2ZQKA

Crystal structure of intimin-tir68 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
183
Chain Sequence
FFDELKIDNKVDIIGNNVRGELPNIWLQYGQFKLKASGGDGTYSWYSENTSIATVDASGKVTLNGKGSVVIKATSGDKQTVSYTIKAPSYMIKVDKQAYYADAMSICKNLLPSTQTVLSDIYDSWGAANKYSHYSSMNSITAWIKQTSSEQRSGVSSTYNLITQNPLPGVNVNTPNVYAVCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the interaction between intimin and Tir of enterohaemorrhagic E coli: evidence for a dynamic sequential clustering-aggregating-reticulating model
rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords Intimin
total genus 47
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02368 Big_2 Bacterial Ig-like domain (group 2)
A PF07979 Intimin_C Intimin C-type lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2zqkA01
3.10.100.10 Alpha Beta Roll Mannose-Binding Protein A; Chain A Mannose-Binding Protein A, subunit A 2zqkA02
2VUVA 2BPEA 2VRPA 2OS9A 2GGUA 3VPPA 1RDN1 1MSBA 1E8IA 1F00I 4CAJA 1U0NB 1XARA 1RDM1 1TN3A 4M1GA 1KZE1 1UEXB 3P5DA 5LGKE 1OZ7B 4QKGA 4GK1A 3CFWA 2XR5A 3RS1A 3UBUA 1BYFA 2ZWKA 4GJ0A 1R14A 4QKHA 4WREA 2I83A 3CCKA 1F02I 2BPDA 1T8CA 3GPRD 3CDGE 2ORKA 2MQGA 3PAQA 4M18A 2ZQKA 3BX4B 1RDJ1 5J6GG 4IOPA 1BJ3A 2N7SA 3WBPA 3P7GA 3WHDA 3DBZA 2YHFA 1X2TA 1U0OB 1GZ2A 1EGGA 2OX9A 4DN8A 3WBRA 3NCXA 1HQ8A 1FVUA 2CL8A 1OZ7A 1WT9B 3WH2A 1PW9A 4J6JA 5KTIA 4AQ1C 1BJ3B 2BRSA 2VRPB 3P5GA 1KCGA 4LU5A 1U0OA 1FIFA 2RIEA 1KWUA 2PF5A 1XPHA 3IKQA 4QKJA 1AFD1 2BPHA 4QKIA 1KG0C 2XR6A 2MH4A 2M94A 1JZNA 2GGXA 5FFTA 3GPRC 4M17A 4C16A 1IXXA 3WSRA 1B6EA 2IT5A 5FFSA 3KMB1 2OX8A 1V4LB 1G1SA 1K9JA 4G96A 1O7CT 3CDGF 4WRFA 3G83A 4MTHA 1UEXA 1IODA 4N33A 2H2TB 4N32A 1UKMA 1K9IA 1IJKC 4N35A 1C3AB 3P5IA 1YXJA 1SL4A 5B1WA 3KQGA 3FF8C 4WUWA 1QO3C 4PP8A 3IKNA 1RDL1 1IODB 1KWTA 1J34A 1JWIB 3BX4A 3K7BA 2ZIBA 1RJHA 1DV8A 1UKMB 3ZHGA 2MTIA 1G1RA 3UBUB 4UXMA 4WRCA 3P7FA 3VYJA 3M9ZA 1RTM1 4AQ1A 1BUUA 1BV4A 4GJXA 1YXKA 1LITA 1HYRA 1BCH1 5KTHA 4KI1E 4YMDA 4KZWA 4YLIA 1KWWA 3VLGA 1RDO1 3FF7C 4WUXA 4N36A 3G84A 1PWBA 5B1RA 2RIAA 1CWVA 5B1XA 4WCOA 4EZMG 3PBFA 4LQFA 3BDWB 4UWWA 3GPRA 1KOEA 3IKRA 1H8UA 1P4LD 4CSYA 2MOGA 3CADA 3T3AA 1IJKB 2AFPA 4GI0A 3WH3A 1C3AA 4ZESA 3G8LA 1UMRC 4IOPB 1KX1A 2H2RA 3WWKB 1MUQA 1E87A 1WMZA 3IKPA 4HU8A 2GO0A 3BDWA 1KWVA 1HUPA 1T8DA 1EGIA 3WBQA 1UOSA 4GKOG 1X2WB 1ESLA 2KV3A 1HTNA 1WT9A 4C9FA 3G81A 3ZHGD 1V7PA 1SL6A 1AFB1 1P1ZD 1V7PB 3P5EA 5M62A 1J35B 4ZETA 3ALUA 5FFRA 2KMB1 4J6MA 1AFA1 4KZVA 1DY1A 1X2WA 2C6UA 3GPRB 4KMB1 1BNLA 1G1QA 3C8JA 2L04A 1KZC1 4N38A 1KX0A 3L9JC 5F2QA 5K8YA 4J6NA 1J35A 3C8KD 1KWZA 2E3XC 1KMB1 3HUPA 4J6LA 1QDDA 3WWKA 1KZD1 2N40A 1U0NC 3P7HA 1J34B 4PDCA 2LS8A 3WWKC 1FVUB 2ORJA 3PAKA 1KZB1 4AK8A 4WQQA 1WMYA 1B08A 1KZA1 1YPUA 1UMRA 1KWXA 1RDK1 3FF9A 2VUZA 4ZRVA 3PARA 2PY2A 4N37A 1FIHA 3P5FA 1WK1A 2RICA 1FM5A 3C22A 1RDI1 4J6QA 1TDQB 1UOSB 2MSBA 1KWYA 4N34A 1Y17A 2RIDA 1SB2B 1G1TA 3NCWA 1SL5A 1BCJ1 3G8KA 3VYKA 1TLGA 3ALSA 3P5HA 1YPOA 2IT6A 4E52A 1X2TB 1DY0A 1YPQA 4G9AA 1UV0A 1YTTA 2E3XB 1JWIA 4WR9A 1JA3A 4J6KA 3ALTA 4S0UA 1DY2A 4J6PA 4ZRWA 1MPUA 1IXXB 1SB2A 1Y17B 1O7BT 1E5UI 2RIBA 3FD4A 1R13A 1V4LA
chains in the Genus database with same CATH superfamily
1WAEA 2WXQA 2FNWA 3O6FA 2CKBA 1QMUA 1GMIA 1U8QA 1UVQA 5F7UA 2I24N 1XXFC 1ICTA 4PRHB 4N0CD 2PR4L 3LKRB 5E6ZA 4H40A 5EU6E 1TU2A 4Q0XH 4KO9A 4EKXA 3V0EA 2P4AB 4FFZA 3HNTL 2P5WE 4K3JL 1AI1H 2AV7A 4UTAA 3V6ZA 1SUHA 4I5BB 1I1YA 1RZFL 4OI9A 1G6RH 3ZJAA 3QZOA 2ED7A 1FYTB 3Q6GH 5C3IA 3PWNB 4AZ8A 2C9AA 1MN4A 4M1GA 5B1BB 2HAZA 3JTTA 4XODA 3WTSA 4WK4B 3DOIA 2X89D 3NAAH 5IBTL 3CZJA 2YD1A 2FD6L 4DK5A 2R9HD 4WI3A 4PI0A 2X70B 4GUCA 5AUMB 3WEXB 3IDGB 5EBLA 5HDOA 3FQUB 4Z7OE 2ORBL 1FYHB 5HGAB 2OZ4H 4OLWH 1BYFA 1BAWA 1A25A 3MN8A 3PHQA 4LCWB 1CD1A 4RAUB 4AEEA 4AQ8A 1KZYA 4EKJA 5ERWA 1FH2A 3VCLA 1FZOB 3GMLB 4YXKL 3K6SB 1PG7X 5IHZA 2G3ZA 4I0KA 3SPHA 4D8PB 4N0CC 3SBQA 4LNRB 3HG1B 2ZPKH 5EA0L 1MPAH 3CC5A 3GI8H 4NNXA 4DP9X 4N9GB 3BD5A 4FULA 1OSYA 1DUYB 5K93A 3UAAA 3B6SB 4KMTH 1AD0A 3QG7H 1ETJA 1AGDB 4MTMA 4YDZA 2L3BA 2JV6A 5T1MB 4E5XG 3RJDA 1WQVT 3PABA 4MQTB 4YO0B 2V3EA 3GK8L 3ZTEA 1RDJ1 2WLKA 2F54B 1EAJA 2APBA 2F53A 5F3HA 4BE6A 4IKKA 1ETZB 4QF1A 2BVYA 4JPIB 2YXVA 5CINL 1CPUA 3MRBA 3KYNB 3EBIA 1FAKT 2PYFB 3ELQA 4H8WC 4ICXA 4GG8A 1OE1A 1JF5A 4NNYB 4OCYH 2X4QA 5AVSB 5JHLL 1T22A 4FQJL 2OX9A 1QRNE 4G11A 3ZQ9A 3ZDZF 4OCRL 3ZT5A 2WXOA 4PIRF 3BZEB 2YPVA 2ZUUA 1HZLA 2AI0L 4YXHH 1ZA3A 5CR1A 1NCIA 2GHZA 1BX2A 4LSPH 5IROC 3KG5A 3AS1A 1WT9B 4GW1B 2FTAA 1RLBA 4AITA 2YWYA 3RX5A 3TZVB 4N4YB 3S5ZA 2HRPH 3E8UL 4DN4H 3OF6A 1NIEA 3GMOB 2Z31B 2VCOA 5JOPD 1QP1A 5B8CC 5D2LB 2VLJB 2YQ2A 1OAUL 3WHXA 4G6FB 2A9CA 4BH8A 1XGTA 3LRSB 1I9RH 4QRRB 5EU6D 4BSWB 1ZXKA 4MAYB 1H3XA 1FIFA 3OMZA 2RIEA 4PV8B 4XXDA 3N41B 7CGTA 2YGOA 4XP5L 1T20A 2FQGA 5EO0B 5IB4B 3QHZL 4EZMA 3QHFH 3HRZB 2WZPA 1ZT1B 4U1IB 5CWSA 5D2LE 5DMIL 4HEMA 3RA7H 4I1PA 2NY0B 2CLVB 1UXSA 1MCWM 5GSRB 1ASOA 2MH4A 4XBPB 5HGDB 5IW3A 5IT2L 2BLFA 3BAKA 4TMPA 2OTWB 4JO2L 4KV5E 4PJBB 4DVRL 2NTSP 4C16A 3EBAA 3DX6B 1GJWA 3DI3B 3V4VA 1TJIL 3BCDA 3HRZC 5EBLB 1JF1A 5ALCL 5KS9B 1LO2H 2GFBA 4XN7A 5LWYL 4WI9A 1UFUA 2Q2LA 3FN0L 4FXKC 4YAQA 2CKBB 2D03L 4UNIA 3G6AA 4N2CA 5LGYA 4M7ZC 5EMYA 1AQ8A 1MIEH 3CZLA 3VDCA 1JMZA 3AS2A 3JUYA 1WZ1H 3CFKB 3MBWA 3UIYA 1OARH 4ZPTB 3EO0A 1D9KC 4P2RA 4BH7A 3IPFA 3LKSB 4I5BA 2F54E 3BHBA 3ZSSA 4AQ8C 1UWFA 2ZT9C 4GKNB 1EHKB 1UUNA 5EORH 2XWEA 2HTKD 5IWLC 5LLIC 3BQUA 3GLDA 1HHJB 4ZYKB 5C6TH 4WGVB 1FFRA 4GJTB 3OKEB 5GS2H 2X88A 1FPTL 3IFNL 2EXWD 2ADJA 1FORL 1SJHB 2ADIB 4P07A 2B2XL 1UB5A 2YIHA 2YA1A 4OJFL 6PAZA 5D1ZD 1DJIA 3TNMA 2WJ5A 2B9AA 3LVTA 4DGYH 3NPSB 4AEHL 1OK0A 3D3VA 1Z5LA 3LKQA 1BXXA 5EUOB 3ZMNA 1FNAA 1O9ZA 4B3EA 2ZOKB 1NJ9A 1N4XL 3CZUB 4U4BA 1N5YH 1S46A 3CIQA 4ZPVA 5D8JL 2CO2A 3BXNA 5F71A 3MLVL 4JFDB 3WTVA 3W2DH 3BVWA 1IKFH 5IW6B 1A0QH 4DP6X 3F3HA 4EE2A 1G9MC 4YXLH 1E5YA 5HYQB 1DQMH 1YNTA 3G6JE 1I3RA 1IC0A 1WCQA 4NFBA 5F0JB 1NGQL 5IUCA 1D7CA 2VLLA 2WXGA 4UXMA 2F8OA 3L7EA 2Z8WC 5E6RB 3ARGA 1ZHBA 3P7FA 5I82A 1SY6L 2JJSC 1CT8A 3I50H 3MYJA 3JZYA 3QEQB 3VD5A 3ZDZE 3UTTE 4YHKL 5EZLA 5IBUB 2EDEA 1ZLSL 1NIAA 4R83A 4LLYB 5JXED 4GJXA 3D34A 4RWYL 5DR5H 1YXKA 4HZLB 2P46B 4PJ5A 4R97C 4DFIA 4PJFA 4L8SC 43CAA 3B3IA 3ILPA 4HCFA 4WWOA 4BDVA 3KNBA 4YSPA 3VD3A 3BDYL 1RJLB 1XF3B 1YMHA 3CN1A 1FLTX 3AMKA 1RULH 1KIRA 1U30A 4G8EB 5GISH 1KFAH 3WY3A 4BZ1A 4LK4A 3DKHA 3GS7A 3FUIA 5D7IA 1ORSB 1OCCB 3QPXL 1ZLVK 1HCFX 3D05A 4LSTH 1UGNA 3PJNA 3ZMEA 1GHFL 1T1XB 3RAJL 4IW4C 4LT7A 4F7EA 2M83A 1IAII 2CBPA 2OL3A 4QGTA 3MXWH 1JXFA 4MB4A 5BPPA 1I3VA 1LMIA 5KW9L 3VXSE 1PIFA 4FQQB 4G8FA 5SX4I 5KZCB 4UM9A 5E9AA 3S88H 2VAAA 2L7UA 4JO5A 3DROA 1RJZB 1EHXA 5EUOA 3T65A 1Q1JH 1AYOA 4YSRA 5TE6H 2BM3A 5I28A 4PBWD 1SEQH 1MW0A 2Q8AH 5G4MA 3VA2C 1FFOA 4KU1A 4P9HL 3NIFB 3O8XB 1HSBA 2QADD 4G6FD 1VRSA 2MMXA 2MOQA 3IRZA 2FBOJ 4FG6C 3AAZA 4IKJA 4PWGA 5JYMA 4X0KB 5KYXA 3N9GH 3QC6X 3DVNA 2J8UA 4GSRA 5FYKH 3SE3C 3ETBF 5B8CA 4R90H 2WLZA 5HHXH 3O8XC 3QZWB 2FYYA 2UY6A 4NEHB 5D4HA 3WKYA 2CR6A 4PJEE 2W8CA 1XGYL 4X9BA 2H0PA 4PJ8D 3SPVB 2VN7A 4MDJA 3K72B 2GI7A 4M6NL 1B2YA 5ADOH 2A6JA 1YEEL 1JERA 3WMQA 4WU5A 2A9NH 4JY4B 4Y19D 5KVFL 2WKLA 2VC2H 2X4UA 4A6YA 4AK1A 5G5DA 2HJKB 2P7TA 4AV0A 3LZRA 1P7QA 3UJIL 3U1PA 5I19H 1NUGA 1D5RA 4N90D 2HSIA 4JJ5B 1JUFA 3FCGA 5ESVB 3ROOB 2XG4B 4OU3A 3FU7A 2XXFA 6FABL 3FFCD 4AL8L 4BK4A 2OV0A 1EERB 4F9LC 4GSUA 1A14L 2HH0H 4MMXA 4LRIC 1AZCA 1S7SB 3WY4A 4YSCA 4FC3E 5FO9A 5C2BH 5LBSL 4AGOA 3QIUC 2OXHB 2Y6SC 2Y25A 5I1KH 5I8OH 2OYMA 1L7IL 4Q4IA 2WW8A 3OMNB 5I8EB 2A4CA 3WJMA 4P3CH 2AJYH 1U3ZA 1XH3B 1IBDA 3RWJB 4FHBD 4MZRA 1C1EL 1BGXL 3KJ4B 3GGWA 4ZXBB 2V7HA 4FI6A 2E76C 2HG0A 3ARFA 4KKBD 5F2QA 1PLAA 5EZIL 1CXIA 1YMMD 2P5PA 3WEOA 3ZZQA 1T0NB 1I8KB 2C3XA 1NBYA 4UINL 5LNGA 4U1HB 1PD1A 5FYJU 2DMHA 3FSZA 4QWWD 4QRPE 4FNQA 1GPOL 1T7ZA 4CW1A 5HGHB 3IGKA 2X4TA 4IRJB 1LEGA 4JM4L 3HZ3A 5F21B 5INDA 4OFIA 4PJCF 4HUUB 3RWHA 4KK6C 1F13A 3WJJA 3WBDA 4H8UA 4YEFA 2BSDA 3A3YB 3SYQA 1XDTT 4H20H 2ZP8A 4P59L 4Z77A 4JQIL 4WQQA 1VZHA 3MBEB 2W88A 3MCKA 4G6KL 4PRHD 4DPAX 2A6DB 3GJFA 3LNFA 4MFHA 4C56B 4DOHB 3VXSD 2G3MA 1T66C 2FHBA 4NUMA 2X38A 2R69L 5DVKA 3ATDA 3H4FA 3EGXA 4Y5VB 1DCEA 1SZNA 1GZQA 1AZRA 1R33A 1LYQA 3R8QA 4A2MA 1G1YA 1VFBB 4PJXF 2AEOA 1U8OA 4EN2A 4O2CA 3HN8A 3TO2B 5LBGA 2H2PD 1DVUA 2VN6A 2DQEL 2Y7MA 4NO0B 1A4KB 1N0XL 2DYPA 1QBBA 7PCYA 5GS0L 4JHUA 3U2SA 1IEAA 1QTSA 2X53A 1I4FB 4WDIA 3NGBC 1ZK5A 3FT0A 4PJHE 2XTJC 2X6BA 5KBLA 5HI5C 1BCJ1 1SL5A 2NQCA 4WFFE 2BNQB 3VJ6A 4V2BA 4YHZH 2J1WA 1B2WL 3L1OL 3UBXB 1UENA 2E7BA 5AW6B 1U8QB 2DQDH 3T09A 4Q74A 5CD5C 3NRFA 1UKTA 4NQCD 1OD7A 3V0WL 5J13C 3Q5YA 3U82B 1MCIA 1KY6A 5JPNC 5ESQB 1RZ7H 3WE6A 4DFHA 1Z9SA 3K0WA 3G04A 2YARA 1VCAA 4OH2A 2ZUSA 2IPUG 4XXCC 3QG6A 5DMYA 1MVUA 2G4EA 3J7HA 3NIFE 3MCYA 1DJGA 2Y2TA 2BIIA 1I8UA 5IMKB 1VACA 4KPHH 3JWOC 43C9B 3C08H 4NUJB 3MV7A 4ZS6C 3U9PH 1Q9LA 4TM9A 5AL0A 1I75A 4PRHA 5E6ID 5I75B 5T33H 1FO0A 1V10A 5ISZA 1LEKA 2HJLA 2OCCB 3VXSB 1NDTA 4U49A 4EN3A 3WNIA 4GI9A 1ZKAA 4ZZKA 1FE8L 3C8KA 3OJ2C 3RL2A 4AIZA 3JV6A 3DMMB 2UVEA 5DUPH 4X83A 1Q0YH 4ODWA 2CMRH 2HG5B 3LPOA 5E8PB 3EOAA 1M7DA 4G43B 5JORA 3TJHD 1FLRH 2ZTBA 4NGHH 4WWPA 1IAIH 1KC5H 3SB3A 4GG6F 5E8EB 3DK0A 4YHLH 3NEOA 2FQFA 3GXTA 3OAWA 2DYSB 5KWYC 5FYKU 3IM1A 3N1FC 1UEXB 1LD9A 1TQVA 4WEBL 5E1GA 4U1GB 5CD3B 2XIBA 1N6QH 5GSVB 1DHKA 2J6EH 1OZ7B 3L7FB 2WC7A 3RVUC 3VXUB 1SEBB 2XR5A 2MNWA 1GIGL 1ZV2A 4AJ0A 3HPLB 5TQ2H 3FOMA 5B1AB 4X7EC 3O4LB 2YD3A 5IHZB 4IMLB 3FU6A 2I83A 4J3OH 2AVGA 2EIJB 4KY1H 3LH2L 5D1QC 4PGJA 2D7MA 3PNWB 3F7PC 1KCSH 1MJUH 2F5BL 3QSKB 5DD3L 3X2QB 5TDPA 3HPJA 4DP8X 5C0AD 2NOYA 3ULUC 2X4TB 3ZU8A 3WELA 1OWWA 4HIEB 1CTMA 1KGXA 1OK8A 2AV1A 4DERA 2I7OA 4XMKL 3ARFB 4HCRH 4OZFB 2NW2A 3P02A 5F1IB 5D5MB 4D9LL 4XN9A 5DRZB 4YL9A 3T0DA 3FQUA 4P46B 4U3CA 1S9YA 4AYEC 1PNCA 3CFMA 3VD2A 3QCVL 3MFFB 3IBEA 1X2TA 1M4KA 5FDWB 3S3PA 3VFVB 2VXTH 1M7IA 4Y4HC 1GSKA 3RNKA 1JK8A 3OKNB 1HEHC 4JO4H 3L1FA 1Z9LA 3B83A 3PV7A 3EG9A 4X6FA 3SE8L 5EHFA 1G6RB 1R24B 5LCVA 1UQSB 2BP0B 3U4BL 1BZQK 3CN2A 4MA1B 3S6CA 4OD1H 1NCGA 2D8KA 4O02H 2YBGA 4E9XA 2HX7A 1OAKL 4GSXA 2B5IB 5BRZD 5HTSA 4UZUA 1MHPH 5J9PB 5T3ZH 1RL1A 3CZNA 5IK3B 2Q0ZX 5LCVL 2Z8RA 1EANA 2HA1A 4ZUSA 3HC0B 3JWDC 4AQ1C 1DVTA 4DTGH 2OX5B 1NANH 1HH9B 4KKQA 1X9QA 3OBAA 2OULB 3G04B 3FTZA 1J1PL 3O41B 5IWLA 5GIRA 3RVVC 5JNYB 2LLGA 3HMWL 1IGIL 4JG0H 3G6AB 1HH6B 1R3HA 4EBQH 4EUPA 1F1GA 3WJLC 3X17A 3VI4E 1DVFA 1KZQA 1VFOA 3F64A 3ARDA 4F37K 4XMLL 3RWIA 4DGUA 3IJYA 3K2UH 5D6CB 3A47A 3CPUA 4X98A 3V95A 1NKGA 1OCRB 5LG1A 3SBRA 4Z3IA 2BNRB 4XPAL 2R4SH 5CJXA 3GPRC 5GPRA 1KG0B 5D2NB 1HWWA 3MGOB 5KJ7E 1HEJC 2NUTA 1O9WA 2KKQA 3QDHA 2E7DA 3TFKD 3NSJA 2TRHA 1WWWX 3B34A 2HX8A 1MY7A 1TTCA 3KPMB 2ZP9A 3CG8A 3QWOA 1XQ4A 2O93L 4I9XA 3TF7C 1YQ2A 1Z0MA 3DURB 5FUCC 4Y9FA 4Q56A 4CU8A 3RURA 4KVCL 3BRFA 4XAKD 4N9OB 4MNHA 3KWUA 4GMTL 3D0LA 3QJVB 4FYTA 3UZVB 1VFMA 5C08D 4YLCA 4IBUA 4J27A 1F8TH 1S7TB 1MHEB 1RUAL 3TT1H 1T83A 4Y2DB 2W81C 3D9AL 2K4AA 3QS2A 4Y89A 2BZCA 1DBJL 5IVXF 4LSQH 4JFHE 1K9IA 1CQKA 4XNUH 1LD9B 4GG6E 4N1EA 1FF5A 3GPSA 4L29A 3K8MA 2K78A 3S3SA 5JQ6L 3UZEC 5J13B 3VXUD 3X3FH 4GW4B 4YZWA 1CFVH 4KK8C 1Q8MA 2PP7A 3TC9A 4AEIL 4DO5A 1A47A 3BVXA 2VZSA 4UNVA 5JORB 4XNMA 3V0GA 2RTTA 1KBVA 1RUQH 4ONHA 4JJOA 3PWVB 5KVFE 5K9QI 4MYWB 2E7CA 3K8LA 1FO0L 4HVBA 5TE7H 4I18A 3VFUB 2GBUA 2NXYB 43CAB 2GCYA 2E5EA 1ZTXE 4OF7A 5CP7A 1KWTA 5JW4R 2NMSA 2XLLA 4K3HA 1IEBA 2PWDA 4QMEA 4RA3A 4Y9EA 3P9MB 4WWKC 3RDTA 2B1HL 4JPWL 3K1KC 3ZHGA 2FR4A 2HLAA 4M7ZB 4PR5B 3HZVA 1CU4L 1KGIA 2IPKB 1NIFA 4M00A 4WO4C 2XFXA 4TL4A 1V8HA 3ZDYE 4J3WA 3KDMB 1IKOP 2XWJA 4HUWB 2ISDA 3REVA 5PAZA 2Q2EB 3KCPB 3MLUH 4JREC 5TE4L 1PY0A 3TA3A 3TA3C 4AMKH 1BUUA 1LE5A 4ZD3H 3MA7B 4PVMA 4WJKB 3KLHC 1H8SA 1XGQB 1GS6X 2QZ5A 3QDJA 1NIDA 2VL5A 4ZPVB 3VD9A 4A7VA 1UTDA 4QAWA 3FSOA 3QI9D 3HUJF 3LKNA 4OI8A 4WFGE 3M1OA 4H0LC 1S2EA 4A7GF 4DW2H 3Q1SL 4GSDH 1MI5D 2CQVA 3DXAA 4TULL 5FFGA 5AW4B 4WUXA 5TD4A 3HC3H 2YSSB 5I1AB 4X6CF 2PW2B 2VRQA 1PY4A 1E4HA 3GRBA 3KLAA 4NC0B 2XYBA 2PETA 2Y1ZA 2ZD0A 3BUPA 3JYBA 4ISVA 4C47A 3LKRA 3U7YL 2A2QT 4LKCA 4WKZA 4A7QA 3FRPA 3EJJX 4HBCL 1PYWA 1FNLA 2IPTH 4HC1H 2PCPB 1KT2B 2A0LC 2LTQC 1RAMA 4EZMG 2WJ7A 1KGCD 4PRPE 1KELH 4HS3B 4Y16C 1JPFB 4MAUH 4PS4H 4LDLB 4NFCA 4ZI8A 2QZQA 3NIDF 5DTFB 3IAPA 5GGTL 4L1DA 3DOSA 4X80L 3WV0A 4P5MA 2QDWA 5DJ0B 2YLKA 1PW3A 4PLOB 4EI5B 3IU3B 2WV3A 2XZQL 3GIVA 3RDTD 4EUPG 3O2VL 5JZ7C 5K9JL 1U58A 2FBJH 5KSUB 1OB0A 2R39A 3QEHB 4J23A 4RFEA 1NBZA 4X98B 3UZQA 5E08L 1XIWC 2F7QA 3O6FC 3BJLA 4MCZB 2JKSA 2Z4TA 2DTML 2VM3A 2W80C 1G6VK 2F1EA 5L2JA 2KS0A 2P8LA 4R7VA 4JRXE 1TSHA 3BKYH 2Y0SA 2CK2A 3MA9L 5DQ9B 2VGLM 3BFOA 3TX4A 1AC6A 5I0ZA 4NQXB 3UC0L 1AP2A 3WIIH 1XF4A 2EEFA 2A77L 2OZ4A 2VDMH 3KL5A 2EVGA 1OO2A 3FW6A 1GXEA 1CS6A 1K2DB 1QI3A 1BM3L 4ZW7A 3PWPD 4FGMA 2X1OA 3QA3B 1KCWA 4M8UA 1FSKC 3QIWC 3HG2A 4HPHA 5EBWA 4FFYL 3T3MB 3A24A 4LEXL 3WTTA 4Q9RH 1XR9B 4KTYA 4QO1A 4FABL 4FNUA 2V4LA 4LU5H 4Y2DA 4GW1A 2DQHH 4MAYC 4JFPA 3KJ6H 2VIRA 1HZHL 3IKCA 4I1NB 1A66A 4TVSa 4ELMF 1V7PB 3R1GL 4ZQKB 3ESMA 1YQVH 3D1MC 1LDPL 3N6YA 3NIDB 1FFQA 2G30A 1WTGT 3IS1X 2EXSA 2QV2A 3QHTC 3ALUA 2Q3XA 3MJWA 2V2TB 4QT5A 3VI4B 5DYOB 1AFA1 3S37H 1N7MH 1W72H 2V0AA 1JZJA 1SJEA 3G5XA 3BT2H 4FCAA 4FXGA 4N6RB 4PWIA 1A6ZB 2DS4A 4ZSOB 3MGTB 4U1LA 3GPRB 4LGRB 1U3JA 1BNLA 1G0XA 1X5MA 2WQ8A 2IOMA 3NCJH 4G6AD 3J27A 1B9KA 4MJIA 3W82A 4AI7A 3CGTA 1GGIL 3F6IA 1WVZA 1BQHG 4M6ML 4N0UA 2O5YH 4ECNA 3TOPA 3TWCH 1JN6B 3DTXB 3QJQB 5CZVL 5CHNB 1RU9H 2N3JA 2LR4A 1D5IL 5IF0A 2HT3C 3VX0A 4M6OL 3U9UA 2LQRA 1UM5L 4WO0A 2Z8SA 4JLRB 4MAYD 2H0EA 1D5XA 1DBML 3D52A 3QW9A 1TZGL 5D7HA 4NBXB 2XHNA 3MGAA 4H5SB 4MWFA 5E99L 1IJNA 2HMIC 4IDJH 4XBEH 1A2YA 1ZV9A 3VI3A 5IHHA 4XNZB 3FRUB 2B5IC 1SRDA 4JM2B 1P5UB 3BQVA 3CFCL 3MLYL 5A16B 3AITA 3EJUA 3C6LB 3S35L 1KZA1 1R5IB 4H0GA 5A7BA 2ZXBA 4X4XB 2JB5H 2CGZA 3ME0A 5BVJB 4X7SL 3SSGA 3B37A 2CZNA 4MS6A 1FNFA 1S3KH 3MLRH 5DVPA 2VZ3A 3G5YA 4JJHA 1FM5A 1NFKA 4HH9A 4PVLA 1G7PB 4OLZH 4YDIH 4BINA 2FK9A 4CU7A 5GGRB 1EZVX 1MZZA 2ZX9A 3BQUB 3KLAB 4FL4B 4GBXD 3BIBX 1PFOA 4JHAH 4NUJA 4Y8AA 4HAKA 1I1AD 4LLMA 2ODHA 4JDTH 1CE1L 4BEIA 3ERXA 2H6OA 1FJ1B 4YQXL 5H35A 4L4TD 5HHOB 2VDKB 3MTXA 5AQ0A 4AGNA 5ACZA 4G7YL 5F7DA 3AY2A 1E7UA 2EEDA 5KSBB 3S3JA 5ICXB 1RZJL 5JIKA 4GRWB 2AJZB 4PRIB 2X09A 3UDWC 4KUZL 1GY2A 4UAOC 5JHDB 4LQ1A 4B27A 2J4WL 1IC4L 4BKLA 3HI1B 1HKLL 1DY2A 4MX7A 1FL5B 1MPUA 2KERA 5CBEA 2I9LB 1SBSH 2HPOA 5FCUL 3SDYL 4PCKA 2DD8H 1FNEA 3AWFA 3L5XH 5C09A 2XN0A 1XF3A 4ZTPL 3KPQB 3RIAK 1FNSL 2BNUB 3W11C 2BW4A 3RKDC 2UZPA 2NLJB 3BKCL 1CO1A 2TSAA 3GSNA 5HHQB 4XCYB 2GGUA 1YPZF 4POZD 4AYMC 3OLIA 2VLRD 4HJGA 2D3LA 4AIOA 3OKOA 1F00I 4BFIA 1Z5LB 2D9CA 2AS5M 4PEEA 1ULVA 3ZZ1A 2ZZUT 4JFDD 3VI3F 5EU7E 1ZDQA 5IBLD 1XARA 1RDM1 5EFIA 4PTUB 1DQLL 1C08A 4GFXA 1IGCL 1W15A 1YY8A 3GSUB 4QT5B 2WXJA 4NIYE 4WGWB 3OXSB 2VAJA 5MHSD 1I1AA 1ORQB 2X05A 1KBBA 2NYKA 4GRLB 4GW5A 1TNNA 4K5PA 4QWWC 3FQRB 1NDMA 4HIHA 4OJAA 3LNEA 5IESL 2IAMD 4OCSL 4P2AA 2UY7B 4IGBA 4WEUD 4R0LA 1I9JH 5IQ9A 4QHUA 4GRWF 2YAFA 5HI5D 3U0WL 4C83A 1BQRA 2BY1A 3T1FA 1XGZA 4WREA 4ABUA 3LHAA 1MVYA 1KJ3H 4X7TB 4YBLC 1L9PA 1MLBB 4UNTA 5FYJD 3UAJD 2ZXCA 5BQ7B 2HTLC 2WXFA 4TVPD 4HHWA 1KCVL 4XCEA 5I5JA 3DX2A 2DJ4A 1H3UA 5IHUH 3L1GA 2L7QA 4PJ7A 1MG2C 2YUZA 3AS0A 4FF9A 5D1ZI 4JFTA 3EYSL 3KYKL 2O1AA 4GKSB 4E41E 2VE6A 3RWIB 5CSGA 3IVKB 4JKPL 2NCMA 3UJJH 1QVOB 4L9DA 1YUKB 2Y7OA 3CX5J 1VIWA 4UAHA 3PQYD 2AQSA 2DV6A 2DQJL 4KI5D 2EEAA 4WAFA 1OSZB 4ZFZA 3VB8A 5LNDA 1U3NA 1UJ3B 5GRUL 5I5IA 4FNLL 4HMCA 3H3KA 4PG9B 3ZKSD 3VI3B 4XPHH 2XTSA 1G7MB 2ENSA 5ACMA 3U4EB 3GIZH 4U1MA 4CVZB 1UWGL 1EZLA 1KULA 1U8MB 4M7KH 2X70A 3L1EA 4YFLI 2VDPH 3V6OC 4CVWA 5A6MA 4NKIL 3ZHDA 3A4AA 1ES0A 2H4EA 2VUKA 5I0WA 4L1BA 5DFVC 4D0BB 3BVDB 1MFEL 3L48A 2YPVL 1IAOB 4J6JA 3TBBA 2BOBB 3SJVB 5HSFA 1U8NA 3NACH 4ZAKA 5IVXB 2B4CH 2H26B 4NHCL 1TXKA 3NDYE 2QQNL 3MU3A 4N68A 5DWUL 1NMAH 1R3HB 2IBZX 4KJWC 3RVUD 4I0CC 2A74B 4PLNC 5FKPA 5B8CB 3HNSL 4AX3A 1QQDB 1YN6A 5E0QA 1TTUA 4XWOD 1KWUA 1D5MA 1FG9C 2CM6A 5H37G 3T0EC 2OR9H 3LZLA 4F9PC 3IPBA 1WFNA 3Q2NA 1MWOA 4HIXL 2YPLD 4XB7A 1RMFL 5FCSH 3AWEA 3LZFH 4YHIA 1KPUB 4M8RA 3N1GC 3CFTA 1B0RB 3IS0X 1RJYA 4MZIA 1V3JA 4NQVA 1U0QA 5MERA 4UYQA 1TFHA 2BC4B 2VXVH 4XBMA 4NP9A 5I1GH 2IT5A 1PZCA 1IEBB 4K15A 2VZTA 3DI2B 3WI9A 1VSCA 2OM5A 4L9LA 5I16A 4YZFE 2Y5TA 1LXMA 2W92A 4A1RA 2JNZA 2NNXA 4JQVC 1E8YA 2EYSB 2P8MA 3GBDA 3QCUL 2C26A 4IRSB 3SDAC 2GK2A 4WFFD 4JKWA 1AE6L 1X7QB 2H1LM 4FMVA 4FLSA 5INCB 1BM7A 3IFPB 1MF2H 1PG7H 1U3HA 4J3VA 2XI9A 4PJ9D 5KVEE 1JTPA 3MRBB 5K39B 4LQFL 1HINL 3C5JB 4BQCA 5AG8A 4MLIA 2RGSA 3LYRA 4MS8C 4NRZA 1Z9OA 4L4TB 2LFGA 1NFAA 2CLRB 2PLTA 4O02B 2H3XC 4W9ZA 2YAMA 4M1GL 3K4DA 5ANMB 1L9SA 1OE3A 1T5XA 3KXFB 4TLTA 2X9ZA 3FK3A 5BRPA 3S36X 2DIJA 1X5HA 4KZDL 1QNZL 1UEYA 3MUZ1 4YIQA 1ZLUK 1YNLL 1AGBA 4FADA 3M17A 5K33A 1U8NB 2JI1A 4ZAKB 5C0EA 5LG6A 1BJ1J 5B1CA 2ARJA 3ZPDA 4HWBH 2Y2WA 3OAUH 4S1SH 1WGVA 5AVRB 5FB8A 1BFTA 1FGNL 3CN4A 4TUKH 2VN4A 4KQ4H 2EKSB 3BJ91 3ZXAC 3NA9H 5JHBA 1G9EA 3LNHA 3HTLX 3KM1A 3BX4A 3QG6B 2AEPL 3B1UA 1N67A 1KJVB 2AQ1A 3GO1L 4WW2F 4GP5B 3ZKQD 4WNQB 2D73A 4HS6B 1UKMB 5DK3A 2EH8L 1SJMA 5DQ9A 1RK1B 4GSQA 2G9HB 2NY1C 3N42F 3ECBB 1IVLA 1I7TA 3AABA 4HXAL 4ELMA 5F9OH 3VYJA 3PDDA 2DAVA 3R7QA 3V52L 4EI0A 4UNUA 4G7QB 4GQ9H 5BS0A 2WINA 3X3GH 4OT1L 2E75C 1JGDA 3ML9A 4JG5A 1TCRA 4D3CL 3JT0A 4AQZA 4FKKA 4KTEL 3BE1L 2W07B 5D7LE 1HK6A 4WHDA 3HB3D 1OTSC 2X2IA 2CUIA 4NT6B 4FFVD 3J2PA 4YVUA 3IU3A 4XOAA 3TH3T 1RZQA 1T0PB 3RDJA 4GKNA 3G9VA 1W0VA 1HHKA 4LBAA 4P4KD 2UX7A 1M2VA 3G9AB 4ODBD 3RUGF 4YX2H 1TVBB 1A4JA 1JPFA 3KPTA 4FKEA 3UPCA 1IO4C 4KZEH 1CXHA 2EUVA 1PG7W 2JKRM 2RR3A 4MQSB 4PGDB 3C5ZC 1NGXA 5IV2B 2ZYIA 4ZX5A 3NN8A 2LLLA 3CVDA 3MNMA 2PNDA 2W0KA 2NNFA 3SKMB 2AEQH 2P48B 5BZDA 4FERA 4QJ3B 4FI7A 4K4KA 5F96L 3QUMB 4GS7C 1XEDA 1UT9A 1YO4A 4P5KB 1MRCL 4ZDHA 3T0EE 3H9ZA 3OR7A 1PFCA 4FTVE 3T0EA 1JIBA 2OMZB 5EBMB 2NTFB 4PJGF 5FHAL 4PRBB 3CSBA 4LOVA 3TM6A 5E2WH 2DY2A 5E5MB 4F15B 1PIGA 1I9EA 4LAJH 4ZOBA 2DH3A 1ZGLM 5IY5B 5KOMC 2R0WH 1UMRC 2MPAL 1I7ZA 3PU7A 1L6PA 4O4YL 4KX7A 2I69A 4XP6H 2W9DH 3B2VH 3H54A 4O51B 3SO3C 5H2BB 1A7NH 3QZPA 4D0DB 2UUDH 3IKPA 1E4XL 1HOEA 2PYFA 4MA1C 3L3KB 1UUSA 3GFUA 5CNHA 5F1NA 3QEQA 1A6AB 1CI5A 1UFGA 3ARPA 2VABB 1DSYA 4ONGH 3O9WC 3CPLB 2J8UE 4J4PA 4J3SA 3N44F 2NSXA 4QRTB 1MCNA 2MQ3A 5E8EA 5CSZA 4NZUL 2JCCB 1KMGA 4DVBA 3K7UA 5KJRL 1WT9A 4C9FA 2R4RH 3EO9L 1SMDA 3DX8A 4OM1H 3RTQD 5CN3A 1V7PA 2VOTA 4MVBD 4O2FB 4UQ2A 2GI0A 1G9NL 4RFOL 3GNMH 2ZSWB 3QRGL 4AH2A 4NT6A 2CJUH 5I0DA 3PRZA 2AK4B 2YD6A 1A3RH 1A6UH 1XSJA 2KL6A 2VITB 3GHBL 5E2VL 4TVPH 3H3PL 3ZKXB 4PJXE 1NANI 5HYFA 3GI9H 1MREH 1WFIA 3IDIB 1WCBA 3MLZH 3L3JA 3TESA 2FO4A 2W07A 4MXQD 2MFNA 3ZKXC 2EKJA 1X2WA 4HS8H 3T2OA 5IJCC 3I74A 3VRIB 5B38G 3RFZA 2YQBA 5D1QE 3G5YB 1G1QA 4PLKC 3LN4A 1AJ7L 2EZ0C 4N38A 3AM8C 5T1KD 3L9JC 3F58H 1EEYB 1ED3B 4N5UA 1A7OH 1KJVA 3ZKMD 3VGAB 3KLHD 1ZSHA 5DJ6A 2PMZA 3LXUX 3ZDYB 4TNEA 1NEUA 4F3FB 4I3GA 3ME0B 2JCWA 2NZ9D 1QBAA 3JZ7A 3QIBA 4GPVA 3FXIC 5HGBB 4HETA 5DD6B 5FDYA 5HY9B 3CXDH 2MWCA 2J8UB 4DF9A 5CFAA 3WNMA 2CO4A 2LVEA 3Q1EA 1RUML 1YEJL 4JPKL 2I5YL 3FT9A 3G6DH 4JDZA 4XNYL 3IE9A 3KBEA 2WLNA 1G7PA 1I1CA 3IBOA 4FFWC 1Q0EA 1XX9C 3MJ9L 3PQYE 5GRXG 5KANG 4O58H 5CJXC 1Q72L 1O6SA 2C7FA 2EVFA 2FQDA 3N1MC 1TQWA 2WVVA 2WWNA 3N91A 5CUSH 4FXLA 4ELMB 3S3CB 3WJLA 1RZKH 4ZUTB 3H2WA 5BW7C 1SXBA 1OM3L 4V11A 1EJOL 4CAGA 2OX5A 3M1BB 3RTLA 3V6ZB 2JKTM 3IETB 4O9HH 3T6XA 4L05A 2KDGA 2PY2A 4G3YH 1DSWA 2A6DA 1JWSA 2AVFA 3GJFB 3O41A 1IIIA 2CA4A 3P5FA 1KEMH 1E2VA 2C7UA 4PJ7E 2YKLL 4BWTA 4QRRA 4ZG1A 3MOBL 5C7XH 4F27A 3ESOA 3OXSA 2AC0A 4M9OA 3JVGC 2QT6A 3QQ3B 3RX7A 3N40F 2MSBA 3ISWA 5TDOB 2DJUA 4U3SA 3CFEB 1DVXA 4YOKA 5C0AE 3VFUA 3DX8B 3WIHH 4MCYB 1WBZB 3NCWA 3B6SA 4Y8DC 3VFPA 3RWFA 4PWJA 3DBSA 3DVIA 1FL6A 4R4ND 3ARGD 4FHKA 4C56A 4HBQA 1QSFE 4E5XA 4AG4H 4F80A 5L8JB 3P5HA 1I7UB 4CRPA 4U7SA 2KLSA 1XF2A 2G9KA 3KR3H 2VYRE 5TH2A 4RAVA 3PIQA 1MEXH 3MRDB 2ITFA 3QPKA 4PW9A 2NYYD 1JZIA 1GGCL 3QWNA 1QR4A 1E3ZA 1N6VA 4WR9A 4Y7OC 2YZ1A 5DHVB 3S8FB 1ADQA 4NN5B 4W4OC 5I17B 5F1NB 2W65B 4C54A 2L4OA 2YO3A 4IRJA 3LS5L 2DIAA 1EGJL 3MPCA 5KSAB 5ENWB 2P5WB 1OAXH 1YAZA 3Q8AA 5HYJB 4OIIH 1LE9A 4XCYA 4J8QA 1I7ZB 4IMKA 3DJZA 2FO1A 2OMYB 1JCVA 2XV0A 2P8LB 1J0ZA 2R83A 3E3QC 2ZNXA 4H4NA 1GW0A 2OS9A 1MRDH 1JZ2A 1OGAA 4AM0Q 5EU5B 3SPCA 2V5SA 2Y9RT 4NQCB 3P11H 2JJUA 4OZ4A 1YPZB 1M3JA 4GO8A 2BZ7A 1YY9C 3U83A 4XNQA 3W9DB 2VDRL 1MELA 1CLVA 1QSVA 2WTRA 3CUPA 2FJFA 5F7BA 2YAEA 2C7UB 5HBBA 4LL9A 1IGTA 1JV5B 1KZE1 4JHWL 5KANI 2OCFD 4ZOAA 4OM0L 1I53A 1P9MC 3GINA 1TG8A 4WO4B 5E2UH 2VW7A 2JK5B 4LESA 4QKGA 2VQUA 4JGJA 2J5LC 1BQUA 4N2GA 3SEPA 4JVUA 5AKSA 5IVXE 3SQRA 3APDA 1VFAB 2Q1EA 2BNQA 1ZLUH 1HHIB 4XCEB 2HMID 1QLRA 2ZWKA 4N85A 4GXVL 2Q86B 4XPTL 3QZWA 1ZY9A 4WFHE 5IQNA 43C9A 2BPDA 5HGDA 5ELIA 3E6FB 4L3EB 4OLVL 3TIEA 2EC8A 2A1WL 4NYLB 1GAFH 4DO6A 1KIQB 5L8LB 3DX6A 3FCTB 3V4VB 2NY5C 1EEUA 2DQFA 3AG4B 4MRBA 3VM7A 2R2CA 3UTZB 2PO6A 2HFEA 1JPSH 1FBIL 3PAQA 4G1EA 4PJDE 3VXRA 1MCPH 4YHOH 1AIFA 5F7EL 3QJSB 3UC2A 2RHEA 4G8GA 1E3XA 4EVNB 1XH1A 5DEGA 3FFCA 2DQIL 3C6SA 7FABL 2DBLH 1EMTL 3JWOL 4AV4A 3IMBA 4NZDA 5E8OB 3FMGL 2OMWA 5DUBA 5IEHA 1J11A 1ZSDB 3WHDA 2O4EA 3SDCA 3Q3GA 1MNUL 2FQEA 4W9FC 3CHSA 5DVOA 4XMPH 1QR1B 1XL6A 3KVQA 3ARDC 1NGWB 3HS0C 4ZK8A 4M1DL 2CO7A 1TJXA 5E9NA 2A73B 4OSUL 2LU5A 4UU9A 3V0IA 3OX8B 4RBPK 1G87A 1GZPB 2BP8A 4UOW0 1XWVA 2OP4H 4JR9L 1X7SA 4G70B 1QSFD 2GB2A 4ZFGL 1TF4A 3ATAA 1LE9B 2Z91A 3S3BB 3TIDB 3MUUA 4ODHL 5EU3A 1XZ0A 3VGAC 2MKWA 4L37A 2DPKA 3IGUA 4NKDB 4BDVB 5ANHA 4ZQKA 5E5RB 1A6VH 4PY7B 5DRZA 5GS0D 1YNKH 5D6DA 4AVHA 5HD8D 3BOVA 3D85B 4LRNL 3MRGB 3UO1H 3KPNB 3A67L 3ZE0E 3L95B 3ULAB 3X13A 4OV5A 2WZ0A 2VDOL 1O0VA 3NJKA 4RX4D 3ZHNA 3CHPA 5IQMA 1TENA 3AZUA 2GTWA 1U91A 5DFTA 2PF5A 1P0SE 1A7QL 2YD5A 4LHUA 3VAEA 2I7SA 3BIKB 1YNTB 5IUSA 2A74C 5KBMA 2Y7SA 3VXRD 2FZ3A 4OZIF 5KVGE 3EADA 3CC5B 4M48H 2VQ1B 3KMB1 3BVNB 2F61A 1DSFL 3CU1A 4PBXA 3BZFB 4V2CB 4F92B 2D31B 2ENJA 4N2FA 1FVEA 1KXHA 2NNAB 2XYCA 3NEXA 3KPSE 2ZCZA 1M1SA 2NY4B 5ESVA 3ROOA 1EDQA 5DD1L 1EGJA 3F6JA 3QNYB 4AEFA 1X6NA 3A0OA 3BH8A 1TEFA 2J25A 3HBQA 3KPPA 4M7LT 4JX0A 3DMMD 4KK9D 3POHA 4M7JH 5CLYA 4EZKA 4KI5C 3SDCB 2YWZA 4XO5A 2VLKB 5HHNB 1A6WL 3HNVH 5CEXB 4AXWA 3K6DA 3BAYA 1FYTA 2OK0L 2H2TB 3DVGA 4PJAE 2ZOUA 3FNKA 2HXAA 5HI3C 4IRZA 3KLQA 4JHZA 3FSVA 4Z18A 4K9EH 3WMSA 1XH3A 3VI3E 1A65A 5B1JC 3JTTB 4ZW6A 5IHLB 3MCLH 3AQDA 3KPSB 5L6YL 4UQ9A 5C0GB 3P5IA 2ZSVB 4PJGE 2CHNA 3NMEA 4XAWL 3TIEB 3EYFB 4H8VA 4YE0A 2AGJH 3CBRA 3CVHL 4PV9B 3C60B 4R26H 5D7EA 1SXAA 3I3DA 2YQ3A 4ODXB 1KIPA 5SV4A 1G7LB 3D4GA 2DLHA 2CG9X 1S3RA 5AVQB 3QNXA 4RETB 3W0WA 3HG1D 4I7ZC 1I85C 4BIKA 5DO8A 2APWA 3BO8B 4DCQA 2FD6H 1IGYB 3TCLA 4JN2A 3FHQA 2VDRB 5DEJA 2OLDA 1UWEL 1YEFH 2JK5A 4B96A 4K3EL 1NGPL 1YYCA 3KXFA 5DRXB 3PS6A 3W5MA 2AJSL 4N2MA 4TOYH 3FUKA 1LWRA 3V4PB 3CSFA 4DH2A 1LEIB 3T4AB 2PTTA 3FT2A 3VXPB 4QRUB 4QHNB 3LH8A 1CLOH 4QY8A 1P4IL 3NJNA 4B0MM 3CHXA 2RCSH 2Q76B 3LOWA 1EHAA 4HIIB 4NENA 1BVNP 4YDNA 4E9QA 2N01B 4LL4A 3X12B 5EUKB 3LQZA 5KTHA 1JCKA 1Y6NR 1RIVH 1IE4A 4EIBA 2ZKHL 3VFWB 3MODH 5IBLC 4JREB 3TVMB 1IE5A 5HHMD 1DQKA 4JQXA 5JPNA 3T0XA 2FBRA 4OCXH 1NUFA 3VXQA 4KVNH 2W1NA 4AYDC 5E6YA 4J6IA 4I0PA 2JB6A 2FEJA 5I8KH 5INDB 5AYQA 3MI6A 4K9JA 4MJ5B 5FV1L 3V8OA 3IWVA 3RWCA 3P0YH 3CVCA 3OC8A 4HC1A 1HL5A 3Q44A 1QWNA 3OPUA 4FNTA 1OALA 4CJ1A 4PR5A 3L16A 4UIMA 5EOQL 4C56E 2HKFH 1CQYA 5A7EA 3CU7A 5HVHC 2ZUWA 2E3VA 1KGWA 1FGVL 4NNYA 3NJHA 1PPIA 5ESAA 2EC9U 1SVBA 2MSPA 1QA9A 3ESNA 2QPDB 1OTUC 3D48R 3GUTA 4UWWA 1PVHA 2A9ML 3AC0A 3THMH 3ZBMA 1T04B 3E8UH 3NPSC 4DN4L 2V2XB 4K94C 3I2CL 2IJ0C 4EO5A 4KRPC 4BFFA 5J11B 1CI3M 4BELD 5DJDB 2HT4D 2LU7A 2IBGA 3N85H 4OF8A 1BD2E 4BUHA 3IAGC 1DCLA 1U8JB 4OD3L 2EE2A 3VQLA 3FTVA 2IG2H 3MKKA 2H2RA 1WWAX 1WFJA 3T3ME 5HYQA 1JVOA 1L3WA 5K9KA 4G9FE 5AD0A 1WGOA 5T1DL 1JGLL 1C9SA 2VZUA 3V0AC 3L7EB 3IFLL 2X1QA 3F7KA 3QIBB 4FDWA 2LU4A 4NHUA 4JN1H 3ZDZB 1KCUH 3GSVA 1YVLA 2E74C 1ESLA 1NSNH 1ET5A 2B3IA 5AKRA 3L3HA 1Z9SB 4WKZB 2FWOA 3BPLB 5EF3A 4K7PY 5LWYH 1VENA 4KGJA 4JFFB 2GSIB 2F6AA 1ZWIB 2A5UA 4YSTA 2Y72A 3IMUA 3AB0B 4L3FA 2EC9T 3B9EA 1YAIA 3S36H 5F7LB 2EEBA 1N3NA 2WUCH 3EH2A 3BKMH 4ISVB 1YEKL 5ADPL 1B0IA 1QFUH 1EHLL 4M3JA 1MCFA 2YPKA 3I6GB 4F7MB 4U3XA 1HAUA 2ADFL 2B15A 4KROB 4NC2B 1DANU 5E2TL 2DYPB 1U8MA 2CBOA 3OSVA 1BVKB 1C5CH 2NY2C 4FE9A 4QHLB 4K3DH 1A7RH 1BFOB 4RGOH 1W0WB 1DBBL 4BH7B 4Y4HD 5JUEL 1R5VB 4X9HA 3UO8B 3BPCA 4NM8L 1FPTH 3NIDE 4YBQC 3B5GA 3N50A 1XCTB 1FDLL 1ZLWK 3MJGX 1KYOK 5DA0B 3MVSA 1U92B 4H0IA 2IANA 1R17A 3UYOD 4U0QB 4KZ0A 3SO3B 25C8L 5KN5A 1QSEA 3QZWG 4PV1C 2YRLA 2VN3A 3BMWA 3EYQD 3PWJA 2YBRA 2HKHH 3REWB 5I18H 2GUYA 2LT9A 1FC2D 3WTUA 4S0SD 2QHLA 3EOBB 1BBDH 5F6HJ 1AMXA 2E59A 4WI8A 4N0UB 1J35A 3LRHA 3IDIA 3BH9B 4IIQC 3DPBA 3VRJA 2H32H 4KHXL 2ZE0A 3QDGE 4KVPA 5KVDL 3SD2A 3FYEB 1U0NC 4HIEA 2Z92B 2AJUL 2MJWA 4UT9H 1L0PA 1NUNB 4PGBB 2NYZA 4UMGA 5CJ5A 4N6RA 1LWHA 4F33A 1JSYA 3PHSA 2R2EA 4JFZL 3PNWA 5D70H 2PO6C 2BO0A 3PGDA 4JM2D 3QUYB 4LLWA 3EJYC 1BAGA 4JFEE 3KLDA 5AVYB 4X7FC 5CXPA 2A9BA 5F1KC 1S9XB 2VSDA 4IU3A 2BOLA 2DICA 3NJLA 4CILA 4YBQD 3H8NA 3ARGB 4Y2NA 4M5SA 4TTDD 4KO7A 1MJ8L 1QBLH 2NW2B 5LGHH 3VI4A 2J43A 1PKQB 4FTDA 4N37A 2CXGA 2WP3T 2AXJA 2Q3ZA 1RK0B 1XF2B 1RIUL 3BDYH 1MH5B 2MHAB 4BFGA 1QPKA 2PP9A 4ZW3A 5AB9A 2QELA 3B3IB 3HG3A 3PWPE 4Y5YA 5CEZD 4I18B 2WO2B 5FA3B 4IBLT 3TT3H 3BKJL 4G8GE 1WPCA 2VDPB 1D6VH 4BQ8A 3RWCB 3VXTB 5FOBB 5L4FA 5IKCB 4A2FA 3ARFD 3BEVB 3U7AA 5IVNA 3QXUA 3AY4A 4ODVL 4AQOA 1IMHC 3ZK0A 1YMMA 3F7YB 4JFEB 5DS2A 3NH7L 4HWZA 5JXEC 2WTPA 1ADWA 2K6WA 4OFYD 2MCPH 2P5EB 4FA7B 5D4QA 1T3FB 3I3BA 3S4SB 3PP4L 1QWHA 3NIGE 4OFVA 4F57H 1T4KA 2YK1L 4CNIB 1J18A 4AIEA 3NTCL 2X6UA 4KV5F 2UZYA 4QHMB 4WQOA 2ZG3A 1FZKB 4HGWB 4PTTB 1PZ3A 2NZ1A 1IILE 1LK3L 4XN4A 3QEGL 3UP6A 4MDJB 3FONA 2FCBA 2AQ2A 3VCLB 4G8GB 1ACXA 5EUOE 5F3FA 2DLFL 3HG4A 5HDLA 2AEWA 1WBYB 1SM3H 2EYRA 2H1PL 3DO3A 3N9GL 2ZUVA 1JZ8A 1PZSA 1S7RA 4W4OA 2J1KA 2DQFB 3OPZH 1A9EA 4P04A 5E00B 5LBSA 5I6OA 2H3KA 3UCQA 1PYWB 3ZUNC 5PCYA 4YPGB 5KSAC 4JJ5A 1BVKA 1JGUL 2C4FT 1EWHA 1JYVA 1JGDB 4ADGA 5D1ZC 5EU6A 2XICA 4IBYA 3ZGHA 4CVUA 1XCTA 4ZFOB 3L08A 1AVAA 4YGVB 4NNPH 2A6JB 1N5AB 2CH8A 3WTXA 4K07A 3QORB 4ODTL 4ZFOL 1UB6B 5HHPB 4GAAA 3QXVA 4CN6A 4HKBA 2K0RA 2WUBL 1ADQL 3QI9C 4X9YA 1P84K 2WK2A 4HPYL 1JNLH 4PJ5E 1IC5L 1U95B 1XSKA 2BXYA 1YEDA 3CXFA 3PPEA 1UVQB 2BHYA 3E1F1 1KB5L 3OZ9H 2HLFC 1I3GL 3H0TA 4FL4C 3WAJA 1FRGL 2IPKA 4O2EB 3O9WB 4DKFL 4L1SA 3MRKB 4PJBE 3WGVB 4AVIA 1UH4A 1VPOL 1ZLWH 5D1QA 1E5BA 1E67A 3RIKA 4APXB 3ESUF 5LVEA 1OGTB 1ZT1A 1DZ0A 2A0LD 3JTBA 4HMDA 1F3DH 2VH5L 2IH1A 3AWGA 3O0LA 1FL3B 5BV7H 5MEPA 2D0GA 2YAOA 1LO3H 3QH3B 4NZRH 3ILPB 1MAJA 1UA3A 1ZA3B 3PL6D 4XXDB 2GABA 4MNGB 4P05A 2WQVA 4QTFA 3G08B 1NAKL 5ICYA 2EIZB 5E6IA 3D18A 4G80B 1CDIA 2CK0H 3LIZH 4Y2LA 3ZT6A 3CLEH 4LIQH 4GAFB 4LHUB 4OVUA 3EFDL 1G7JB 1HKFA 4XNXH 1XCQA 3AU1B 4LRIA 5B39B 2ESVD 4KOCA 3MCKB 1QAWA 4UOZA 3OB0K 1I82A 3CDCA 1MQKH 2YHFA 1CGYA 5AZUA 1HDMA 3KPNA 3O45B 3D3VD 1BX2B 2B08A 1E27A 5DJZB 4U1SB 1DQTA 5GHWH 3T0AA 3WAKA 5HVWA 1KXQE 4AKPA 2G5BB 2CJSA 5J0BA 2VLKD 4XB3A 3KGUA 1H3WM 1UJ3C 1M7DB 3VMPA 5JXAH 3DIFB 2FX8L 3BPLC 3RRQA 1Q0XL 4LBEB 5BO1H 1NCDL 3PAUA 3LN5A 3WTYA 4X5RA 2BFVL 4KKCD 3UERA 4POYA 4RGNB 1XGRB 3TNMB 3RZWA 3ZYJA 5FFOA 1T89A 4Z8FL 5E8OA 4H26B 1HI6B 6PCYA 1XBRA 5HHOD 4XMVA 2HPTA 2APTA 3HKFA 3OKEA 4FZEL 1MVUB 1OAQL 2QQLH 4AMXA 1U95A 2F8IA 1KN2H 2N59A 3MLSH 2K3TA 3L81A 3S34L 4QTIL 1LO4L 2AAAA 5HGBA 2HFGL 2VR3A 4F7CB 2WAQA 4N8VB 5D2NE 4FA8A 3N06B 4ZS7H 4J1UA 4U6TA 5GGUB 3V5HA 12E8L 3IJSB 3QBTB 3Q2LA 1R0AH 4Y4FA 4APXA 1IJ9A 3SGDH 1AFD1 2XR6A 4YBHA 2J88L 3GSNL 4NS0A 2ZKMX 2Z91B 4JB9L 3VDAA 3CCHB 4YUEL 1KCLA 2Y3NA 5JIMA 1E5AA 5SWQB 4WUUE 3VSTA 4AQEB 4UT6H 2EXWC 4NX0A 4EI5A 4TPRL 2PPAA 5I1JH 2ADJB 1FO0B 1PQZA 5DO2C 5EC2A 5CCGE 4RFEB 4ONFL 3PYCA 4R9HA 4KK9C 3RWDA 3QQ4A 4EI6A 3GDCA 3KLLA 1O7CT 4QGYA 4MA7H 4JO1L 4OB5H 4XHJC 3RY4A 1HOCA 4HUKB 1G84A 1WISA 2O5ZL 4N33A 3C5SB 5FUOH 1QTYT 4OCNC 1RVFL 3W0WB 5J5EA 1GC1L 3GKWL 1OEZW 1SFDA 3VA6A 5T33L 4HKXB 5DJAA 1D5BA 1WAAF 5TF1L 4WI0A 4Y1AA 3GSWB 2Q20A 4H1LG 5BS0E 4XTRC 4KAQH 3K6FA 4QXTB 1EXHA 2Z3FA 1DUZB 3SGJA 5ITBL 4KJPD 1IQDB 2DEWX 4ELKB 4UQBA 3L4XA 3ARGC 2GUOA 3LPWA 5I1IH 5JW4Q 2Y69B 1V7NL 1SL4A 3U1SL 1N68A 1P4BL 3CZKA 3QXDA 1BD2B 4XZUB 4NWTL 3X14B 1QEXA 3UDWA 3BZ5A 4M4RB 4HK3J 2P47B 4KI1A 3L3DB 3FQWA 3EJSA 4PJ8A 5DGQA 2H7WA 3JTSA 3O2DH 3SGEH 4YC2C 4P5TA 1PGRB 1JVLA 2CD0A 2IIJA 1F1DA 3FTGA 1NAMB 1M56B 1CR9H 2GY5A 5IW1B 5KSAA 3FRUA 3WNLA 3VXMA 1DO5A 1MCBA 3RB7A 1JFQH 2OYKA 2JKWA 4HYTB 5M94B 4UUJB 4MLSA 5K39A 3TJHC 5B7MA 4OCWH 2AJVL 1D5XB 1Q1PA 15C8H 4BHUA 3CLFL 5CN1A 1INEL 5I71B 2XKSA 3KS0J 3ALWA 3LKPA 5IIEA 4LSUL 4FEIA 5KTEL 2VDMB 5DEFA 4HP5A 5EN2A 2Y2YA 4Z76A 4XMKH 3QXAB 1BCIA 4YMDA 4OLYL 3G3LA 1T04A 5AENA 1QHOA 2XA3A 3QQ3A 1CGTA 4LB8A 3ARBA 1V55B 4OGXH 2VQ4A 3BN9D 4NQVB 4CN1A 2X9XA 5JR1L 4Z5RA 4ORZC 4CMHB 1HIMH 5JW4M 1F3DJ 3HS9A 2WBJB 4FQLH 1JHLH 4M1CD 1AI1L 1MWAA 1CFMA 4IEFA 3HKZA 4QOKB 5E03A 1IFHH 5H4YA 1SOKA 1GKOA 3HMXL 3QXWA 3B5TA 4ZNEA 1CWVA 3UFIA 1GYCA 5AUMA 2ENYA 1P7KA 3WS6A 2I07A 1PX8A 4K23L 1DUZA 3O8XD 2JJTC 2IQ9H 1HJCA 4OQ1A 4UOW1 2P8PB 3PBFA 2H1XA 2FB4H 4RQQB 3TTSA 3W11D 2A6KB 3O4LD 5BS0B 1OAKH 3V7AG 1IZJA 4FMFA 3ULVH 3FU8A 4UT7L 3K1DA 2C9PA 3QQDA 1OP3K 4A63A 4X5QA 1H8NA 3GMLA 4JUTA 1TJMA 2JB6B 4ADJA 3P2DA 3FB7B 2YC1A 3QQXA 3M8OH 1H5BA 4UV7L 5I8CB 4HWNA 2EIEA 2WXKA 3O6LH 4JQXC 4ZW5A 3KPMA 3T3AA 1P5UA 1BV8A 2OFQA 1UCTA 1K9TA 4XC1L 2P49B 2AABL 4ZBJA 1JDCA 1KCKA 4PJGA 4UMSA 4LEEA 2IDFA 1HHIA 2C9XA 4P4KB 5A2LH 4A2DA 3RVXC 1N3NB 4KKPA 4FXGC 1IM3A 1UH2A 3C2SA 1BMGA 1L5GB 1HXMB 2RAMA 5C0RL 2ALAA 4YWGL 4LLUB 3PUCA 2L8AA 1WP6A 2EECA 4GUOA 5HYSB 3SOBL 1A1MA 4XXCA 5AOIA 3DROB 3QUXB 3WL9A 2WQXA 3OKKB 3B2MA 1QPXA 3KCWA 5GJTL 2WTRB 3CUPB 4G1MA 4XP4H 2VLKE 3ORJA 3A23A 4KBPA 4LSDA 1F0LA 3VXOA 2PXYD 4A6YH 1HTYA 1LNUB 1YDPB 1L6ZA 4OCYL 1RZIA 4XT1C 5DK2A 4MDIB 1ONQB 3TN0B 4FFZL 3NFNA 4L5FL 5J12C 3LSOB 4W9LC 4L8SA 2YD9A 1NLDH 2E6PA 4GMSH 4LLQB 1HSAA 4C83B 1E6OL 4J6MA 2GVYA 5CEXA 1RP9A 3HAEA 1S7QB 3D2UA 3RWHB 1F56A 2MTAA 2DIEA 1KENH 2MHAA 3GBNL 5EEYA 2BDNH 2V7NA 4LF3A 2JCCA 3KBFA 4BZ2H 3CXHK 1BF5A 2ICEA 1OW0A 3NFSL 4K8RD 1NAMA 3MRHA 3TJEL 1PLBA 5DRWA 1M42A 2AXFB 1CFTA 2DQMA 3MYZA 4ANXA 1A6AA 4EN3D 3BVNA 1LEGB 4UF7C 4XR8C 7PAZA 3EGDB 2PABA 3FO1A 4HXBL 3C8KD 2FUTA 4ODSL 1AACA 5DVLA 1W91A 3E9TA 3A5VA 3CDYA 4ZFQA 5BXFA 2R2EB 5E4IA 1AFVL 4P5TB 1EVUA 3ZL4H 3SOTA 4NDMB 1LO0L 4HSCX 1GZPA 1EPFA 1UM4H 1XTLA 3GB7B 1NMCB 1U93A 3MRMB 5FUCE 3WLBA 4PJFE 4KNQA 4JVPA 3WLWC 2JJVA 1LEKB 5ISZB 4L3CB 5FXCH 4C59B 3FUHA 4ZXBA 4HDIB 2CIKB 1YECL 2UXTA 4JKMA 1JVKA 1P5VA 1F3JB 3C60C 3R19A 4QDGA 3RFRA 3U30C 3VSUA 1KLUA 1ID5I 1OTUD 1U8HB 2CNZA 3Q5OA 3QJHA 4HG4J 4A39A 4CN4A 2BFGA 1OARL 3JVFC 5DTFA 5L2KA 4X6BB 2X4OA 4ZUTA 4YDKL 1J9RA 3SCMC 1IGFL 2FIRT 3Q1SH 4GSDL 1PAZA 4PHXA 1ERNA 3RL2B 3HNTH 4K3JH 4J6QA 4P2RB 4B5ZA 2PWFA 4GQPH 4X4MA 3T2LA 1HSAB 1MKFA 2KZ1B 5DDHA 1MCLA 1N64L 1UZGA 2HG5A 1ZHKA 1UZ6F 4TVUA 2BOBA 3SJVA 4JRWA 4JKKA 3VU1A 5I1CL 1DFBL 3OKLB 5KBKA 1JDDA 4MS8D 5D7LD 1T1YA 2AKRA 2J1YA 1KEGH 4RNRA 2HJLB 2DQCH 1A4CA 1QYGL 5IHBA 3ECBA 4Y5VC 1T80A 1A5FH 2QVTA 2DIBA 4F3FA 4GQZA 3ISYA 1G4MA 4LZKA 5E94B 3AY4C 3BSHA 1F97A 3C60D 4DQOL 4KKLC 1IKFL 3K46A 1VACB 3WKNA 3UBHA 3TV3L 1YTTA 5F7HA 1U3YA 3LV3A 3QUYC 3UOAB 4MNQE 5C0CE 4J6KA 3ALTA 1EAQA 5CILH 4LLUA 4Z3TA 5E08H 4XO8A 3TP4A 3VRIA 4LPTA 5TGBB 1WHPA 1IXXB 2NY7L 4LLAA 1DEEB 4M6AA 4JZJB 3LMJH 4PRAA 4OFPA 1U2YA 3HFMH 1A2YB 2UZXA 5CLWA 4DEPC 4OZGA 4YNYA 2VUVA 2OXGB 1HHGB 3RY5A 1G9HA 4G2AA 2BPEA 3KPSA 2VLJA 3A6CL 1P5UC 4GAGH 2L0DA 3N0PB 3GK8H 4QYOB 5CN2A 1FC1A 1FWXA 3P4MA 1Q90A 4TQHA 1LP9A 5BJTA 3Q2VA 4YZFF 1CLYL 2ICWI 3M17B 1T1XA 5HYJE 2QPFA 4WSKA 4Q9RL 2Z93A 4WCYL 4NERA 5JIHA 4FABH 3ENEA 5DMGD 4E41D 5H37A 1FH5H 3PGFL 4DT2A 3DSNA 2IH3A 4U1SA 1AIZA 2BY0A 1XZWA 3L3OA 3P3TA 2WYHA 3C09C 3RDTB 5C97A 3V0DA 3ULUL 1PKQE 3O2WL 4L4TA 3D8MA 4J6RH 1OTSD 4MMZA 4WEEA 2XQBL 1ZANH 5FOJA 3QDAA 2BOCA 1IIKA 1JPST 3C9NB 1E4WL 4KKAD 5B39A 5B38A 5MEQA 1FL6B 3OAZH 3S88L 1U8CB 3Q7JA 4F5CA 4JFWA 4KI5F 4TF4A 1U93B 4ZJ9A 4LDOB 2F5AL 1UM6L 2P5WA 1J9SA 2XXGA 4A38A 4UQEA 4FCHA 1RJYB 3QIWD 4TRPH 1NCCH 4PJ5B 3GT6A 5LQBH 4ZMOA 1MRFH 2KYIA 4X6DB 3IEAA 5D5MA 5IVZB 3UAEA 5E5UB 5L4JA 2DWTA 1K6QH 4FRWA 4N0UE 2WXIA 3WS3A 1FVDA 1TSRA 5L7XH 1JXGA 1ZD6A 3L5WB 3C5ZA 3T1WA 4V33A 5A1AA 3GZKA 4U33A 1UB5B 1JPGB 3KAAA 1JZFA 5CGMA 2FEEI 5DUML 5ADOL 1ZTXL 2WY3B 5C0NC 1SF3A 3TBSA 4OZHE 1AQDA 3WY1A 4N2OA 1JG9A 1GMEA 4WTZG 1I9IH 3PXLA 4EOWH 2JIXA 1RZJC 3R0NA 5E4EB 4HKXA 5DJAB 4ZTOL 4YSSA 3MV8D 9PCYA 1KIUB 4U1KA 1FVUA 4S0TD 1RSYA 5AEAA 4NZFA 2UYLB 1KIQA 4RSYA 2WBWB 2XY2A 3QR0A 4KKCC 1N0LB 5KYNA 5J6HA 2I25N 2E7MA 1INQA 3OKDB 1KBKA 1JE6A 2COVD 2Q9OA 2YRBA 3TLRA 3WO4B 5MP6L 4NO3A 2QSTA 3FU7B 1BJ3B 4PP1C 3C6SB 4A67A 5GXBB 3QWQB 3PWJB 1QFWL 1SGKA 4MD0B 3NDZE 4LU5A 2BVUA 4KROD 4ATWA 5JW5A 3FPYA 1AP2B 4P3CL 1BD2D 5KYUB 3NZSA 2OYLA 1EFXD 2GG1A 4HWEL 5F7NC 1R5VA 3OV6A 4AEHH 3DTUB 5LAXB 5FIEA 3PWNA 3NT0A 3R06A 5FGCB 2RMNA 4L18A 4OFQA 5JDJA 5KYWA 2XV3A 3V4UH 1KXQA 3IPEA 3QJZA 3O11A 4RRPG 4QKJA 4YQXH 1F41A 1FHNA 1R3KB 5EIVA 2PW1A 1QHPA 1EAOA 1JRHI 3DV4A 5FV2A 1B4LA 2YFNA 1PQZB 3KDPB 1IXXA 1OAZL 4UQIM 3FQTA 1RZGB 5AZEL 4D7PA 4XVJL 1C7TA 2EADA 4URKA 4I3RL 4QRRE 3P2TA 1EO8H 3F2LA 2OI9B 4PJBA 1G1SA 1MCRA 1K9JA 4R8WH 4LP5A 4XHJD 5EZPA 3GSOB 3QUHA 2QADC 4OGAD 2EVHA 3LEVH 5DHEA 5F7FA 2V37A 3VMOA 5A6LA 5FCUH 5CSZB 2DD8L 3TNNA 2VAAB 5D7JC 4RWYH 1WAAA 5F0PB 4KWUA 4FX5A 2HFTA 4ZTPH 2Z31A 4P9HC 1FNSH 4MMZB 3CHOA 1MLCA 1D9KD 3ARXA 4I88A 5C0JA 1S9XA 2HVKB 3RFZB 3II2A 2GEQA 2XRAL 4KMLB 3D85A 3V79C 2VITA 4AYGA 4M3HA 1GGYA 1S7UB 1RFDL 2LABA 3GS4A 4E5XB 4WKXA 1H3GA 1CF1A 3JTSB 3O6KL 1VFBA 3AUWB 1BSIA 1MCQA 2G60L 5EIIG 4I77L 5KSBF 4FLOA 2AMUA 3NABH 4LSTL 4WUWA 4P2QE 3RAJH 4B53A 2V5TA 3BZEA 1EUTA 1KXTB 3OHXB 4IOFD 5EZOH 4R4BB 2Z92A 4PREA 5CGBA 4HQQL 5GGSB 3IB4A 4YHML 1YJDL 3K7BA 3CV5A 4ENZA 2K1MA 3FZUC 3HG1E 4LSVH 5I73B 5CS7A 4X6CA 4GUPA 3SKJH 3ARTA 1RJHA 5GS1A 1RUPL 1SXZA 1XH0A 4OW6A 4R4FL 5GS3A 3W5NA 2I32A 3I85A 5CIPH 4A55A 3QEUB 3H0TB 2QBWA 4ZX3A 4MD5B 3TCTA 1HHHA 1T2JA 2AQTA 3BWAB 3VFRB 3C8HA 4PB0L 3MLTB 2F7OA 4XNMB 5FM5O 2VUYA 4PJXA 1DJSA 3UACA 1ODAA 3OB0H 5CAYB 3I75B 4YHPB 3SCMA 2R0ZL 2O30A 4KI1E 1F3RB 1HT6A 4KZWA 5E1QA 2KUTA 4NQQA 3BO8A 2B1AH 4PW3A 2N7AA 3C09B 3RDTC 2EQDA 4AKQA 1G7MA 3QCTH 4CVZA 3EJPA 4NFDA 3QISA 1X5AA 3Q13A 1G7QB 2IV8A 9CGTA 4MJID 4JPVL 4XVUC 3DX9B 1HZKA 1L6XA 4Z1PA 3K2KA 4NQDE 3WDIA 2FGWH 1VZGA 1ZA6A 3GEWB 3HCVA 3FH7A 5DS1A 3SKUD 5DF0A 3RU8L 4LPCA 1G1KA 2ARWA 4NGHL 5DJYA 3TBCA 1GW6A 1R5WA 5DQJA 2V17H 4YHYC 5K9OB 3ZRFC 3TBYA 2WLJA 2OTPA 2VO8A 4IDLA 3TH2T 4NKIH 4BRJA 3NFNB 5M95B 4ZPTA 4UYPA 4RZCA 2NNRA 4K0OA 1MFEH 3OG6B 3F83A 35C8H 4D7BA 4DP0X 5EEUA 4PQXA 1PZ2A 3T77B 4M56A 4G82A 4G6MH 5DJ8A 1AOZA 3L4TA 2QQNH 4XWGL 4I3SH 5T1JA 3ZYZA 1TQBC 4N6QA 3RZCD 1C5DB 3CDFA 4UDTB 2PKDA 5B7FA 5ABZA 1RIHH 2HWZH 3KH4A 1RZPA 5AWNL 3NQKA 2QQKH 3OLDA 5C0GA 4M3KB 4NQED 1BZ7A 4IOPB 1LJMA 4R96B 5AKTA 5J3HC 1ZVYA 3GHEH 4ZMYA 4HOXA 3WWKB 1PSKL 2OMYA 1NKRA 1ASQA 3RKDD 1E40A 2DWXA 4Z7QF 5E2JA 3L3IB 4IKLA 3QVAA 4OQTH 1J0IA 4G42B 4UINH 2X4QB 1QA9B 2VMJA 4X7CC 5FYJL 4ENEC 1HUPA 4AT6B 3BI9X 4CSTA 4JANB 4GG6A 2HVBA 3AQZA 3D4YA 3QNZA 4FXGB 1Z6JT 1DQQA 1YY8B 4XNQB 1IT9L 4ZNCD 3C5JA 5A16A 5C0BD 2IC2A 1P5VB 2KV3A 3V0FA 4RBPH 1H5BB 3FC8A 3QCUH 3OC5A 5CP3H 1C12B 2AQPA 3CIAA 3TZVA 2K6ZA 1MLCB 1CB4A 3DIFA 3LHPH 4PUBL 5C0JB 1UCBH 4AW4A 5ICZA 1DQIA 1R3JA 5FB8B 2GBAA 3FN9A 2FWLB 3H53A 5GGVY 4KNSA 4CVXA 5GZNC 1KB3A 5EEVA 2XZZA 1XR8B 4N3TA 3AVEA 2R69H 4IMLA 3ZR6A 1WWCA 4RGMC 2DTSA 1AHWA 1HWHB 1IV8A 2D0HA 1S9VB 4HLJA 4BJLA 1M3IA 4OCLC 3GSXA 2C6UA 2CGRH 4UILH 1J8HD 2Y6SD 2ZICA 5I9QB 1M1XA 4FI8A 1JK9B 2Z1KA 3HR5B 3MRHB 3FS9A 2YQGA 1KIRB 5IB1B 4TSAH 4XX1G 3V5KB 3I9GH 3VXOB 3TXAA 1RKRA 5I1LB 4MB5A 2EH7H 2XKNB 4G80A 1J5OL 4BZ1L 4PCSA 2OMVB 3RWJA 4C4BA 3D0VA 1QW9A 3ISRA 2NR6C 3AU1A 1XCQB 2RD0A 3V4LA 3K71B 3PABB 4YO0A 3SGKA 3UTSB 2DQTL 4X2UA 3K72A 4PRIA 5E8DL 1IM9B 1FJ1A 2E3XC 3BN3B 3MX0A 3DMMA 1XCXA 3U46A 1E0OB 4JQVA 3VWJB 5AVTB 5FYLH 3WWKA 3BUDA 2N40A 5DHVH 4DNLA 5SWZA 4H8HA 3QDMB 1YEWA 1TJHH 1FUNA 3MV9A 2IQAB 2VM4A 2FT6A 4FYRA 4L3EE 5F70A 1SY6A 2AJZA 1P4UA 1FFPA 1KZB1 3WFDH 1QI5A 3QYNA 4HXAH 1KG0A 5D2NA 1ZMYA 1CL7H 4X0NA 2ZP0T 4F8QA 4MRCA 5HHOE 4NP4H 4A6YB 2YPKB 3I6GA 2R2HB 2KZBA 3EOTH 2CRIA 2WYZA 4NO5A 1UMRA 4QXGH 3LNDA 4I1RA 1XBDA 4J3OC 1E9OB 3IXTA 4IGBD 1M9WA 1A7BA 1W0VB 1RDK1 3T2NL 1TZIB 4YC2B 3S96A 1AOHA 3UTSE 3P9LA 4ILDA 5BOPA 4RMUA 1R5WB 1AR1C 5DQJB 3TT1L 3DHPA 2KLTA 1YZZA 3ZDWA 3C22A 4TSBL 4G6JH 2D0FA 1AYRA 1X5JA 5AOKA 3QUMH 5FO2A 1T1YB 4ANKA 5JHMA 2J2ZB 1M6OB 4QXTA 4BUQA 2EDXA 4P23D 4JFFA 5DD0L 4GAJL 1WIUA 1CGXA 5JHDE 5D72L 3MO1A 3NZ8B 4B97A 4M62L 4TV3A 3KL3A 1HXYA 5FOBA 1RUQL 2J56A 3KPRB 4LSSH 3VFNB 4HISA 1DN0A 3ETBJ 1MZYA 1XD0A 4NN7C 1BZ8A 2BRRL 2X4SB 3TBYB 2D7TH 1EEYA 4W9DC 4PJIA 1NDMB 4KX9A 2XSKA 4RDQG 3DOHA 3RNKB 4LLYA 4EN3C 1IBZA 3BP6A 1F18A 4K2UH 3MRGA 4JZOA 2VXSL 4DGIL 1NCBH 4JRYD 4S0UA 1C08B 1ITBB 1W6LA 2Y06H 4CNIA 1X5GA 4B9YA 3WS3B 3N55A 1D2OA 3VXMB 4TNVK 4XCFH 1CF8H 1ZHLA 3D07A 1YEIH 2E47A 3QUGA 5EU3B 1CBVH 4ZW8A 3B7UX 3K71A 2X4PB 4M7LH 3DDFA 1YMMB 1XT5A 5AB0A 1X9RA 3IDXH 1J1OL 1CD8A 4JAMA 4LXFA 1NZRA 1NCHA 5EN2B 4UTAH 1NM4A 3HZKB 3JYCA 4LASH 5ESAB 3VRJB 1MOEA 2X1WL 3EGXB 4Y5VA 3FOLA 4TULH 2NY3B 2DN7A 1KCRH 2J20A 3IF1A 1J5IA 4Z3FA 2EVJA 2GPZA 1NGZB 1ZS8B 2BSTB 3MV8E 4D0CB 3EO9H 3DGDA 2DYRB 1RUKH 5LAPA 4ERSL 2YEZA 1SVCP 2P80D 5HJGA 2DDQH 2IXQA 4BE5A 2IGTA 4P23B 3DSFL 1EX0A 1SDYA 2F2HA 2F08A 1O7DE 2R0LL 4NRYA 5HPMB 4RCAA 1G1CA 3QO1B 4X6EA 5D1XA 1UWYA 5CU9A 3JWNH 2J12B 3KGRA 1OP9A 3QZBA 2GIMA 2PF6A 2XZAH 5GGTH 1BQKA 3D0AA 1OANA 3VTTA 1UACH 5TFSL 4LFHG 3O6MH 1QFHA 2DQGH 1IC7L 4QY8B 5I30L 4NI3A 4PJ9A 2ZUQC 4KKRA 3PQYB 3GJEB 4JRYA 4ES9A 4Y0GA 4I13B 1DDHA 5IGXL 1MCHA 1Y7VA 4RRPA 4UAOB 1SLWA 3X12A 5E5LA 1QQDA 1YN6B 1A8ZA 1ZVSB 1F4WH 5HDQH 3CQFA 5KSUA 3GXDA 4E9TA 1D6EA 1H3TA 2HJKA 4WDIB 1BVZA 4YN3A 4M9PA 3QXTA 4P4RB 4U6YB 1QZ1A 4R7NA 3U25A 1KXVA 3QWRD 1M2VB 2VDML 3HE7D 3U0TB 1QKZH 1ML0A 4F58H 3CK0L 5I1EH 1EJFA 3HG5A 2W0FB 3P9WB 4MMXB 4I48B 4XWOC 1MAMH 2EDOA 4WI6A 2VXUL 2YAQA 4JCWA 2SODB 1K8DB 3DNKA 1ZS2A 3MXVL 4Y9BA 2P80A 3K2IA 3WXWL 3QUXD 4NCC1 1YYMH 4APQD 2FATH 3BUIA 3FULA 5AZ2L 1CFNB 2Q7YA 4WUKH 3WEBA 3WOVA 3GBLA 3BUQA 2R7EA 3IJ8A 1QLEB 5HYEA 1FNGB 1WICA 5K5YA 2Z35A 2ZOWA 4ONOA 3ILQC 1AO7B 4XC3L 3QDGA 3QORC 2R1WB 4P46A 4JFED 3X1NA 3QZMA 5GGQL 4K8RH 1W72L 1QLEL 3JWNE 5DHVA 4ZMVA 2WVUA 2OJZH 1VGKA 2AXGB 2P44B 1CGSL 1CFVL 1BXAA 3T3PB 2A4EA 1FCGA 4WFHD 3WO4C 3FO1B 1KYUA 3CH8A 1FI8C 5TH2B 1MFDL 4BXSV 3DUSA 4U6XA 3VH8G 3MGTA 1S7XA 4Z7IA 1BIIB 4YDVB 5F1IA 4FLHA 2Z65C 1FIGH 4CADA 1MCWW 3VD1A 1J1XH 5FFTA 3U4AA 1YMHB 5DMIH 4AG4L 2YGVA 3VFPB 1QOKA 3F05A 1OGAB 2BP3A 5CCKH 1KXVC 5DZPA 5JW3L 4JO2H 1MNNA 1P2CA 1DBMH 3HE7B 2TAAA 3KWTA 3UG5A 4UB0H 2X4PA 3U9UB 3VFGH 5C09E 1CG9B 5DXWA 2VQTA 4IDJL 4XBEL 1A9BB 4M43L 5D1QB 3MFFA 5D9SB 3ARVA 3G83A 1F42A 1GJUA 3EH4B 2AJ3A 3WKPA 4OIIL 3OHXA 4PJDF 1WZ1L 3D25B 4U1JB 5I1DB 4HX1A 3A4DA 2CO7B 4CMMB 5C86A 3FDWA 1MWAL 3FJTA 2OSLB 3CSYA 2GIYA 2XX0A 1I7RA 2X3BA 3APMA 2CUAA 3AREA 4P46D 1OB1A 2D4FA 2WCPA 2IV9A 4URTB 3GBEA 1G6RL 3VG9B 4P2OA 3L5JA 2VMDA 1KPRB 5EZLB 2C3HA 4MD4A 2RFXB 3NSFA 2W9EH 5GRVL 1I8LA 2UY6B 1MFAL 1QO3C 2PO6B 2BS8A 4YDJA 4DEWA 1OZUA 3HAEH 4HT1L 1E9PB 3ECWA 4WI7A 4D9RE 3HBPA 2NPLX 5DEGB 4LPXA 3FUNA 1RD6A 2R9HC 5FKAB 4MAZA 4GFTB 1HL4A 2A9DA 3GDBA 4L0YA 4TKWA 2DMCA 1KN4L 3DARA 3KW7A 4FP8H 5DUBB 3TA4D 5BNXD 3BAWA 1A0QL 3UTZA 5ISZD 1G1RA 4DKEL 3EAKA 3HB3B 5ACZB 3ATBA 2YR3A 1JGVL 2R8SL 3JV4B 4R7NB 1JDAA 4Z95H 4X8GA 1HYSC 5EDXA 2DTMH 1MFVA 3D3VB 5FGCE 3U2JA 4AM0A 4DGWC 3JV6B 5DURD 1HKLH 4TSCL 4QYOA 4PCTA 2AQRA 2GYSA 1DZBA 2BJMH 1BCH1 1JPSL 4FHJA 5CJ8A 3VTMA 3WIIL 4P5MB 2HT3D 4YHOL 4XE5B 4RZCB 4MBOA 4F7KA 3QFGA 2V9TA 4PRAB 4KJYB 1U58B 1MCDA 5DJ8B 5CZXC 1OQOA 3MUGB 1B4TA 5T1KA 4Z7WF 2TSBA 3BHBB 1BFVL 1RULL 3ARBB 2G9HA 2YGNA 1J5CA 3PREA 4PJ8C 5JHLH 1TNMA 3V0VA 2K70A 3O3AA 4XPBH 5GRYA 1LDSA 1SVZA 4DSYA 1QPPA 3KJ6L 4AQAA 4UQ2B 3SDXE 3EDKA 4MJ4A 1XB3A 2C1OB 2ATPB 4OJEH 3PHOA 3ULSB 5F7AA 3PWUB 1MW1A 3R1GH 4JRXA 1IQWL 2PCPA 5C0AA 4GKZB 1ID2A 3DJRA 3ZDXB 4U1JA 1T7YA 2BVTA 2G4GA 3CPLA 5I17A 4LARL 1B3JA 3RZCC 2ZOLA 1JGEB 1WCBB 2PWGA 3BVVA 2IOOA 3CHRA 3D6GA 1NCJA 2B0SL 3EF7A 1THAA 1VADB 2QVIA 3VDBA 3F6LA 4S0HA 4LRNH 5DLLA 3UTSA 1WD9A 4EDWL 4IK7A 4Y19B 4ZX4A 3WH3A 1HL9A 2IDUA 5IW6A 1C3AA 4K55A 4L2YA 4ZESA 4R0LB 5I74B 3SE4A 1G4RA 1FVCA 2P28B 4IMKC 2F7PA 4NKQB 4M6MH 4KQ3H 3QXAA 1E87A 4TNWF 1A1NB 5ECGA 1KCVH 1WMZA 4PRPA 3H7BA 1GZQB 3CE1A 3WFCH 1TZOA 4PRNB 1U8LB 5B21A 3MYJB 2XV2A 1UM5H 1KGCE 1RJCA 2EIBA 2GTWB 4JRFA 3ZQWA 4EI5C 4FJYA 3SY0A 1NKOA 3FO9B 4PGEB 4F5CE 3FTSA 3QDMD 5EFIB 1UOSA 1DR9A 2ZF8A 3HUJA 4JY5L 4HIJB 1DSFH 2XWXA 4M6NH 5BVPH 1YEEH 1MJ7L 1HNFA 2Z1PA