4W6WB 3D39A 2QBWA 3WXVL 2Q10A 2HG5A 3FFCB 4LARH 1V7PB 4NWTH 4O02L 4PJDB 4GXVH 2XXMB 1IM3D 4D0BB 3KCWA 3AU0A 1GOFA 2EUWA 1DTUA 4I3RH 4G42B 4KROD 1FFTB 1PG7X 2AJSL 3K72A 5DK3A 1XF4A 2GQHA 5IR1B 1ROCA 2XR5A 1VZGA 1UT2A 1DR9A 3OLIA 4YSDA 5TK2A 2ID5A 3BVNA 2Z7YA 1QEWB 2Z34A 2E4FA 2IWFA 4OFYA 1RZJC 4I3SH 3GSWA 3K2MC 4ABWA 4KV5E 4L4VA 3WHE0 5I8EB 4FHBD 4ZPVB 3FN0H 1P6WA 3DETD 5D72H 1QKZL 4NQDD 1QTSA 1WD8A 4XE0A 3VWKA 1HX0A 5AFAA 1I7TB 1T8DA 1S7UB 2QMKA 2EH8H 3KVDD 3C5JB 1A1MA 3DV6A 4FL4B 4J23A 4PV9B 3QUXB 3PXHA 4P57B 3F58H 5CHNA 5IQ9B 1B0RA 1L6ZA 3WCYA 2HTLC 4KTDL 2OMUB 4XC1L 3B5GA 3HE6D 3FRPB 4HJ0D 3R7RA 3TM6A 1G4RA 1R33A 2JCCB 1P1ZA 4BWTA 3LIUA 2WLYA 2NCEA 1FG2B 2RA1A 3G5YB 3HI5H 1ZAGA 4I0PA 4Z76B 1N7MH 4L3EE 3N85H 4G9DA 4P59L 4V1DA 1MVYA 3FULA 1JXDA 4DP2X 3QG7L 4M03A 3IN0A 4KKBC 3CC5B 3V4UL 1ZHLB 4TUOA 5CZKA 4M7ZB 1XF5B 2IH1A 2NX5E 3EGDB 2FYVA 2QGDA 1DBBH 5KSBF 3C60C 1MPAH 1U4EA 3FOLA 3WJMA 4WLCA 1CFSB 3PWPA 1DSYA 4OZFH 4RX4D 1FI8C 3B3IB 4RGNC 3QIUB 2A9NH 3MRJA 4WAFA 3VFWB 3VSUA 1WZLA 4JLRB 4X5QA 1YN7A 2WYIA 3DRTB 5F88A 1RDK1 1ZS8B 1UJ3B 4CAJA 5AALA 3HCVB 3QCTL 5FLVA 1FYTD 3S5YA 1ZLUK 4YSSA 2D9QB 2WXJA 1FP5A 3P4MA 1V5JA 4U3XA 5FGBA 5SWSD 3TBYA 2D3JA 5GRUH 1QZ1A 2W5PA 4NFBA 1LEKB 3PNWA 2VZOA 1MHHA 1UM6H 5B7FA 3V6FB 3NUKA 4FXLA 2FZ3B 4FYQA 1G9NC 3SE9L 5GJTL 1BZ7B 5CEZD 2G4EA 2XWTA 4PJ8D 1PTZA 5F2FA 4ZFQA 4XGZB 1FVDA 5KVEL 3S88H 1QFWL 3NG5A 2R39A 3CFWA 4YO0B 5D7HA 1LE9B 3MNDA 4PRPD 3OR7A 1AXSB 4Y4HB 3B6SA 1G5AA 1Z5LA 4KQ0A 1YZZA 4BH8B 3QJUB 1OGAB 2P5WD 2JJVA 2XY2A 1HFUA 3BESR 2ZOOA 3S8FB 1NMBH 1VFBB 1O9VA 4OLYH 1RVFH 4FJZA 3ETTA 3QQDB 2BY3A 1UFUA 2XJLA 3WDJA 1JPFA 3BEVA 4GKNB 4PTUA 3NSFA 4XZUA 3L1OL 2IQAA 4BUQA 3NFPA 2F8OA 2HRGA 2XG4A 5ADPH 2AS5M 5TDPB 5C08E 3CN1A 4JR9H 1WE5A 2CIKB 4YHLL 4HEPA 4FL4C 5TE4H 2JWYA 5F97E 1IZJA 3PHSA 3QUXC 1RK0B 4UV4L 5BO0D 1K85A 3G08B 1NC2B 5DC4B 2XNAA 3BXNB 4MCZB 1J35B 5DQ9A 4HJGA 1NAML 2H7WA 4WWKD 4DUVA 1KMB1 1MUJB 4X6EA 3TV8A 4XBEL 3C6EA 3VXRE 4AZ8A 5E7FA 2XX1A 1ASOA 2PTVA 3RWGA 2VRPB 4G5ZL 2Y7QA 3NCYS 1U8CA 1CXHA 1KCVL 4DJMA 4LCIL 1BVZA 2E8YA 3GKWL 2WXHA 3IJEB 2MQCA 4KUZH 4U6XB 3LZQA 1BBJB 3PAZA 1F4AA 4F20A 4DP8X 1QBAA 3B2VH 4CKVX 4M7ZC 4MA8L 4UBDC 4KX8A 3KXFE 2OAAA 5J6GB 4KK5C 4HJTA 1YTTA 3MMEA 4M43H 1HL8A 4Y5VB 1JWMB 4JG0H 4LQ1A 4OV6F 5ESAA 3VD1A 4RZKA 4Z95H 4TLUA 3PYCA 3QIUC 4AMWA 3M88A 1O7BT 5I1HL 3SGKA 4WREA 3AY4A 3RJDA 2GPZA 1J8HB 2X1PA 5K9OB 2MQ3A 1UJ3C 2YPKA 1DUYB 5F3HA 5LNDA 3IKPA 1BXUA 4N2AA 3RUGE 2DLTA 2CR6A 5AL0A 1B0WA 3FQRB 5E94A 2FEEI 3IS0X 3O3DB 4ZUUA 4G9AA 1ZLWK 4G8EB 4LO9A 5AVZB 2YD1A 3P9WB 5B7MA 1KF9B 3VD3A 4HWEL 5I6LA 5KTEL 5E95B 1G6RL 4WV1B 3L5XL 2OQJA 1G94A 4JFDA 3HZ3A 3MNVA 1F58L 4WTXA 4Y7OC 1YNTA 4DVBA 2Y6SD 1NEPA 2AJZB 3SYAA 4Y4HC 3B8YA 4GSDL 4AJYV 3H3PH 2J73A 2BVOB 3ORJA 1I8IA 1AXIB 3O2VH 2QVTA 5I1GH 3G81A 1KCWA 3UJIL 1GA2A 3NPZB 5DA4A 5HI4D 4YH6A 3BMWA 4OCLC 4FQQA 1CO1A 2B59A 2XETA 3EJYC 5B1KA 1DJGA 2ZICA 4AYID 1E8XA 1CT8B 2QSQA 4B9YA 3WSQH 1WS7A 2WKGA 5JA8B 1NCJA 2E7LC 4PJIB 4DTGH 3UTTA 1QD0A 4NNXA 2IALB 5DK0A 3D0AA 1M2OA 3T71A 4XXWA 1FORH 3NJXA 1R0AL 3NJIA 5EU6A 3DV4A 2KT6A 2ORKA 4PTTB 4IQHA 1KFAL 4XO8A 4OGYL 3O8XA 2DIEA 1EFXB 1RK7A 1IVLA 3QHZL 4JDEB 4TM9A 4C58B 3VGDA 1GGIH 4P5TA 1WQVT 1KXTB 4JCWA 4QHKJ 4ZG1A 2E76C 1L5GB 3KPMB 3LEYL 1T1WA 2TSAA 2G5UA 2HFEA 3AS1A 1NM4A 5K59E 1YHPA 4MD0B 1IM9D 1PZCA 1GPOH 5IG7A 4Y5YB 3MX0B 5IB3B 43CAB 2F1AA 3FUMA 2ATKA 4L5FH 2VE6A 1ZTXL 1JZGA 5D7JA 4Y5VC 5H94B 2A6JB 4ODTH 3K7BA 1AIFA 1ZLWH 1X5XA 1ZK9A 2JB5H 4H44C 3SPVA 5ACLA 2DWEB 5DSCA 1JGUH 1XR8B 2PO6B 1TLKA 4JY5H 3A67L 5I18H 3T6ZA 1A9VA 2QLVB 1UTDA 4ATTA 1LJMA 3T8VA 3KWWA 3RNKB 5J3HD 1E6JH 1MRFL 2EZ0C 2XV3A 3FHAA 1KIRB 4WI6A 5MEQB 1KTJA 3F7VB 5CR8A 3TIEB 2W92A 1N3NA 4FQPA 5FGCB 4OZGB 4QAMB 3GHPA 3ZZ1A 3KPOB 4WV1C 3ZO9A 3ZKXB 1SMDA 1RZIB 4GBXB 3UC2A 4QHUA 3TBSB 4JJHA 2FEJA 5LBSA 2FJFB 4M1GL 3S36H 1YJDH 3KLKA 4X0KB 1INEH 3DYMA 2G60L 2H3KA 4R7VA 4YFDB 4ORZC 2WXPA 2XOTA 4IRJD 2ARJB 3II1A 4F7KA 2CKBH 5IBTL 3RL2A 1YNLL 4JFFD 4FP8L 2G4GA 3DKHA 4BELD 3CVHA 2P43B 4PI2A 2NTFB 1SBSL 1C9SA 1L9SA 3EJCA 3DX8B 3FK3A 3S3BB 1IQWL 4JFEB 2RCSL 1MAJA 5F9JB 1LVEA 2FTAA 1RIVH 2ZIDA 1FRGL 3VFGH 3LH2H 1HINL 3IF1B 5K69A 1QUPA 3I6GA 3NGBC 3WS6A 5I28A 3EFDL 4HPOH 4EN2A 1S6NA 2BFGA 5I6PA 1A9EB 2BP0A 3GRWH 4EUPB 3MXVL 5T5FA 4GKSA 5AW1B 2H2TB 3V0WL 2YHFA 4ISVA 1LE5A 4PJ6A 3W82A 3GPRB 1KTLB 1CG9B 4QHLB 3GIZH 4XVTL 2FO8A 3FYEB 4HGWB 1ORSB 5IWLA 4HUMB 3GLZA 2FT8A 5KSBE 1E5BA 2XZCH 2Z6FA 1KWWA 3HZVA 2V3EA 1QRNA 2WXFA 4NNYA 1LEGB 1D7CA 3CVIL 5DVPA 4HUCA 3T2NH 4BZ1A 4NFDA 1Y17A 5F7MC 4TVPD 1KEML 1TZHB 4HOWA 3SSGA 3MLWH 5I5IA 4JQXC 3QZBA 4JZNB 3TVMA 3CZSA 2FECL 2CO6B 3ZR6A 4AJVA 4Y5YC 3V6ZA 1JWSA 3JWOC 3O6ML 3QWRD 2B14A 1NDGB 3CVCA 1NGPH 1JPTH 3F62A 2UWEF 4KGJA 1RUKH 5I2IA 1WISA 3D50A 4IS6B 2EUVA 4YNYB 3JWNH 2X0UA 1SYVA 4K23L 2JIXA 3DNKA 5L8LB 5FK9A 4LE8A 5D4HA 3RWCA 2VMDA 1CU4H 2PO6C 2BW5A 1WEJL 2ZX5A 3L08A 3IDIB 1D6VL 4GQZA 4NUPA 1CMOA 1CLOL 1ZLSL 4PJAF 3CSFA 1PD0A 2VLLA 5D9SA 5HHVL 1BAFH 4N4YB 3NJKA 4J8QA 1KIPA 4JO8A 4MAYA 4X9IA 1GTNA 2RAMA 1A0QL 3FONB 5IOPB 4PGDA 3D09A 4P4KB 3ZKXC 3WAJA 4GBXC 4FTVE 5C86A 1FO0H 2AK4A 1MCJA 1TUPA 1PAZA 4H8UA 4NSKA 2DMCA 3HUJA 5DVNA 4U1HA 2DYRB 4NNPL 2HN7A 5E4AA 2WKOF 1V3LA 5D7SH 5DD6B 3OAUL 2Q8BL 3K6FA 1AQDB 1TTGA 5FYKH 1CI3M 3MRLA 3NCBB 3P40A 3QWQB 5DK2B 3ZKQD 1L3NA 5J13B 1BX2B 2CUIA 1MCOL 2IADA 3GB7A 4PS8A 2I5YH 5B1XA 2JK5A 3CN0A 4NS0A 5DVKA 4ZMPA 5KS9B 5F7EH 4BRJA 5JYLA 2UYLB 5BW7C 1G4MA 3K2KA 1F1GA 3VXSE 3IRZA 1CGSH 5AW9B 5JHLL 2PWDA 1I3RA 4YQXL 3U48A 1HWHB 4IDJH 4C4KT 4UIKL 1A1OA 3POCA 4V11A 4X4KA 4YFLI 2ITDB 3UDWC 1RZJL 3GPRC 4ONGL 1XGPB 4E68A 3GSQB 15C8H 2HT4D 4HXBL 4MA7H 4R4FL 1KACB 3RDTB 5JXAL 3BDWA 1AKPA 2ZUVA 4PHZA 1OSZA 1NGXB 3OGCA 4WHYG 4LSSL 1XD0A 1KGJA 1N4XH 1T2QL 4X5XB 1ZRUA 1BLIA 2C8NA 3S34L 3GM8A 3MLSH 1K6QL 5ENWA 1NGWA 4I18A 5DZ9A 4R4ND 1ZMYA 3BPOB 2IH3B 3QPQD 1IGFL 1NFDF 4YEEA 1G7HA 5E5LA 3ZTJH 4BCXA 1U3JA 4Z78A 3D9AH 2BRQA 4RRPA 4NBYB 1EEZA 2C9XA 4NQDE 4E52A 3VE0B 2MQGA 4Z0XB 2OYKA 4LCVA 4Z7VB 2MHAA 2VW7A 4RISL 3EYVA 2OMXA 3I75A 3U6RA 2X3BA 1EMTL 2FB4L 2IMNA 3V4VL 4QLWA 3DX4A 5ESQA 2X4TB 5DEFA 3SKOA 5E5UB 2NXZB 4DH2A 2VQUA 4HKJA 5EU7E 2EO9A 2EH7H 2CRMA 1XH3B 1N70A 2ADJA 2VJ0A 1OPGL 5EUOB 2FT7A 2JB6A 3I74A 3BQUD 4WNJA 1CTNA 1DQML 2CDGB 4ILDA 2QV4A 3F5WA 3FOMA 1TU2B 3LN4B 1FJ1B 2APBA 1NWOA 5TPWH 4O2CA 3TCLB 1IKNA 2JKNA 1CGVA 1PX4A 4P4KC 4PRDB 3V2AR 5IFJA 2J8OA 3N0PB 4UILL 2X87A 2Z64C 2X0WA 1DBJL 4EIUA 1TJHL 1N59B 3D69B 2I7SA 3QQNA 1OD9A 4KOBA 4MTMA 2Y2TA 4YHKH 4NO0B 3SE4A 3FQUB 3QAQA 4LCWB 4YUEH 5J13C 4FNLH 3FF8A 5IZ7A 5HJGA 3MV9B 2X4RA 1FYTE 4NKMB 2Y7OA 5SWSE 1GS6X 1UA6H 4N0UB 3CFCH 2WXLA 3AUWB 5LB1A 3BKJL 1IIKA 2VDLH 3GSNA 3ML9A 5CEZE 2VABB 1NC4B 5I0VA 4LKXB 4DP9X 3AACA 2HRPL 1BJ1H 3BZ4B 4H1LG 3RZWA 4GRWB 1RJYA 2CK0L 3ISWA 5A2LH 4GKOG 2HJKB 3RNQA 3KH3A 4PRPE 3MRGB 1HHKB 1MFEL 4AQ1B 5F0MB 4NM4L 4NQXA 4QRQB 3RDTC 4GIPD 1BOGB 3WE6A 4HD5A 2XFGB 3D3VA 1J8KA 4FFZL 5DRZA 4TVSa 5LGYA 4D94A 1A4CA 2P5WE 2HT2C 4U1KB 2D4DA 2JE8A 1NLBH 1H3UA 1W16A 4WEMB 1YPUA 3DARA 4ZAKD 5H35B 4NUGL 2Q20A 4F1ZA 2F53B 2YC1B 2B7DT 3BSZH 3GQFA 1HUPA 3QQ9D 5IVNA 3BPOC 3Q2WA 4OUOA 1RJLB 5JQ6L 3GMPB 2Z31B 4PS4L 3RA7H 2BZDA 1ND0A 2XN9D 3GSNL 3P9MB 4ODVH 3B9KD 4DVRH 1JVLA 3GHEH 4HMDA 4MXVF 4XXDB 5FUCC 4M62L 4L0ZA 3UJJH 2A9CA 3EGXA 3I9GH 4AQAB 5CKAA 5JOEA 1C5DA 5K39A 3HZMA 1WZ1L 5DLMH 5DUMH 3BP7A 4Z6AT 5IB2A 3KPQA 1FGNL 5D7LD 3KPLB 5EOCH 4D2NA 4R90L 1NPUA 1DE4B 2O5YL 3PDGA 3BAJA 3H4FA 4NKOA 2WQSA 4J3BA 2NXZC 3HPLA 3NJNA 1K8IB 4ZO6A 5C0GB 2KLRA 3DX9B 5JXED 3M8OL 4P3WA 3INUL 4NIKB 4WUUB 3NRFA 3AZUA 4C4KO 2VGLM 1QTPA 2W65A 2LE9A 2NNAA 2XVBA 5I9QB 3CH1B 4OFPA 5FM8A 2JI3A 2WQVA 4Z9KB 4ZS7L 3IEAA 5I0ZA 3FTZA 4NAJA 4ANWA 4BXVA 2VW4A 3QUKA 3MBXH 5KANI 3GZKA 3WFDL 3GM0A 3GXFA 4H8WC 4HUWB 1PKOA 2HFFA 2P45B 5JR1H 2HJLB 4TQIA 4U3SA 3NZSA 3FQXA 5CFAA 3FQ1A 2EIDA 4XN8A 3QUMA 1LQBC 1XVSA 3T09A 4H20H 4L1LA 1ADQH 3UMNA 3LRSB 4ABVA 4QXUL 4WEEA 1FHNA 4X6DF 5PCYA 4DN3H 4BDVA 1KWYA 3WFHB 2LR4A 2EEBA 1DFBH 1EBPA 3OMNB 4GRMB 4K0OA 4OJFH 3AT0A 3WE1A 4DERA 2HKHL 2XUWA 5BRPA 2UVEA 3HHMA 1JGLH 3BWSA 2WQAA 4HV8B 3SKNA 1DQQB 4K9EL 3FN3A 1P53A 3GNMH 4FGMA 4PP2A 4U1IA 1LO2L 1S7QB 4FFYH 4FQIH 3NA9H 3IXTA 3WUWB 1GIGL 5CUSL 3AC0A 1IJNA 1ED3B 1PIGA 3QO1A 5IHLB 4HMCA 4JHWH 2WQ8A 4ZTPH 5FECB 2H26B 5HYJB 4TQEL 3P5FA 3S5LB 4AQ1C 5C2BL 4WEUD 2UWEE 2C6UA 3DBZA 1A3ZA 2OCFD 2APSA 2DQMA 2AJ3B 4NB7A 1N6QL 4NDMA 3W37A 5HHNA 3UTQA 2D3LA 2R2CA 3MBWA 5E2VL 5KYYB 2Z31C 3DX1A 4I2XE 1NUDA 4PJAE 5FFLA 1MHEB 4AT6B 4A37A 3CZFB 4GEIA 2PTUA 1BIIB 3NIFF 3EYUH 3IWVA 3Q2VA 3U4BH 5DVMA 4IOIB 1Q9WA 5LCVA 3DDFA 2ZYSA 1CFVH 3DURA 3K8MA 2LTQB 3QUZB 4G6JL 1XF1A 3P2DA 1DY0A 3E0GA 1HSBB 2D7OA 4FJYA 5AOJA 1EJFA 1WRFA 3D18A 1X9LA 2X4NB 3TPUA 5DU7A 3MCKA 1OZUA 2ESVD 1ZGLM 4MZIA 4JHAL 3TO4B 3GS4A 1CC3A 5FYJH 4XCEA 1QSFA 4IIZA 3PWNA 5HYIA 1NEUA 1E0OB 1NWPA 1ZJAA 2X89D 4HCIA 4MNHA 3IYLW 4R7XA 5D70H 1MCSA 1CYGA 2DYPA 1ZHBB 4QRPD 4YE0A 1O6VA 4KKCC 1OANA 4ZK8A 5I24A 5I8KL 4HJEA 4GW4B 5DFTA 1ET8A 2OL3B 5CS7A 1BP3B 2PP9A 1LTXA 3DHMA 4L9LB 1LGVA 3L2NA 4UQ3B 4IKJA 1SM3L 3W9EB 4FXKA 4XAKD 2AFNA 5ALCH 2V7HB 3PAYA 4FADA 4UDTA 1KGYE 1IBZA 5EHFA 1YEIL 5DMKB 3ZE0B 1AGEA 3QCUH 2YR3A 3UTPD 2CALA 1K5NA 2EE6A 3ECBB 2JV6A 4NZUL 4JN1H 4AGQA 4LVNB 1HILA 4PJHB 1L9QA 1A8JH 1AFB1 1NCNA 1CFQA 2DM3A 2B1HL 2OMVA 4PV8A 3QNYA 2DWDB 1NBVH 4WJ5A 4Y2OB 5DHVB 1H8OA 3L7EA 3T1FA 4DKAA 4FAAB 2D3VA 1OARH 3KAAA 3EH1A 3ETSA 1MFAL 3CSGA 5CJBA 4Z0BL 4Z1PA 3SYCA 1A6TA 5A3IC 5L6YH 1VFOA 1A6UH 2X9ZA 1QLFB 3H7LA 3P4NA 4KPHH 4MCNA 1NFDE 1DEDA 1DBAH 4WU5A 4DGIH 3KPSD 1DZ0A 5FWQA 5JORB 2J12B 4LBAA 5DJYA 3ZQ9A 3CN4A 4RGOH 3ET9F 4N85A 1KB5H 3UJTL 3IGLA 1KJ3H 5AB9A 1EAQA 1T83A 2DWYA 1DQKA 3QXWA 2XN2A 3CXDH 4GG8B 4JJ5B 4BE6A 2ZIBA 1UOKA 2MJWA 4MD4B 4HKBB 4LMQI 5FDWB 3DHJA 2AXJA 3GXNA 4FMKA 1MN4A 4YDKH 2IANA 2X10A 1BCH1 3IPBA 4TTDD 4XTRC 4JO1H 32C2B 1WA0X 2ZUXA 2AZUA 4S0TD 3B83A 3MJ9H 3AROA 3J27A 4LCCB 2N4IA 3HFFA 3QUZC 2OV0A 4PREB 1BQKA 1NCOA 1SN5A 2XWXA 5EH1A 1MRDH 1W6LA 4U3HA 4ODXB 2Q87A 4UQ9A 3UYOD 1GKOA 4UYPA 3TO4C 4EI5B 2R9HD 1II4E 4MHHG 4OJAA 1UM4L 1C1EL 3M17B 4BCZA 1PW3A 3ULVL 4JRXD 2WKLA 2BINA 3NACH 1D5XB 4F57L 2YPLE 4HJIA 3FSZA 3V7MA 4L8SB 4Z77B 2OX5A 4L9LC 2B1AH 4KMTL 2VRAA 1YNKL 3SJVE 5D7IA 1NCBH 2FJHB 5EN2A 3O4LD 2DICA 2IH8A 1NCCL 2P46B 4OKVB 3KJ6H 1TVHB 5DJ8A 1H0DB 4AXWA 4U7KA 2DQHL 4KX9A 4HX1B 4I1NB 1ANUA 4C57C 1NOFA 4GKLA 3MQIA 2A7BA 3HG1D 4M4PA 4X5PA 1E2VA 5ALBL 3V0DA 5LNEA 3WIHA 3Q44A 1OGSA 3X1NA 4LVNC 4DAGL 1MLBA 1LO3H 5C0RH 4YBHA 3FMGL 5EO0B 4FCAA 4RRPG 5C0IB 2JKSA 1EVTC 3K81A 1RULH 2R23B 2N7AA 4KTYA 4MMYB 5A16A 1XBRA 4JGMA 4AJ0A 4F2FA 3HHSB 3QBTB 4ZQKB 5K9KA 4YL4A 3V4PA 4PSPA 2L4OA 4ODUA 5EEVA 2YD2A 1RIHH 5T1KA 4UTAL 5D71L 3CSYB 2FBOJ 5AKSA 3T0EA 4XO4A 5CINL 5IW1B 1BVKA 4F5CE 2VZUA 1KPVB 2XWRA 1FL6B 1BF5A 3KR3L 1LEIB 4N9GA 5HD8C 4MXVE 3GGWB 4PRNA 4PW9A 4ALAC