2ZQRA

Crystal structure of auh without rna
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
266
structure length
266
Chain Sequence
b'EDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylglutaconyl-CoA hydratase
publication title AU-rich RNA-binding induces changes in the quaternary structure of AUH
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 96
structure length 266
sequence length 266
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.18: Methylglutaconyl-CoA hydratase.
pdb deposition date 2008-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 2zqrA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2zqrA01
4JYJA 1FC6A 4KPKA 4G2RA 4KNPA 3KTHA 4YLHA 5KJPA 4IZCA 3R9TA 2J5II 1K39A 3HINA 5DU4A 3ZWBA 5C9GA 2DUBA 3LKEA 5E0SA 2ZL2A 1YG6A 1XNYA 1Y7OA 1SG4A 3ISAA 2PPYA 3MT6A 4I4ZA 3DJAA 3GLMA 3ZW8A 2C8TA 3GF3A 5DUFA 4IZBA 4JJTA 3KTIA 3V5IA 3RSIA 4I52A 4FZWA 4FNBA 1HNUA 5DKPA 3N6RB 2Q34A 4HNKA 3LAOA 4HC8A 5JBWA 5INGA 2W3PA 1RJMA 5DZKA 1YG8A 1UYRA 1WZ8A 1XNVA 2VSSA 3U9TB 3Q0GA 3IAVA 1FC7A 3H0SA 2UZFA 4QIIA 3IBBA 1W2XA 3Q1TA 4K2NA 2VX2A 2Q35A 2F9IA 2PBPA 5CTBA 4QFEA 3NJDA 2FBMA 4QIJA 3R9QA 1FC9A 2VSUE 3V5EA 3T8AA 1Q51A 1FCFA 3KQFA 3K50A 3QKAA 3TLFA 1NZYB 5FIFA 1PIXA 4L8KA 4EMLA 4GHNA 4ELWA 2CBYA 3Q7HA 5G1SA 4F47A 3GKBA 2VSUC 3Q0JA 2Q2XA 5JBXA 1TYFA 3SLLA 1ON3A 4K3WA 4JCSA 2VSSF 3DORA 1HZDA 5INIA 1XNWA 2FW2A 5DZKH 3NJBA 3L3SA 2CE3A 3U9RB 5INFA 4L6WA 1EF8A 2ZQRA 3H0QA 1J7XA 1N6DA 1PJHA 3P5MA 3TVWA 3TDCA 2J5SA 2A7KA 4U1AA 3RSTA 4OG1A 3PEAA 2ZL4A 4JOTA 4EMPA 1MJ3A 4LK5A 2J5GA 3QMJA 4OMRA 3PZKA 3TT7A 5IKLB 5G1RA 3OMEA 5MGBA 2WTBA 2VREA 3QXZA 2X24A 4Q1IA 5CTCA 4RYFA 1NZYA 3HE2A 4NNQA 5DUCA 4OLQA 1X0UA 1UIYA 1XX4A 3T89A 3KTGA 3HRXA 2A81A 1WDMA 4ZDDA 4U18A 4U0HA 1HNOA 3KTJA 3VIVA 2ZQQA 3RRVA 5KDRB 3TRRA 5E0SH 3IB9A 5DU8A 3QYRA 2NP9A 4WCZA 2ZL0A 4KD6A 3QREA 4JSBA 2J5IB 4EMMA 1K32A 1EY3A 4FB8A 3JU1A 2GTRA 5DU6A 2A7SA 3MOYA 4NEKA 4ASIA 2F6IA 3R6HA 3QXIA 4JCRA 4U19A 4Q0GA 4JFCA 1RJNA 2BZRA 4MXIA 4RYFH 3R9SA 2PG8A 1VRGA 3P85A 1DCIA 2F9YB 4FN8A 3T8BA 4FN7A 2VSUA 3WG5A 3PE8A 4MI2A 4IZDA 4ZDFA 2X58A 4K29A 4JCTA 3T3WA 1SZOA 2F9IB 1EF9A 1ON9A 3M6NA 5FUSA 3K8XA 3OC7A 3H02A 3TVUA 4JYLA 3ZW9A 3MYBA 4ELSA 4Z0MA 4ZDEA 4I42A 2J5GD 4JCQA 1JXZA 4FJWD 1UYVA 5C90A 3I47A 5KDRA 2VSSE 3KTKA 4JWVA 5E0NX 1WDKA 3ZWAA 4U0GA 3QWDA 3U9SB 2F6QA 4B3HA 3STAA 4ZU2A 2J5IA 4MOUA 4GM2A 4ZDBA 4FZWC 4B3JA 1UYTA 5DL1A 2VSUF 3BEZA 2ZL3A 4B3IA 1DUBA 3P2LA 5DTWA 1O8UA 3BPPA 1OD2A 3HLN1 4RCNA 2IEXA 4WYOB 1N6EA 2F9YA 5DTPA 4ZDCA 1OD4A 1WDLA 3TZ3A 2DEOA 3MFMA 3ST9A 3M6MA 3BF0A 3H0UA 3T88A 4KWBA 3PGQA 3FF6A 1Q52A 3GMAA 2EJ5A 3H81A 2HW5A 1TG6A 4U0GH 3H0JA 4ELXA 4JVTA 3TV5A 1N6FA 4DI1A 2D3TA 1UYSA 3ZWCA 4FNDA 4WZ8B 3FDUA 3SWXA 5G1QA 2QQ3A 3R0OA 3QK8A 2FZSA 3OT6A 3TT6A 3GF7A 1XO6A 3G64A 3HP0A
chains in the Genus database with same CATH superfamily
4JYJA 1FC6A 3AJMA 4KPKA 4G2RA 4KNPA 3KTHA 4YLHA 3AM1A 5KJPA 4IZCA 3R9TA 2J5II 1K39A 3A4LA 3HINA 5DU4A 3ZWBA 5C9GA 2DUBA 3LKEA 5E0SA 2ZL2A 1YG6A 1XNYA 1Y7OA 1SG4A 5HUQA 3ISAA 2PPYA 3MT6A 4I4ZA 3DJAA 3GLMA 3ZW8A 2C8TA 3GF3A 5DUFA 4IZBA 4JJTA 3KTIA 3V5IA 3RSIA 4I52A 4FZWA 4FNBA 1HNUA 5DKPA 3N6RB 2Q34A 4HNKA 3LAOA 4HC8A 5JBWA 5INGA 2W3PA 1RJMA 5DZKA 1YG8A 1UYRA 1WZ8A 1XNVA 2VSSA 3U9TB 3Q0GA 3IAVA 1FC7A 3H0SA 2UZFA 4QIIA 3IBBA 1W2XA 3Q1TA 4K2NA 2VX2A 2Q35A 2F9IA 2PBPA 5CTBA 4QFEA 3NJDA 2FBMA 4QIJA 3R9QA 1FC9A 3ADDA 2VSUE 3V5EA 3T8AA 1Q51A 1FCFA 3KQFA 3K50A 3QKAA 3TLFA 1NZYB 5FIFA 3W8HB 3IRBA 1PIXA 4L8KA 4HDTA 4EMLA 2P63A 4GHNA 4ELWA 2CBYA 3Q7HA 5G1SA 4F47A 3GKBA 2VSUC 3Q0JA 2Q2XA 5JBXA 1TYFA 3SLLA 1ON3A 4K3WA 4JCSA 2VSSF 3DORA 1HZDA 5INIA 1XNWA 2FW2A 5DZKH 3NJBA 3L3SA 3A4NA 2CE3A 3U9RB 5INFA 3ADBA 4L6WA 1EF8A 2ZQRA 3H0QA 1J7XA 1N6DA 1PJHA 3P5MA 3TVWA 3TDCA 2J5SA 2A7KA 4U1AA 3RSTA 4OG1A 3PEAA 2ZL4A 4JOTA 4EMPA 1MJ3A 4LK5A 2J5GA 3QMJA 4OMRA 3PZKA 3TT7A 5IKLB 5G1RA 3OMEA 5MGBA 2WTBA 2VREA 3QXZA 2X24A 4Q1IA 4GEHB 5CTCA 4RYFA 3W8IB 1NZYA 3HE2A 4NNQA 5DUCA 4OLQA 1X0UA 1UIYA 1XX4A 3T89A 3KTGA 3A4MA 3HRXA 2A81A 1WDMA 4ZDDA 4U18A 4U0HA 1HNOA 3KTJA 3VIVA 2ZQQA 3RRVA 5KDRB 3TRRA 5E0SH 3IB9A 3L8IA 5DU8A 3QYRA 2NP9A 4WCZA 2ZL0A 4KD6A 3QREA 1UX4A 4JSBA 3BPTA 2J5IB 4EMMA 1K32A 1EY3A 4FB8A 3JU1A 2GTRA 5DU6A 2A7SA 3MOYA 4NEKA 4ASIA 2F6IA 3R6HA 3QXIA 4JCRA 4U19A 4Q0GA 4JFCA 1RJNA 2BZRA 4MXIA 4RYFH 3R9SA 2PG8A 1VRGA 3P85A 1DCIA 2F9YB 4FN8A 3T8BA 4FN7A 2VSUA 3WG5A 3PE8A 4MI2A 4IZDA 4ZDFA 2X58A 4K29A 4JCTA 3T3WA 1SZOA 2F9IB 1EF9A 1ON9A 3M6NA 5FUSA 3K8XA 3OC7A 3H02A 3TVUA 4JYLA 3ZW9A 3MYBA 4ELSA 4Z0MA 4ZDEA 4I42A 2J5GD 4J2UA 4JCQA 1JXZA 4FJWD 1UYVA 5C90A 3I47A 5KDRA 4NARA 2VSSE 3KTKA 4JWVA 5E0NX 1WDKA 3ZWAA 4U0GA 3QWDA 3U9SB 2F6QA 4B3HA 3STAA 4ZU2A 2J5IA 4MOUA 4GM2A 4ZDBA 4FZWC 3RQEA 4B3JA 1UYTA 5DL1A 2VSUF 3BEZA 2ZL3A 4B3IA 1DUBA 3P2LA 5DTWA 1O8UA 3ADCA 3BPPA 1OD2A 3HLN1 4RCNA 2IEXA 4WYOB 1N6EA 2F9YA 5DTPA 4ZDCA 1OD4A 1WDLA 3TZ3A 2DEOA 3MFMA 3ST9A 3M6MA 3BF0A 3H0UA 3T88A 4KWBA 3PGQA 3FF6A 1Q52A 3GMAA 2EJ5A 3H81A 2HW5A 1TG6A 3RQGA 4U0GH 2YJGA 3H0JA 4ELXA 4JVTA 3TV5A 1Y64B 3RQFA 1N6FA 4DI1A 2D3TA 1UYSA 3ZWCA 3O4XE 3L8JA 4FNDA 4WZ8B 3FDUA 3SWXA 5G1QA 2QQ3A 3R0OA 3QK8A 2FZSA 3OT6A 3TT6A 1UX5A 3GF7A 1XO6A 3G64A 3HP0A
chains in the Genus database with same CATH topology
4JYJA 1FC6A 4KPKA 4G2RA 4KNPA 3KTHA 4YLHA 5KJPA 4IZCA 3R9TA 2J5II 1K39A 3HINA 5DU4A 3ZWBA 5C9GA 2DUBA 3LKEA 5E0SA 2ZL2A 1YG6A 1XNYA 1Y7OA 1SG4A 5HUQA 3ISAA 2PPYA 3MT6A 4I4ZA 3DJAA 3GLMA 3ZW8A 2C8TA 3GF3A 5DUFA 4IZBA 4JJTA 3KTIA 3V5IA 3RSIA 4I52A 4FZWA 4FNBA 1HNUA 5DKPA 3N6RB 2Q34A 4HNKA 3LAOA 4HC8A 5JBWA 5INGA 2W3PA 1RJMA 5DZKA 1YG8A 1UYRA 1WZ8A 1XNVA 2VSSA 3U9TB 3Q0GA 3IAVA 1FC7A 3H0SA 2UZFA 4QIIA 3IBBA 1W2XA 3Q1TA 4K2NA 2VX2A 2Q35A 2F9IA 2PBPA 5CTBA 4QFEA 3NJDA 2FBMA 4QIJA 3R9QA 1FC9A 2VSUE 3V5EA 3T8AA 1Q51A 1FCFA 3KQFA 3K50A 3QKAA 3TLFA 1NZYB 5FIFA 1PIXA 4L8KA 4HDTA 4EMLA 4GHNA 4ELWA 2CBYA 3Q7HA 5G1SA 4F47A 3GKBA 2VSUC 3Q0JA 2Q2XA 5JBXA 1TYFA 3SLLA 1ON3A 4K3WA 4JCSA 2VSSF 3DORA 1HZDA 5INIA 1XNWA 2FW2A 5DZKH 3NJBA 3L3SA 2CE3A 3U9RB 5INFA 4L6WA 1EF8A 2ZQRA 3H0QA 1J7XA 1N6DA 1PJHA 3P5MA 3TVWA 3TDCA 2J5SA 2A7KA 4U1AA 3RSTA 4OG1A 3PEAA 2ZL4A 4JOTA 4EMPA 1MJ3A 4LK5A 2J5GA 3QMJA 4OMRA 3PZKA 3TT7A 5IKLB 5G1RA 3OMEA 5MGBA 2WTBA 2VREA 3QXZA 2X24A 4Q1IA 5CTCA 4RYFA 1NZYA 3HE2A 4NNQA 5DUCA 4OLQA 1X0UA 1UIYA 1XX4A 3T89A 3KTGA 3HRXA 2A81A 1WDMA 4ZDDA 4U18A 4U0HA 1HNOA 3KTJA 3VIVA 2ZQQA 3RRVA 5KDRB 3TRRA 5E0SH 3IB9A 5DU8A 3QYRA 2NP9A 4WCZA 2ZL0A 4KD6A 3QREA 4JSBA 3BPTA 2J5IB 4EMMA 1K32A 1EY3A 4FB8A 3JU1A 2GTRA 5DU6A 2A7SA 3MOYA 4NEKA 4ASIA 2F6IA 3R6HA 3QXIA 4JCRA 4U19A 4Q0GA 4JFCA 1RJNA 2BZRA 4MXIA 4RYFH 3R9SA 2PG8A 1VRGA 3P85A 1DCIA 2F9YB 4FN8A 3T8BA 4FN7A 2VSUA 3WG5A 3PE8A 4MI2A 4IZDA 4ZDFA 2X58A 4K29A 4JCTA 3T3WA 1SZOA 2F9IB 1EF9A 1ON9A 3M6NA 5FUSA 3K8XA 3OC7A 3H02A 3TVUA 4JYLA 3ZW9A 3MYBA 4ELSA 4Z0MA 4ZDEA 4I42A 2J5GD 4J2UA 4JCQA 1JXZA 4FJWD 1UYVA 5C90A 3I47A 5KDRA 4NARA 2VSSE 3KTKA 4JWVA 5E0NX 1WDKA 3ZWAA 4U0GA 3QWDA 3U9SB 2F6QA 4B3HA 3STAA 4ZU2A 2J5IA 4MOUA 4GM2A 4ZDBA 4FZWC 4B3JA 1UYTA 5DL1A 2VSUF 3BEZA 2ZL3A 4B3IA 1DUBA 3P2LA 5DTWA 1O8UA 3BPPA 1OD2A 3HLN1 4RCNA 2IEXA 4WYOB 1N6EA 2F9YA 5DTPA 4ZDCA 1OD4A 1WDLA 3TZ3A 2DEOA 3MFMA 3ST9A 3M6MA 3BF0A 3H0UA 3T88A 4KWBA 3PGQA 3FF6A 1Q52A 3GMAA 2EJ5A 3H81A 2HW5A 1TG6A 4U0GH 2YJGA 3H0JA 4ELXA 4JVTA 3TV5A 1N6FA 4DI1A 2D3TA 1UYSA 3ZWCA 4FNDA 4WZ8B 3FDUA 3SWXA 5G1QA 2QQ3A 3R0OA 3QK8A 2FZSA 3OT6A 3TT6A 3GF7A 1XO6A 3G64A 3HP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYJ A;  1FC6 A;  4KPK A;  4G2R A;  4KNP A;  3KTH A;  4YLH A;  5KJP A;  4IZC A;  3R9T A;  2J5I I;  1K39 A;  3HIN A;  5DU4 A;  3ZWB A;  5C9G A;  2DUB A;  3LKE A;  5E0S A;  2ZL2 A;  1YG6 A;  1XNY A;  1Y7O A;  1SG4 A;  3ISA A;  2PPY A;  3MT6 A;  4I4Z A;  3DJA A;  3GLM A;  3ZW8 A;  2C8T A;  3GF3 A;  5DUF A;  4IZB A;  4JJT A;  3KTI A;  3V5I A;  3RSI A;  4I52 A;  4FZW A;  4FNB A;  1HNU A;  5DKP A;  3N6R B;  2Q34 A;  4HNK A;  3LAO A;  4HC8 A;  5JBW A;  5ING A;  2W3P A;  1RJM A;  5DZK A;  1YG8 A;  1UYR A;  1WZ8 A;  1XNV A;  2VSS A;  3U9T B;  3Q0G A;  3IAV A;  1FC7 A;  3H0S A;  2UZF A;  4QII A;  3IBB A;  1W2X A;  3Q1T A;  4K2N A;  2VX2 A;  2Q35 A;  2F9I A;  2PBP A;  5CTB A;  4QFE A;  3NJD A;  2FBM A;  4QIJ A;  3R9Q A;  1FC9 A;  2VSU E;  3V5E A;  3T8A A;  1Q51 A;  1FCF A;  3KQF A;  3K50 A;  3QKA A;  3TLF A;  1NZY B;  5FIF A;  1PIX A;  4L8K A;  4EML A;  4GHN A;  4ELW A;  2CBY A;  3Q7H A;  5G1S A;  4F47 A;  3GKB A;  2VSU C;  3Q0J A;  2Q2X A;  5JBX A;  1TYF A;  3SLL A;  1ON3 A;  4K3W A;  4JCS A;  2VSS F;  3DOR A;  1HZD A;  5INI A;  1XNW A;  2FW2 A;  5DZK H;  3NJB A;  3L3S A;  2CE3 A;  3U9R B;  5INF A;  4L6W A;  1EF8 A;  2ZQR A;  3H0Q A;  1J7X A;  1N6D A;  1PJH A;  3P5M A;  3TVW A;  3TDC A;  2J5S A;  2A7K A;  4U1A A;  3RST A;  4OG1 A;  3PEA A;  2ZL4 A;  4JOT A;  4EMP A;  1MJ3 A;  4LK5 A;  2J5G A;  3QMJ A;  4OMR A;  3PZK A;  3TT7 A;  5IKL B;  5G1R A;  3OME A;  5MGB A;  2WTB A;  2VRE A;  3QXZ A;  2X24 A;  4Q1I A;  5CTC A;  4RYF A;  1NZY A;  3HE2 A;  4NNQ A;  5DUC A;  4OLQ A;  1X0U A;  1UIY A;  1XX4 A;  3T89 A;  3KTG A;  3HRX A;  2A81 A;  1WDM A;  4ZDD A;  4U18 A;  4U0H A;  1HNO A;  3KTJ A;  3VIV A;  2ZQQ A;  3RRV A;  5KDR B;  3TRR A;  5E0S H;  3IB9 A;  5DU8 A;  3QYR A;  2NP9 A;  4WCZ A;  2ZL0 A;  4KD6 A;  3QRE A;  4JSB A;  2J5I B;  4EMM A;  1K32 A;  1EY3 A;  4FB8 A;  3JU1 A;  2GTR A;  5DU6 A;  2A7S A;  3MOY A;  4NEK A;  4ASI A;  2F6I A;  3R6H A;  3QXI A;  4JCR A;  4U19 A;  4Q0G A;  4JFC A;  1RJN A;  2BZR A;  4MXI A;  4RYF H;  3R9S A;  2PG8 A;  1VRG A;  3P85 A;  1DCI A;  2F9Y B;  4FN8 A;  3T8B A;  4FN7 A;  2VSU A;  3WG5 A;  3PE8 A;  4MI2 A;  4IZD A;  4ZDF A;  2X58 A;  4K29 A;  4JCT A;  3T3W A;  1SZO A;  2F9I B;  1EF9 A;  1ON9 A;  3M6N A;  5FUS A;  3K8X A;  3OC7 A;  3H02 A;  3TVU A;  4JYL A;  3ZW9 A;  3MYB A;  4ELS A;  4Z0M A;  4ZDE A;  4I42 A;  2J5G D;  4JCQ A;  1JXZ A;  4FJW D;  1UYV A;  5C90 A;  3I47 A;  5KDR A;  2VSS E;  3KTK A;  4JWV A;  5E0N X;  1WDK A;  3ZWA A;  4U0G A;  3QWD A;  3U9S B;  2F6Q A;  4B3H A;  3STA A;  4ZU2 A;  2J5I A;  4MOU A;  4GM2 A;  4ZDB A;  4FZW C;  4B3J A;  1UYT A;  5DL1 A;  2VSU F;  3BEZ A;  2ZL3 A;  4B3I A;  1DUB A;  3P2L A;  5DTW A;  1O8U A;  3BPP A;  1OD2 A;  3HLN 1;  4RCN A;  2IEX A;  4WYO B;  1N6E A;  2F9Y A;  5DTP A;  4ZDC A;  1OD4 A;  1WDL A;  3TZ3 A;  2DEO A;  3MFM A;  3ST9 A;  3M6M A;  3BF0 A;  3H0U A;  3T88 A;  4KWB A;  3PGQ A;  3FF6 A;  1Q52 A;  3GMA A;  2EJ5 A;  3H81 A;  2HW5 A;  1TG6 A;  4U0G H;  3H0J A;  4ELX A;  4JVT A;  3TV5 A;  1N6F A;  4DI1 A;  2D3T A;  1UYS A;  3ZWC A;  4FND A;  4WZ8 B;  3FDU A;  3SWX A;  5G1Q A;  2QQ3 A;  3R0O A;  3QK8 A;  2FZS A;  3OT6 A;  3TT6 A;  3GF7 A;  1XO6 A;  3G64 A;  3HP0 A; 
#chains in the Genus database with same CATH topology
 4JYJ A;  1FC6 A;  3AJM A;  4KPK A;  4G2R A;  4KNP A;  3KTH A;  4YLH A;  3AM1 A;  5KJP A;  4IZC A;  3R9T A;  2J5I I;  1K39 A;  3A4L A;  3HIN A;  5DU4 A;  3ZWB A;  5C9G A;  2DUB A;  3LKE A;  5E0S A;  2ZL2 A;  1YG6 A;  1XNY A;  1Y7O A;  1SG4 A;  5HUQ A;  3ISA A;  2PPY A;  3MT6 A;  4I4Z A;  3DJA A;  3GLM A;  3ZW8 A;  2C8T A;  3GF3 A;  5DUF A;  4IZB A;  4JJT A;  3KTI A;  3V5I A;  3RSI A;  4I52 A;  4FZW A;  4FNB A;  1HNU A;  5DKP A;  3N6R B;  2Q34 A;  4HNK A;  3LAO A;  4HC8 A;  5JBW A;  5ING A;  2W3P A;  1RJM A;  5DZK A;  1YG8 A;  1UYR A;  1WZ8 A;  1XNV A;  2VSS A;  3U9T B;  3Q0G A;  3IAV A;  1FC7 A;  3H0S A;  2UZF A;  4QII A;  3IBB A;  1W2X A;  3Q1T A;  4K2N A;  2VX2 A;  2Q35 A;  2F9I A;  2PBP A;  5CTB A;  4QFE A;  3NJD A;  2FBM A;  4QIJ A;  3R9Q A;  1FC9 A;  3ADD A;  2VSU E;  3V5E A;  3T8A A;  1Q51 A;  1FCF A;  3KQF A;  3K50 A;  3QKA A;  3TLF A;  1NZY B;  5FIF A;  3W8H B;  3IRB A;  1PIX A;  4L8K A;  4HDT A;  4EML A;  2P63 A;  4GHN A;  4ELW A;  2CBY A;  3Q7H A;  5G1S A;  4F47 A;  3GKB A;  2VSU C;  3Q0J A;  2Q2X A;  5JBX A;  1TYF A;  3SLL A;  1ON3 A;  4K3W A;  4JCS A;  2VSS F;  3DOR A;  1HZD A;  5INI A;  1XNW A;  2FW2 A;  5DZK H;  3NJB A;  3L3S A;  3A4N A;  2CE3 A;  3U9R B;  5INF A;  3ADB A;  4L6W A;  1EF8 A;  2ZQR A;  3H0Q A;  1J7X A;  1N6D A;  1PJH A;  3P5M A;  3TVW A;  3TDC A;  2J5S A;  2A7K A;  4U1A A;  3RST A;  4OG1 A;  3PEA A;  2ZL4 A;  4JOT A;  4EMP A;  1MJ3 A;  4LK5 A;  2J5G A;  3QMJ A;  4OMR A;  3PZK A;  3TT7 A;  5IKL B;  5G1R A;  3OME A;  5MGB A;  2WTB A;  2VRE A;  3QXZ A;  2X24 A;  4Q1I A;  4GEH B;  5CTC A;  4RYF A;  3W8I B;  1NZY A;  3HE2 A;  4NNQ A;  5DUC A;  4OLQ A;  1X0U A;  1UIY A;  1XX4 A;  3T89 A;  3KTG A;  3A4M A;  3HRX A;  2A81 A;  1WDM A;  4ZDD A;  4U18 A;  4U0H A;  1HNO A;  3KTJ A;  3VIV A;  2ZQQ A;  3RRV A;  5KDR B;  3TRR A;  5E0S H;  3IB9 A;  3L8I A;  5DU8 A;  3QYR A;  2NP9 A;  4WCZ A;  2ZL0 A;  4KD6 A;  3QRE A;  1UX4 A;  4JSB A;  3BPT A;  2J5I B;  4EMM A;  1K32 A;  1EY3 A;  4FB8 A;  3JU1 A;  2GTR A;  5DU6 A;  2A7S A;  3MOY A;  4NEK A;  4ASI A;  2F6I A;  3R6H A;  3QXI A;  4JCR A;  4U19 A;  4Q0G A;  4JFC A;  1RJN A;  2BZR A;  4MXI A;  4RYF H;  3R9S A;  2PG8 A;  1VRG A;  3P85 A;  1DCI A;  2F9Y B;  4FN8 A;  3T8B A;  4FN7 A;  2VSU A;  3WG5 A;  3PE8 A;  4MI2 A;  4IZD A;  4ZDF A;  2X58 A;  4K29 A;  4JCT A;  3T3W A;  1SZO A;  2F9I B;  1EF9 A;  1ON9 A;  3M6N A;  5FUS A;  3K8X A;  3OC7 A;  3H02 A;  3TVU A;  4JYL A;  3ZW9 A;  3MYB A;  4ELS A;  4Z0M A;  4ZDE A;  4I42 A;  2J5G D;  4J2U A;  4JCQ A;  1JXZ A;  4FJW D;  1UYV A;  5C90 A;  3I47 A;  5KDR A;  4NAR A;  2VSS E;  3KTK A;  4JWV A;  5E0N X;  1WDK A;  3ZWA A;  4U0G A;  3QWD A;  3U9S B;  2F6Q A;  4B3H A;  3STA A;  4ZU2 A;  2J5I A;  4MOU A;  4GM2 A;  4ZDB A;  4FZW C;  3RQE A;  4B3J A;  1UYT A;  5DL1 A;  2VSU F;  3BEZ A;  2ZL3 A;  4B3I A;  1DUB A;  3P2L A;  5DTW A;  1O8U A;  3ADC A;  3BPP A;  1OD2 A;  3HLN 1;  4RCN A;  2IEX A;  4WYO B;  1N6E A;  2F9Y A;  5DTP A;  4ZDC A;  1OD4 A;  1WDL A;  3TZ3 A;  2DEO A;  3MFM A;  3ST9 A;  3M6M A;  3BF0 A;  3H0U A;  3T88 A;  4KWB A;  3PGQ A;  3FF6 A;  1Q52 A;  3GMA A;  2EJ5 A;  3H81 A;  2HW5 A;  1TG6 A;  3RQG A;  4U0G H;  2YJG A;  3H0J A;  4ELX A;  4JVT A;  3TV5 A;  1Y64 B;  3RQF A;  1N6F A;  4DI1 A;  2D3T A;  1UYS A;  3ZWC A;  3O4X E;  3L8J A;  4FND A;  4WZ8 B;  3FDU A;  3SWX A;  5G1Q A;  2QQ3 A;  3R0O A;  3QK8 A;  2FZS A;  3OT6 A;  3TT6 A;  1UX5 A;  3GF7 A;  1XO6 A;  3G64 A;  3HP0 A; 
#chains in the Genus database with same CATH homology
 4JYJ A;  1FC6 A;  4KPK A;  4G2R A;  4KNP A;  3KTH A;  4YLH A;  5KJP A;  4IZC A;  3R9T A;  2J5I I;  1K39 A;  3HIN A;  5DU4 A;  3ZWB A;  5C9G A;  2DUB A;  3LKE A;  5E0S A;  2ZL2 A;  1YG6 A;  1XNY A;  1Y7O A;  1SG4 A;  5HUQ A;  3ISA A;  2PPY A;  3MT6 A;  4I4Z A;  3DJA A;  3GLM A;  3ZW8 A;  2C8T A;  3GF3 A;  5DUF A;  4IZB A;  4JJT A;  3KTI A;  3V5I A;  3RSI A;  4I52 A;  4FZW A;  4FNB A;  1HNU A;  5DKP A;  3N6R B;  2Q34 A;  4HNK A;  3LAO A;  4HC8 A;  5JBW A;  5ING A;  2W3P A;  1RJM A;  5DZK A;  1YG8 A;  1UYR A;  1WZ8 A;  1XNV A;  2VSS A;  3U9T B;  3Q0G A;  3IAV A;  1FC7 A;  3H0S A;  2UZF A;  4QII A;  3IBB A;  1W2X A;  3Q1T A;  4K2N A;  2VX2 A;  2Q35 A;  2F9I A;  2PBP A;  5CTB A;  4QFE A;  3NJD A;  2FBM A;  4QIJ A;  3R9Q A;  1FC9 A;  2VSU E;  3V5E A;  3T8A A;  1Q51 A;  1FCF A;  3KQF A;  3K50 A;  3QKA A;  3TLF A;  1NZY B;  5FIF A;  1PIX A;  4L8K A;  4HDT A;  4EML A;  4GHN A;  4ELW A;  2CBY A;  3Q7H A;  5G1S A;  4F47 A;  3GKB A;  2VSU C;  3Q0J A;  2Q2X A;  5JBX A;  1TYF A;  3SLL A;  1ON3 A;  4K3W A;  4JCS A;  2VSS F;  3DOR A;  1HZD A;  5INI A;  1XNW A;  2FW2 A;  5DZK H;  3NJB A;  3L3S A;  2CE3 A;  3U9R B;  5INF A;  4L6W A;  1EF8 A;  2ZQR A;  3H0Q A;  1J7X A;  1N6D A;  1PJH A;  3P5M A;  3TVW A;  3TDC A;  2J5S A;  2A7K A;  4U1A A;  3RST A;  4OG1 A;  3PEA A;  2ZL4 A;  4JOT A;  4EMP A;  1MJ3 A;  4LK5 A;  2J5G A;  3QMJ A;  4OMR A;  3PZK A;  3TT7 A;  5IKL B;  5G1R A;  3OME A;  5MGB A;  2WTB A;  2VRE A;  3QXZ A;  2X24 A;  4Q1I A;  5CTC A;  4RYF A;  1NZY A;  3HE2 A;  4NNQ A;  5DUC A;  4OLQ A;  1X0U A;  1UIY A;  1XX4 A;  3T89 A;  3KTG A;  3HRX A;  2A81 A;  1WDM A;  4ZDD A;  4U18 A;  4U0H A;  1HNO A;  3KTJ A;  3VIV A;  2ZQQ A;  3RRV A;  5KDR B;  3TRR A;  5E0S H;  3IB9 A;  5DU8 A;  3QYR A;  2NP9 A;  4WCZ A;  2ZL0 A;  4KD6 A;  3QRE A;  4JSB A;  3BPT A;  2J5I B;  4EMM A;  1K32 A;  1EY3 A;  4FB8 A;  3JU1 A;  2GTR A;  5DU6 A;  2A7S A;  3MOY A;  4NEK A;  4ASI A;  2F6I A;  3R6H A;  3QXI A;  4JCR A;  4U19 A;  4Q0G A;  4JFC A;  1RJN A;  2BZR A;  4MXI A;  4RYF H;  3R9S A;  2PG8 A;  1VRG A;  3P85 A;  1DCI A;  2F9Y B;  4FN8 A;  3T8B A;  4FN7 A;  2VSU A;  3WG5 A;  3PE8 A;  4MI2 A;  4IZD A;  4ZDF A;  2X58 A;  4K29 A;  4JCT A;  3T3W A;  1SZO A;  2F9I B;  1EF9 A;  1ON9 A;  3M6N A;  5FUS A;  3K8X A;  3OC7 A;  3H02 A;  3TVU A;  4JYL A;  3ZW9 A;  3MYB A;  4ELS A;  4Z0M A;  4ZDE A;  4I42 A;  2J5G D;  4J2U A;  4JCQ A;  1JXZ A;  4FJW D;  1UYV A;  5C90 A;  3I47 A;  5KDR A;  4NAR A;  2VSS E;  3KTK A;  4JWV A;  5E0N X;  1WDK A;  3ZWA A;  4U0G A;  3QWD A;  3U9S B;  2F6Q A;  4B3H A;  3STA A;  4ZU2 A;  2J5I A;  4MOU A;  4GM2 A;  4ZDB A;  4FZW C;  4B3J A;  1UYT A;  5DL1 A;  2VSU F;  3BEZ A;  2ZL3 A;  4B3I A;  1DUB A;  3P2L A;  5DTW A;  1O8U A;  3BPP A;  1OD2 A;  3HLN 1;  4RCN A;  2IEX A;  4WYO B;  1N6E A;  2F9Y A;  5DTP A;  4ZDC A;  1OD4 A;  1WDL A;  3TZ3 A;  2DEO A;  3MFM A;  3ST9 A;  3M6M A;  3BF0 A;  3H0U A;  3T88 A;  4KWB A;  3PGQ A;  3FF6 A;  1Q52 A;  3GMA A;  2EJ5 A;  3H81 A;  2HW5 A;  1TG6 A;  4U0G H;  2YJG A;  3H0J A;  4ELX A;  4JVT A;  3TV5 A;  1N6F A;  4DI1 A;  2D3T A;  1UYS A;  3ZWC A;  4FND A;  4WZ8 B;  3FDU A;  3SWX A;  5G1Q A;  2QQ3 A;  3R0O A;  3QK8 A;  2FZS A;  3OT6 A;  3TT6 A;  3GF7 A;  1XO6 A;  3G64 A;  3HP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...