2ZQKA

Crystal structure of intimin-tir68 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
183
Chain Sequence
FFDELKIDNKVDIIGNNVRGELPNIWLQYGQFKLKASGGDGTYSWYSENTSIATVDASGKVTLNGKGSVVIKATSGDKQTVSYTIKAPSYMIKVDKQAYYADAMSICKNLLPSTQTVLSDIYDSWGAANKYSHYSSMNSITAWIKQTSSEQRSGVSSTYNLITQNPLPGVNVNTPNVYAVCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the interaction between intimin and Tir of enterohaemorrhagic E coli: evidence for a dynamic sequential clustering-aggregating-reticulating model
rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords Intimin
total genus 47
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
A PF07979 Intimin_C Intimin C-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zqkA01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 2zqkA02
1KZA1 2ZWKA 4N33A 2VRPA 4ZRVA 1RDN1 3P7HA 1PWBA 1KWXA 1P1ZD 5K8YA 4MTHA 3P7FA 1YTTA 1WT9B 4N38A 1BCJ1 4ZESA 4AK8A 4J6LA 4PDCA 3WWKB 1G1QA 4KZVA 3WBQA 3CDGE 3P7GA 1KZB1 4M17A 1U0NC 4DN8A 2AFPA 3P5HA 2PF5A 2L04A 3VPPA 1V4LB 1DY0A 4GI0A 1T8CA 1V4LA 1XPHA 2MTIA 3UBUA 3ALSA 1K9JA 3ALTA 5J6GG 1IJKB 2OX8A 2CL8A 4AQ1C 1FVUA 3G81A 1YPUA 4E52A 1SL5A 1HYRA 1FVUB 1G1SA 2MH4A 1TDQB 1RDL1 4UWWA 4WR9A 1YXKA 4WQQA 2RIAA 1BCH1 1K9IA 1R14A 2I83A 1R13A 1IXXB 1U0NB 4HU8A 1C3AA 3IKRA 1KG0C 1P4LD 1RDM1 1HTNA 2RIEA 1KWWA 1SB2A 2ORJA 1KZC1 3P5DA 1YXJA 2VUZA 3FD4A 4KI1E 3WWKC 4M1GA 1AFD1 3WH3A 1KX1A 4J6NA 2GGUA 2YHFA 3NCWA 1SL6A 1OZ7B 1X2TA 3CDGF 1BJ3A 1F02I 5KTIA 4ZRWA 4KZWA 1V7PB 3BDWB 1DV8A 1XARA 3CADA 4YMDA 4WRCA 3VLGA 1X2WA 1UEXB 3FF9A 2IT6A 4J6JA 1JWIA 4WREA 4IOPB 4WUXA 4YLIA 2GO0A 4N32A 5M62A 2RIDA 2LS8A 1JZNA 5B1RA 2IT5A 1RDO1 1V7PA 2H2RA 3BDWA 3CCKA 4GJ0A 4C9FA 2OX9A 1BJ3B 1DY2A 3WBPA 1FIHA 1O7CT 3C8KD 1KCGA 4J6MA 4KMB1 4QKIA 4J6PA 1Y17B 3CFWA 1B6EA 3DBZA 1WMYA 1J35A 2E3XB 3KQGA 1SL4A 5LGKE 1E5UI 4GKOG 1AFB1 3G84A 4CAJA 1KWZA 4PP8A 2BRSA 4EZMG 1ESLA 4LU5A 1RDI1 2RIBA 1IODA 1UEXA 2ZIBA 1J35B 2KV3A 1HUPA 4N34A 2BPHA 3PAKA 1MUQA 5KTHA 1H8UA 1RJHA 2OS9A 1IODB 1E8IA 2H2TB 1DY1A 3UBUB 3VYJA 2XR6A 1RTM1 1BV4A 3NCXA 1OZ7A 4J6QA 4WUWA 3IKQA 4GK1A 1BNLA 1YPQA 1KWTA 2GGXA 3ALUA 3GPRC 3T3AA 1QO3C 3IKPA 1KZE1 2BPEA 1GZ2A 3BX4B 3FF8C 1EGIA 4ZETA 2VRPB 1IXXA 1O7BT 3C8JA 1Y17A 4LQFA 1KWUA 3K7BA 1UKMB 5B1WA 2KMB1 4UXMA 2VUVA 1PW9A 2ZQKA 4QKGA 3G8LA 1J34B 1X2WB 1G1RA 2MSBA 3G83A 3BX4A 3ZHGD 4S0UA 1T8DA 1BUUA 1KX0A 2RICA 1B08A 1QDDA 1CWVA 4QKHA 3P5EA 3RS1A 1X2TB 1UOSB 1UOSA 2M94A 2N7SA 3ZHGA 5FFSA 3IKNA 3PARA 4J6KA 5F2QA 1HQ8A 1E87A 1IJKC 2MOGA 3GPRD 1YPOA 3M9ZA 4GJXA 3WSRA 1LITA 1C3AB 2N40A 3L9JC 1J34A 1RDJ1 1EGGA 4QKJA 5B1XA 4C16A 3KMB1 3GPRA 1U0OB 1TN3A 1F00I 1U0OA 1UMRA 3WBRA 2MQGA 4CSYA 1SB2B 1MPUA 3WHDA 1UV0A 5FFRA 3P5FA 3WH2A 1KMB1 3PAQA 1G1TA 1KZD1 1WMZA 3FF7C 2XR5A 3GPRB 4G9AA 3C22A 1BYFA 2C6UA 2BPDA 5FFTA 3P5GA 3PBFA 1UMRC 4WRFA 2E3XC 4N37A 2ORKA 4M18A 3WWKA 3HUPA 4AQ1A 1MSBA 1FM5A 1WT9A 1JA3A 1KWYA 1RDK1 2PY2A 1WK1A 1AFA1 4WCOA 1FIFA 4IOPA 1JWIB 4N35A 1KOEA 3VYKA 3G8KA 3P5IA 1TLGA 1KWVA 4N36A 1UKMA 4G96A
chains in the Genus database with same CATH superfamily
4PJHA 1XH3A 3V2AR 4QXTA 3BLKA 4CVZA 1AHWA 4ZRVA 5C86A 1KB3A 2CRIA 1OGTA 4PGBB 5CN3A 1A14L 3ISRA 3L2LA 1MF2H 3RIKA 4DEPB 5A7EA 2HFEB 5EU7E 1NGQL 1IV8A 1BMZA 2G2RA 5INCB 5JMRA 2VISB 4WEBH 3RGHA 2I5YH 5D1QB 3VTMA 3AQYA 1C1EL 5EF2A 2W60B 3D51A 3ZKXB 5K1NA 2JKTM 4NRZA 2BMKA 4WUUD 2AJUL 2W0FB 5K8YA 2CKNA 1UUSA 5AVQB 4X5WB 2F58H 4RIRB 1ROCA 4HJ0C 1C5DB 4C4KO 3BRDA 2QVKA 4R4ND 4XO3A 4N8UA 1MEXH 3S0PA 3LMJH 2J1ZA 1F4WH 4F2MA 4AK8A 3RZCD 3P0VH 3MGOA 4IKLA 4Q9RL 1TZGH 2Y7QA 3N1QC 3M86A 4N2MA 3MNWA 2OL3H 2R27A 1JD9A 3D4YA 4PRPE 3VFRA 5AAWC 3CC5B 3NACL 4N2BA 1OAZL 4GY4A 5AKVA 2YA1A 4JDEB 2CPCA 1QSZA 3UAJD 3PPEA 5DEFB 5D71L 1E2VA 4L8DA 2XKNA 1WHOA 3DI2B 3G08B 4C56E 4PJ7A 3C5ZB 3NZHL 4W9IC 5CJQH 1HQ4B 1HIML 4LESA 4UQ3B 5EBWA 4ZTPL 5LAPA 3SPVA 3QYMA 1E5ZA 4RSVA 2R15A 4LLMB 3BO8A 4JVPA 3KR3L 1AXSB 5GIRA 2IEPA 3ECBA 1BZOA 2XHNA 3WDJA 4U6HA 3S9DB 4MMZA 2DIJA 1QRKA 3H4FA 3TEUA 1NTDA 1KG0A 4KKAC 2VLME 3AQXA 4S1DC 5E2TH 4E9SA 5GRUL 5GGTL 3WFHA 5JHAA 3ARXA 4XVUD 1U3ZA 5I6XB 3NCJL 3K2UH 2W0KA 2NYYC 1J0HA 4WSGA 1LEGA 4KKBD 4IBUA 2XN9D 4IKNA 1WFTA 3T2NL 1TU2A 3N55A 5G4OA 5T33H 1CQKA 1G4RA 3L4CA 1UWEH 4NQCE 3VI3B 2NY0B 3KPSB 5D6CB 3GGWA 5GHWL 2UY6A 3ULSA 4JZJB 2P43B 3QRFM 2J6EA 1MCQA 3I75A 1RZPA 3HC4H 4BGLA 5HYQB 4EUPH 4P05A 2CJSA 4M56A 3EO0B 3UABA 2JKJA 3T6XA 4PJDB 3C6SA 2B3RA 4MHHI 4OF6A 5GRVK 2RR3A 2ZUVA 2X9YA 4FXLA 5IFHL 2G0KA 1IKOP 4QLRA 1F6FB 3LOWA 5CIPB 3V7AG 2ORJA 1NCCL 3MBED 5HI4D 1R3KA 1XAUA 4J4PC 2D0GA 3ZHFA 6PAZA 2E86A 5KSUA 4FQ2L 1F1DA 2W0PA 4HKBA 1SYSB 2VDML 3QDHA 4WCYH 1A4KB 5IEKA 5BS0D 3ABLB 5AOJA 1P4IH 1MCCA 3EG9B 1AO7A 5E2UH 1EHNA 3G5ZB 3UX9B 2OXGB 4OCWL 3QO0B 3ZIMA 4OGZA 4MCYA 3CUPA 4R0LA 2N1KA 2A6JA 1MW2A 2W59A 3MJ9L 5IWLA 5CCGE 4MJIE 5D1XB 2DQUL 4ZMOA 3ARDA 4P8QA 5DK0A 4YHIA 3QA3A 3ZN6A 4DN4H 1G0DA 3CHOA 3M1CA 3PAZA 3LH8A 1OOAA 2IT6A 3DRTA 4IKIA 3EYQC 1KXVA 1OAYH 2O5ZL 5AUMA 3C5ZA 3AY4C 3X12A 1P5UB 3EJSA 1N6UA 4K9EH 1AC0A 4PD4K 4R26L 2C3GA 5DWUH 4ECNA 3PNWB 5H4ZA 1HH6B 4B9YA 2D3VA 3HTLX 1YHPA 1RJYB 3JVFC 3RFRA 4QXGH 2NLJA 3KYAA 4GMSL 5DQJA 5I82A 3MRLB 3VFVB 5EIIB 5DVOA 2ERJC 1Z3GH 3HBPA 3MA9H 1OPGH 3TJEH 5A2JH 3B9AA 2J8UB 5KSVB 3SJVD 3W82A 1JS4A 4KO9A 5D2LE 1T4WA 3BPOB 4TVPE 2OCFD 5D7JD 3UJTH 2PN5A 4N0FB 4MJ6A 4NN5B 4OVVA 3KYMB 2EDXA 2XZCH 1AZZC 1BV8A 2PLTA 3VWJC 2R4SL 3ECUA 4KMTH 1ADWA 4L8CB 1UD6A 2X53A 2CKBH 2X9WA 1XCXA 4GRMA 1Z3GL 3MLWL 1KB9J 1XR8B 1XSJA 4P5MA 4S11A 1G84A 1E9QB 3P11L 1NCDL 5J06A 2HTLC 3SQRA 1G9MH 5LJYH 1GGIH 1MJUL 3FMGL 4ZOCA 2VMCA 1QR1B 4NZRL 3OKDA 2DQ6A 3E9UA 2AJ3A 4HBQA 2VLJB 2X41A 1F90H 2W65A 4WU7A 2QVIA 5LB1A 4HXAL 5FCUL 3WNJA 1MRFH 4WAFA 4ZMYA 2VXTH 2AJXH 3LPGA 2IO5A 4BIKA 4X4XB 4HLZH 3NFPA 3V4VB 1KTLA 2R0LH 3P9LB 3E1F1 5FYLD 5AKSA 1CXKA 2ZYIA 5CBEB 2EXSA 4X4MA 3RIAF 2PO6C 3PHAA 4PP8A 4XC1H 3S35H 4YHOL 3LXCA 4F8QA 1A6UL 1RDI1 4Z78B 1T0NA 3BZ4B 2CK2A 4S0TD 2A6KB 2JQAA 4AI7A 4NO3B 2OYKA 4DPCX 5GRZA 2P9RA 2HRGA 3DX1A 4M8RA 4KFZC 4MBOA 2PR9A 3QVAA 2ZIBA 1F1AA 2KV3A 4GUPB 1J0JA 3C09C 3S8FB 2YKLL 1AGCA 2P5WD 3Q8AA 3ZKMC 2HFFB 1AH1A 3PAKA 2R2EB 3DNKA 5BV7C 4X9HA 5HY9B 2IAMA 1QEWA 4K3JL 3D05A 1MCPH 4XNXH 3WFZA 1FYTA 2XN2A 2WVVB 1JHKL 1M3JA 5ENWB 1MNUH 2XOTA 2JWYA 1NCUA 4PCTA 3HAEB 2XXMB 3VQMA 4XMKH 4XODA 4FERA 5TQ2H 1NC2A 1LP9E 3GT6A 3BDXA 4XVOA 4N22A 4L1BA 1A4KA 4KZDH 3NTCH 4PTUB 3UP1A 3V95A 5BZDB 1U8IA 3NGBC 2XWBA 3EOBA 1N8OE 3EJRA 1UOLA 1WLHA 4IOSD 5HDBF 1I85C 1WZLA 5GJSH 2JKLA 1RD6A 1RIUH 1VCBC 2GEEA 3ECVA 3JV4A 1WUZA 4HPOL 5JQIB 4QT5A 3TCTA 4YDVB 3T3AA 5K39A 3G5VB 5FYLL 5F88A 5CU9A 2BS71 5HHOE 4NM4H 1P9MC 1LEKB 2VL4A 4LKCA 3FF8C 4C55A 1BSIA 3X11A 3AY2A 4C54A 3HG4A 4KRPB 3GRBA 4P2RD 3HLKA 4PCSA 4WFGD 2PR4H 1TKWB 4WUUB 4TUKH 5GGQL 2WCSA 5JW4Q 3K7BA 2YRPA 4EEEA 3PABA 2YAPA 3K71B 4AGPA 3MQIA 3AU0A 4R7NB 3QIWD 2V3DA 5EU6B 4CW1A 5L6YL 2Y23A 3UPRA 3GLDA 1WS7A 5D8JL 1L9TA 1A4JA 1E9PB 2BY2A 2KT6A 4HIHA 1IQWH 2D31B 4PS4L 4N9OB 4G59C 3KM1A 4JFQA 1UXWA 2XV6B 2X0UA 2EP6A 1XBDA 3BAEH 4IDJL 3GRWL 1JV2B 1CB4A 2XPGB 3N42F 4FCAA 1MHEA 4OLYL 2FLBT 4MXVE 2N56A 5I1GL 4WI7A 2NW3B 2EO7A 3UBXG 4Z0BH 1JZ7A 5J6GA 2HT3C 1C5BH 4JKKA 3OSKA 1YQ2A 2OJZL 1HN1A 1L6ZA 1BFTA 4WFFE 3NSJA 1T7XA 3UG3A 4GXUM 3P5EA 1T7WA 1RH8A 1J5HA 2KHAA 1FVCA 5I0ZA 2ZWYA 4QY8B 2Z92A 5HHQB 3B2MA 1SQMA 2DQGL 2WXGA 1OD9A 5HJ3A 4E41B 5DHXB 4JO2L 2PCFA 3ZHDA 2FIKB 1MWAL 5KVDL 1HQ8A 4JY6A 4YHKH 4EIUA 5DDHA 3D3VD 5I76B 1QP1A 3MYJA 1GZPA 4L48A 2BSTA 2W9LA 3W2DH 4A7SA 2ED8A 1KGCD 1B0RB 5IGXL 3L3OB 3Q7JA 1H8SA 3E8UL 4S2SA 4BZ2H 1CTOA 3L9JC 1SNRA 5EEUA 5EO1A 4YDIL 2XTJB 3FB5B 2J1YA 4LHUB 4Z78A 4OM0L 5F3HB 5KJ4A 2CXKA 2WTRA 3WHE1 2QSCL 2GSIA 3NSDA 4KJYB 3RVXC 3GS0A 2P24B 3HC2A 1MFMA 5IMLA 1UMRA 4L8SA 4KOCA 5DHVB 4PRNA 5LN8A 5E6SB 3Q8BA 4WI5A 2I27N 5CEZD 3MCG1 3HC0A 2K6YA 4K15A 2R8SL 3B6SB 3SE3C 4KK9C 4OW6A 2DWSA 2X6MA 4U0RB 1NH6A 3HMWH 1G5GA 5D2LB 2PXYA 3FQUB 5EG6C 5JHDB 1JPEA 4DAGH 5FKPB 1RUQL 3RG1C 1EXHA 1YECL 1QSEE 5HHMD 1QFWH 1JK9B 4H2AA 4LGPB 1I82A 5GJTH 2BERA 2BNRE 4CVZB 2WK2A 3II2A 3IWVA 2FWOA 1J8HB 4L4TB 1MFCL 1XD0A 4RDBA 5IQOA 3EF4A 3CDGA 4WKZB 2NSXA 1DN0A 2C5DC 2VZ1A 2PCFB 3B34A 5C0FB 3MACL 5FHAH 3L3KA 4FMFA 3HUJB 1A3LH 3GJFA 1BJMA 3QHFL 4NOFA 4DVRL 4AMKH 1ZANH 1ETA1 3T0EC 2JCCB 1BJ1H 1F2QA 3GO1L 1GGYA 3VXME 1LO4H 1YMMA 1KJ2B 2H1XA 1DVFC 3UJIL 3ZL4L 2KS0A 4YJZL 4OTXH 4P3CH 5FFTA 4QRRE 4FKEA 4ELDA 1EH9A 4GSDL 5D2NE 2UUDK 2XVBA 2XZQL 3SHSA 3P2TA 2F74A 5DQJB 1URIA 2RHEA 2WKGA 3JVGA 3OAUL 2O26U 5EU4A 4PWGA 2CK0L 1E4HA 3UYOD 1W91A 2OXGA 4U1IA 1OP3K 5DFVD 3TJHC 2EDFA 1E6OL 3GTNA 4JHZA 4QY8A 3UOAB 1S5IL 1WAPA 4OCLC 1EHLH 1NICA 2Y5TB 4DN4L 3HMXL 3KL0A 3PQYA 4CW1B 1CD9B 2XJKA 1W8EA 2PPEA 3ML8A 1G6RL 2ZKHL 2FQEA 2LU3A 1ULVA 1ZA3A 4G6AC 1EJOL 3TZVB 3VXNA 4HS6B 4BSWB 1OP9A 4ODVL 4KO7A 4AG4L 1OE1A 2E6JA 4X6CE 3BVDB 4TSAH 1MI5D 4OFYD 4G9FB 4N33A 5T3XL 4R96B 3OPZL 1YNKH 2AXFB 1DBMH 1KBGL 2MKLC 3WNMA 4NYLB 3CHPA 1OSYA 2H9GB 4QXGL 4D7PA 5J56B 2Q2LA 1HL4A 4KXAA 2BY3A 4OZGA 1E8XA 1PWBA 4GPVA 3CZSA 2D03L 1NPUA 4RZCB 1AGBB 1U58A 2WTOA 4AYBA 4LAJH 5CJ5A 1CD8A 3G6AB 1HZKA 2OMUA 5T3ZL 1F6AB 1Q9KB 1CLYL 4KZ0A 3H9ZA 2HVKA 2WWMD 2E7LA 4IBZA 1L9OA 4P2AA 2J3SA 3E1ZA 3HI6L 4NZUL 1IGCH 2VDKB 3KPRA 4HEPG 4MJ4A 2I9TA 1UM5H 3KEDA 4OKVA 2BINA 2NY5L 5EZPA 1HHIB 3U7WH 2WYIA 1Y18B 3UCQA 2YGOA 2QLYA 3ULVL 4M93C 2D0FA 1I7ZA 5A16B 5TF1H 1BOGB 1BX2A 3UBHA 2KBGA 2NY0C 3CFUA 2OMYA 5D7LA 3DGDA 5DURD 3EOBB 1MW3A 4GW4A 3VWKC 4RQQA 2X6UA 1YY8B 3FN9A 1XHHA 3BP7B 1QSED 1CD1A 5DD3L 3B7SA 2NY3C 3VPPA 2HSIA 5EA0L 4HAKA 3QQ3B 2P5EE 3DHJA 5I5JA 4YXHH 1DN0B 4P9HL 2D7PA 1NIFA 2OMVA 3S97C 2NY4D 4WW1A 3B9EA 4BK4A 2KI6A 1UCBH 4YFEA 4X6CA 5KYNA 4M1GL 1DJIA 1FN4B 3CBJB 5C6WH 1C8PA 1O75A 4M9OA 1RSYA 4AC2A 3K72B 5DUJA 3RVVC 1JSYA 3OR7B 3S48A 3TN0A 2XC8A 3CH1A 4M6OL 4JFSA 4R4BA 4RX4A 4X6BA 4XP1L 3L95A 4ZZKA 3IBOA 1W0WA 2P45B 5E4OA 3T09A 3GMMB 8PAZA 2ZUQB 5J1TC 2XVLA 1A7QH 3B8YA 1G9EA 3F64A 4A67A 4HS3B 1OSZA 3FONA 2A3TA 2Z65C 2WUBL 4OJFH 1Z9SA 2WLIB 4PYGA 1HI6A 1KTCA 1HINL 4P2RA 1MAJA 2M2DA 4FNUA 1Z0NA 5F7MC 1CLZH 2ADJB 5T5FH 2ITFA 5JTWA 4J28A 3PGCB 3ATBA 2ZG3A 5JW4N 4LOUC 3IDXH 3UC2A 3V0EA 5C0NC 1UACH 5KBPA 5E4IA 2WYTA 4MD4A 2HJFB 3CLEL 1T1XA 4O4YH 3RL2B 5TH2A 1G1YA 1U3HA 4X6EB 5DJ6B 2F5AH 3RBGA 1WEJL 3VXMA 3LMJL 1LQBC 3GMRA 3DGGA 3M45A 1B4JH 4N24A 2GJZA 2VL5A 4PS7A 2ZOUA 3NZUA 4NNYB 3OMZA 4JB9L 5IQNA 5EF3A 3P4OB 2WLLB 5CN2A 4Y5XB 3AACA 1C8QA 5AQ0A 3QR2A 1KPUB 2EXWD 1FVCB 2L0DA 2YD0A 1BFOB 2FSEB 1A3ZA 1H3XA 4MDRA 5B38G 2XKSA 1X5JA 3BP4B 3MGAA 4U2YA 1RZIB 1J5DA 4JFXA 4ZMLA 1TDQA 3V6FA 1B0GB 4QO1B 3VXSD 1TTUA 4IGBB 2GK0A 5EOQH 1TUPA 5EIIA 1HZLA 3KM2A 2Q7YA 1W0WB 3FHEA 3S37L 5LGJB 1XGUA 2ADYA 2BM3A 1B6DA 5C09A 4WTZG 2NW3A 2XWDA 4GG8A 3CZEA 1ZIBA 1WAAE 3O6FB 5C3LD 5J4MA 1T20A 3CADA 4IK6A 1XH3B 1KYUA 2CM5A 4XBEH 5C71A 3MYJB 3NZHH 4PGCA 3P0VL 5CD5C 1R0AH 2B20A 3FN0H 2D31A 4FN0A 5I8KH 1IAKB 4Z95L 2CDFA 5HYSG 5ISZE 1QPKA 4UT7L 2WVTA 2VC2L 1JWIA 1U95A 5DJCA 2OK0H 4X5RA 4GP8B 5D71H 1V7MH 4C56D 5HDBB 3KBEA 1O0VA 2QGEA 3IDNA 1J9TA 3QJZA 4UIMA 4D3CH 4F7PB 4NBYB 3RJQB 2HRPL 2WNGA 2WQUA 5DUMH 1CFTB 5M62A 2WQ8A 4AW7A 5LG1A 2X09A 4QWWC 5EO0A 2TSAA 4ZX6A 5L0QC 5AW4B 1BM7A 3MA7A 1AKJA 1PW3A 4YBLC 1A6ZB 5F7LB 4MZ2A 4AGLA 4BQCA 1KCUH 3BDWA 2V7NA 5EB9A 1IJ9A 1NBVL 4IU3B 5F72S 2JTYA 2WBKA 5JIPA 1BJ3B 1U3HD 4RGMC 4PJGB 2AJUH 5EZLA 3BIAX 3FW6A 1EFXD 3NZ8A 4KKBC 5LBVA 3P02A 2J6EH 3Q8EA 4HIXL 3E8UH 1A6TB 2P5WE 5KYWA 5F89B 3QZWA 2YPKB 2EECA 4IRSB 5E2JA 1Q9OA 2CJ3A 4RAHA 3WS6A 1RJLB 1SXAA 1X9UA 2VTFA 2MHAB 2X4SB 4I3SH 4PJBF 5E4AA 2WINB 5FO9B 5CIPA 3K1DA 2HJLB 4DTGL 2Y25A 4R3SB 2J2ZB 4JO3H 5D4JA 2ZTBA 4GRLD 4MZ3A 4XNUH 3BRFA 5TQ0L 2ENPA 2RJMA 4K71B 4I18B 5L4IA 3PGFL 2P46B 2YAQA 4PJ9C 3WFDL 1S7XB 4BUGA 4YX2L 1NEZG 2VDLL 2D3JA 4JPWL 3DO3A 5MEOA 1A1NB 1UUNA 3CVHB 3IE4A 2EDKA 1JF5A 1E5UI 4GKOG 2LU5A 2XWBB 2UX6A 2EH7H 4Z76A 2GQHA 2W88A 4WHYG 1XB3A 1XIWA 5I1LA 1NC2B 4PI0A 1EEZB 3QJUB 3U0WH 3HFML 4QPEA 3T0BA 1JFHA 3QIBB 3FPXA 2E56A 2VDPL 2ZF8A 3N91A 3B9KA 1WT5C 2NUPA 3F7VB 3NA9L 4M3KB 3MR9B 5FUZH 4ZS7L 3GHPA 1VGEH 3CHXA 3TV8A 3CSYB 2HFFA 2PYED 3OLDA 2APFA 2PCXA 2D7QA 4JM4L 4P2OA 4OQTA 5DWPA 4UV4L 4PJFB 3RDTB 3BUYB 3UO1L 3SKJL 1TXKA 1YVLA 2A9NH 1RK0B 1AG0A 3BO8B 1ZWIB 3JYCA 3WY2A 2CA4A 1RZIA 3S35X 3F58L 1G7IB 2DD8L 5DVNA 1TO4A 3EYQD 4WWPA 2CDEA 3VMPA 4XN4A 4AL8H 4U6XB 1MWAB 4LEOA 3QO1B 1BOYA 1JNHA 1YJDL 2HJKB 2DMCA 4O02B 4R7LA 3H42H 4W4OC 1E4KA 2RCSL 2ZG1A 4FZEL 2DJ4A 2E9WA 1I1FA 4NO0D 2VDOH 1FNSL 5F1NB 1RHHB 3Q2NA 3HUJE 3UAEA 1NDTA 2KZWA 3QIBD 3Q2WA 4R0LC 2FK9A 3GPRC 3CN1A 3QJFB 1MCLA 5AWNH 3S2CA 2H32H 5TFSH 2MPAH 3NJGA 4P2QB 3UJTL 2Y06L 3FT0A 2JK5A 1C9SA 4ZETA 4FFVD 4Y4FA 3EYOB 2Y7SA 4HCFA 5EF1A 4EN2A 1FH5H 1UJ3C 3DXAD 1E9QA 4KK5D 2GJPA 4NNPL 5CJBA 4P5TC 4WWKD 4AIZB 1FV1A 3KVDD 4UXMA 4X7EC 2ENSA 2FNBA 5BRPA 5H37A 1F11A 2O4EA 1G7QB 3AWFA 3GKWL 4WGVB 2F8XC 2W38A 2G4EA 5T3XD 2LLGA 3VB9A 2ZICA 3CIQA 5DZ9A 4Q2ZB 1E4WL 1OSZB 1CUOA 2AP2A 3WUWA 3WAKA 5IVXA 1IT9L 1BM3H 4KK6C 4ZFOL 4NB7A 2AAVA 1HESA 1XGZA 2DLEA 3VFOB 2AVGA 1W6LA 4OGYH 3KWUA 1AR1C 4MCYB 4P2YA 5J6HA 2W92A 4N90E 3S4SA 3UDWA 1F0LA 3K72A 4HKJB 4XVTL 1SVBA 4MNGA 4Y16A 3U2JA 3UXFA 3DIDA 2CUAA 2P7TB 4IRSD 1J1XH 3W57A 4YR6A 3FZUC 4P2OD 4CDHA 1A6UH 4X4YB 2OMVB 1USQA 3KYKH 3N9GH 1B3JA 4HUXB 4MXWH 4ZYKA 1AR1B 4OZIF 3ULAB 5J9PA 1QI5A 4LAQH 3MJWA 1ML0A 1IBFA 3OAZH 4G6KH 3MLZH 4OZFG 2Q87A 5L7XL 3PARA 4NUPA 1KFAL 5IEHA 4ODHL 3VE0B 3D33A 1N7ML 2ARJA 2D9QB 5HVGB 3IPFA 2A9DA 3AC0A 4LSDA 4QHLB 1VKXB 1LITA 1IFGA 2N40A 5KZCD 1WRFA 3PGDB 4IOIA 4IW4C 2GAZA 5JQHC 2IBGA 3NCMA 2PXYD 3OJ2C 3PAYA 1ZEAL 2YKLH 4HALA 1L0YA 1YN7B 2AEQH 4QR7A 4I48B 4HS8L 4WJG3 43CAA 1RDJ1 1OPGL 3TJEL 5HYSA 3FYEB 3KLQA 3WJMB 5CHNA 4WJKB 4X6DB 2Y4SA 2AKRB 4M1GH 2ZUUA 5FYLE 1KJVB 4F7MA 4XNXL 3ZRCC 3ZDZE 3VXUA 4F5CA 3MV7A 2UZYA 4S0SD 5L8LB 3HZVB 3VNYA 1R9FA 4KROD 3LKSB 5K59E 3BZ5A 3MV9B 1R5VA 1X9LA 5DMKB 1XT5A 2X1PA 4YO0A 4X9BA 2NQ3A 1XD1A 4WO4A 4BXVA 4Q6YA 1CBJA 3OC5A 4PMEA 1BIHA 3FUEA 3RVTD 2ENQA 1KTDA 1GAFH 4OLVH 1UWYA 3U6XS 3GMNA 3T3PB 3AWGA 5A2IH 1DQQA 4DGVL 2UX7A 2WBWB 5D5MA 3C22A 1ETZB 3I02B 4CRPA 2AJXL 3QZWG 1LXMA 1T83A 3F84A 4UWQB 1YYLH 4RDQF 5B38B 5GS0C 3ZUCA 3SPVB 3LZFL 1RK1B 4QJ5B 5I1DB 2G30A 1UWGL 2H3KA 2JJUA 1AYOA 5HY9A 1X7SA 4HU2A 3LB6C 3NIFB 1IM9A 4MNGB 5TDOA 4N37A 4F92B 1JYNA 1PZBA 4Q6IB 2QDVA 1DDHB 2HN7A 3MBEB 4M18A 3F7QA 5C09B 1BZQK 3MO1A 4HQQH 2KUTA 3H3KA 3HVNA 4N86A 4ODUA 2EIMB 3BHBA 4ZYKB 1L3WA 2R1XB 4UIMB 4F7PA 4DO5A 4Y89A 1JA3A 1GRWA 2ZPKL 3J27A 3BKCH 1SJVA 5I73C 2E3VA 3QEQE 1UADC 2VMDA 3OZKA 4YR6B 3VYKA 1NANH 2X4NA 3TWCL 5BOPA 1ZHBB 4TUJA 5EUKA 5J1AA 1P5VA 1I3RB 1XR9A 4LDOB 1BWMA 3OKLB 3FQYA 3HC4L 2FHBA 2P5ED 3U6RA 5KS9A 1U8CB 2FBJH 2J7LA 2ZYRA 1B0IA 2Q3ZA 1IL1A 3QQ9D 4QXTB 5B1AB 4ZMVA 1NFIA 4GP4B 1FNGA 1NBYA 4K9JA 4K7FA 1T7ZA 5AOLA 3D7PA 1MFEL 2O30A 5HVFB 4AY0A 4XMLH 1E0OB 5I18L 5CP7B 4FQCL 2VXUH 5LQBH 3TVMD 1CGTA 1JWUB 5IB1A 1MJJA 1QKZL 3J7HA 5AW2B 3LV3A 5K33A 1J11A 1EVUA 1DQJA 3E6FA 2C1OA 3OHXB 3LDBC 4NI3A 4RSYA 1KPRA 4W9EC 4M02A 2DQFA 2H2SD 1CDHA 2OQJA 4QGTA 4ZMWA 4XE5B 2F53E 2ZD0A 2WQAA 2GCYB 3QARA 1FORL 2AJZB 2NLJB 3UJIH 3P11H 5HHOD 2ZCHL 2XJLA 2MCPL 1G1CA 4BFNA 4F57H 1IIIA 2VDMH 3GMPA 3WOVA 4JEGB 4E5XA 4WHCA 4DAGL 1P5UA 2DMBA 5DT1H 1IGTA 2L04A 1H3WM 4DUVA 3M88A 3O4OC 4JHWL 1ZT7A 4JRYE 3VMOA 2YPVH 1XF5A 1MFAL 4HOXA 1DQQB 1QBAA 2HG0A 3ARDB 3S88L 1X5IA 2VH5L 4LCCC 4PJAE 2IFFH 4K3EH 4NBZB 4G9FD 4PJ5A 5I26A 2OYLA 2C7UA 3DIFB 4AQ1B 3BISA 1A3QA 4CC4A 1NCJA 2OZNA 4Z3GA 1KTDB 3IKCA 4JQIH 4I0PA 3OAUH 3LJ3A 5EOCJ 4X6BB 4RFEA 3D0LA 4NQQA 2AI0L 2BC4A 2XXCB 3FCSB 2NUPB 1S9VB 3SQBB 1D5XA 1Z9MA 7FABH 5FUZL 1XGYH 1G6RH 2ZKHH 4S1SL 2GC4C 1MZZA 1KT2A 3F3HA 3H3PL 4OKDA 4U1JB 3TO4A 4PV8B 5I0WA 1TCMA 1UZ8B 3W9DA 3VD1A 4OLZH 5LUMA 3A4DA 1FPTH 2EYRB 3VCLB 4ORGB 5DD1L 2C7FA 3FQWB 3GYRA 4X6DF 4XP5L 2PTTB 1I7RB 1UA6L 5EMYA 2FZ3B 4RNRB 3TVMA 4WFED 4FRWA 4JFFD 1EANA 3QJHB 3RUGE 3DXAE 3REWB 4XB8A 1WVZA 1G7HB 3QNXA 2N1TE 3C60A 2YWYA 4LLYB 1U8JB 4G8IB 4HAGA 1Q72H 1SGKA 4X6DE 4YHPA 5BV7B 3VXSA 4Y4HC 1OE3A 3IDJA 1RIVL 3GSQA 1OGPA 4XX1E 3ZTDC 4PJDE 5I2IB 1JBJA 4XWOD 1GZHC 5F7YC 2VDRL 2DYPA 2A38A 3CPUA 3THMH 4UUJB 1KY7A 2YPLA 2R0KH 3DMMC 1TETL 1DANU 2E8ZA 2RCSH 3QZWB 4LT7A 4L4TD 5A2FA 3LCYA 4Y4KA 3NZ8B 2WP3O 2CGRH 2IDQA 1X2TA 1FNSH 2VDOL 1BYOA 3V9CA 1BQUA 4PS8A 2JJWA 5CEZE 4HUUB 4JQIA 1R3IL 3VG9C 1E5YA 3W1ZA 3NPSC 3WXVH 5JHDD 1MXDA 2Y06H 4XVUC 2PPCA 2H3NA 3X14A 3SJVE 1CURA 4C58B 5AB1A 4E36A 4R96A 1VJSA 3DOIA 3GIVA 4U3SA 1P6FA 1HHHA 4J3OC 3L4YA 4LDEB 4HGKC 1YZZA 3VTTA 3HE6B 1MUJB 1IKNA 3IS1X 4B53A 4ZUWA 4AENB 2X6CA 1EO5A 5GJSL 1KIQA 4J3OF 2CO6B 5C0CE 3QXAA 4M7ZC 3IMUA 1E7VA 1XFPA 5AW0B 1X3DA 2Y3AA 3EO9H 3CDZA 1EVTC 4KZDL 2ICWJ 3QHZH 2DY2A 4MAUL 1GGTA 3N1FC 2WQWA 1RZKH 5J3HC 4N32A 2NY4C 5CO1A 3FFCD 2Q3XA 4EJ1C 2AGJH 3UEZA 4L5FE 3B5TA 4OUOA 5A6IA 4GI9A 1T21B 5IESL 2N4IA 3HVDA 3IRPX 4XXCA 1V3MA 2EIZA 2IH1B 1Q1JL 3E3QE 4R8WL 3GSXA 2OX9A 2DIEA 1A7OL 1D5BA 2UWEF 5DRWB 4XPFL 1MXGA 3QZLA 3WBPA 4IU2A 1OZUA 3PCYA 4K7PH 3VFGL 2YWZA 3O0RH 2D3NA 4Z7WB 5ES4B 4DVBA 1J48A 3HCVB 4MJ5B 4L8CA 1PZSA 3BUTA 4D0CA 5E23A 3TBBA 1UURA 2HH0L 3EYVB 1AZCA 2PR4L 4I0KA 1O5PA 2WNKA 1JL8A 5F2FA 3MLUL 4PJFA 3RDTA 3PHQA 5HD8C 4KQ4L 3TESA 5DLLA 3ZE0E 2A83A 3DBZA 1WMYA 4P2RE 5I76A 3K4AA 4OSUH 1JXFA 4YHOH 1J35A 5TE7L 5EZIL 3V4VL 2J8HA 5SX4I 4RX4D 4XHJC 3NIGF 3DJZA 1OHQA 3A6CL 5HJ3B 2VWEC 2XV2A 5D7IF 4WW1B 2IXQB 5DF0A 3APFA 3QUYA 4FI7A 1W6WA 1D5MA 3QXAB 1ZPUA 2R1XA 1VERA 3QIWC 1GA2A 1YLBB 2DQJL 4WVRA 3WL9A 2EE2A 3GIZH 2P8PA 3NIGE 1AG6A 2E7CA 3PWLB 1TTRA 2VSDA 3A22A 5GS3A 3L95B 5I6MA 3SYPA 4DWHA 1JGEB 5AD0B 3ARPA 4BSVA 5JA9A 3BUYA 1MVFA 5ADPH 4Q58C 4NSKB 3RWDA 2P5EA 2BPBA 4PLJC 1MPAL 2G5UA 3D52A 4IHBA 1HHJA 2HLAA 4UNUA 2Q7NA 1EEQA 2FIKA 5FX3A 1JDAA 1RJHA 4NT6A 2VR8A 5HGHB 3UBUB 1XZ0B 5E1IA 4ZUVB 1U8PA 2VJXA 4X8CA 4AW4A 5FHBL 4XBEL 5B1BB 3G6DL 1VEMA 3P73B 3MZTA 2JELL 3APMA 3AB0C 3IKQA 1VCAA 1SXNA 1MCOL 1V55B 4DP7X 2VDOB 2VJ0A 1YEKH 2A74C 5DVKA 1YPQA 4NQEA 3FQ1A 5TGBA 3MCLH 1R3KB 2YOAA 2HZHA 3RX7A 4P46A 2XWEA 2Q0ZX 2CBOA 2YUVA 4K2UH 4LBAA 4YOKA 4J2XA 1HX0A 2PWHA 4OIBA 1K4DB 3F7YA 4PPTA 1IEBA 2FB4H 5C70A 4KITB 1GZ2A 2FUTA 4JQIL 3U1SL 1G6VK 1EZVY 3B9DA 1IM3B 5K59F 2BZDA 1ORSB 1XB6A 3RUGB 1OGAA 4PHXA 4EBQL 4N2FA 3GKZA 3QPQD 3P1VA 1NCWL 2H1LM 5E2UL 4KH2A 5DI8B 4TTDD 1KJ2H 3RTQD 1YN7A 5F7HA 4PBVC 3MI6A 3Q1EA 5CILL 5AL0A 1E5AA 1FIEA 1U8OB 2WCPA 5AZUA 1CE1H 3WCYA 1RZFH 4LPTA 1KGCE 2MSBA 2K7QA 2IAMB 2YJQA 4F57L 4KK9D 1ZT1B 2F7PA 3EZ8A 4PY8J 1D6VL 4LSPH 1F4XL 4S0UA 3SDXB 1A66A 4Z95H 1SJMA 1NBZA 3SGJA 4NPKA 4LKXA 4EE2A 2QPFA 2DLTA 1ZGLP 1YUKB 3LIZL 3POHA 4KAQL 1IAIM 4KI5E 2FQGA 4KDWA 3UO8B 1ZV2A 1T2XA 5J9PB 5JQ6H 2RFXB 3MRJB 1KXQE 5AAPA 3BP4A 4L9LC 4XPBL 4JPKH 5ITBL 2CUIA 5E6ID 1WAAA 3LVEA 5E2WL 1RLWA 3SJVB 3ARGA 4HMCA 5DJZB 2X2JA 4FC3E 4DK5A 4U1IB 1BD2B 1GL4B 2NNXA 3ZKXC 5F7FA 2C9QA 2QPUA 2WLZA 2FEDC 4F8TA 5EC1A 1ONQA 2UVEA 2VR7A 3V10A 1TEGA 4P9HH 2XBDA 2DM3A 1IAOA 4LB8A 3B5HA 5C2UB 1PZAA 4GJXA 3QCUL 5C6TH 3WSRA 2FSDA 3SE4A 2MMXA 3W0WB 4NNXB 3MLXH 1DUYA 5E1HB 3V6BR 5SWSB 4YWGH 3ZGHA 3CZJA 2IG2L 3IEAA 3VO0A 3WKNA 2CA3A 2DJSA 3NH7L 1RJCA 5KVEL 1WTLA 1V7NH 3MROA 3WEAA 3R18A 4HJJH 1WHPA 3FQRA 1YQVH 2IVFC 2I07A 1AJ7H 5IBTL 1TVBB 3HNVL 4G71B 4RRPG 5F71A 5C08E 5L4MA 4UF7C 4XZUA 2CWRA 3C9NB 3MXWL 5LCVH 2JTDA 2P4AB 4U3XA 4B9ZA 3KLSA 1CLZL 1MFBL 2ITEA 4XB3A 2FGZA 4QYOA 1ET5A 2J72A 4XH2A 2BRQA 4I2XA 5F7EH 4NQVA 2A0LC 2IWGA 1EGJA 4AYMC 4WNQB 3ULUL 1KMB1 4H1LG 3BGAA 1OTTC 5E1GA 4JRYA 4NN7C 4DP9X 4PJHB 5HVHC 2EVFA 1SXCA 3CDZB 2YJLA 1R1CA 3IRZA 4JFPA 3BRGC 3I6LD 2KH2B 1KCSL 4JFVA 2COVD 3IF1A 3UTTD 2AQTA 4RFOL 5EEYA 3MNVB 5PCYA 3SKUD 1UD8A 2WZ6A 1FDLH 2OW7A 4OGAC 4UM9A 3I50H 2GW5A 1R75A 2MTPA 4AV0A 3BN9C 1JRHL 2V37A 4P2OB 4LFHD 3VXRB 2BNQA 3MO1B 4O02H 4WENB 4C4BA 3FB8A 4Y19A 3ULVF 3FUIA 3IMVA 4XPAH 1F45A 3RYMA 4K8RD 3DWTA 5IJVB 9PCYA 1RJYA 2EABA 4TSBH 4AM0B 2BSBA 4BA0A 2ZOOA 1VFUA 2APVA 4XXWA 1SY6L 1ZXQA 2NY0D 2ICEB 5CKAA 3N85L 2J5LB 4WI2A 3T8XA 3OAYH 3OL2A 3ARVA 3VRLF 5BS0A 3OGCB 5D7HA 1U8OA 2Y72A 1WK1A 1JZ5A 1AO7D 1A7PL 3TOPA 3MN8A 1WBYA 3HN8A 3VG0L 1AQKH 1DBKL 4IS6B 1CTMA 2ICEC 1DBAL 6FABH 3CSBA 2CRMA 1QLRB 1XIWC 1NFDB 2DTML 4W1TA 4LKXB 1B2YA 1N0LA 5J13C 3QNFA 3TF7C 2EILB 3GFUA 4CL7A 1U41A 3GM0A 1EDYA 3T8MA 5HBBA 5GS1B 4RMRA 3WNLA 2XFXB 1PY0A 3VFGH 2XKUA 4ZRGA 3G04A 1URZA 5LVEA 1FCCA 2PPDA 4AZ8A 4IQHA 3FSWA 3IE9A 4WSJA 5BZWB 1F8TH 5ITFB 3LY6A 3BZFB 2X28A 3KPSA 1UZ8A 3P7FA 5DRNB 2OMUB 4JRXB 2NY5C 2ZKWA 3QJTB 3LQAL 1C5CL 1K8IB 5F9AC 5FW6A 1JHLH 5LXGH 3BUDA 2AEPL 3JBG7 3PWJB 5KUMA 3UCRA 1NGQH 2EYSB 5F88B 3DX9B 1KUMA 1UB5B 4XPHL 5CEZH 2N01B 5EU4B 1WBXB 1X5GA 3PGDA 2GSGB 3IGAA 3MA7B 3MTRA 4LLVA 3FB8B 1YRKA 4WTQA 1XH2A 4N5UA 4NFBA 5DFVC 3REWA 4DK6A 2PYEB 3VFPB 4WFHD 1K8DB 4JJOA 1RERA 2P28B 3ETTA 4BK5A 1U0NC 3L1OH 4HFWB 1V05A 3WTSA 1O7DC 2A6KA 3KE0A 4R4FH 1ZVYA 3HPLA 1BXUA 3CDYA 1INEL 1AOZA 2GUOA 3QFDB 4GI0A 3HAEA 3UBUA 2BW4A 5D2NC 4HF5H 1M7IA 2OK0L 1I9IH 1HXMB 2CL8A 3OF6D 2NY6B 5KEZA 2R0ZL 2J1KA 3MC0A 5IGXH 1YPUA 3KWTA 5AYUH 4WNQA 4JKPH 3BC9A 3LB6D 4JFEA 1I1AB 4WJ5A 1HYRA 3QEGL 4OGXL 1PVHA 1ZSDA 2BNQB 4HYTB 4LARH 4JHVA 3D9AL 5DJ0B 4LIQE 3CFNA 4O2FA 1YECH 4PJ7E 4GT0A 4OGQC 4JM2F 3ARRA 1MLBA 4F8NA 4IHOB 1CDUA 2WLJA 4MKTA 2FECI 4TQEH 2AJVL 2QQQA 2WWMC 3LKRA 1F4AA 2X3BA 4WQQA 4NXKA 3NRPA 1HKLH 3WDIA 1ZCRA 5J6SA 5DS2A 4EIBA 2IPUK 1BF8A 1OB1A 1MRCL 4BV1A 3GEWB 3KGTA 1OGTB 4PGBA 3AS1A 3RURA 3L3OA 1NIAA 3BSHA 3EYSH 1NANI 4XRCB 3C08L 4XNQA 4DTGH 3LS4H 1P4LD 1SOKA 4EUPA 1J8SA 3D39B 1PFCA 1N6QH 2ICWA 1A7NH 2L7JA 4TUOB 4ZX4A 1YEDA 4JDVA 2EDYA 2DN7A 2XQYA 4M1DL 1QKZH 1KPRB 5E9DE 2E47A 2EIBA 2X4NB 1WWWX 3U0WL 2GEQA 2EXYC 2HX9A 4EDXA 4M8QA 1HQRA 1LL1A 1UWXK 3HB3D 2XDHA 3KYMA 1L3NA 1I7TB 3LKPB 3QJRB 3ZJAA 3B4NA 1SL6A 1Z9SB 1DVQA 4IK7A 1OZ7B 1BQRA 4FF9A 5BW7C 2ZIDA 4MS6A 4C56B 3NJVA 1YC8A 4CGUB 4Z7OB 4MVBD 5MERB 4GBXD 5JZ7D 1ADQH 3K2KA 4H26B 4MHHG 3MREA 4ISVA 1T21A 3RVVD 1NFIB 2X7LB 4FG4A 1QFHA 4LPWA 3ZKMD 3OJVC 1VACA 3MZGB 2VDPH 5ILTH 2HUEA 1D7BA 1HH6A 3GIVB 2Y07L 4TNWF 4PJ9D 1BFVL 2G9HB 1MFAH 1M2VA 1OKEA 3LPPA 1SMAA 4JPIB 4HH9B 1CU4L 4Z7IA 1I8KA 1RURL 1WC7A 2YSSA 1BD2A 4H8HA 2MCPH 1T5KA 2AEIT 4IGBD 3U79A 2WCGA 5TDPA 3VXRE 4ZNEE 1WFIA 3Q0HA 3FDWA 4OFIA 1QASA 1UD2A 4HFWA 3G5XA 4XCCH 1NMAH 4AM0Q 3HG1A 2YZ8A 3DYMA 3TA3A 2R56H 4HBCL 4WLCA 1XTMA 2DQUH 3FO9A 5GZOA 2OCCB 1Q38A 5BVPL 4H13C 3PWPD 1T22A 3LZOA 4YE0A 5LG6A 2VIRB 5J12C 3QEQA 1DUZB 1RDO1 3JWDC 1RZGA 3VGBA 1D2OA 5I18H 3BJ91 2R7EA 1FO0A 1NSNL 4NQXA 4X6FA 3QCUH 1E40A 1I9RH 5HHNB 5EZOL 5D96B 1WGVA 3RNQA 4G43A 1CFQA 2EDNA 1U33A 3IJSA 3WIIL 1J9QA 1H8OA 4OZIA 1KC5L 1N59A 4J6MA 4DEPC 4X2UA 4YSDA 1K2DA 1N19A 4NJAL 5BQ7B 4HC1H 4XNMB 3GSVA 3RB5A 1DN2A 5EBGA 4J6PA 5HI5D 3O4LD 2ALWA 2MFNA 2GUYA 4TOYL 3NCFB 2CCLA 1ZTXL 3MRKA 2NRDA 1QEWB 3KL5A 3O11B 1HHJB 2CJUL 1NUDA 3ARUA 4G6FD 3NSFA 4FQJH 3U7AA 3ULUF 1H15B 3EF7A 3ZDZF 1CZ8H 1S9VA 3HR5A 5DVPA 4KI1A 5TE6H 3F83A 1JUFA 1L5GA 4IS6A 4RFOH 2YARA 4LSTH 1OVZA 3HZVA 2V2WB 4JZJA 5PAZA 4ORGA 2ZZUT 4QD2E 2YEQA 4ZAKA 2YD4A 2V5YA 3WNNA 5D6CA 4KY1H 1ZTXH 4MJIB 1S46A 3MRIA 1LWHA 4MQ7B 2WSKA 4OD3L 4DT2A 2BVUA 1X4YA 3D0AA 1N5AB 5CEXB 5HDWA 5DJXA 5CP3H 4OD1L 3SQBA 5F7AA 2KMWA 3N5AA 2MWCA 2HLAB 4H1LB 1AXTH 3GQFA 3VXUE 4F93B 4G6KL 4U2ZA 2Y2TA 2JQZA 3DA0A 3MRNB 3S98A 4LNVA 3UAJA 1U8HA 4K7PY 3FT9A 3UG5A 4BZYA 1VACB 3FU7A 4JHUA 1A0QL 1M6OB 5L0QB 1AS7A 1SDDB 3VYJA 4XAWH 2RQEA 4XXDA 5FS5A 4L05A 4ZFGL 4OLUH 5DUBB 1AQDA 5JXED 4P4KC 3CZLA 1CG9B 1OZ7A 2IV9A 5TDNA 2Y6TE 2WXOA 2GTWB 1SEQL 1ZVSA 2J6WA 3TCLB 4PJDF 1P1ZB 1WEJH 4GRLC 5TPWL 1KWTA 4F7TA 1J0IA 2R2BB 5F6IC 1KCVL 2HFEA 4RMUA 4L1TA 1QO3C 1F18A 1SDAB 3IKPA 3UBXA 3LD8B 1MFUA 5JO5A 5CWSA 3BX4B 2GHWB 2WLNA 1S9XA 1Y7VA 3NPSB 5F96H 1JNNL 3MLSL 3S5LG 3UMTA 2E9JA 5F3BA 1MI5B 3MBWB 1Y17A 3WEXB 4LQFA 5KBKA 4X5WA 2CLRA 2J88H 5D72L 1GYWA 5FF6B 2JB5L 2NY1D 2AVFA 2VCOA 3TEYA 4XP6H 3OKMB 2DL9A 3FQRB 1XV8A 5HJBA 3EBAA 3ULVD 3QISA 4GAYB 5DD3H 5E6RB 2VKWA 4HZLB 1KYFA 4WW2F 1WZ1H 1HEHC 4K7FB 4ZG1A 3IGLA 1PX3A 4M6OH 4XP1H 4Y4FB 3S3BB 1WSST 1PSKH 2MIZA 3QNYA 4ILDA 1B0RA 3T4AC 1A14H 1G9MC 2J8UA 5KSVA 2GIYA 3U1PA 1EK3A 2ZUSA 4J7RA 5JXAL 3TEZA 2Y7OA 4HAFA 1CO1A 3CU7A 5DDHB 1G43A 2H3NB 3X14B 4B27A 5B39G 3OR7A 4KJWC 1CWVA 2BK8A 3GB7B 1V5JA 5GRYA 3TV3H 4Z7OE 4J3SA 3BPCA 4KQ4H 4L5FH 3WEMA 4G6ML 1BJ1J 1Q1PA 5B4MC 4W9LC 5I23A 3RS1A 3SJVA 1ZE3H 5LXGL 4F9PA 2GIMA 4JM2D 2R59A 1JE6A 3ILEA 4I3RL 4QGYA 4ZAKB 3LRLA 1A3RH 5LBSH 3DX7A 4FG6C 3S36L 5IF0B 3K4DA 5GS0D 4NZTH 1MCIA 2VR5A 5I6NA 3RQ3A 3G6DH 5EOTB 5I1JL 4PRBA 4YDJB 4Y7MA 1JGIA 3C8KB 4XBPA 1SXZA 3FFDB 3GLEA 3LD8C 3MXVH 5IROC 3UTSE 4AWJC 1I85A 2VLKE 1IBBA 1VESA 4PJGF 5JHLA 4ZPTA 5EUOA 4K7PL 1T3FB 3N44B 3HZYA 3U0PA 5HHMB 1J34A 4QTFA 2NT0A 4ODXB 2QV4A 3GD1C 1HH9B 4JQVC 1L7TL 4FLRA 5DMGC 1DLFL 4Z8FH 4JZOB 1QO3B 3O4OB 1ZLVK 5TE4L 4FJYA 2D7TH 5C0IB 3GGWB 1D5IL 1OQXA 1SYSA 3PWUA 5FECB 1QBML 3PWNA 1TN3A 2XRAH 4NO5B 3ULUD 1HWWA 1I3VA 1BAFL 1BVNT 2YC1A 3ATFA 1J9CT 2XVKA 1LMKA 1BQHA 5EZJB 5MEOB 1GZQA 5FYKU 3JWNC 3OKEB 4XP5H 1SB2B 5AVYB 4OLYH 2Z9TA 3SBQA 2GAZB 1KN4H 3QUXD 4NGHL 3IDIA 4NFCA 1WWBX 4AJWA 5TF0A 2ED9A 1ZDSA 5HJGA 1AQMA 1QLEB 1MQKL 3C6SB 2YS4A 3IKCB 4M93B 4FP8H 2XX1A 2UZYB 2G2PA 1QRNE 5CKGA 3SKNB 3FZUD 4LHUG 1NCWH 1MEXL 1U8IB 5DJYA 5HGAB 5HGBA 4HUVA 1BVLA 4HP5A 2X4SA 2EJ1A 2RB8A 3TZVA 3VXNB 1IAIH 4JQVA 4EN3A 1GW0A 4NGHH 4KGJA 2ED7A 2HMIC 1ZK5A 2HFGH 2XIIA 1EGJH 4NZJA 3H9SA 4G9DB 4TTDC 1O6VA 4GMTL 5I74B 3E0GA 1KJ3H 3AITA 1PU0A 1OPOA 4YSRA 3U48A 2HTKC 3X13A 2WN2A 3O3DB 2H2SC 5FA3B 4V1DD 2AAAA 4UYPA 5L2KE 2VIRA 4R90L 1BEYL 5KN5B 5AD0A 2CSPA 2X7LA 5F1SA 1UXLA 4ERSL 3WFCL 1Y6NR 4Q4EA 3BQUA 4MNGE 5GZNC 1KLFA 5IFAH 1N4XH 2VN7A 2JIXD 5B22A 4QHMB 1RIHH 3RVUD 4JHBA 1U8QB 4W93A 4QXWA 5DEZA 1OF2B 4DFIA 5IHUL 3FF7A 3FTWA 4HUNB 3K8MA 4HJSA 1YCSA 2LLLA 4GAYA 3MUHL 3FT4A 4PJ5E 1KGYE 4N0UB 2Q6WB 5IB2A 5EU6D 1JDDA 3RWEA 4OGXH 2CUHA 5LXVA 4P23A 3PGFH 3BKMH 2WNWA 3HI1A 1IAII 1DBBL 3NJKA 1O7VA 4LCWA 2MPAL 1PDKA 1PZ2A 1PKOA 3CV5A 1FPTL 3F6IA 3OKDB 3RILA 3VXPA 4PRID 1PYWA 2QSTA 2EQDA 4KQ3H 1C12B 3KYNA 3RIFK 4CNIA 1OCWH 1UM6H 3BLBA 3ETBF 3JTBA 4EZLA 1HTYA 4FQXB 2J71A 3QWOB 4G7VH 4JRLA 4DETA 2FQFA 3L9RA 2FYVA 3NABH 1UA6H 1FL6A 5IQ7H 1W72H 5C7ZA 1E27B 2BNRB 3LPOA 2BZ7A 4Q74A 4WHYH 1NPNA 3NYKA 2DLFL 2DH2A 4LSUH 3GLZA 2R69A 4PG2C 5D7IB 3T0EB 4E2OA 1A1OB 3CPLA 4M43H 1IGML 4PJ6A 4TPRL 1QW8A 5CP7A 1FA4A 3GSXB 4N38A 2CCWA 4FNRA 4JDTH 2G2RB 3F05A 2K7PA 4ZESA 3I9PA 5KYUB 4KI5F 4C4KT 4NKQB 1NBYB 3K0YA 1G1QA 5SWSA 4LL9A 3WO4B 3LIZH 1CFNB 4IIQA 1YPZE 3VXMB 1SBSH 1U9KA 3L81A 1U8HB 5KS9B 2GY7B 3SD2A 1JF1B 4EZKA 2MTAA 4Y9EA 3E2HC 2DS4A 2QQLL 4HD5A 3S88H 1Z1WA 3VGAC 2K9FB 4FTVB 4K55A 4GIOA 3II3A 5LBGA 1PLBA 1YPZF 5CEXA 1A22B 4FQ1L 4G3YL 2BSED 3INUL 1ZPLA 5IMMB 1SDDA 2FLRT 1XF3B 4L8SC 3ALTA 1HI6B 5ETUA 4KJQD 2RAMA 3HE7C 4ZX3A 3MRIB 5IESH 3MJ6A 4DVRH 1SY6H 1U30A 3L16A 1J1PL 4XMPH 2P1YA 1LE5A 3VG0H 1N9PA 1INQB 4TSBL 4KH9A 1I1AA 3N41F 5BNXD 2CHXA 5FB8A 1A64A 3BAYA 3EHBC 5JNYB 4DN3H 3QJSB 3QT2A 5I6KA 2F2HA 3T08A 3U46A 5EORH 1E8ZA 2AEOA 3FCBA 4OZFA 4FA7B 4K9EL 3C87A 4GSQA 4HIHB 4YQXL 4LP8A 4GLRH 1RUPL 4DEWA 4WR9A 5GRJL 4HIPA 1L9SA 4OF3A 3K0WA 4PRHA 4GXVL 2IG2H 5C07D 2CRZA 2X4OA 2DWDB 4BKLB 4HK3N 1FUNA 2ALAA 2BP5M 2ID5A 5IM7A 5FO8A 2NSMA 2YZ1A 2F5BH 1HHGB 1SM3L 1KCRL 5FYKL 3DO7A 4OFQA 4JVUA 2Q2EB 4LRIC 4NWTL 2I60H 3H9SE 5C3TA 3X11B 4AH2A 3QNXB 2IPKA 1JZGA 1Y18A 2XA3A 3O6LL 4MKMA 4X5LA 2Y9RT 3T9WA 4XTRC 1RDM1 4BZ1H 2H6PA 3VE0A 1KWWA 5F7EL 2CIKA 3TBWB 1T1YB 1CXEA 1AKJB 1XL4A 2CGRL 4RNRA 4AK1A 3O8XA 2PPAA 2B14A 3B3BA 4O2CB 3MXVL 2A77H 4LRIA 1N6VA 3ZSSA 4MLIA 3AUVA 3C12A 5ALBL 1WZKA 1R3JA 3PQYB 1CFQB 5AVUB 4HFUH 3UP6A 5LNGA 4PV8A 1H9VA 3CD4A 4ODHH 4X4YA 2GI0A 4F20A 4GYBA 4RFNC 5I8CB 4GKNA 3UZVB 2JFCA 5IJCC 1OP5K 5AZ2H 1OTUD 2WLHA 2WGXA 2VDNB 3TASA 3ZRSA 4G83A 4AM0A 4OF8A 1T3FA 3RJOA 3D0LB 25C8H 5E4EC 4N6QA 1CE1L 1GJUA 4NKIL 5HD8D 1W8NA 4U1KB 2FT6A 2AQQA 4JVWA 2Z31C 4Z7UB 1SHXA 1KIRB 2B8OT 3N6YA 3KL3A 3MHZA 2DQTH 1JK8A 3QG6B 4UNIA 1AY1H 3D48R 2TSBA 4BGDA 2PETA 1J18A 3DX7B 2GITB 4HIQA 5ICXB 1PSKL 3FNKA 3L7FA 3RB7A 4EKXA 3CQQA 1G9NH 2XQBL 3K2IA 5LCVA 4FTVA 4M5SA 4AQZA 2BS8A 3NEEA 2W07A 1WG3A 1I3GH 1KCBA 1MI5E 4LIQL 2IMNA 1NLDL 2G5BB 4BQBA 2C4XA 3BKCL 3EJPA 3TFBA 3HNTL 3QIBC 4Q8BA 3EJCA 1S7RB 3GXFA 3MMEA 3CZGA 4IIQB 3W11C 4D9QE 3VVWA 4GRWE 5KYYA 4CSZA 3MUJA 2X4QB 3FKUS 3FXIC 3HS0B 3Q8FA 3CCKA 4ZW5A 2CUMA 1EUUA 2I26N 2ZXAA 4N0UE 1BYPA 4UIKH 5KBNC 4N2AA 2P49B 1IGFL 5D7SL 1G94A 2HJKA 1Q94B 3KNBA 4OLXH 4DK3A 4U1NB 3DMMD 4JG1L 1LO2L 4L0ZA 1CCZA 2Z93B 1ZLDA 3NJHA 1KJMB 4JPVL 5EBMA 2HUHA 3U82B 2Y36H 3VDAA 1S9YB 4NLHA 3RX5A 2GY5A 4M4RA 4PUBH 5D1QA 3HCVA 4C83A 3VUAA 2RACA 4ATWA 5IFHH 4GS7B 1A6WL 4PVNA 3ELAT 3QRGH 3VI4F 2WN3A 4TUOA 2YXFA 2E7HA 2J5LC 3V7AE 5A40E 1R5IA 3U1SH 4I4WA 3O3AB 3KXFB 3Q5OA 5FYJL 3KS0H 2KLTA 4U1LB 1DJGA 1A5FL 3GMMA 2SODB 3QE5A 5TE7H 2BDNH 2XWTB 5F9DC 1DLHA 2Y69B 2CMRL 4X9FA 2R29A 4MAYC 3RIAK 4DZBA 3QQDB 1U93B 2OSXA 4YAQA 5JHMA 3ZDXB 5C07B 5IJKA 4PBWD 1FH2A 4DGIH 3WXWH 3VDBA 3G84A 2Z8VC 1O9ZA 1UM4L 3DX2A 4Y2DB 2EXYD 5FM4A 2BRSA 3UAFA 3I3BA 1EO8H 5F9WB 1D9KD 1QFUH 1T03L 3KJ4B 5ISZB 2WM0A 4M00A 4YSAA 2RIBA 3QXTA 1P7QB 3WUZA 4HCGA 2BW5A 3IFLH 2WB7A 3MRFB 4NQUA 4ETYA 3C5ZD 3T0XA 4F7EB 1ET7A 1TLKA 4A2HA 1BIIA 4XCCL 3BDYH 2DQHL 4FULA 3V6ZA 2BCKB 4K4KA 1TZIB 3BKYH 5IHZB 5JPMB 3O3DA 1WS8A 4JPKL 5LHDA 1BLNB 4JO1H 4PV1C 5IVNA 4UQBA 1T04A 4B7LA 1TTGA 3QHFH 3NJNA 3N2JA 1BZEA 1QUNB 3GHBL 4IBYA 5TTRA 3U0TA 4BK5C 5I8CA 3IJEA 1TPXB 4OFPA 4KQ0A 4K5NA 1CLCA 3WI9A 2VLRE 2XT1B 3S5YA 5FGSA 5A43C 5F97E 1KZQA 4WUWA 2NUTA 3RFZA 1N2RB 2WAQA 5KSBB 5DEGB 2C8NA 4DP5X 2KZ1B 1FH5L 2OMYB 2H3XC 5D7LB 4JZNB 1INDL 4O9HL 4OUUA 4ZTOL 3OB8A 3MODH 4LOEA 3KVQA 3VGEA 2YD1A 5D1QD 4LF3B 4RGNB 4IU3A 2QHLA 4U1GB 4HWEH 3C6LA 4M1DH 4LHQB 4XMTA 3HHSA 3NJLA 4S0HA 5D7KD 1QTYT 1BD2E 2AXFA 3DVGB 5BO1L 3CZUB 1AGDB 2MNWA 3L3DB 5E00B 2A5UA 1LE9A 3B2PA 1CYWA 4HHGA 5GHWH 2EIKB 1DJSA 1N0LB 4YEEA 3HG1B 1WTGT 2A6IA 5CHNB 2NMSA 3HZ3A 4JZOA 2EDOA 1Y6MR 4FYQA 4ES8A 3HFMH 4I48A 1TQVA 2W80C 1YO4A 2FO8A 2YPKA 4LMQI 5SV4A 4A7GA 1BG9A 3NA9H 4QKGA 2UV3A 4S10A 1TETH 2MCG1 3DBXB 4QRAA 4ZTEA 1IEBB 3CFBA 2MJWA 4NNPH 2OR7A 3RWDB 4PLJD 5IT2L 4ZI8A 3L17A 1ZK9A 3ARBB 3LRGA 4JG9A 3SEPA 5JNYA 4YDJA 4QT5B 3MJGX 2B0SH 3LAFA 3GHEH 4PRIE 4OZIE 1KF9B 3IDGA 5C3IA 3PL6A 4DPAX 1OTTD 1ZHKB 4ONFL 4OIIL 4WI8A 1DBKH 4XNYL 2R51A 3LIUA 3TA3B 3Q05A 3MAWA 5F9OL 2KC0A 1J5OH 5F7DA 5IK3A 3R7RA 5D1XE 3ZHGA 5DHEA 4EQ3A 1QFWI 1HHKA 1ZSHA 2HX7A 5C0DB 1OEZW 2COQA 1SOXA 4OLZL 2XKNB 2QLVB 1U6AH 1M2VB 1H0DA 3S5LB 4G2AA 4AITA 1KWGA 4U1LA 1NAMA 3AREC 4PLNC 4X5QA 1MLCB 2ZSVA 4A6YA 4N8VA 3BUPA 4LVNC 2R0ZH 3FOMB 1IC7L 4P57A 1U8LB 1MFDH 1P2CB 1SUJA 2YAFA 2H5UA 3EYVA 2N7AA 4UBDD 3N40F 3GZPA 4QO1A 3CVHL 1HNFA 5E5RB 2ZCZA 5L2KB 1CDCA 4Y8AA 3OG4B 1EGGA 5C7XL 4LRNL 4OF5A 1D7DA 1QA9A 3RTQC 4PEEA 3M17B 1NMCB 3KMB1 4HJUA 4KJYA 4MJ6B 1MF2L 3QG7L 1TQCB 4M7LL 4BCYA 4J1UB 2ZSWA 3MLUH 4XMKL 5LAXA 3QXDA 1J8HA 3QSKB 4KQ3L 1XGQA 1AHWC 5C0GB 4YDLC 4DZ8A 2YA0A 1XIWD 2NCMA 1ZKAA 2W65B 2CBPA 4RAVB 3WH2A 5FW8A 1HWGB 1GPOL 5FO7B 2X1QA 2BSTB 5GRXG 3FF7C 4A7UA 1WZ1L 4LSSH 4GEJA 3ZXAC 4WY7H 1I9EA 1WCQA 1E28A 1P5VB 2DL2A 5DUPH 5IB4A 3TURA 3QDJD 4ZUTA 2NX5A 2MQ3A 2NY1C 5ABAA 1BYFA 4PWJA 2J88L 3FPYA 1OF2A 1A6AA 5GGVH 1X5ZA 32C2B 5C0BB 3ZT5A 1SJHA 1NAKL 1HHHB 4L4VD 5L4JA 3A67H 5D7IE 3BSZA 3T0EE 3AVEA 1DVZA 3PJNA 4G6MH 5I1GH 3T77B 3ZE2B 3HZKA 2ITDB 4APQB 1WUNT 3MCYA 3TV3L 4P23D 1VAHA 2WBJB 3K5SA 2BVPA 5J11B 2R0LL 2FECL 4FFYA 1F3JA 3OQRA 5I1CL 2W9DH 1UTDA 3WLBA 2X4PA 4LGSB 2HT4C 5F7DB 2WKOA 4Y4KD 4N0RA 2W07B 4ZW3A 3U25A 3HRZC 3FB7A 3QWQB 2UZIH 1NJ9A 5CNHA 3RGBA 4Y5VB 4LPCA 3BPLC 3LRKA 3AT9A 2A9ML 2D7MA 1L7TH 1YAZA 1YEGH 1M7DA 4TN9A 2JLPA 4EI0A 3SGKA 1KWVA 1ES0A 4OZGB 4W9KC 1ET8A 3LHPH 2IDSA 1TKWA 4WUUA 1A9BA 2MOVA 5DLML 1IKFH 3AT0A 4KV5F 4HCIA 4N0YL 5ICUA 4G80A 5JIDA 2OTPA 2VRPA 5F3FA 4ELMF 1M42A 5MENE 1JGLH 4PY8I 3FH7A 15C8L 4WGWB 3TYGL 3ZDWA 2ATAA 3OXSA 4MLSA 4HPOH 5TQ2L 3MV9E 1I4FA 5GGUA 1TJIH 2WNXA 3GBNH 3A6OA 2LR4A 3VFNA 3TONA 2J4WL 5C0AE 1E4KC 4WI9A 1F6AA 1DP0A 4O58H 2FH6A 2LFGA 4OGAD 2Y5TA 3GHBH 3ZL2A 1R24A 3IWUA 3WJMA 3W5NA 1SY6A 1P4LA 2V3EA 3BN9D 3STLA 4JLRA 4X6FB 1TF4A 4ZFQA 3TO2A 4EN3C 3GXDA 4F8LA 4FA6A 5I2IA 3ULUC 2MRYA 2WB1A 1LEGB 4IRJD 1VZHA 4OCXL 2ODIA 4KTGA 1UC6A 4K8RC 1T04B 1CL7H 1YMMD 5AW1B 4LLYA 1VKXA 5DD5L 2ITDA 2MNJB 1OAKH 4HSAC 4PJHF 4WO0A 4MQXD 2X5PA 4JGJA 5E5MA 3HAEG 1EXUB 3ESPA 3V6ZB 3S3JA 4DCQA 2FD6L 3F7RA 3IDNB 3G5XB 3V0IA 2V8MA 2CMRH 3EJYD 3R4DA 1TR7A 1TO5A 5LDSA 3D39E 4R7XA 3WY4A 1T8CA 3CMGA 1WC7B 4HMEA 3BT2H 3Q13A 4XR8C 5GS0H 4HH9A 1NGYA 1BBJA 4OZ4A 1IC1A 2OULB 2WUCL 1OAUL 4JPSA 4PJXE 3V8OA 3U30B 4PRHD 4UT6A 3NEXA 3BQUC 1OIOA 5IIEA 4DGYH 3AABA 3GB7A 5IG7B 1GC1L 4MNQD 4K23L 5EC2A 1J10A 3GLAA 2BLFA 2BX5A 1CTNA 2ADFH 1YJDC 4JFDD 3EDDA 4JREC 4JN1H 4TYUA 4XAKE 4KFMA 4P04A 3AQZA 3H0TB 3P3SA 1O9VA 5BXFB 1T80A 2VZVA 4KUZH 3B6SA 3ZYIA 1UYWL 3A24A 3IFPA 5E8OA 5DHVA 3SQOH 4AG4H 3U4EA 3EXLA 1KGXA 2QQNH 4KTEH 2NZIA 1RZFL 1WZMA 4NRZB 3FL7A 1G7LA 4KKQA 5IQLA 5T3XH 1UWEL 3DROB 3CQPA 3SPJA 1R14A 1KYOK 2UXVA 3BGFB 5IBTH 1Q9LA 1ND0B 2ADGA 1JZEA 2C1PB 1JRHI 1PX4A 4N8CL 4S2SB 3MRPB 2FWOB 1U8MB 1I9RL 1R33A 1VB9A 1QBBA 5BRZE 2AJZA 2F19H 4FHKA 2B2XL 1OB1B 3ARFD 3WFBH 3K81A 5D2NB 3U83A 4P99A 4ZSOB 1EZLA 2WXMA 4G72B 3R8QA 5IBLD 1ZHBA 4TUJB 4M1GA 3CN4A 2OR9L 3P30L 2PYFB 4MXQC 2Z93A 4L4VB 3TNNA 2I7SA 5KW9H 1PG7L 1TVBA 4NZUH 2YD6A 2YFNA 4N5ED 2DMGA 4R2GC 3HRZA 2BRRL 1KIQB 1PLGL 4XO4A 4ZRWA 2BP3A 3O3BB 2IH8A 3GXUB 5HI5C 1YG9A 2EEBA 3QDJB 3OX8B 5CAYB 5MEND 3FOMA 4GOSA 1RURH 4YFDB 3V0JA 3EH1A 4PWKA 3VYNA 4OD1H 3ZMRA 2V33A 3EYUL 2MCAA 1K3ZA 1XEUA 1KIPA 1C16B 3M1BB 4Z7UA 5FA3A 4Z7NB 2TAAA 1RZKL 1OGAD 2XPZA 4PRIA 3IGFA 4G3YH 2YMOA 2QTVA 3GHEL 5C0BE 4DIXA 4ONGH 4XC3H 2MCMA 4AMKL 2Y2WA 1EFQA 4B9CA 4NFDA 3V4PB 2G2NA 1R3HA 1WH0A 4EI5A 2FX9H 2IGFH 2NY2B 5C07E 2R0WH 1NWOA 4UQIM 5D1XA 2IFGA 2BFVH 4EKJA 3RAJL 3MFFB 4MCZB 4N85A 5JHLL 4PSRA 4LKCB 2MQCA 5T5FA 2CALA 1LEKA 3ZPDA 1Q90A 5B1RA 3FTZA 1G9HA 1E6OH 1I8MB 4H8QA 4J3VA 3BFWA 5C7XH 4YHPB 3SDXF 4EPSA 1W72L 2C4FT 4YXKH 1S7UA 4MDJA 2I5YL 1RUPH 4NJAH 2JKNA 2WXQA 3RE0A 4KXCA 4PJ8C 3RGVC 3KH3A 1VF5C 2HJLA 3N43B 4AK2A 2M1KA 3QJHA 3HB3C 3VXUB 1LD9A 1NCAL 3F00A 5E9NA 5JHLH 2VAAA 2JQMA 3G6AA 3IJ8A 3LVTA 4N87A 3WU1A 3GDBA 4X6DA 5D5MB 4GG6F 3V0GA 3BCDA 3H56A 4K5MA 3SGDI 1KELL 3WTYA 3L1OL 5I1IH 3VD9A 3IJSB 1H6EA 3QUYC 2YLHA 5DR5L 2CIKB 3W9DB 2H9GA 4Y1AA 4WWNA 2A1WL 1BLNA 5K93A 3QUZB 4NDMA 5KBDA 1M6UA 1FFPB 2APXA 4XBPB 3SE8H 4K8RH 1IGCL 4BDVB 3C6LB 3RJDA 3FO0H 4YZWA 1VPOL 4OCRL 3ZU8A 4P46B 3GRWA 5CJQL 2XY2A 5C2BL 3QDGA 4D8OA 2R2HA 4MMXC 1GPOH 1RKRA 1CK0H 3MV11 4G8AC 5BS0E 3K80A 3V5HA 1MG3C 1MFNA 4EDWL 5LGKE 2ZUXA 3UJJH 4MASA 3BPNB 5IV2A 1IQWL 4LSSL 4M03A 5FIEA 1J5IA 1KY6A 3EO9L 4LSQH 4XNBA 1UXSB 1EX0A 1ZLUK 3FO0L 3RZCA 3ULVC 4ZPVA 5AYUL 3E38A 3Q06A 3QI9B 3QQNA 2WBJA 3WD5L 4F1SA 1V3KA 3VX0A 1CI3M 1LHZA 2E59A 4WUKL 5JPMA 1KJ3L 1WP6A 4ODTH 3D6GA 5LBSL 3CC5A 4JO4L 3ROLB 3NOIA 4X83A 1JGVL 4S1QH 4AUJA 2OS9A 4KJWD 2ZF9A 4LVHC 3ZKND 1T1ZB 2OQJB 3H4HA 1PZ3A 2R69H 4QRTB 5D1XC 4G70B 4UQ3A 3O8XD 5B39B 4YDIH 5K9OB 1MWAH 5KVDH 3MOBL 5B7MA 4WUKH 3QULA 4RIRA 3O41A 4UOW1 4MA1C 4A2GA 4JO4H 1RIUL 3JTTA 2BIQA 1JPGB 3W2DL 2CDGB 5C9JA 1D5BB 1BMGA 2VC2H 5D1QE 5EN2A 1SYVB 1BAFH 1QVOA 3O4LE 3FT2B 2KLSA 3NTCL 2CR3A 1D5IH 4KX9A 1JHLL 1D6EB 5DHVH 1IBYA 5C8JB 4J6RH 4Z8FL 3OKKB 2OI9B 1KZE1 4OJYA 4X6EA 1P1VA 3QNZA 2X4TA 3H7BB 3VA2C 1ID2A 3C9NA 4I9WD 5IJDC 3JWDL 3B56A 1SEBB 3ARGC 2J25A 3EOTH 3ES6A 5D7KE 1NEPA 4L3ED 4NRYA 3N40P 2KMB1 1A1MB 2L7EA 3LYRA 1RU9L 5ICXA 1X5KA 5IMOB 4LVOB 2NZ1A 3LIZA 1ZS2A 1KBWA 3G8LA 3SO5A 2ZE0A 3EYOA 1ZV9A 4BRJA 4F3FA 4PREB 4OJEH 4ERSH 1A9EB 3ROLA 3M8OL 4KRLB 1O5DT 3EXJA 1GZHA 3ZHGD 2YRLA 1FG2A 2D8KA 4GSXA 4QAMB 1X6LA 4JB9H 3SCMD 4ZMAT 1UM4H 1BUUA 4GKSB 5D8JH 4OAWA 5E56A 3QPXL 4FQCH 5LQBL 3F5WB 2ARJQ 1OO2A 1P53A 4NAMA 2VABA 3JQOB 3PHSA 1MQ8A 1TQCC 2Z1PA 4HVBA 1DJXA 3RU8L 4Z7NF 2NYZA 4P4KD 1IUZA 1CG9A 3L9YA 3CHQA 3BI9X 4H0HB 4R5TA 3VD5A 4AVIA 2WTPA 1U4EA 3DETD 5EIVA 1W9XA 5FFSA 2VITB 4OZGF 1CBVL 3TBSB 3TJPA 4PB0H 1XSIA 3MNMA 4Z7NE 1FP5A 2GFBB 1HNGA 4GJTB 4D3CL 1WCBA 1SLUA 3VXRD 3GBLA 4BDVA 1NGZB 4HIJB 1IGFH 5D7SH 4Q9QH 4TTGA 5SX5H 4O9HH 3U4AA 3P4NB 3V0AC 3X3FH 4ZFOB 3KBPA 1C3AB 1LO2H 1IVTA 4FX5A 5DHDA 4Y1TA 3NSCA 4HDIB 3NDZE 4CJ1A 2OMZA 1NDMB 3CDFA 3H7LA 3HE7B 1TTBA 3LKSA 4H1LH 4NC1C 4UIKL 4UQEA 5AYTA 2IQAB 1JPST 4YHLH 3RNKA 1QBMH 4MQTB 4KUZL 1DQVA 1OAUH 1OGAB 3QDGE 3RVUC 3X1BA 1YSOA 1U0OB 3DV4A 5AYQA 5CSBA 4Z1PA 5KSUB 4FXGC 2GHZA 3FH8A 3L3DA 4WZ9A 5E00A 3GTTA 1MCWM 3BGMA 3QGVA 1K4DA 2IMMA 3F7YB 3HJEA 4APXB 3O6KH 4WEEA 2TRHA 4MRCA 3RWHB 3UTZA 3WHDA 2IBZY 3U0PB 2C3WA 1CN4A 2XX0A 3IDYB 4N2IA 4I18A 1HSBA 4FXGA 4B60A 3E7JA 1EWHA 3FSVA 3KYOA 4I0PB 4K94L 4N2OA 4F33A 4AEEA 3F7LA 1KZD1 3C8KA 5GPRA 1GVIA 2GT9B 1PG7H 1JRHH 3GSWB 5IOPA 5FECA 3RLSA 4FNSA 3D1MC 3R0MA 4MNHB 2R1YB 43CAB 2VXTL 4AC4A 4OF0A 7PCYA 3H2QA 2YSSB 3SDAD 2F54D 4CJ0A 1S3KL 2JJTC 3QI9C 4X50A 5SWSD 1TYJA 2YO3A 3GXPA 2C6UA 4PLOB 3QK0A 5FK9B 2F19L 3ULVH 1OQOA 5BMFL 4YLBA 3TEWA 3AM8C 3OQ3B 2WXKA 3P4NA 2PW2A 1QACA 2G9HA 5BVJB 1GSMA 3OWEA 3PQYD 4MA7H 4WRFA 2EDMA 4NXSA 5IR1B 1IVLA 2H41A 2ZCKH 4D9QD 3O2WL 4PRAB 4NQED 3RVWD 3V55A 2UY7A 5LN4A 4F7EA 1KTRL 5DA0B 3K91A 3N1PC 1WE5A 5EEWA 2ZCHH 4DUWA 4L29A 4KMTL 5I75B 5IUSA 3FUHA 5ESVB 3Q43A 3EUUA 4JY5L 2Z35A 4P4RA 4MJHA 2WQXA 1A6VL 4ODVH 3PIQA 4K71C 1TOXA 3WTXA 1FIFA 5GGSA 5CSZA 3ZT7A 3O2WH 4ZT1A 1EJOH 1HXYB 2GIXA 3MV8E 5H2BA 5I74C 3VFWA 3DPBA 4HULB 4H0IA 1T0PB 2ROYA 1YNKL 2BWQA 3FAXA 3PHOA 4HT1H 4K5LA 5E2VL 3W39B 1KN2L 4M5YL 1MG2C 4OAWB 4IMLB 3NFSH 4TSAL 2NZ9D 3BWUF 2BO0A 3DK2A 1IC0A 3W9EB 4JDEA 1QRND 3QXWA 4BBWA 1ZVNA 4P3DB 4Q0XH 1BQLL 2IAMD 3B3IA 1I3UA 5ICYA 2CLZB 1T1XB 5GRJH 4PJXB 3RL2A 1CGSL 3EHBD 4KRMB 1I1YB 4OCYL 2YAEA 3ZRFC 5GSRB 5JIMA 3H9HA 3I6GA 4YXLL 2DV6A 5C0GA 1KWXA 5EUKB 2W81C 4NPYB 4IBVA 5T3ZD 4K0OA 4YBLB 5H8DA 4XMWA 5K9KB 1U21A 5GGSY 3FQTA 1II4E 3U7WL 4PP1C 3U7YH 1JI1A 5FKAA 2C9SA 5E6IA 3ECQA 3OXRA 2O6EA 1V3LA 3RA7L 3L5HA 3UL4A 2KZKA 3QWOA 2BIMA 5AAMA 1QWHA 1DJYA 3PUCA 4D9LL 1X5MA 3UIYA 1U8LA 1CLYH 1UM5L 4GT7A 3WEOA 5KN5A 2A77L 5A6LA 3TFKD 3UPAA 4PRAA 4G5ZL 5FUOL 3J2PA 1U8CA 4MCMA 3B43A 3GJFK 3HI5H 1KBBA 2ITCA 3BAEL 4IDJH 4EOWH 5JDSB 1G1KA 2FRGP 2UVFA 4MS8C 2A99A 3CIAA 4Z7VB 4LCWE 3BUIA 1AGFB 4LLUA 3FT4B 1E4XL 1UWGH 5JW5A 2DWXA 4HWUA 1HCFX 3NCCB 2PWFA 5JLZB 1A6PA 3S4SG 3QG6A 1ITBB 2L3BA 3IDMB 3L9BA 4XGZA 2XFGB 5H37H 5KSBF 1U4FA 2EUXA 4DKAA 1QSFB 2DMHA 1AO7E 4XP4L 3PL6B 3QORD 4YQXH 4E9VA 2J73A 3QYNA 3MNZA 4Y2LA 4YO0B 2EDRA 3LKNB 4WRLA 3QIUC 4HJGA 4LIQH 4WFGE 5IR1A 4AKOA 5KSBE 1NAML 2H7WA 3EG9A 1G9NL 2XQBH 3I6LE 3P0GB 1BQHB 3GI9L 5EV7A 4PGZA 2WZ0A 5IEKB 2EUZA 4JRYD 4LCVA 3EO1A 3MV7B 1JVLA 3IFNH 1X7QB 3BZFA 1KJVA 4NENA 4FLOA 4HEMA 4L2YA 4Y4FC 3A47A 5SV3A 5GGRB 3D3VA 1KDIA 3NFNA 1K9IA 2LABA 1I4FB 4YSPA 3KLHD 1AE6H 1JTPA 4KKNA 1F86A 1HYRC 3CJJA 3S34L 2Y6SC 3QCVH 2WQRA 2CE6A 3AG1B 5HI3C 5DFAA 2JIXB 4AE0A 1W72B 4ZUSB 3WSQH 1ZEAH 2QZQA 3FFDA 4WO4B 5AW6B 5AOMA 4A2LA 5B3SB 4XNUL 3T4AB 5DMKA 2PWGA 3TN0C 2WV3A 2BSSB 4Y2NA 1F3DH 1BQHG 3WS6C 1KULA 3STLB 3MACH 4KI1E 2PWEA 1J0YA 2VDLH 4Z0XB 2OBGA 4JX0A 2YC1B 3OLEA 4JN2A 3DOHA 1HXKA 2Y07H 4KJQC 4CU6A 5EDXA 1MFCH 3IPEA 4XNAA 1FO0B 3A21A 3ARWA 4L8BA 3SZKC 3BDWB 1RZGB 3IN2A 2LT9A 1RZ7H 4S1DD 3TBVB 2BVPB 3EKCA 3OXSB 4LEXL 3F5WA 4BZ2L 1EGJL 3BH4A 3D09A 5EFIB 4PJAA 3UROR 4Z7QB 2ZOKA 3SD5A 3IN0A 2CNYA 4E68A 2G3XA 4PRDB 3BFOA 3FTUA 3H3BC 3IFOA 1WFUA 3QB7C 3PE9A 4EUPG 1WCBB 5IB3B 3QXUA 4L3AA 3LNHA 3ZMEA 3MRFA 2VDQB 4XP9L 3UTTA 3CSPA 3UO1H 5IF0A 1P6WA 3TBSA 5MHSD 2X4UA 4NKDA 2VMJA 4KTYA 1VFBB 3WD5H 1H3PH 1XGTA 4W70A 5C0FA 1S7QB 2VH5H 3VI3F 1JDCA 4UT7H 5JDSA 1XSOA 3VQ2C 3T2QA 4ZS7H 3NP3A 4PGCB 3M7FB 2P80D 1B6UA 2DYSB 2IPUG 2P7TA 4J3TA 5AKTA 1JTOA 3P4OA 3WS3A 1Q9WA 3BXNA 5J0BA 5ACZB 4IRZL 3D18A 3MBXL 2I32A 3UYPB 4F8OA 5CUSL 4TQ8A 4M6MH 2H2RA 1IFRA 1WQVT 1F3RB 3MV8B 5EPMB 4B0MB 3CFCL 4YGVA 5KSAA 4X5XB 2OI9C 3RHWK 4MD4B 4L8SB 4FFZH 2DQCL 2W5PA 3C8KD 1LO3H 4A38A 1MJJB 1Y1UA 3L3KB 2QQLH 2B1HH 5K9OA 2OPCA 3T3ME 2DWEB 3CX2A 1FNHA 4NUGH 3CLFH 1FV1B 5DD6A 4M1CC 3V5DB 5KJRL 2D0HA 4M6ML 3X1GA 2F7IA 2JNZA 3CN3A 5F3BB 4LOUD 4YVNA 5CLYA 4JRYB 3LEXB 1FZKA 5DD0H 3ZYOA 3PP3H 4WFHE 3H0TA 2HYMA 2GG1A 3MLVH 4ZOAA 2HJFA 3NJFA 4B5ZA 4AKQA 5TQ0H 2JCCE 1YN6A 4XH2B 2VWEE 3ML9A 2KQMA 3D50A 2ZOLA 3WTWA 3HNVH 5CD3B 3DURB 2XYBA 3B7RL 3FQNA 5JOPE 2ATPB 4PJAF 4P0DA 1MWAA 2B2XH 4WFEE 2V5SA 2FYYB 1TVHB 1S7QA 4HGMA 4LU5A 3ZDXE 1N0XL 3ME0B 1RV6X 2OCJA 4X99B 1WF5A 4Y9CA 3WJLA 2D7OA 2QDWA 1XZWA 2AI0H 3LSOB 4JHWH 4OBRA 4P9MH 4OH2A 2VLKD 1DUYB 2B77A 4JN1L 1GGBH 3BPNC 4JG5A 4ELKB 1JV2A 1R3IH 1Z9NA 3K46A 1ETJA 2YPLE 3NRFA 3OD3A 3S5LA 3RWFB 4PJAB 5HHXH 3TWYA 4U0RC 1IGJA 3CZFA