2ZQNA

Crystal structure of the earthworm r-type lectin c-half in complex with lactose
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
KPKFFYIKSELNGKVLDIEGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWIVSGNTIAQLSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQKFIIESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sugar-complex structures of the C-half domain of the galactose-binding lectin EW29 from the earthworm Lumbricus terrestris
pubmed doi rcsb
molecule keywords 29-kDa galactose-binding lectin
molecule tags Sugar binding protein
source organism Lumbricus terrestris
total genus 37
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2zqnA00
4Q9GA 5BXSA 3S8KA 3PHZA 2UUSA 3HALA 4I4RA 2FFVA 2E4MA 5JLVA 3BA7A 2Z48A 4EEEB 1R8NA 1EVTA 4ZA3B 4OEGA 3VSZA 4GP3A 2RG9B 1FQ9A 2FO1A 4ZFYB 5D62A 3D7WB 3O4BA 2F8XC 2KI6B 3A22A 3O49A 4L4HA 2NP0A 2HWMA 1AXMA 3CA6A 3O4OA 1S0FA 5FNXA 5FZYA 2MIBA 4IYBA 3N7JA 1AVXB 2DS0A 3ZXDA 4JQ0A 3RMYA 1UPSA 2K8RA 3WA1A 1V6VA 2VXTI 1S0GA 3O4CA 2IHOA 1AVAC 1YXWA 4I4SA 4LO0A 3BAUA 4Q91A 1G9DA 3BAHA 3CRHA 3CA3A 2HZ9A 5GAQA 4ZLBB 4A7YA 4IZEA 3V0AA 1A8DA 3WO2A 1S0BA 2D7RA 5F8SA 1HWMB 2K4AB 1M16A 4YOLA 4X38A 1HCEA 1JY0A 3O4DA 1ISWA 4QBVA 3T8SA 1G9CA 3O44A 1EPWA 3O4AA 1YF8B 3UDAA 3WINA 1GGPB 4LO1C 4F34A 3WMUA 3ZC9A 9ILBA 1FMZA 1DIWA 1BASA 4HJJA 2FFUA 4I4QA 3BRFA 3AH2A 4G1RA 1IILA 3AZWA 2D22A 3FJHA 3AKIA 3O3QA 1J0SA 1XG6A 3OBTA 1XYFA 1NZKA 2ZQNA 3N7KA 2ZR1B 4EFQA 5D61A 3P6IA 5FZZA 2D24A 3AZVA 4GAFA 3CQAA 3S8JA 2LIEA 3FJIA 4LO8B 1T4QA 4GOVA 1IJTA 1CVSA 3PG0A 4GOYA 3HBWA 1JQZA 1Z2VA 1ISZA 3I2XA 1IT0A 1TOOA 2Y9XE 1FV2A 1IOBA 1DQOA 3BB2A 3CRIA 3VUOA 2MC2A 2BEAA 2Y9GA 1RY7A 3H6RA 5DSSB 3HN1A 1M2TB 1II4A 1WBAA 3F62B 2E4MC 1Q03A 2RQ9A 1DQGA 3WO4A 1AVUA 3AKHA 3WMVA 4IY9A 1TWEA 1AFCA 3E8LC 2I1BA 4XFTA 4XFUA 5F8WA 3FJJA 5I1BA 1R8OA 3Q7WA 4USPA 3UD8A 3TC2A 1ILR1 3FGMA 2M49A 4QO3A 3JUTA 4J2YA 1ISXA 1ISVA 3ILAA 2VUAA 1HIBA 4I4OA 4A7ZA 1XHBA 4OWKA 4G9MA 4LO3A 3BAQA 4IY8A 3Q7XA 3V0AB 4QKSA 3W9TA 3UJ0A 2HW9A 1BA7A 1FWUA 4JKQA 2Y9WC 4LO0C 1HWPB 4LO2A 4OEFA 5FZUA 1MD6A 4JRAA 3HMYA 1DZDA 3ZC8A 3FJKA 3BA4A 31BIA 2IWTB 3UJ4A 1Q1UA 4OEEA 2X2SA 5DVHA 2ET2A 1JTCA 4IHZA 2X2TA 2D1ZA 7I1BA 2P23A 1BLDA 3RTIB 3WINC 3FJFA 4FGFA 2WBCA 4IONA 4TLPA 1TTUA 4OW4A 2MLLB 3A07A 3OJ2A 2DRYA 2J3PA 4F83A 4X39A 4I37A 4H04A 1JT5A 1K5UA 1FMMS 5FNWA 2NYYA 1N4KA 4GAIA 3BADA 4I6IA 3VEQA 3AJ6A 3RSJA 3CA0A 5BOWA 3R4SA 1Q04A 2QN4A 4I4UA 3NBDA 1HKNA 2KI4A 2Q9XA 4I8MA 4ZKTB 3IIRA 2QYIB 4EKXB 1K5VA 3CA5A 5DZUA 3OGGA 3NJ5A 2R9KB 3H6RB 4EFRA 2ZQOA 1BFFA 1D0HA 3QR5A 2VSAA 4I1EA 1I1EA 3PUBA 1W3FA 4ENDA 1VCLA 3A21A 4I96A 1PUUB 1BFCA 3CA1A 3H6QA 1V6WA 3AH4A 21BIA 1Z0HA 2AAIB 4EFPA 1FV3A 3UD7A 3FJDA 4GP0A 2K43A 1DLLA 2NTDA 1DJSB 2P39A 1NUNA 2DRZA 1F31A 1BFGA 2KH2A 3QYDA 2NVHA 5E24E 3I2AA 1MC9A 1W3AA 4DENA 2Z49A 3V0BA 4I3NA 3OBRA 1IHKA 3RMXA 2D44A 3R4UA 4P6AA 5D63A 4OWJA 4P0JA 1XZZA 1CE7B 3K1XA 2D43A 3BA5A 1RZOB 4IQPA 4ZGRB 4LO3C 2RSTA 4I4PA 3BX1C 1BARA 4I2SA 2D23A 1PUMB 4P0LA 1ITBA 1YBIA 2D20A 4KBBA 5BQUA 3V79C 1QQKA 3FUOA 2VSEA 1SZ6B 4G9NA 1ISYA 2KKIA 5BXPA 3H6SE 4ISRA 4LO2C 3CRGA 3AKGA 3LTQA 1HWOB 4KEIA 2VXRA 4I1BA 4G6MA 4ZOTA 1L2HA 4J2KA 1W3GA 4Z9WB 3BAOA 1PWAA 2XOAA 1JLXA 4J2SA 3BAVA 3BAGA 4JPZA 4KEJA 4J2XA 4I7IA 3UD9A 1FWVA 1QXMA 3A23A 3CA4A 4JAWA 1BLAA 4X37A 4Z8SB 1IRAX 4HR6C 1YTOA 3NBNA 1HWNB 3FJ9A 2AFGA 41BIA 6I1BA 3JRRA 4L4IA 4CJMA 1SR4A 2YUGA 3N7MA 2F2FA 3NBCA 4XFSA 5EHAA 3BRDA 3KMVA 1S0EA 3AH1A 5BXRA 1WD3A 2AQZA 5EC5A 2HWAA 1Z4SA 1ONKB 2FDBM 2L5XA 4IZXA 3AKFA 3O5WB 2NM1A 1WBCA 5BP5A 1BFBA 3IM5A 1V6UA 5F8YA 3P6JA 3HSMA 1FGAA 3POKA 1DFQA 2GO2A 3OJVA 4XKIA 3VSFA 4J23B 4QBCA 4D0ZA 3I29B 1E0OA 1JLYA 5B2HA 4PC4A 3CU1B 2VU9A 1I1BA 2KLLA 3ZXGA 1DZCA 5G00A 3IM7A 1JT7A 5DUYA 3MPPG 2ERMA 1HCDA 2LIQA 3AJ5A 3IM6A 4P0KA 4AN6A 1TFMB 3VT0A 2GZBA 4JKXB 1RMLA 2BFHA 3Q7YA 4QALA 1EYLA 4ZBVB 1TIEA 3V0BB 5EG6C 4OWLA 4I4XA 4X3AA 2NZ9A 1V6XA 3N7LA 2FGFA 4LO7B 3VWCA 1WD4A 4Q9PA 1FN0A 1JT4A 1DFCA 8I1BA 1S0CA 1P63A 2VLCA 3FJAA 3BTAA 5BXTA 1YYNA 4WBCA 4HA2A 4ZFUB 1G9AA 1S0LA 1TWMA 3PMEA 4LO7C 1ABRB 3B9UA 1EV2A 2ESUA 1OQLB 4QKRA 3VT2A 5BQUC 4FVVA 3WO3A 2Q3NB 4AN7B 3OJMA 5JMCA 4DEPA 5HPZA 3F1RA 2BEBA 4II0A 4OUJA 3LLPA 4QD2B 1IRPA 4LO1A 4D0TA 1PC8B 3MALA 2DREA 3SNVA 3VT1A 4JP0A 4EB2B 3NBEA 3EF2A 1G9BA 3P53A 4D8HA 1QQLA 4ZFWB 3ZX7A 4KC3A 4KEKA 3C9ZA 4G6JA 1AF9A 3BRGC 4DCKC 1G82A 3FJBA 4QD2C 1RG8A 3FJEA 4R6UB 1T9FA 3FUQA 1SR4C 5F90A 3HOMA 2F2FC 3N0KA 3FJ8A 2AXMA 4I0YA 3FFZA 3OGFA 4A7KA 1TP0A 5BVPI 3RTJB 1AVWB 1JT3A 2D7IA 2Y9FA 4I4VA 4QC4A 3FJCA 1S0DA 3CAHA 4ISQA 5BP5C 1PZZA 1KNMA 4USOA 2WRYA 3IAGC 4H9WA 4I4YA
chains in the Genus database with same CATH superfamily
4Q9GA 5BXSA 3S8KA 3PHZA 4MZGB 2UUSA 3HALA 4I4RA 2FFVA 2E4MA 5JLVA 3BA7A 2Z48A 4EEEB 1R8NA 1EVTA 4ZA3B 4OEGA 3VSZA 4GP3A 2RG9B 1FQ9A 2FO1A 4ZFYB 5D62A 3D7WB 3O4BA 2F8XC 2KI6B 3A22A 4MZHA 3O49A 4L4HA 2NP0A 2HWMA 1AXMA 3CA6A 3O4OA 1S0FA 5FNXA 5FZYA 2MIBA 4IYBA 3N7JA 1AVXB 2DS0A 3ZXDA 4JQ0A 3RMYA 1UPSA 2K8RA 3WA1A 1V6VA 2VXTI 1S0GA 3O4CA 2IHOA 1AVAC 1YXWA 4I4SA 4LO0A 3BAUA 4Q91A 2NS2A 1G9DA 3BAHA 3CRHA 3CA3A 2HZ9A 5GAQA 4ZLBB 4A7YA 4IZEA 3V0AA 1A8DA 3WO2A 1S0BA 2D7RA 5F8SA 1HWMB 2K4AB 1M16A 4YOLA 4X38A 1HCEA 1JY0A 3O4DA 1ISWA 4QBVA 3T8SA 1G9CA 3O44A 1EPWA 3O4AA 1YF8B 3UDAA 3WINA 1GGPB 4LO1C 4F34A 3WMUA 3ZC9A 9ILBA 1FMZA 1DIWA 1BASA 4HJJA 2FFUA 4I4QA 3BRFA 3AH2A 4G1RA 1IILA 3AZWA 2D22A 3FJHA 3AKIA 3O3QA 1J0SA 1XG6A 3OBTA 1XYFA 1NZKA 2ZQNA 3N7KA 2ZR1B 4EFQA 5D61A 3P6IA 5FZZA 2D24A 3AZVA 4GAFA 3CQAA 3S8JA 2LIEA 3FJIA 4LO8B 1T4QA 4GOVA 1IJTA 1CVSA 3PG0A 4GOYA 3HBWA 1JQZA 1Z2VA 1ISZA 3I2XA 1IT0A 1TOOA 2Y9XE 1FV2A 1IOBA 1DQOA 3BB2A 3CRIA 3VUOA 2MC2A 2BEAA 2Y9GA 1RY7A 3H6RA 5DSSB 3HN1A 1M2TB 1II4A 1WBAA 3F62B 2E4MC 1Q03A 2RQ9A 1DQGA 3WO4A 1AVUA 3AKHA 3WMVA 4IY9A 1TWEA 1AFCA 3E8LC 2I1BA 4XFTA 4XFUA 5F8WA 3FJJA 5I1BA 1R8OA 3Q7WA 4USPA 3UD8A 3TC2A 1ILR1 3FGMA 2M49A 4QO3A 3JUTA 4J2YA 1ISXA 1ISVA 3ILAA 2VUAA 1HIBA 4I4OA 4A7ZA 1XHBA 4OWKA 4G9MA 4LO3A 3BAQA 4IY8A 3Q7XA 3V0AB 4QKSA 3W9TA 3UJ0A 2HW9A 1BA7A 1FWUA 4JKQA 2Y9WC 4LO0C 1HWPB 4LO2A 4OEFA 5FZUA 1MD6A 4JRAA 3HMYA 1DZDA 3ZC8A 3FJKA 3BA4A 31BIA 2IWTB 3UJ4A 1Q1UA 4OEEA 2X2SA 5DVHA 2ET2A 1JTCA 4IHZA 2X2TA 2D1ZA 7I1BA 2P23A 1BLDA 3RTIB 3WINC 3FJFA 4FGFA 2WBCA 4IONA 4TLPA 1TTUA 4OW4A 2MLLB 3A07A 3OJ2A 2DRYA 2J3PA 4F83A 4X39A 4I37A 4H04A 1JT5A 1K5UA 1FMMS 5FNWA 2NYYA 1N4KA 4GAIA 3BADA 4I6IA 3VEQA 3AJ6A 3RSJA 3CA0A 5BOWA 3R4SA 1Q04A 2QN4A 4I4UA 3NBDA 1HKNA 2KI4A 2Q9XA 4I8MA 4ZKTB 3IIRA 2QYIB 4EKXB 1K5VA 3CA5A 5DZUA 3OGGA 3NJ5A 2R9KB 3H6RB 4EFRA 2ZQOA 1BFFA 1D0HA 3QR5A 2VSAA 4I1EA 1I1EA 3PUBA 1W3FA 4ENDA 1VCLA 3A21A 4I96A 1PUUB 1BFCA 3CA1A 3H6QA 1V6WA 3AH4A 21BIA 1Z0HA 2AAIB 4EFPA 1FV3A 3UD7A 3FJDA 4GP0A 2K43A 1DLLA 2NTDA 1DJSB 2P39A 1NUNA 2DRZA 1F31A 1BFGA 2KH2A 3QYDA 2NVHA 5E24E 3I2AA 1MC9A 1W3AA 4DENA 2Z49A 3V0BA 4I3NA 3OBRA 1IHKA 3RMXA 2D44A 3R4UA 4P6AA 5D63A 4OWJA 4P0JA 1XZZA 1CE7B 3K1XA 2D43A 3BA5A 1RZOB 4IQPA 4ZGRB 4LO3C 2RSTA 4I4PA 3BX1C 1BARA 4I2SA 2D23A 1PUMB 4P0LA 1ITBA 1YBIA 2D20A 4KBBA 5BQUA 3V79C 1QQKA 3FUOA 2VSEA 1SZ6B 4G9NA 1ISYA 2KKIA 5BXPA 3H6SE 4ISRA 4LO2C 3CRGA 3AKGA 3LTQA 1HWOB 4KEIA 2VXRA 4I1BA 4G6MA 4ZOTA 1L2HA 4J2KA 1W3GA 4Z9WB 3BAOA 1PWAA 2XOAA 1JLXA 4J2SA 3BAVA 3BAGA 4JPZA 4KEJA 4J2XA 4I7IA 3UD9A 1FWVA 1QXMA 3A23A 3CA4A 4JAWA 1BLAA 4MZFB 4X37A 4Z8SB 1IRAX 4HR6C 1YTOA 3NBNA 1HWNB 3FJ9A 2AFGA 41BIA 6I1BA 3JRRA 4L4IA 4CJMA 1SR4A 2YUGA 3N7MA 2F2FA 3NBCA 4XFSA 5EHAA 3BRDA 3KMVA 1S0EA 4H75A 3AH1A 5BXRA 1WD3A 2AQZA 5EC5A 2HWAA 1Z4SA 1ONKB 2FDBM 2L5XA 4IZXA 3AKFA 3O5WB 2NM1A 1WBCA 5BP5A 1BFBA 3IM5A 1V6UA 5F8YA 3P6JA 3HSMA 1FGAA 3POKA 1DFQA 2GO2A 3OJVA 4XKIA 3VSFA 4J23B 4QBCA 4D0ZA 3I29B 1E0OA 1JLYA 5B2HA 4PC4A 3CU1B 2VU9A 1I1BA 2KLLA 3ZXGA 1DZCA 5G00A 3IM7A 1JT7A 5DUYA 3MPPG 2ERMA 1HCDA 2LIQA 3AJ5A 3IM6A 4P0KA 4AN6A 1TFMB 3VT0A 2GZBA 4JKXB 1RMLA 2BFHA 3Q7YA 4QALA 1EYLA 4ZBVB 1TIEA 3V0BB 5EG6C 4OWLA 4I4XA 4X3AA 4UY4A 2NZ9A 1V6XA 3N7LA 2FGFA 4LO7B 3VWCA 1WD4A 4Q9PA 1FN0A 1JT4A 1DFCA 8I1BA 1S0CA 1P63A 2VLCA 3FJAA 3BTAA 5BXTA 1YYNA 4WBCA 4HA2A 4ZFUB 1G9AA 1S0LA 1TWMA 3PMEA 4LO7C 1ABRB 3B9UA 1EV2A 2ESUA 1OQLB 4QKRA 3VT2A 5BQUC 4FVVA 3WO3A 2Q3NB 4AN7B 3OJMA 5JMCA 4DEPA 5HPZA 3F1RA 2BEBA 4II0A 4OUJA 3LLPA 4QD2B 1IRPA 4LO1A 4D0TA 1PC8B 3MALA 2DREA 3SNVA 3VT1A 4JP0A 4EB2B 3NBEA 3EF2A 1G9BA 3P53A 4D8HA 1QQLA 4ZFWB 3ZX7A 4KC3A 4KEKA 3C9ZA 4G6JA 1AF9A 3BRGC 4DCKC 1G82A 3FJBA 4QD2C 1RG8A 3FJEA 4R6UB 1T9FA 3FUQA 1SR4C 5F90A 3HOMA 2F2FC 3N0KA 3FJ8A 2AXMA 4I0YA 3FFZA 3OGFA 4A7KA 1TP0A 5BVPI 3RTJB 1AVWB 1JT3A 2D7IA 2Y9FA 4I4VA 4QC4A 3FJCA 1S0DA 3CAHA 4ISQA 5BP5C 1PZZA 1KNMA 4USOA 2WRYA 3IAGC 4H9WA 4I4YA
chains in the Genus database with same CATH topology
4Q9GA 5BXSA 3S8KA 3PHZA 4MZGB 2UUSA 3HALA 4I4RA 2FFVA 2E4MA 5JLVA 3BA7A 2Z48A 4EEEB 1R8NA 1EVTA 4ZA3B 4OEGA 3VSZA 4GP3A 2RG9B 1FQ9A 2FO1A 4ZFYB 5D62A 3D7WB 3O4BA 2F8XC 2KI6B 3A22A 4MZHA 3O49A 4L4HA 2NP0A 2HWMA 1AXMA 3CA6A 3O4OA 1S0FA 5FNXA 5FZYA 2MIBA 4IYBA 3N7JA 1AVXB 2DS0A 3ZXDA 4JQ0A 3RMYA 1UPSA 2K8RA 3WA1A 1V6VA 2VXTI 1S0GA 3O4CA 2IHOA 1AVAC 1YXWA 4I4SA 4LO0A 3BAUA 4Q91A 2NS2A 1G9DA 3BAHA 3CRHA 3CA3A 2HZ9A 5GAQA 4ZLBB 4A7YA 4IZEA 3V0AA 1A8DA 3WO2A 1S0BA 2D7RA 5F8SA 1HWMB 2K4AB 1M16A 4YOLA 4X38A 1HCEA 1JY0A 3O4DA 1ISWA 4QBVA 3T8SA 1G9CA 3O44A 1EPWA 3O4AA 1YF8B 3UDAA 3WINA 1GGPB 4LO1C 4F34A 3WMUA 3ZC9A 9ILBA 1FMZA 1DIWA 1BASA 4HJJA 2FFUA 4I4QA 3BRFA 3AH2A 4G1RA 1IILA 3AZWA 2D22A 3FJHA 3AKIA 3O3QA 1J0SA 1XG6A 3OBTA 1XYFA 1NZKA 2ZQNA 3N7KA 2ZR1B 4EFQA 5D61A 3P6IA 5FZZA 2D24A 3AZVA 4GAFA 3CQAA 3S8JA 2LIEA 3FJIA 4LO8B 1T4QA 4GOVA 1IJTA 1CVSA 3PG0A 4GOYA 3HBWA 1JQZA 1Z2VA 1ISZA 3I2XA 1IT0A 1TOOA 2Y9XE 1FV2A 1IOBA 1DQOA 3BB2A 3CRIA 3VUOA 2MC2A 2BEAA 2Y9GA 1RY7A 3H6RA 5DSSB 3HN1A 1M2TB 1II4A 1WBAA 3F62B 2E4MC 1Q03A 2RQ9A 1DQGA 3WO4A 1AVUA 3AKHA 3WMVA 4IY9A 1TWEA 1AFCA 3E8LC 2I1BA 4XFTA 4XFUA 5F8WA 3FJJA 5I1BA 1R8OA 3Q7WA 4USPA 3UD8A 3TC2A 1ILR1 3FGMA 2M49A 4QO3A 3JUTA 4J2YA 1ISXA 1ISVA 3ILAA 2VUAA 1HIBA 4I4OA 4A7ZA 1XHBA 4OWKA 4G9MA 4LO3A 3BAQA 4IY8A 3Q7XA 3V0AB 4QKSA 3W9TA 3UJ0A 2HW9A 1BA7A 1FWUA 4JKQA 2Y9WC 4LO0C 1HWPB 4LO2A 4OEFA 5FZUA 1MD6A 4JRAA 3HMYA 1DZDA 3ZC8A 3FJKA 3BA4A 31BIA 2IWTB 3UJ4A 1Q1UA 4OEEA 2X2SA 5DVHA 2ET2A 1JTCA 4IHZA 2X2TA 2D1ZA 7I1BA 2P23A 1BLDA 3RTIB 3WINC 3FJFA 4FGFA 2WBCA 4IONA 4TLPA 1TTUA 4OW4A 2MLLB 3A07A 3OJ2A 2DRYA 2J3PA 4F83A 4X39A 4I37A 4H04A 1JT5A 1K5UA 1FMMS 5FNWA 2NYYA 1N4KA 4GAIA 3BADA 4I6IA 3VEQA 3AJ6A 3RSJA 3CA0A 5BOWA 3R4SA 1Q04A 2QN4A 4I4UA 3NBDA 1HKNA 2KI4A 2Q9XA 4I8MA 4ZKTB 3IIRA 2QYIB 4EKXB 1K5VA 3CA5A 5DZUA 3OGGA 3NJ5A 2R9KB 3H6RB 4EFRA 2ZQOA 1BFFA 1D0HA 3QR5A 2VSAA 4I1EA 1I1EA 3PUBA 1W3FA 4ENDA 1VCLA 3A21A 4I96A 1PUUB 1BFCA 3CA1A 3H6QA 1V6WA 3AH4A 21BIA 1Z0HA 2AAIB 4EFPA 1FV3A 3UD7A 3FJDA 4GP0A 2K43A 1DLLA 2NTDA 1DJSB 2P39A 1NUNA 2DRZA 1F31A 1BFGA 2KH2A 3QYDA 2NVHA 5E24E 3I2AA 1MC9A 1W3AA 4DENA 2Z49A 3V0BA 4I3NA 3OBRA 1IHKA 3RMXA 2D44A 3R4UA 4P6AA 5D63A 4OWJA 4P0JA 1XZZA 1CE7B 3K1XA 2D43A 3BA5A 1RZOB 4IQPA 4ZGRB 4LO3C 2RSTA 4I4PA 3BX1C 1BARA 4I2SA 2D23A 1PUMB 4P0LA 1ITBA 1YBIA 2D20A 4KBBA 5BQUA 3V79C 1QQKA 3FUOA 2VSEA 1SZ6B 4G9NA 1ISYA 2KKIA 5BXPA 3H6SE 4ISRA 4LO2C 3CRGA 3AKGA 3LTQA 1HWOB 4KEIA 2VXRA 4I1BA 4G6MA 4ZOTA 1L2HA 4J2KA 1W3GA 4Z9WB 3BAOA 1PWAA 2XOAA 1JLXA 4J2SA 3BAVA 3BAGA 4JPZA 4KEJA 4J2XA 4I7IA 3UD9A 1FWVA 1QXMA 3A23A 3CA4A 4JAWA 1BLAA 4MZFB 4X37A 4Z8SB 1IRAX 4HR6C 1YTOA 3NBNA 1HWNB 3FJ9A 2AFGA 41BIA 6I1BA 3JRRA 4L4IA 4CJMA 1SR4A 2YUGA 3N7MA 2F2FA 3NBCA 4XFSA 5EHAA 3BRDA 3KMVA 1S0EA 4H75A 3AH1A 5BXRA 1WD3A 2AQZA 5EC5A 2HWAA 1Z4SA 1ONKB 2FDBM 2L5XA 4IZXA 3AKFA 3O5WB 2NM1A 1WBCA 5BP5A 1BFBA 3IM5A 1V6UA 5F8YA 3P6JA 3HSMA 1FGAA 3POKA 1DFQA 2GO2A 3OJVA 4XKIA 3VSFA 4J23B 4QBCA 4D0ZA 3I29B 1E0OA 1JLYA 5B2HA 4PC4A 3CU1B 2VU9A 1I1BA 2KLLA 3ZXGA 1DZCA 5G00A 3IM7A 1JT7A 5DUYA 3MPPG 2ERMA 1HCDA 2LIQA 3AJ5A 3IM6A 4P0KA 4AN6A 1TFMB 3VT0A 2GZBA 4JKXB 1RMLA 2BFHA 3Q7YA 4QALA 1EYLA 4ZBVB 1TIEA 3V0BB 5EG6C 4OWLA 4I4XA 4X3AA 4UY4A 2NZ9A 1V6XA 3N7LA 2FGFA 4LO7B 3VWCA 1WD4A 4Q9PA 1FN0A 1JT4A 1DFCA 8I1BA 1S0CA 1P63A 2VLCA 3FJAA 3BTAA 5BXTA 1YYNA 4WBCA 4HA2A 4ZFUB 1G9AA 1S0LA 1TWMA 3PMEA 4LO7C 1ABRB 3B9UA 1EV2A 2ESUA 1OQLB 4QKRA 3VT2A 5BQUC 4FVVA 3WO3A 2Q3NB 4AN7B 3OJMA 5JMCA 4DEPA 5HPZA 3F1RA 2BEBA 4II0A 4OUJA 3LLPA 4QD2B 1IRPA 4LO1A 4D0TA 1PC8B 3MALA 2DREA 3SNVA 3VT1A 4JP0A 4EB2B 3NBEA 3EF2A 1G9BA 3P53A 4D8HA 1QQLA 4ZFWB 3ZX7A 4KC3A 4KEKA 3C9ZA 4G6JA 1AF9A 3BRGC 4DCKC 1G82A 3FJBA 4QD2C 1RG8A 3FJEA 4R6UB 1T9FA 3FUQA 1SR4C 5F90A 3HOMA 2F2FC 3N0KA 3FJ8A 2AXMA 4I0YA 3FFZA 3OGFA 4A7KA 1TP0A 5BVPI 3RTJB 1AVWB 1JT3A 2D7IA 2Y9FA 4I4VA 4QC4A 3FJCA 1S0DA 3CAHA 4ISQA 5BP5C 1PZZA 1KNMA 4USOA 2WRYA 3IAGC 4H9WA 4I4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q9G A;  5BXS A;  3S8K A;  3PHZ A;  2UUS A;  3HAL A;  4I4R A;  2FFV A;  2E4M A;  5JLV A;  3BA7 A;  2Z48 A;  4EEE B;  1R8N A;  1EVT A;  4ZA3 B;  4OEG A;  3VSZ A;  4GP3 A;  2RG9 B;  1FQ9 A;  2FO1 A;  4ZFY B;  5D62 A;  3D7W B;  3O4B A;  2F8X C;  2KI6 B;  3A22 A;  3O49 A;  4L4H A;  2NP0 A;  2HWM A;  1AXM A;  3CA6 A;  3O4O A;  1S0F A;  5FNX A;  5FZY A;  2MIB A;  4IYB A;  3N7J A;  1AVX B;  2DS0 A;  3ZXD A;  4JQ0 A;  3RMY A;  1UPS A;  2K8R A;  3WA1 A;  1V6V A;  2VXT I;  1S0G A;  3O4C A;  2IHO A;  1AVA C;  1YXW A;  4I4S A;  4LO0 A;  3BAU A;  4Q91 A;  1G9D A;  3BAH A;  3CRH A;  3CA3 A;  2HZ9 A;  5GAQ A;  4ZLB B;  4A7Y A;  4IZE A;  3V0A A;  1A8D A;  3WO2 A;  1S0B A;  2D7R A;  5F8S A;  1HWM B;  2K4A B;  1M16 A;  4YOL A;  4X38 A;  1HCE A;  1JY0 A;  3O4D A;  1ISW A;  4QBV A;  3T8S A;  1G9C A;  3O44 A;  1EPW A;  3O4A A;  1YF8 B;  3UDA A;  3WIN A;  1GGP B;  4LO1 C;  4F34 A;  3WMU A;  3ZC9 A;  9ILB A;  1FMZ A;  1DIW A;  1BAS A;  4HJJ A;  2FFU A;  4I4Q A;  3BRF A;  3AH2 A;  4G1R A;  1IIL A;  3AZW A;  2D22 A;  3FJH A;  3AKI A;  3O3Q A;  1J0S A;  1XG6 A;  3OBT A;  1XYF A;  1NZK A;  2ZQN A;  3N7K A;  2ZR1 B;  4EFQ A;  5D61 A;  3P6I A;  5FZZ A;  2D24 A;  3AZV A;  4GAF A;  3CQA A;  3S8J A;  2LIE A;  3FJI A;  4LO8 B;  1T4Q A;  4GOV A;  1IJT A;  1CVS A;  3PG0 A;  4GOY A;  3HBW A;  1JQZ A;  1Z2V A;  1ISZ A;  3I2X A;  1IT0 A;  1TOO A;  2Y9X E;  1FV2 A;  1IOB A;  1DQO A;  3BB2 A;  3CRI A;  3VUO A;  2MC2 A;  2BEA A;  2Y9G A;  1RY7 A;  3H6R A;  5DSS B;  3HN1 A;  1M2T B;  1II4 A;  1WBA A;  3F62 B;  2E4M C;  1Q03 A;  2RQ9 A;  1DQG A;  3WO4 A;  1AVU A;  3AKH A;  3WMV A;  4IY9 A;  1TWE A;  1AFC A;  3E8L C;  2I1B A;  4XFT A;  4XFU A;  5F8W A;  3FJJ A;  5I1B A;  1R8O A;  3Q7W A;  4USP A;  3UD8 A;  3TC2 A;  1ILR 1;  3FGM A;  2M49 A;  4QO3 A;  3JUT A;  4J2Y A;  1ISX A;  1ISV A;  3ILA A;  2VUA A;  1HIB A;  4I4O A;  4A7Z A;  1XHB A;  4OWK A;  4G9M A;  4LO3 A;  3BAQ A;  4IY8 A;  3Q7X A;  3V0A B;  4QKS A;  3W9T A;  3UJ0 A;  2HW9 A;  1BA7 A;  1FWU A;  4JKQ A;  2Y9W C;  4LO0 C;  1HWP B;  4LO2 A;  4OEF A;  5FZU A;  1MD6 A;  4JRA A;  3HMY A;  1DZD A;  3ZC8 A;  3FJK A;  3BA4 A;  31BI A;  2IWT B;  3UJ4 A;  1Q1U A;  4OEE A;  2X2S A;  5DVH A;  2ET2 A;  1JTC A;  4IHZ A;  2X2T A;  2D1Z A;  7I1B A;  2P23 A;  1BLD A;  3RTI B;  3WIN C;  3FJF A;  4FGF A;  2WBC A;  4ION A;  4TLP A;  1TTU A;  4OW4 A;  2MLL B;  3A07 A;  3OJ2 A;  2DRY A;  2J3P A;  4F83 A;  4X39 A;  4I37 A;  4H04 A;  1JT5 A;  1K5U A;  1FMM S;  5FNW A;  2NYY A;  1N4K A;  4GAI A;  3BAD A;  4I6I A;  3VEQ A;  3AJ6 A;  3RSJ A;  3CA0 A;  5BOW A;  3R4S A;  1Q04 A;  2QN4 A;  4I4U A;  3NBD A;  1HKN A;  2KI4 A;  2Q9X A;  4I8M A;  4ZKT B;  3IIR A;  2QYI B;  4EKX B;  1K5V A;  3CA5 A;  5DZU A;  3OGG A;  3NJ5 A;  2R9K B;  3H6R B;  4EFR A;  2ZQO A;  1BFF A;  1D0H A;  3QR5 A;  2VSA A;  4I1E A;  1I1E A;  3PUB A;  1W3F A;  4END A;  1VCL A;  3A21 A;  4I96 A;  1PUU B;  1BFC A;  3CA1 A;  3H6Q A;  1V6W A;  3AH4 A;  21BI A;  1Z0H A;  2AAI B;  4EFP A;  1FV3 A;  3UD7 A;  3FJD A;  4GP0 A;  2K43 A;  1DLL A;  2NTD A;  1DJS B;  2P39 A;  1NUN A;  2DRZ A;  1F31 A;  1BFG A;  2KH2 A;  3QYD A;  2NVH A;  5E24 E;  3I2A A;  1MC9 A;  1W3A A;  4DEN A;  2Z49 A;  3V0B A;  4I3N A;  3OBR A;  1IHK A;  3RMX A;  2D44 A;  3R4U A;  4P6A A;  5D63 A;  4OWJ A;  4P0J A;  1XZZ A;  1CE7 B;  3K1X A;  2D43 A;  3BA5 A;  1RZO B;  4IQP A;  4ZGR B;  4LO3 C;  2RST A;  4I4P A;  3BX1 C;  1BAR A;  4I2S A;  2D23 A;  1PUM B;  4P0L A;  1ITB A;  1YBI A;  2D20 A;  4KBB A;  5BQU A;  3V79 C;  1QQK A;  3FUO A;  2VSE A;  1SZ6 B;  4G9N A;  1ISY A;  2KKI A;  5BXP A;  3H6S E;  4ISR A;  4LO2 C;  3CRG A;  3AKG A;  3LTQ A;  1HWO B;  4KEI A;  2VXR A;  4I1B A;  4G6M A;  4ZOT A;  1L2H A;  4J2K A;  1W3G A;  4Z9W B;  3BAO A;  1PWA A;  2XOA A;  1JLX A;  4J2S A;  3BAV A;  3BAG A;  4JPZ A;  4KEJ A;  4J2X A;  4I7I A;  3UD9 A;  1FWV A;  1QXM A;  3A23 A;  3CA4 A;  4JAW A;  1BLA A;  4X37 A;  4Z8S B;  1IRA X;  4HR6 C;  1YTO A;  3NBN A;  1HWN B;  3FJ9 A;  2AFG A;  41BI A;  6I1B A;  3JRR A;  4L4I A;  4CJM A;  1SR4 A;  2YUG A;  3N7M A;  2F2F A;  3NBC A;  4XFS A;  5EHA A;  3BRD A;  3KMV A;  1S0E A;  3AH1 A;  5BXR A;  1WD3 A;  2AQZ A;  5EC5 A;  2HWA A;  1Z4S A;  1ONK B;  2FDB M;  2L5X A;  4IZX A;  3AKF A;  3O5W B;  2NM1 A;  1WBC A;  5BP5 A;  1BFB A;  3IM5 A;  1V6U A;  5F8Y A;  3P6J A;  3HSM A;  1FGA A;  3POK A;  1DFQ A;  2GO2 A;  3OJV A;  4XKI A;  3VSF A;  4J23 B;  4QBC A;  4D0Z A;  3I29 B;  1E0O A;  1JLY A;  5B2H A;  4PC4 A;  3CU1 B;  2VU9 A;  1I1B A;  2KLL A;  3ZXG A;  1DZC A;  5G00 A;  3IM7 A;  1JT7 A;  5DUY A;  3MPP G;  2ERM A;  1HCD A;  2LIQ A;  3AJ5 A;  3IM6 A;  4P0K A;  4AN6 A;  1TFM B;  3VT0 A;  2GZB A;  4JKX B;  1RML A;  2BFH A;  3Q7Y A;  4QAL A;  1EYL A;  4ZBV B;  1TIE A;  3V0B B;  5EG6 C;  4OWL A;  4I4X A;  4X3A A;  2NZ9 A;  1V6X A;  3N7L A;  2FGF A;  4LO7 B;  3VWC A;  1WD4 A;  4Q9P A;  1FN0 A;  1JT4 A;  1DFC A;  8I1B A;  1S0C A;  1P63 A;  2VLC A;  3FJA A;  3BTA A;  5BXT A;  1YYN A;  4WBC A;  4HA2 A;  4ZFU B;  1G9A A;  1S0L A;  1TWM A;  3PME A;  4LO7 C;  1ABR B;  3B9U A;  1EV2 A;  2ESU A;  1OQL B;  4QKR A;  3VT2 A;  5BQU C;  4FVV A;  3WO3 A;  2Q3N B;  4AN7 B;  3OJM A;  5JMC A;  4DEP A;  5HPZ A;  3F1R A;  2BEB A;  4II0 A;  4OUJ A;  3LLP A;  4QD2 B;  1IRP A;  4LO1 A;  4D0T A;  1PC8 B;  3MAL A;  2DRE A;  3SNV A;  3VT1 A;  4JP0 A;  4EB2 B;  3NBE A;  3EF2 A;  1G9B A;  3P53 A;  4D8H A;  1QQL A;  4ZFW B;  3ZX7 A;  4KC3 A;  4KEK A;  3C9Z A;  4G6J A;  1AF9 A;  3BRG C;  4DCK C;  1G82 A;  3FJB A;  4QD2 C;  1RG8 A;  3FJE A;  4R6U B;  1T9F A;  3FUQ A;  1SR4 C;  5F90 A;  3HOM A;  2F2F C;  3N0K A;  3FJ8 A;  2AXM A;  4I0Y A;  3FFZ A;  3OGF A;  4A7K A;  1TP0 A;  5BVP I;  3RTJ B;  1AVW B;  1JT3 A;  2D7I A;  2Y9F A;  4I4V A;  4QC4 A;  3FJC A;  1S0D A;  3CAH A;  4ISQ A;  5BP5 C;  1PZZ A;  1KNM A;  4USO A;  2WRY A;  3IAG C;  4H9W A;  4I4Y A; 
#chains in the Genus database with same CATH topology
 4Q9G A;  5BXS A;  3S8K A;  3PHZ A;  4MZG B;  2UUS A;  3HAL A;  4I4R A;  2FFV A;  2E4M A;  5JLV A;  3BA7 A;  2Z48 A;  4EEE B;  1R8N A;  1EVT A;  4ZA3 B;  4OEG A;  3VSZ A;  4GP3 A;  2RG9 B;  1FQ9 A;  2FO1 A;  4ZFY B;  5D62 A;  3D7W B;  3O4B A;  2F8X C;  2KI6 B;  3A22 A;  4MZH A;  3O49 A;  4L4H A;  2NP0 A;  2HWM A;  1AXM A;  3CA6 A;  3O4O A;  1S0F A;  5FNX A;  5FZY A;  2MIB A;  4IYB A;  3N7J A;  1AVX B;  2DS0 A;  3ZXD A;  4JQ0 A;  3RMY A;  1UPS A;  2K8R A;  3WA1 A;  1V6V A;  2VXT I;  1S0G A;  3O4C A;  2IHO A;  1AVA C;  1YXW A;  4I4S A;  4LO0 A;  3BAU A;  4Q91 A;  2NS2 A;  1G9D A;  3BAH A;  3CRH A;  3CA3 A;  2HZ9 A;  5GAQ A;  4ZLB B;  4A7Y A;  4IZE A;  3V0A A;  1A8D A;  3WO2 A;  1S0B A;  2D7R A;  5F8S A;  1HWM B;  2K4A B;  1M16 A;  4YOL A;  4X38 A;  1HCE A;  1JY0 A;  3O4D A;  1ISW A;  4QBV A;  3T8S A;  1G9C A;  3O44 A;  1EPW A;  3O4A A;  1YF8 B;  3UDA A;  3WIN A;  1GGP B;  4LO1 C;  4F34 A;  3WMU A;  3ZC9 A;  9ILB A;  1FMZ A;  1DIW A;  1BAS A;  4HJJ A;  2FFU A;  4I4Q A;  3BRF A;  3AH2 A;  4G1R A;  1IIL A;  3AZW A;  2D22 A;  3FJH A;  3AKI A;  3O3Q A;  1J0S A;  1XG6 A;  3OBT A;  1XYF A;  1NZK A;  2ZQN A;  3N7K A;  2ZR1 B;  4EFQ A;  5D61 A;  3P6I A;  5FZZ A;  2D24 A;  3AZV A;  4GAF A;  3CQA A;  3S8J A;  2LIE A;  3FJI A;  4LO8 B;  1T4Q A;  4GOV A;  1IJT A;  1CVS A;  3PG0 A;  4GOY A;  3HBW A;  1JQZ A;  1Z2V A;  1ISZ A;  3I2X A;  1IT0 A;  1TOO A;  2Y9X E;  1FV2 A;  1IOB A;  1DQO A;  3BB2 A;  3CRI A;  3VUO A;  2MC2 A;  2BEA A;  2Y9G A;  1RY7 A;  3H6R A;  5DSS B;  3HN1 A;  1M2T B;  1II4 A;  1WBA A;  3F62 B;  2E4M C;  1Q03 A;  2RQ9 A;  1DQG A;  3WO4 A;  1AVU A;  3AKH A;  3WMV A;  4IY9 A;  1TWE A;  1AFC A;  3E8L C;  2I1B A;  4XFT A;  4XFU A;  5F8W A;  3FJJ A;  5I1B A;  1R8O A;  3Q7W A;  4USP A;  3UD8 A;  3TC2 A;  1ILR 1;  3FGM A;  2M49 A;  4QO3 A;  3JUT A;  4J2Y A;  1ISX A;  1ISV A;  3ILA A;  2VUA A;  1HIB A;  4I4O A;  4A7Z A;  1XHB A;  4OWK A;  4G9M A;  4LO3 A;  3BAQ A;  4IY8 A;  3Q7X A;  3V0A B;  4QKS A;  3W9T A;  3UJ0 A;  2HW9 A;  1BA7 A;  1FWU A;  4JKQ A;  2Y9W C;  4LO0 C;  1HWP B;  4LO2 A;  4OEF A;  5FZU A;  1MD6 A;  4JRA A;  3HMY A;  1DZD A;  3ZC8 A;  3FJK A;  3BA4 A;  31BI A;  2IWT B;  3UJ4 A;  1Q1U A;  4OEE A;  2X2S A;  5DVH A;  2ET2 A;  1JTC A;  4IHZ A;  2X2T A;  2D1Z A;  7I1B A;  2P23 A;  1BLD A;  3RTI B;  3WIN C;  3FJF A;  4FGF A;  2WBC A;  4ION A;  4TLP A;  1TTU A;  4OW4 A;  2MLL B;  3A07 A;  3OJ2 A;  2DRY A;  2J3P A;  4F83 A;  4X39 A;  4I37 A;  4H04 A;  1JT5 A;  1K5U A;  1FMM S;  5FNW A;  2NYY A;  1N4K A;  4GAI A;  3BAD A;  4I6I A;  3VEQ A;  3AJ6 A;  3RSJ A;  3CA0 A;  5BOW A;  3R4S A;  1Q04 A;  2QN4 A;  4I4U A;  3NBD A;  1HKN A;  2KI4 A;  2Q9X A;  4I8M A;  4ZKT B;  3IIR A;  2QYI B;  4EKX B;  1K5V A;  3CA5 A;  5DZU A;  3OGG A;  3NJ5 A;  2R9K B;  3H6R B;  4EFR A;  2ZQO A;  1BFF A;  1D0H A;  3QR5 A;  2VSA A;  4I1E A;  1I1E A;  3PUB A;  1W3F A;  4END A;  1VCL A;  3A21 A;  4I96 A;  1PUU B;  1BFC A;  3CA1 A;  3H6Q A;  1V6W A;  3AH4 A;  21BI A;  1Z0H A;  2AAI B;  4EFP A;  1FV3 A;  3UD7 A;  3FJD A;  4GP0 A;  2K43 A;  1DLL A;  2NTD A;  1DJS B;  2P39 A;  1NUN A;  2DRZ A;  1F31 A;  1BFG A;  2KH2 A;  3QYD A;  2NVH A;  5E24 E;  3I2A A;  1MC9 A;  1W3A A;  4DEN A;  2Z49 A;  3V0B A;  4I3N A;  3OBR A;  1IHK A;  3RMX A;  2D44 A;  3R4U A;  4P6A A;  5D63 A;  4OWJ A;  4P0J A;  1XZZ A;  1CE7 B;  3K1X A;  2D43 A;  3BA5 A;  1RZO B;  4IQP A;  4ZGR B;  4LO3 C;  2RST A;  4I4P A;  3BX1 C;  1BAR A;  4I2S A;  2D23 A;  1PUM B;  4P0L A;  1ITB A;  1YBI A;  2D20 A;  4KBB A;  5BQU A;  3V79 C;  1QQK A;  3FUO A;  2VSE A;  1SZ6 B;  4G9N A;  1ISY A;  2KKI A;  5BXP A;  3H6S E;  4ISR A;  4LO2 C;  3CRG A;  3AKG A;  3LTQ A;  1HWO B;  4KEI A;  2VXR A;  4I1B A;  4G6M A;  4ZOT A;  1L2H A;  4J2K A;  1W3G A;  4Z9W B;  3BAO A;  1PWA A;  2XOA A;  1JLX A;  4J2S A;  3BAV A;  3BAG A;  4JPZ A;  4KEJ A;  4J2X A;  4I7I A;  3UD9 A;  1FWV A;  1QXM A;  3A23 A;  3CA4 A;  4JAW A;  1BLA A;  4MZF B;  4X37 A;  4Z8S B;  1IRA X;  4HR6 C;  1YTO A;  3NBN A;  1HWN B;  3FJ9 A;  2AFG A;  41BI A;  6I1B A;  3JRR A;  4L4I A;  4CJM A;  1SR4 A;  2YUG A;  3N7M A;  2F2F A;  3NBC A;  4XFS A;  5EHA A;  3BRD A;  3KMV A;  1S0E A;  4H75 A;  3AH1 A;  5BXR A;  1WD3 A;  2AQZ A;  5EC5 A;  2HWA A;  1Z4S A;  1ONK B;  2FDB M;  2L5X A;  4IZX A;  3AKF A;  3O5W B;  2NM1 A;  1WBC A;  5BP5 A;  1BFB A;  3IM5 A;  1V6U A;  5F8Y A;  3P6J A;  3HSM A;  1FGA A;  3POK A;  1DFQ A;  2GO2 A;  3OJV A;  4XKI A;  3VSF A;  4J23 B;  4QBC A;  4D0Z A;  3I29 B;  1E0O A;  1JLY A;  5B2H A;  4PC4 A;  3CU1 B;  2VU9 A;  1I1B A;  2KLL A;  3ZXG A;  1DZC A;  5G00 A;  3IM7 A;  1JT7 A;  5DUY A;  3MPP G;  2ERM A;  1HCD A;  2LIQ A;  3AJ5 A;  3IM6 A;  4P0K A;  4AN6 A;  1TFM B;  3VT0 A;  2GZB A;  4JKX B;  1RML A;  2BFH A;  3Q7Y A;  4QAL A;  1EYL A;  4ZBV B;  1TIE A;  3V0B B;  5EG6 C;  4OWL A;  4I4X A;  4X3A A;  4UY4 A;  2NZ9 A;  1V6X A;  3N7L A;  2FGF A;  4LO7 B;  3VWC A;  1WD4 A;  4Q9P A;  1FN0 A;  1JT4 A;  1DFC A;  8I1B A;  1S0C A;  1P63 A;  2VLC A;  3FJA A;  3BTA A;  5BXT A;  1YYN A;  4WBC A;  4HA2 A;  4ZFU B;  1G9A A;  1S0L A;  1TWM A;  3PME A;  4LO7 C;  1ABR B;  3B9U A;  1EV2 A;  2ESU A;  1OQL B;  4QKR A;  3VT2 A;  5BQU C;  4FVV A;  3WO3 A;  2Q3N B;  4AN7 B;  3OJM A;  5JMC A;  4DEP A;  5HPZ A;  3F1R A;  2BEB A;  4II0 A;  4OUJ A;  3LLP A;  4QD2 B;  1IRP A;  4LO1 A;  4D0T A;  1PC8 B;  3MAL A;  2DRE A;  3SNV A;  3VT1 A;  4JP0 A;  4EB2 B;  3NBE A;  3EF2 A;  1G9B A;  3P53 A;  4D8H A;  1QQL A;  4ZFW B;  3ZX7 A;  4KC3 A;  4KEK A;  3C9Z A;  4G6J A;  1AF9 A;  3BRG C;  4DCK C;  1G82 A;  3FJB A;  4QD2 C;  1RG8 A;  3FJE A;  4R6U B;  1T9F A;  3FUQ A;  1SR4 C;  5F90 A;  3HOM A;  2F2F C;  3N0K A;  3FJ8 A;  2AXM A;  4I0Y A;  3FFZ A;  3OGF A;  4A7K A;  1TP0 A;  5BVP I;  3RTJ B;  1AVW B;  1JT3 A;  2D7I A;  2Y9F A;  4I4V A;  4QC4 A;  3FJC A;  1S0D A;  3CAH A;  4ISQ A;  5BP5 C;  1PZZ A;  1KNM A;  4USO A;  2WRY A;  3IAG C;  4H9W A;  4I4Y A; 
#chains in the Genus database with same CATH homology
 4Q9G A;  5BXS A;  3S8K A;  3PHZ A;  4MZG B;  2UUS A;  3HAL A;  4I4R A;  2FFV A;  2E4M A;  5JLV A;  3BA7 A;  2Z48 A;  4EEE B;  1R8N A;  1EVT A;  4ZA3 B;  4OEG A;  3VSZ A;  4GP3 A;  2RG9 B;  1FQ9 A;  2FO1 A;  4ZFY B;  5D62 A;  3D7W B;  3O4B A;  2F8X C;  2KI6 B;  3A22 A;  4MZH A;  3O49 A;  4L4H A;  2NP0 A;  2HWM A;  1AXM A;  3CA6 A;  3O4O A;  1S0F A;  5FNX A;  5FZY A;  2MIB A;  4IYB A;  3N7J A;  1AVX B;  2DS0 A;  3ZXD A;  4JQ0 A;  3RMY A;  1UPS A;  2K8R A;  3WA1 A;  1V6V A;  2VXT I;  1S0G A;  3O4C A;  2IHO A;  1AVA C;  1YXW A;  4I4S A;  4LO0 A;  3BAU A;  4Q91 A;  2NS2 A;  1G9D A;  3BAH A;  3CRH A;  3CA3 A;  2HZ9 A;  5GAQ A;  4ZLB B;  4A7Y A;  4IZE A;  3V0A A;  1A8D A;  3WO2 A;  1S0B A;  2D7R A;  5F8S A;  1HWM B;  2K4A B;  1M16 A;  4YOL A;  4X38 A;  1HCE A;  1JY0 A;  3O4D A;  1ISW A;  4QBV A;  3T8S A;  1G9C A;  3O44 A;  1EPW A;  3O4A A;  1YF8 B;  3UDA A;  3WIN A;  1GGP B;  4LO1 C;  4F34 A;  3WMU A;  3ZC9 A;  9ILB A;  1FMZ A;  1DIW A;  1BAS A;  4HJJ A;  2FFU A;  4I4Q A;  3BRF A;  3AH2 A;  4G1R A;  1IIL A;  3AZW A;  2D22 A;  3FJH A;  3AKI A;  3O3Q A;  1J0S A;  1XG6 A;  3OBT A;  1XYF A;  1NZK A;  2ZQN A;  3N7K A;  2ZR1 B;  4EFQ A;  5D61 A;  3P6I A;  5FZZ A;  2D24 A;  3AZV A;  4GAF A;  3CQA A;  3S8J A;  2LIE A;  3FJI A;  4LO8 B;  1T4Q A;  4GOV A;  1IJT A;  1CVS A;  3PG0 A;  4GOY A;  3HBW A;  1JQZ A;  1Z2V A;  1ISZ A;  3I2X A;  1IT0 A;  1TOO A;  2Y9X E;  1FV2 A;  1IOB A;  1DQO A;  3BB2 A;  3CRI A;  3VUO A;  2MC2 A;  2BEA A;  2Y9G A;  1RY7 A;  3H6R A;  5DSS B;  3HN1 A;  1M2T B;  1II4 A;  1WBA A;  3F62 B;  2E4M C;  1Q03 A;  2RQ9 A;  1DQG A;  3WO4 A;  1AVU A;  3AKH A;  3WMV A;  4IY9 A;  1TWE A;  1AFC A;  3E8L C;  2I1B A;  4XFT A;  4XFU A;  5F8W A;  3FJJ A;  5I1B A;  1R8O A;  3Q7W A;  4USP A;  3UD8 A;  3TC2 A;  1ILR 1;  3FGM A;  2M49 A;  4QO3 A;  3JUT A;  4J2Y A;  1ISX A;  1ISV A;  3ILA A;  2VUA A;  1HIB A;  4I4O A;  4A7Z A;  1XHB A;  4OWK A;  4G9M A;  4LO3 A;  3BAQ A;  4IY8 A;  3Q7X A;  3V0A B;  4QKS A;  3W9T A;  3UJ0 A;  2HW9 A;  1BA7 A;  1FWU A;  4JKQ A;  2Y9W C;  4LO0 C;  1HWP B;  4LO2 A;  4OEF A;  5FZU A;  1MD6 A;  4JRA A;  3HMY A;  1DZD A;  3ZC8 A;  3FJK A;  3BA4 A;  31BI A;  2IWT B;  3UJ4 A;  1Q1U A;  4OEE A;  2X2S A;  5DVH A;  2ET2 A;  1JTC A;  4IHZ A;  2X2T A;  2D1Z A;  7I1B A;  2P23 A;  1BLD A;  3RTI B;  3WIN C;  3FJF A;  4FGF A;  2WBC A;  4ION A;  4TLP A;  1TTU A;  4OW4 A;  2MLL B;  3A07 A;  3OJ2 A;  2DRY A;  2J3P A;  4F83 A;  4X39 A;  4I37 A;  4H04 A;  1JT5 A;  1K5U A;  1FMM S;  5FNW A;  2NYY A;  1N4K A;  4GAI A;  3BAD A;  4I6I A;  3VEQ A;  3AJ6 A;  3RSJ A;  3CA0 A;  5BOW A;  3R4S A;  1Q04 A;  2QN4 A;  4I4U A;  3NBD A;  1HKN A;  2KI4 A;  2Q9X A;  4I8M A;  4ZKT B;  3IIR A;  2QYI B;  4EKX B;  1K5V A;  3CA5 A;  5DZU A;  3OGG A;  3NJ5 A;  2R9K B;  3H6R B;  4EFR A;  2ZQO A;  1BFF A;  1D0H A;  3QR5 A;  2VSA A;  4I1E A;  1I1E A;  3PUB A;  1W3F A;  4END A;  1VCL A;  3A21 A;  4I96 A;  1PUU B;  1BFC A;  3CA1 A;  3H6Q A;  1V6W A;  3AH4 A;  21BI A;  1Z0H A;  2AAI B;  4EFP A;  1FV3 A;  3UD7 A;  3FJD A;  4GP0 A;  2K43 A;  1DLL A;  2NTD A;  1DJS B;  2P39 A;  1NUN A;  2DRZ A;  1F31 A;  1BFG A;  2KH2 A;  3QYD A;  2NVH A;  5E24 E;  3I2A A;  1MC9 A;  1W3A A;  4DEN A;  2Z49 A;  3V0B A;  4I3N A;  3OBR A;  1IHK A;  3RMX A;  2D44 A;  3R4U A;  4P6A A;  5D63 A;  4OWJ A;  4P0J A;  1XZZ A;  1CE7 B;  3K1X A;  2D43 A;  3BA5 A;  1RZO B;  4IQP A;  4ZGR B;  4LO3 C;  2RST A;  4I4P A;  3BX1 C;  1BAR A;  4I2S A;  2D23 A;  1PUM B;  4P0L A;  1ITB A;  1YBI A;  2D20 A;  4KBB A;  5BQU A;  3V79 C;  1QQK A;  3FUO A;  2VSE A;  1SZ6 B;  4G9N A;  1ISY A;  2KKI A;  5BXP A;  3H6S E;  4ISR A;  4LO2 C;  3CRG A;  3AKG A;  3LTQ A;  1HWO B;  4KEI A;  2VXR A;  4I1B A;  4G6M A;  4ZOT A;  1L2H A;  4J2K A;  1W3G A;  4Z9W B;  3BAO A;  1PWA A;  2XOA A;  1JLX A;  4J2S A;  3BAV A;  3BAG A;  4JPZ A;  4KEJ A;  4J2X A;  4I7I A;  3UD9 A;  1FWV A;  1QXM A;  3A23 A;  3CA4 A;  4JAW A;  1BLA A;  4MZF B;  4X37 A;  4Z8S B;  1IRA X;  4HR6 C;  1YTO A;  3NBN A;  1HWN B;  3FJ9 A;  2AFG A;  41BI A;  6I1B A;  3JRR A;  4L4I A;  4CJM A;  1SR4 A;  2YUG A;  3N7M A;  2F2F A;  3NBC A;  4XFS A;  5EHA A;  3BRD A;  3KMV A;  1S0E A;  4H75 A;  3AH1 A;  5BXR A;  1WD3 A;  2AQZ A;  5EC5 A;  2HWA A;  1Z4S A;  1ONK B;  2FDB M;  2L5X A;  4IZX A;  3AKF A;  3O5W B;  2NM1 A;  1WBC A;  5BP5 A;  1BFB A;  3IM5 A;  1V6U A;  5F8Y A;  3P6J A;  3HSM A;  1FGA A;  3POK A;  1DFQ A;  2GO2 A;  3OJV A;  4XKI A;  3VSF A;  4J23 B;  4QBC A;  4D0Z A;  3I29 B;  1E0O A;  1JLY A;  5B2H A;  4PC4 A;  3CU1 B;  2VU9 A;  1I1B A;  2KLL A;  3ZXG A;  1DZC A;  5G00 A;  3IM7 A;  1JT7 A;  5DUY A;  3MPP G;  2ERM A;  1HCD A;  2LIQ A;  3AJ5 A;  3IM6 A;  4P0K A;  4AN6 A;  1TFM B;  3VT0 A;  2GZB A;  4JKX B;  1RML A;  2BFH A;  3Q7Y A;  4QAL A;  1EYL A;  4ZBV B;  1TIE A;  3V0B B;  5EG6 C;  4OWL A;  4I4X A;  4X3A A;  4UY4 A;  2NZ9 A;  1V6X A;  3N7L A;  2FGF A;  4LO7 B;  3VWC A;  1WD4 A;  4Q9P A;  1FN0 A;  1JT4 A;  1DFC A;  8I1B A;  1S0C A;  1P63 A;  2VLC A;  3FJA A;  3BTA A;  5BXT A;  1YYN A;  4WBC A;  4HA2 A;  4ZFU B;  1G9A A;  1S0L A;  1TWM A;  3PME A;  4LO7 C;  1ABR B;  3B9U A;  1EV2 A;  2ESU A;  1OQL B;  4QKR A;  3VT2 A;  5BQU C;  4FVV A;  3WO3 A;  2Q3N B;  4AN7 B;  3OJM A;  5JMC A;  4DEP A;  5HPZ A;  3F1R A;  2BEB A;  4II0 A;  4OUJ A;  3LLP A;  4QD2 B;  1IRP A;  4LO1 A;  4D0T A;  1PC8 B;  3MAL A;  2DRE A;  3SNV A;  3VT1 A;  4JP0 A;  4EB2 B;  3NBE A;  3EF2 A;  1G9B A;  3P53 A;  4D8H A;  1QQL A;  4ZFW B;  3ZX7 A;  4KC3 A;  4KEK A;  3C9Z A;  4G6J A;  1AF9 A;  3BRG C;  4DCK C;  1G82 A;  3FJB A;  4QD2 C;  1RG8 A;  3FJE A;  4R6U B;  1T9F A;  3FUQ A;  1SR4 C;  5F90 A;  3HOM A;  2F2F C;  3N0K A;  3FJ8 A;  2AXM A;  4I0Y A;  3FFZ A;  3OGF A;  4A7K A;  1TP0 A;  5BVP I;  3RTJ B;  1AVW B;  1JT3 A;  2D7I A;  2Y9F A;  4I4V A;  4QC4 A;  3FJC A;  1S0D A;  3CAH A;  4ISQ A;  5BP5 C;  1PZZ A;  1KNM A;  4USO A;  2WRY A;  3IAG C;  4H9W A;  4I4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...