2ZQQA

Crystal structure of human auh (3-methylglutaconyl-coa hydratase) mixed with (auuu)24a rna
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
266
structure length
266
Chain Sequence
EDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title AU-rich RNA-binding induces changes in the quaternary structure of AUH
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Methylglutaconyl-CoA hydratase
total genus 96
structure length 266
sequence length 266
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.18: Methylglutaconyl-CoA hydratase.
pdb deposition date 2008-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2zqqA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2zqqA01
4JCSA 3T88A 4WZ8B 5IKLB 2ZL0A 2FW2A 4ASIA 3TT6A 3QXZA 5C9GA 4EMMA 1W2XA 5MGBA 5DTWA 1XNWA 2X24A 3R9SA 4Z0MA 1X0UA 3Q0GA 3ZWAA 3GLMA 1XO6A 2J5IA 2NP9A 5KJPA 4JCRA 4ELWA 4FZWA 4U0HA 3MFMA 4ZDBA 3KTIA 2PG8A 2X58A 4JFCA 1SG4A 3TDCA 2C8TA 2DEOA 3H0UA 2HW5A 2A81A 2VSSA 3LAOA 2QQ3A 2VSUE 5DU4A 1MJ3A 1WDMA 4FB8A 4IZCA 3I47A 4IZDA 2VX2A 1HNUA 3KTJA 4YLHA 5INGA 3QK8A 5INIA 4ZDFA 2FZSA 2PPYA 2A7SA 1UYRA 4U19A 1Y7OA 2UZFA 3PE8A 3U9RB 5KDRB 3QREA 4OG1A 3JU1A 1EF9A 2EJ5A 4L6WA 4FZWC 4U18A 3P5MA 1ON3A 1XNVA 5DL1A 4ZDCA 2D3TA 5INFA 3PGQA 2VSUF 2BZRA 1RJNA 3STAA 3H0JA 3P85A 3BEZA 1FC9A 2Q2XA 4K29A 1OD4A 4ZU2A 4GM2A 4OLQA 2A7KA 4FN8A 3N6RB 3KQFA 3IAVA 3P2LA 4JSBA 2VSUC 2J5GA 1UYVA 3ST9A 3Q1TA 4OMRA 4GHNA 5C90A 3R6HA 4JYLA 5FUSA 1JXZA 3NJBA 3TT7A 1SZOA 5DKPA 2F9IB 1PJHA 3TVUA 3ZWBA 3MOYA 2ZL3A 3OC7A 2W3PA 4B3IA 4U0GH 2F6QA 3TV5A 3HP0A 1XX4A 3T3WA 3SWXA 4NEKA 3IB9A 4FN7A 2IEXA 2DUBA 3U9SB 3ZW8A 4G2RA 1WZ8A 3NJDA 4JOTA 3V5IA 2ZQQA 2WTBA 4B3JA 4L8KA 4ZDDA 3GKBA 5DUCA 3QXIA 4I4ZA 1N6DA 5JBWA 1DCIA 2CBYA 4QIIA 3QKAA 1PIXA 3HRXA 2J5SA 1NZYA 3FF6A 4JJTA 4MXIA 3M6MA 1HZDA 5G1SA 3QMJA 4KNPA 3TVWA 3LKEA 4U0GA 5G1QA 4WCZA 3K50A 3H0SA 1UIYA 2Q35A 5KDRA 3QYRA 4ELSA 4RCNA 4F47A 3ISAA 4HC8A 4KWBA 1Q51A 3T8AA 5DTPA 5DU6A 4QFEA 3RSTA 2PBPA 3H0QA 1FC7A 3OT6A 2FBMA 4Q0GA 3GMAA 1TG6A 2Q34A 3KTGA 4KD6A 1WDKA 2ZL4A 2F9YA 1K32A 2GTRA 3WG5A 4U1AA 3TLFA 3FDUA 4FJWD 1HNOA 1TYFA 3DORA 5FIFA 3RSIA 4EMPA 1ON9A 2CE3A 3VIVA 1J7XA 3T8BA 4I42A 5JBXA 5DU8A 2VREA 1OD2A 3MYBA 1UYTA 5DZKA 4EMLA 3SLLA 4FNBA 3HLN1 3OMEA 3T89A 3L3SA 5DUFA 1EF8A 4FNDA 1XNYA 2ZL2A 4WYOB 1N6EA 4LK5A 1N6FA 2F9IA 5DZKH 4HNKA 3G64A 3PEAA 3KTHA 4Q1IA 2VSSF 4JVTA 1FC6A 4MOUA 5CTCA 3RRVA 4I52A 4K3WA 2J5GD 3DJAA 1YG6A 1RJMA 3TRRA 3BF0A 3BPPA 1Q52A 1YG8A 3Q7HA 4MI2A 4JYJA 3GF3A 3HE2A 3MT6A 2F6IA 3GF7A 4JCTA 3H02A 1FCFA 3R9QA 3M6NA 3ZWCA 4KPKA 3K8XA 1NZYB 5E0SH 5G1RA 2VSSE 4B3HA 2F9YB 4RYFH 1EY3A 1VRGA 5E0NX 1UYSA 1O8UA 3H81A 3IBBA 2ZQRA 3R0OA 3ZW9A 2J5II 5CTBA 4QIJA 1WDLA 4RYFA 4DI1A 3R9TA 4ELXA 1K39A 5E0SA 3Q0JA 4ZDEA 3KTKA 4NNQA 3QWDA 4IZBA 3PZKA 4JCQA 4K2NA 4JWVA 3HINA 2VSUA 3U9TB 3V5EA 1DUBA 3TZ3A 2J5IB
chains in the Genus database with same CATH superfamily
4JCSA 3T88A 4WZ8B 5IKLB 3IRBA 2ZL0A 2FW2A 4ASIA 3TT6A 3QXZA 5C9GA 4EMMA 1W2XA 5MGBA 5DTWA 1XNWA 2X24A 3R9SA 4Z0MA 1X0UA 3Q0GA 3ZWAA 3GLMA 1XO6A 2J5IA 2NP9A 5KJPA 4JCRA 4ELWA 4FZWA 4U0HA 3MFMA 4ZDBA 3KTIA 3A4NA 2PG8A 2X58A 4JFCA 1SG4A 3TDCA 2C8TA 2DEOA 3W8HB 3H0UA 3RQGA 3RQFA 5HUQA 2HW5A 2A81A 4GEHB 3W8IB 2VSSA 3LAOA 2QQ3A 2VSUE 5DU4A 1UX5A 1MJ3A 1WDMA 4FB8A 4IZCA 3I47A 4IZDA 2VX2A 1HNUA 3ADDA 3KTJA 4YLHA 5INGA 3QK8A 5INIA 4ZDFA 2FZSA 2PPYA 2A7SA 1UYRA 4U19A 1Y7OA 2UZFA 3PE8A 3U9RB 5KDRB 3QREA 4OG1A 3JU1A 3L8JA 1EF9A 2EJ5A 4L6WA 4FZWC 4U18A 3P5MA 1ON3A 1XNVA 5DL1A 4ZDCA 2D3TA 5INFA 3PGQA 2VSUF 2BZRA 1RJNA 3STAA 3H0JA 3P85A 3BEZA 1FC9A 2Q2XA 4K29A 1OD4A 4ZU2A 4GM2A 4OLQA 2A7KA 4FN8A 3L8IA 3N6RB 3KQFA 3IAVA 3P2LA 3ADCA 4JSBA 2VSUC 2J5GA 1UYVA 3ST9A 3Q1TA 4OMRA 4GHNA 5C90A 3R6HA 4JYLA 5FUSA 1JXZA 3NJBA 2P63A 3TT7A 1SZOA 5DKPA 1UX4A 2F9IB 1PJHA 3TVUA 3ZWBA 3MOYA 2ZL3A 1Y64B 3OC7A 2W3PA 4B3IA 4U0GH 2F6QA 3TV5A 3RQEA 3HP0A 1XX4A 3T3WA 3SWXA 4NEKA 3IB9A 4FN7A 2IEXA 2DUBA 3U9SB 3ZW8A 4G2RA 1WZ8A 3NJDA 4JOTA 3V5IA 2ZQQA 3O4XE 2WTBA 4B3JA 4L8KA 4ZDDA 3GKBA 5DUCA 3QXIA 4I4ZA 1N6DA 5JBWA 1DCIA 2CBYA 4QIIA 3QKAA 1PIXA 3HRXA 2J5SA 1NZYA 3FF6A 4JJTA 4MXIA 3M6MA 1HZDA 5G1SA 3QMJA 4KNPA 3TVWA 3BPTA 3LKEA 4U0GA 5G1QA 4WCZA 3K50A 3H0SA 1UIYA 2Q35A 5KDRA 3QYRA 4ELSA 4RCNA 4F47A 3ISAA 4HC8A 4KWBA 1Q51A 3T8AA 5DTPA 5DU6A 4QFEA 3RSTA 2PBPA 3H0QA 1FC7A 3OT6A 2FBMA 4Q0GA 3GMAA 1TG6A 2Q34A 3KTGA 4KD6A 1WDKA 2ZL4A 2F9YA 1K32A 2GTRA 3WG5A 4U1AA 3TLFA 3AM1A 3FDUA 3AJMA 4FJWD 1HNOA 1TYFA 3DORA 2YJGA 5FIFA 3RSIA 4EMPA 1ON9A 2CE3A 3VIVA 1J7XA 3T8BA 4I42A 5JBXA 5DU8A 2VREA 1OD2A 3MYBA 1UYTA 5DZKA 4EMLA 3SLLA 4FNBA 3HLN1 3OMEA 3T89A 3L3SA 4HDTA 5DUFA 1EF8A 4FNDA 1XNYA 2ZL2A 4WYOB 3A4LA 1N6EA 4LK5A 1N6FA 2F9IA 5DZKH 4HNKA 3G64A 3PEAA 3KTHA 4Q1IA 2VSSF 4JVTA 1FC6A 4MOUA 5CTCA 3RRVA 4I52A 4K3WA 2J5GD 3DJAA 1YG6A 1RJMA 3TRRA 3BF0A 3A4MA 3BPPA 4J2UA 1Q52A 1YG8A 3Q7HA 4MI2A 4JYJA 3GF3A 3HE2A 3MT6A 2F6IA 3GF7A 4JCTA 4NARA 3ADBA 3H02A 1FCFA 3R9QA 3M6NA 3ZWCA 4KPKA 3K8XA 1NZYB 5E0SH 5G1RA 2VSSE 4B3HA 2F9YB 4RYFH 1EY3A 1VRGA 5E0NX 1UYSA 1O8UA 3H81A 3IBBA 2ZQRA 3R0OA 3ZW9A 2J5II 5CTBA 4QIJA 1WDLA 4RYFA 4DI1A 3R9TA 4ELXA 1K39A 5E0SA 3Q0JA 4ZDEA 4NNQA 3KTKA 3QWDA 4IZBA 3PZKA 4JCQA 4K2NA 4JWVA 3HINA 2VSUA 3U9TB 3V5EA 1DUBA 3TZ3A 2J5IB
chains in the Genus database with same CATH topology
4JCSA 3T88A 4WZ8B 5IKLB 2ZL0A 2FW2A 4ASIA 3TT6A 3QXZA 5C9GA 4EMMA 1W2XA 5MGBA 5DTWA 1XNWA 2X24A 3R9SA 4Z0MA 1X0UA 3Q0GA 3ZWAA 3GLMA 1XO6A 2J5IA 2NP9A 5KJPA 4JCRA 4ELWA 4FZWA 4U0HA 3MFMA 4ZDBA 3KTIA 2PG8A 2X58A 4JFCA 1SG4A 3TDCA 2C8TA 2DEOA 3H0UA 5HUQA 2HW5A 2A81A 2VSSA 3LAOA 2QQ3A 2VSUE 5DU4A 1MJ3A 1WDMA 4FB8A 4IZCA 3I47A 4IZDA 2VX2A 1HNUA 3KTJA 4YLHA 5INGA 3QK8A 5INIA 4ZDFA 2FZSA 2PPYA 2A7SA 1UYRA 4U19A 1Y7OA 2UZFA 3PE8A 3U9RB 5KDRB 3QREA 4OG1A 3JU1A 1EF9A 2EJ5A 4L6WA 4FZWC 4U18A 3P5MA 1ON3A 1XNVA 5DL1A 4ZDCA 2D3TA 5INFA 3PGQA 2VSUF 2BZRA 1RJNA 3STAA 3H0JA 3P85A 3BEZA 1FC9A 2Q2XA 4K29A 1OD4A 4ZU2A 4GM2A 4OLQA 2A7KA 4FN8A 3N6RB 3KQFA 3IAVA 3P2LA 4JSBA 2VSUC 2J5GA 1UYVA 3ST9A 3Q1TA 4OMRA 4GHNA 5C90A 3R6HA 4JYLA 5FUSA 1JXZA 3NJBA 3TT7A 1SZOA 5DKPA 2F9IB 1PJHA 3TVUA 3ZWBA 3MOYA 2ZL3A 3OC7A 2W3PA 4B3IA 4U0GH 2F6QA 3TV5A 3HP0A 1XX4A 3T3WA 3SWXA 4NEKA 3IB9A 4FN7A 2IEXA 2DUBA 3U9SB 3ZW8A 4G2RA 1WZ8A 3NJDA 4JOTA 3V5IA 2ZQQA 2WTBA 4B3JA 4L8KA 4ZDDA 3GKBA 5DUCA 3QXIA 4I4ZA 1N6DA 5JBWA 1DCIA 2CBYA 4QIIA 3QKAA 1PIXA 3HRXA 2J5SA 1NZYA 3FF6A 4JJTA 4MXIA 3M6MA 1HZDA 5G1SA 3QMJA 4KNPA 3TVWA 3BPTA 3LKEA 4U0GA 5G1QA 4WCZA 3K50A 3H0SA 1UIYA 2Q35A 5KDRA 3QYRA 4ELSA 4RCNA 4F47A 3ISAA 4HC8A 4KWBA 1Q51A 3T8AA 5DTPA 5DU6A 4QFEA 3RSTA 2PBPA 3H0QA 1FC7A 3OT6A 2FBMA 4Q0GA 3GMAA 1TG6A 2Q34A 3KTGA 4KD6A 1WDKA 2ZL4A 2F9YA 1K32A 2GTRA 3WG5A 4U1AA 3TLFA 3FDUA 4FJWD 1HNOA 1TYFA 3DORA 2YJGA 5FIFA 3RSIA 4EMPA 1ON9A 2CE3A 3VIVA 1J7XA 3T8BA 4I42A 5JBXA 5DU8A 2VREA 1OD2A 3MYBA 1UYTA 5DZKA 4EMLA 3SLLA 4FNBA 3HLN1 3OMEA 3T89A 3L3SA 4HDTA 5DUFA 1EF8A 4FNDA 1XNYA 2ZL2A 4WYOB 1N6EA 4LK5A 1N6FA 2F9IA 5DZKH 4HNKA 3G64A 3PEAA 3KTHA 4Q1IA 2VSSF 4JVTA 1FC6A 4MOUA 5CTCA 3RRVA 4I52A 4K3WA 2J5GD 3DJAA 1YG6A 1RJMA 3TRRA 3BF0A 3BPPA 4J2UA 1Q52A 1YG8A 3Q7HA 4MI2A 4JYJA 3GF3A 3HE2A 3MT6A 2F6IA 3GF7A 4JCTA 4NARA 3H02A 1FCFA 3R9QA 3M6NA 3ZWCA 4KPKA 3K8XA 1NZYB 5E0SH 5G1RA 2VSSE 4B3HA 2F9YB 4RYFH 1EY3A 1VRGA 5E0NX 1UYSA 1O8UA 3H81A 3IBBA 2ZQRA 3R0OA 3ZW9A 2J5II 5CTBA 4QIJA 1WDLA 4RYFA 4DI1A 3R9TA 4ELXA 1K39A 5E0SA 3Q0JA 4ZDEA 3KTKA 4NNQA 3QWDA 4IZBA 3PZKA 4JCQA 4K2NA 4JWVA 3HINA 2VSUA 3U9TB 3V5EA 1DUBA 3TZ3A 2J5IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCS A;  3T88 A;  4WZ8 B;  5IKL B;  2ZL0 A;  2FW2 A;  4ASI A;  3TT6 A;  3QXZ A;  5C9G A;  4EMM A;  1W2X A;  5MGB A;  5DTW A;  1XNW A;  2X24 A;  3R9S A;  4Z0M A;  1X0U A;  3Q0G A;  3ZWA A;  3GLM A;  1XO6 A;  2J5I A;  2NP9 A;  5KJP A;  4JCR A;  4ELW A;  4FZW A;  4U0H A;  3MFM A;  4ZDB A;  3KTI A;  2PG8 A;  2X58 A;  4JFC A;  1SG4 A;  3TDC A;  2C8T A;  2DEO A;  3H0U A;  2HW5 A;  2A81 A;  2VSS A;  3LAO A;  2QQ3 A;  2VSU E;  5DU4 A;  1MJ3 A;  1WDM A;  4FB8 A;  4IZC A;  3I47 A;  4IZD A;  2VX2 A;  1HNU A;  3KTJ A;  4YLH A;  5ING A;  3QK8 A;  5INI A;  4ZDF A;  2FZS A;  2PPY A;  2A7S A;  1UYR A;  4U19 A;  1Y7O A;  2UZF A;  3PE8 A;  3U9R B;  5KDR B;  3QRE A;  4OG1 A;  3JU1 A;  1EF9 A;  2EJ5 A;  4L6W A;  4FZW C;  4U18 A;  3P5M A;  1ON3 A;  1XNV A;  5DL1 A;  4ZDC A;  2D3T A;  5INF A;  3PGQ A;  2VSU F;  2BZR A;  1RJN A;  3STA A;  3H0J A;  3P85 A;  3BEZ A;  1FC9 A;  2Q2X A;  4K29 A;  1OD4 A;  4ZU2 A;  4GM2 A;  4OLQ A;  2A7K A;  4FN8 A;  3N6R B;  3KQF A;  3IAV A;  3P2L A;  4JSB A;  2VSU C;  2J5G A;  1UYV A;  3ST9 A;  3Q1T A;  4OMR A;  4GHN A;  5C90 A;  3R6H A;  4JYL A;  5FUS A;  1JXZ A;  3NJB A;  3TT7 A;  1SZO A;  5DKP A;  2F9I B;  1PJH A;  3TVU A;  3ZWB A;  3MOY A;  2ZL3 A;  3OC7 A;  2W3P A;  4B3I A;  4U0G H;  2F6Q A;  3TV5 A;  3HP0 A;  1XX4 A;  3T3W A;  3SWX A;  4NEK A;  3IB9 A;  4FN7 A;  2IEX A;  2DUB A;  3U9S B;  3ZW8 A;  4G2R A;  1WZ8 A;  3NJD A;  4JOT A;  3V5I A;  2ZQQ A;  2WTB A;  4B3J A;  4L8K A;  4ZDD A;  3GKB A;  5DUC A;  3QXI A;  4I4Z A;  1N6D A;  5JBW A;  1DCI A;  2CBY A;  4QII A;  3QKA A;  1PIX A;  3HRX A;  2J5S A;  1NZY A;  3FF6 A;  4JJT A;  4MXI A;  3M6M A;  1HZD A;  5G1S A;  3QMJ A;  4KNP A;  3TVW A;  3LKE A;  4U0G A;  5G1Q A;  4WCZ A;  3K50 A;  3H0S A;  1UIY A;  2Q35 A;  5KDR A;  3QYR A;  4ELS A;  4RCN A;  4F47 A;  3ISA A;  4HC8 A;  4KWB A;  1Q51 A;  3T8A A;  5DTP A;  5DU6 A;  4QFE A;  3RST A;  2PBP A;  3H0Q A;  1FC7 A;  3OT6 A;  2FBM A;  4Q0G A;  3GMA A;  1TG6 A;  2Q34 A;  3KTG A;  4KD6 A;  1WDK A;  2ZL4 A;  2F9Y A;  1K32 A;  2GTR A;  3WG5 A;  4U1A A;  3TLF A;  3FDU A;  4FJW D;  1HNO A;  1TYF A;  3DOR A;  5FIF A;  3RSI A;  4EMP A;  1ON9 A;  2CE3 A;  3VIV A;  1J7X A;  3T8B A;  4I42 A;  5JBX A;  5DU8 A;  2VRE A;  1OD2 A;  3MYB A;  1UYT A;  5DZK A;  4EML A;  3SLL A;  4FNB A;  3HLN 1;  3OME A;  3T89 A;  3L3S A;  5DUF A;  1EF8 A;  4FND A;  1XNY A;  2ZL2 A;  4WYO B;  1N6E A;  4LK5 A;  1N6F A;  2F9I A;  5DZK H;  4HNK A;  3G64 A;  3PEA A;  3KTH A;  4Q1I A;  2VSS F;  4JVT A;  1FC6 A;  4MOU A;  5CTC A;  3RRV A;  4I52 A;  4K3W A;  2J5G D;  3DJA A;  1YG6 A;  1RJM A;  3TRR A;  3BF0 A;  3BPP A;  1Q52 A;  1YG8 A;  3Q7H A;  4MI2 A;  4JYJ A;  3GF3 A;  3HE2 A;  3MT6 A;  2F6I A;  3GF7 A;  4JCT A;  3H02 A;  1FCF A;  3R9Q A;  3M6N A;  3ZWC A;  4KPK A;  3K8X A;  1NZY B;  5E0S H;  5G1R A;  2VSS E;  4B3H A;  2F9Y B;  4RYF H;  1EY3 A;  1VRG A;  5E0N X;  1UYS A;  1O8U A;  3H81 A;  3IBB A;  2ZQR A;  3R0O A;  3ZW9 A;  2J5I I;  5CTB A;  4QIJ A;  1WDL A;  4RYF A;  4DI1 A;  3R9T A;  4ELX A;  1K39 A;  5E0S A;  3Q0J A;  4ZDE A;  3KTK A;  4NNQ A;  3QWD A;  4IZB A;  3PZK A;  4JCQ A;  4K2N A;  4JWV A;  3HIN A;  2VSU A;  3U9T B;  3V5E A;  1DUB A;  3TZ3 A;  2J5I B; 
#chains in the Genus database with same CATH topology
 4JCS A;  3T88 A;  4WZ8 B;  5IKL B;  3IRB A;  2ZL0 A;  2FW2 A;  4ASI A;  3TT6 A;  3QXZ A;  5C9G A;  4EMM A;  1W2X A;  5MGB A;  5DTW A;  1XNW A;  2X24 A;  3R9S A;  4Z0M A;  1X0U A;  3Q0G A;  3ZWA A;  3GLM A;  1XO6 A;  2J5I A;  2NP9 A;  5KJP A;  4JCR A;  4ELW A;  4FZW A;  4U0H A;  3MFM A;  4ZDB A;  3KTI A;  3A4N A;  2PG8 A;  2X58 A;  4JFC A;  1SG4 A;  3TDC A;  2C8T A;  2DEO A;  3W8H B;  3H0U A;  3RQG A;  3RQF A;  5HUQ A;  2HW5 A;  2A81 A;  4GEH B;  3W8I B;  2VSS A;  3LAO A;  2QQ3 A;  2VSU E;  5DU4 A;  1UX5 A;  1MJ3 A;  1WDM A;  4FB8 A;  4IZC A;  3I47 A;  4IZD A;  2VX2 A;  1HNU A;  3ADD A;  3KTJ A;  4YLH A;  5ING A;  3QK8 A;  5INI A;  4ZDF A;  2FZS A;  2PPY A;  2A7S A;  1UYR A;  4U19 A;  1Y7O A;  2UZF A;  3PE8 A;  3U9R B;  5KDR B;  3QRE A;  4OG1 A;  3JU1 A;  3L8J A;  1EF9 A;  2EJ5 A;  4L6W A;  4FZW C;  4U18 A;  3P5M A;  1ON3 A;  1XNV A;  5DL1 A;  4ZDC A;  2D3T A;  5INF A;  3PGQ A;  2VSU F;  2BZR A;  1RJN A;  3STA A;  3H0J A;  3P85 A;  3BEZ A;  1FC9 A;  2Q2X A;  4K29 A;  1OD4 A;  4ZU2 A;  4GM2 A;  4OLQ A;  2A7K A;  4FN8 A;  3L8I A;  3N6R B;  3KQF A;  3IAV A;  3P2L A;  3ADC A;  4JSB A;  2VSU C;  2J5G A;  1UYV A;  3ST9 A;  3Q1T A;  4OMR A;  4GHN A;  5C90 A;  3R6H A;  4JYL A;  5FUS A;  1JXZ A;  3NJB A;  2P63 A;  3TT7 A;  1SZO A;  5DKP A;  1UX4 A;  2F9I B;  1PJH A;  3TVU A;  3ZWB A;  3MOY A;  2ZL3 A;  1Y64 B;  3OC7 A;  2W3P A;  4B3I A;  4U0G H;  2F6Q A;  3TV5 A;  3RQE A;  3HP0 A;  1XX4 A;  3T3W A;  3SWX A;  4NEK A;  3IB9 A;  4FN7 A;  2IEX A;  2DUB A;  3U9S B;  3ZW8 A;  4G2R A;  1WZ8 A;  3NJD A;  4JOT A;  3V5I A;  2ZQQ A;  3O4X E;  2WTB A;  4B3J A;  4L8K A;  4ZDD A;  3GKB A;  5DUC A;  3QXI A;  4I4Z A;  1N6D A;  5JBW A;  1DCI A;  2CBY A;  4QII A;  3QKA A;  1PIX A;  3HRX A;  2J5S A;  1NZY A;  3FF6 A;  4JJT A;  4MXI A;  3M6M A;  1HZD A;  5G1S A;  3QMJ A;  4KNP A;  3TVW A;  3BPT A;  3LKE A;  4U0G A;  5G1Q A;  4WCZ A;  3K50 A;  3H0S A;  1UIY A;  2Q35 A;  5KDR A;  3QYR A;  4ELS A;  4RCN A;  4F47 A;  3ISA A;  4HC8 A;  4KWB A;  1Q51 A;  3T8A A;  5DTP A;  5DU6 A;  4QFE A;  3RST A;  2PBP A;  3H0Q A;  1FC7 A;  3OT6 A;  2FBM A;  4Q0G A;  3GMA A;  1TG6 A;  2Q34 A;  3KTG A;  4KD6 A;  1WDK A;  2ZL4 A;  2F9Y A;  1K32 A;  2GTR A;  3WG5 A;  4U1A A;  3TLF A;  3AM1 A;  3FDU A;  3AJM A;  4FJW D;  1HNO A;  1TYF A;  3DOR A;  2YJG A;  5FIF A;  3RSI A;  4EMP A;  1ON9 A;  2CE3 A;  3VIV A;  1J7X A;  3T8B A;  4I42 A;  5JBX A;  5DU8 A;  2VRE A;  1OD2 A;  3MYB A;  1UYT A;  5DZK A;  4EML A;  3SLL A;  4FNB A;  3HLN 1;  3OME A;  3T89 A;  3L3S A;  4HDT A;  5DUF A;  1EF8 A;  4FND A;  1XNY A;  2ZL2 A;  4WYO B;  3A4L A;  1N6E A;  4LK5 A;  1N6F A;  2F9I A;  5DZK H;  4HNK A;  3G64 A;  3PEA A;  3KTH A;  4Q1I A;  2VSS F;  4JVT A;  1FC6 A;  4MOU A;  5CTC A;  3RRV A;  4I52 A;  4K3W A;  2J5G D;  3DJA A;  1YG6 A;  1RJM A;  3TRR A;  3BF0 A;  3A4M A;  3BPP A;  4J2U A;  1Q52 A;  1YG8 A;  3Q7H A;  4MI2 A;  4JYJ A;  3GF3 A;  3HE2 A;  3MT6 A;  2F6I A;  3GF7 A;  4JCT A;  4NAR A;  3ADB A;  3H02 A;  1FCF A;  3R9Q A;  3M6N A;  3ZWC A;  4KPK A;  3K8X A;  1NZY B;  5E0S H;  5G1R A;  2VSS E;  4B3H A;  2F9Y B;  4RYF H;  1EY3 A;  1VRG A;  5E0N X;  1UYS A;  1O8U A;  3H81 A;  3IBB A;  2ZQR A;  3R0O A;  3ZW9 A;  2J5I I;  5CTB A;  4QIJ A;  1WDL A;  4RYF A;  4DI1 A;  3R9T A;  4ELX A;  1K39 A;  5E0S A;  3Q0J A;  4ZDE A;  4NNQ A;  3KTK A;  3QWD A;  4IZB A;  3PZK A;  4JCQ A;  4K2N A;  4JWV A;  3HIN A;  2VSU A;  3U9T B;  3V5E A;  1DUB A;  3TZ3 A;  2J5I B; 
#chains in the Genus database with same CATH homology
 4JCS A;  3T88 A;  4WZ8 B;  5IKL B;  2ZL0 A;  2FW2 A;  4ASI A;  3TT6 A;  3QXZ A;  5C9G A;  4EMM A;  1W2X A;  5MGB A;  5DTW A;  1XNW A;  2X24 A;  3R9S A;  4Z0M A;  1X0U A;  3Q0G A;  3ZWA A;  3GLM A;  1XO6 A;  2J5I A;  2NP9 A;  5KJP A;  4JCR A;  4ELW A;  4FZW A;  4U0H A;  3MFM A;  4ZDB A;  3KTI A;  2PG8 A;  2X58 A;  4JFC A;  1SG4 A;  3TDC A;  2C8T A;  2DEO A;  3H0U A;  5HUQ A;  2HW5 A;  2A81 A;  2VSS A;  3LAO A;  2QQ3 A;  2VSU E;  5DU4 A;  1MJ3 A;  1WDM A;  4FB8 A;  4IZC A;  3I47 A;  4IZD A;  2VX2 A;  1HNU A;  3KTJ A;  4YLH A;  5ING A;  3QK8 A;  5INI A;  4ZDF A;  2FZS A;  2PPY A;  2A7S A;  1UYR A;  4U19 A;  1Y7O A;  2UZF A;  3PE8 A;  3U9R B;  5KDR B;  3QRE A;  4OG1 A;  3JU1 A;  1EF9 A;  2EJ5 A;  4L6W A;  4FZW C;  4U18 A;  3P5M A;  1ON3 A;  1XNV A;  5DL1 A;  4ZDC A;  2D3T A;  5INF A;  3PGQ A;  2VSU F;  2BZR A;  1RJN A;  3STA A;  3H0J A;  3P85 A;  3BEZ A;  1FC9 A;  2Q2X A;  4K29 A;  1OD4 A;  4ZU2 A;  4GM2 A;  4OLQ A;  2A7K A;  4FN8 A;  3N6R B;  3KQF A;  3IAV A;  3P2L A;  4JSB A;  2VSU C;  2J5G A;  1UYV A;  3ST9 A;  3Q1T A;  4OMR A;  4GHN A;  5C90 A;  3R6H A;  4JYL A;  5FUS A;  1JXZ A;  3NJB A;  3TT7 A;  1SZO A;  5DKP A;  2F9I B;  1PJH A;  3TVU A;  3ZWB A;  3MOY A;  2ZL3 A;  3OC7 A;  2W3P A;  4B3I A;  4U0G H;  2F6Q A;  3TV5 A;  3HP0 A;  1XX4 A;  3T3W A;  3SWX A;  4NEK A;  3IB9 A;  4FN7 A;  2IEX A;  2DUB A;  3U9S B;  3ZW8 A;  4G2R A;  1WZ8 A;  3NJD A;  4JOT A;  3V5I A;  2ZQQ A;  2WTB A;  4B3J A;  4L8K A;  4ZDD A;  3GKB A;  5DUC A;  3QXI A;  4I4Z A;  1N6D A;  5JBW A;  1DCI A;  2CBY A;  4QII A;  3QKA A;  1PIX A;  3HRX A;  2J5S A;  1NZY A;  3FF6 A;  4JJT A;  4MXI A;  3M6M A;  1HZD A;  5G1S A;  3QMJ A;  4KNP A;  3TVW A;  3BPT A;  3LKE A;  4U0G A;  5G1Q A;  4WCZ A;  3K50 A;  3H0S A;  1UIY A;  2Q35 A;  5KDR A;  3QYR A;  4ELS A;  4RCN A;  4F47 A;  3ISA A;  4HC8 A;  4KWB A;  1Q51 A;  3T8A A;  5DTP A;  5DU6 A;  4QFE A;  3RST A;  2PBP A;  3H0Q A;  1FC7 A;  3OT6 A;  2FBM A;  4Q0G A;  3GMA A;  1TG6 A;  2Q34 A;  3KTG A;  4KD6 A;  1WDK A;  2ZL4 A;  2F9Y A;  1K32 A;  2GTR A;  3WG5 A;  4U1A A;  3TLF A;  3FDU A;  4FJW D;  1HNO A;  1TYF A;  3DOR A;  2YJG A;  5FIF A;  3RSI A;  4EMP A;  1ON9 A;  2CE3 A;  3VIV A;  1J7X A;  3T8B A;  4I42 A;  5JBX A;  5DU8 A;  2VRE A;  1OD2 A;  3MYB A;  1UYT A;  5DZK A;  4EML A;  3SLL A;  4FNB A;  3HLN 1;  3OME A;  3T89 A;  3L3S A;  4HDT A;  5DUF A;  1EF8 A;  4FND A;  1XNY A;  2ZL2 A;  4WYO B;  1N6E A;  4LK5 A;  1N6F A;  2F9I A;  5DZK H;  4HNK A;  3G64 A;  3PEA A;  3KTH A;  4Q1I A;  2VSS F;  4JVT A;  1FC6 A;  4MOU A;  5CTC A;  3RRV A;  4I52 A;  4K3W A;  2J5G D;  3DJA A;  1YG6 A;  1RJM A;  3TRR A;  3BF0 A;  3BPP A;  4J2U A;  1Q52 A;  1YG8 A;  3Q7H A;  4MI2 A;  4JYJ A;  3GF3 A;  3HE2 A;  3MT6 A;  2F6I A;  3GF7 A;  4JCT A;  4NAR A;  3H02 A;  1FCF A;  3R9Q A;  3M6N A;  3ZWC A;  4KPK A;  3K8X A;  1NZY B;  5E0S H;  5G1R A;  2VSS E;  4B3H A;  2F9Y B;  4RYF H;  1EY3 A;  1VRG A;  5E0N X;  1UYS A;  1O8U A;  3H81 A;  3IBB A;  2ZQR A;  3R0O A;  3ZW9 A;  2J5I I;  5CTB A;  4QIJ A;  1WDL A;  4RYF A;  4DI1 A;  3R9T A;  4ELX A;  1K39 A;  5E0S A;  3Q0J A;  4ZDE A;  3KTK A;  4NNQ A;  3QWD A;  4IZB A;  3PZK A;  4JCQ A;  4K2N A;  4JWV A;  3HIN A;  2VSU A;  3U9T B;  3V5E A;  1DUB A;  3TZ3 A;  2J5I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...