2ZR0A

Msreca-q196e mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
316
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINELRETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 96
structure length 316
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr0A01
1DS6A 1KMQA 1RVDA 5FUXA 5FTMA 2AWOA 3MWKA 2AR7A 4KBFA 1KAGA 3GLGB 1E2LA 1ELOA 2OFXA 2ZR7A 5GJVC 3TRFA 2CDNA 3WBKA 2ERXA 3PXGA 1VG8A 2RMKA 4OJQA 4N0EA 2YOGA 2ZRBA 2YC4C 5FTJA 4DDUA 3CF2A 3BFXA 5LD2B 1JJVA 3AH8A 4LJ8A 4BLOA 2QY9A 3M4YA 1W1WA 3P27A 3A1UA 2ZRJA 1VYUA 4LHYA 2J0QA 3GD7A 3TQCA 1R4AA 5KNDA 1S4QA 4DBLC 5JCZA 4C7OA 4LRWA 1IONA 4ASUD 2ZEJA 3SBDA 2PZEA 1CLUA 2P65A 1NLZA 2QORA 4WZBE 2WV9A 4B2LA 4IDOA 2FH5B 2ZSAA 2KSQA 3AF0A 4TMTA 8OHMA 4LHVA 3KJIA 4JT4A 4Z51A 3B9QA 4CVNA 1DTSA 4NDZA 4V03A 3ADCA 1OKKA 1L4YA 2ZITA 3T5GA 3R9XA 1R2QA 3SZRA 2QG6A 1Q22A 1XEWY 1R8SA 3ZGXA 1EFRA 3GLGA 4KFSA 5JRZA 4A0HA 4RZ3A 3QKUA 1FP6A 1OXTA 3ZH9B 1SZPA 2AFIE 5CB6A 4YONB 4HLDA 3IO5A 2AXNA 4HLQB 2GRJA 4Q4HB 1T9HA 4ARZB 4ACAA 2ZYUX 2YWEA 3I62A 5BN3A 2QZ4A 1VHLA 4KODA 4NBSA 1KO5A 1G5PA 1G8PA 2ORWA 3N70A 3W90A 4CF7A 4RZXA 1QHXA 3AKYA 4G5SA 3GJ7A 5BYJA 4HUTA 4FINA 4QM6A 3CRRA 4PZZA 1CEEA 2B8TA 3Q3JB 2DWPA 4G1UC 1Z22A 2CE2X 2IYLD 5JFGA 5DH9A 1NBMD 2WSSD 3CWQA 2R65A 2IUTA 1IQPA 1MKYA 1CJMA 4PZLA 1QHGA 1KI7A 1LS1A 4URXR 3U3MA 4WA7A 4TLCA 1K5DA 3TR0A 3FHCB 2FPKA 2PLFA 2ZQ5A 4JT2A 5JS7A 3EIHA 1OPXA 2QQEA 4IXMA 4URWR 2DPXA 1H8HA 5DLQC 4DLZA 4DVGA 2JLVA 4FMDF 2J0UB 5ANRB 2IX3A 1OXSC 1HE8B 4DZZA 2GJ9A 2JJ1D 2ZJZA 2YV5A 4P3YA 3PUYA 1PZNA 3DOEA 3FE2A 2WBLC 2XSZD 3I4LA 2IBMA 3PR1A 5DNYB 2VHUA 1ZU4A 3TAHA 2D06A 1XMSA 3V4FA 4C0BA 5IF9A 1PV4A 5L8VA 1MV5A 2GK6A 2NPIA 3AUYA 3NXSA 1DE0A 2ZETA 1GFIA 1P2VA 1DELA 4QGGA 4U00A 4JKIA 4OQLA 1NN1A 4JLNA 1G6OA 1RRCA 2R62A 1XPOA 1KNQA 4IDQA 3R8CA 4IDNA 3QKSB 3VR2A 2J7KA 1TTTA 2G9NA 4B74A 2Z0MA 2GZDA 1E9FA 3PIRA 2V4ZA 2O52A 1P60A 3SYNA 4OI0A 1ODFA 3O8DA 2W6JA 4JL6A 1JAIA 1GRQA 4NL4H 3RDPA 4P32A 4D26A 1U0JA 4EPTA 1M6NA 5FUYA 1RIFA 3WYAA 2IF0A 4NTZA 2PJRA 5B2ZA 2IUSA 2ZRGA 4ZIRB 1LVGA 3TMKA 4DXAA 4YMSA 5DHAA 4K8OA 5HPYB 4NZYA 5TXGA 3OESA 5F3WB 1YHNA 2BMFA 4YMWA 4RZUA 3CONA 1UJ2A 2PT5A 1TPZA 1KDOA 2J0UA 3B82A 1AKYA 1P7CA 1H8ED 4LJ4A 4A2QA 2MMGA 4ABYA 1OFTA 1XRJA 1KI6B 1KMHB 4TSFD 2BMJA 1DARA 2IYUA 1NN0A 2EYQA 1JXOA 2NIPA 4NYIQ 3WNCA 2GXUA 5FTLA 4TLDA 4M0LA 3CPJB 4Q66C 2Q9BA 4ZDKA 2QENA 3DHWC 4IKEA 1JPNA 1TAGA 4C0AC 4EPVA 3K53A 4R71A 1N0VC 2XITA 5J4YA 4MYCA 4KXFB 4M2LA 1LB1B 1FP7A 4DDVA 1OXXK 1PLLA 2GBLC 2ZRDA 3HJNA 1CJTC 1Z8FA 4F91B 1ZM2A 3QE0A 2FZ4A 4CT5A 1JALA 4PC1A 1OFIA 2BC9A 1ZJ6A 1RRFA 4B44A 1TEXA 3NBYC 4YMUA 3QPWA 5J4VA 3DM9B 4UNQA 2OXRA 4BFUA 4B3GA 5IHPA 4Q1DA 1FPMA 1R0ZA 4RFVA 1D2MA 2CLDX 2ZI3A 1KI6A 1W0JD 5HCIA 2ZI4A 4A8JC 1RYHA 3AUXA 2ZS9A 1E2HA 2VF7A 4Q4JA 5GVRA 1K5GA 2F9MA 2ZU6A 4TL9A 4EJSC 2F1JA 3CPEA 4B34A 2VLIA 3GLFE 1NY5A 2WHXA 3UATA 1NSTA 3EPLA 2R44A 2GCOA 3VTKA 1D2EA 4D82A 5C46F 1E2GA 4NH0A 3W6OA 2IS2A 2BKEA 4LPKA 2ZXUA 2IYTA 4JLMA 3UKDA 1GG2A 4QBHA 1NIPA 3CH5A 4QJ4A 2X77A 2VSOA 4I1OA 1WF3A 3QQ5A 1UEIA 4MRSA 1TNDA 5FL7A 3NBFA 2QTHA 2OFWA 2O8BB 3AGPA 1SKYB 4PXAA 3IBYA 1AA3A 3KQNA 5JLJA 4DDWA 1SHKA 3RRNA 2YINC 3LW7A 3Q5DA 4ZPXA 1CF4A 1G4AE 4MYUA 4JL8A 2PEYA 1RPZA 3JVUA 2QAJA 4ZKEA 4BFZA 1GL9B 1LF5A 1TQ6A 3TW8B 4NKRA 2ZAOA 3A4MA 5K8TA 4RJLA 1F60A 4RKEA 3X1DA 1N3BA 3A1TA 3AGQA 2BBSA 3X1XA 1NJFA 3QBTA 2W83A 4A6XA 4POAA 2XXAB 2V1UA 3B1XA 4HB3A 1YVDA 3N5CA 3B6EA 4OI2A 4D0NA 3BBPA 1SXJE 2Z5FA 4JLPA 3SS8A 3W5IA 1FW6A 4DB2A 1AN0A 1E4VA 4A2WA 2G83A 5TV2A 5KNBA 4D81A 1CR1A 1N5IA 4JVNA 2CNWA 3OFND 1DEKA 4QRHA 2EFCB 4TMXA 1NJGA 1KIMA 2KJQA 1P3JA 4LJ7A 4F4CA 4LC0A 1RYFA 2PLRA 3GCGA 3WMFA 4C0SA 3LQQA 2OCAA 4I99A 2RGNA 5B57C 2AK2A 1LFDB 2BEKA 1TF2A 2WJIA 1XMJA 4FIDA 3RS2A 2J0SA 1Z63A 2O8BA 2X1VA 4B76A 5TVKA 1EFTA 2J1LA 1ZBDA 2DHRA 1S1MA 3C4JA 4JBYA 2Q6TA 1C4OA 2Q9CA 2FA9A 1P9RA 4Q1AA 3GLIB 4DCSA 1VIAA 2JATA 2IYQA 221PA 4CT4B 1B0UA 3ZQJA 3P32A 5EZ6B 4ZDWA 3RS5A 1GOTA 4HB0A 5DN6A 2L0XA 2IW3A 5FUVA 1M34E 3BB1A 3E5HA 2J59A 4GI7A 3FTQA 4RY2A 2ZAMA 1VCMA 3FFAA 3I73A 2XXAA 1T3LA 2REOA 1UKYA 4XVRA 3VKGA 4GOKA 2XZLA 3C7KA 3VR3A 4LOAA 3QEJA 2GCNA 3TJZA 2HJGA 1X1RA 4KYUA 4PHGA 4D0LB 3A4LA 4A8JB 1RC8A 1W2GA 1Z6AA 3B1VA 1M74A 2PMKA 4DT1B 4EJSB 1TMKA 2NOAA 4GDFA 1WP9A 1Z2AA 2OAQ1 4DHEA 3UG6A 3EASA 3VHLB 3CRW1 2ODEA 1PLJA 4LV6A 4ILEA 1ETUA 1HYQA 3AP1A 4RD0A 4U02A 2GJAA 5CYPA 1IBRA 1AIPA 2ZVQX 4Q19A 5CDFE 1KOFA 2CE7A 4RSGA 5BW8A 3PJRA 2ZTSA 2C96A 4IOKA 5E95A 2O0JA 2EFGA 4DJTA 3CRMA 3HDTA 4EPWA 3GLIA 5KDLA 5AJYA 3B5JA 1GKYA 4LUCA 3W5JA 3C5CA 1VCNA 3CKLA 2ZRAA 3GJ8A 1JNYA 5FL3A 4D80A 3BWDD 2QBYB 2CMKA 3KFXA 1S9HA 1NNEA 1VMAA 3HPQA 4I1UA 2WTUA 3PEUA 3ZIAD 4L9WA 1IY2A 5FPSA 3OEHA 3LXXA 2CHGA 3NBZC 4HDCA 4D4JA 3SFVA 4M9QA 1G20E 5FPHA 4DC9A 3W3ZB 3ZZUA 2ZE7A 1R0WA 2WJVA 4PZYA 1E9EA 1KKLA 3HPRA 4TTRA 5FI1B 4C3ZA 3NH9A 3AVPA 1U0LA 5J4LA 2RH5A 2AKAB 2YWFA 4KLNA 5E3HA 2WWXA 4UJ3A 2VP6A 2ZI9A 5FPKA 2QE7A 3TUJC 3WHLA 2DB3A 4AKIA 4OBEA 1G3IA 2WIBA 5CLQA 1SXJA 2HT1A 1HT1E 5B30A 3SQXA 4QHSA 1EFHA 2R6GA 4PQYA 1ONBA 1W4CA 1IAQA 3DOFA 4IW3B 3GJ0A 3K9GA 4I4LA 1GKIA 1M7HA 4R2IA 1AKEA 3I8XA 2W6IA 2WKPA 4JLAA 2VO1A 5K8UA 2VA8A 2JJ8A 1HV8A 2XX3A 1DAKA 1D8TA 2VTKA 2IEYA 1EFUA 2XNDA 4AG5A 4NYMQ 3KQKA 2QBYA 2JDIA 4GOXA 4MKHA 4Z1MA 1Z29A 2WIAA 3ND8A 2R8RA 2GVZC 2FGJA 1OKKD 5G40A 2V54A 1E2JA 2BM0A 3CR7A 1FOEB 1R5BA 2OESA 4FXPA 3LNCA 3AVWA 1ZP6A 1EFRD 1P72A 1U2RA 1YE8A 1U8YA 4D2IA 2WWFA 3ASZA 3SJBA 4ESVA 2I4IA 4NE2A 4LK2A 3UG7A 1NIJA 1V5WA 5ELXA 5F9FA 1KO4A 3OAAA 2VHJA 1KY2A 1E99A 4FI3C 4DWJA 1FUKA 4XD7A 5GADl 3FFBA 4DCVA 1XZPA 1UAAA 2ZRKA 4LJAA 2RGDA 1IM2A 2AKYA 5KPDA 1G291 1U99A 1GP2A 2AFHE 1WDTA 1II8B 1A5TA 5KSYA 1XCPA 4BLPA 2N46A 4DLYA 3KQLA 5JJKA 4TMVA 1ZM3A 2ZSEA 3ZD6A 2V9PA 5EXXA 3RWMB 1ZNYA 3LFUA 1YRBA 2QMOA 4H1VA 5JEDA 1IXRC 2G1KA 5CK4A 1IN4A 3N2EA 3UANA 3BORA 3QUSA 1KSHA 4B32A 2YVUA 821PA 1DAFA 2X19A 4OK3A 1OJLA 1BH2A 4KLZA 3CUEF 3B2EA 4EPXA 3HU1A 4NYIR 2NZJA 2OG2A 4GMXA 3PUVA 2YC2C 2ZS8A 4DSUA 1U8AA 2RGEA 3ZVMA 2RGAA 3NKVA 2V7QD 4DCUA 1COWA 1SVMA 4BECA 3ZS8A 1YRAA 2HXSA 3LX8A 4LBVA 2LWIA 4X8MA 4HZIA 4JSTA 3C16C 1IN8A 4Q1CA 4BWYA 3ONWA 1PLKA 3CNLA 3G82C 4PC6A 3KL4A 5F2EA 4QHTA 1KO7A 2BOVA 2OCPA 2WJGA 3FMFA 1QHHA 3K0AB 4GFDA 5D3QA 2GVDC 1E1RA 1G7SA 1ZM4A 3Q8XB 4FMBB 2H5EA 3UMSA 1II8A 2OCYC 1N6IA 1P5ZB 2W6JD 3DMNA 3EARA 3A6PC 3B9PA 4OQMA 4BRWA 1G6HA 2YOHA 3NC0C 2QMEA 1HEIA 3TSZA 4LY6A 3WYFA 1ZINA 2FFBA 1SVIA 2ZYVX 1E94E 4HATA 1JJ7A 5E4FA 4O2RA 1CU1A 4HDQB 1G19A 1AS2A 1DO0A 1E2DA 2IYWA 1KDPA 5KSPA 1T8UA 1ZCBA 3KX2A 4DLRA 4BQSA 3MJRA 2XJ9A 5HCNA 5CB8A 4E5UA 1EWQA 4FCVA 3QJYA 2G0NA 3I32A 4TMKA 4Q1EA 3IGFA 4B6EA 3VMFA 4P4UA 4IOLA 4KYIB 2J3EA 2IYZA 1P2UA 3FGNA 3M1IA 5DO9A 2W58A 1G3QA 2WJHA 3QENA 3U4QB 2DR3A 5EE5B 3QXSA 2B7BA 4E09A 1IHUA 5GJWC 3GLGE 2ZJ2A 2DFNA 4YXWA 2CLSA 2P2LA 2GJKA 1OW3B 3OZXA 3AKEA 2WWGA 3K0AA 3EZ9A 3EW9A 1ZC3A 5DYIA 2G3YA 2HLDD 5EP3A 2VSXA 2P5TB 3I3SR 2FFAA 2Z4SA 1KJYA 1JR3A 1QG4A 5GVSA 1UKVY 4Q01A 1QF9A 2ZJOA 4C2TA 2C99A 2D74A 5D3MB 1DAIA 5JI3E 3MAAC 5H8WA 4D4MA 2BBTA 4Z54A 5FOUA 3CB4A 1HT2E 5AUOB 2CXXA 1VG9B 2IYSA 2ONKA 1GAJA 2OZEA 4IEIA 4MDEA 4UXJA 2YWGA 3DEFA 5A0FA 3ZZTA 1D2NA 1MH1A 4IEEA 1ZYUA 3E2IA 1G21E 1H65A 2ZI6A 2VP9A 4ZCLA 3LD9A 2QGNA 2BIFA 1W2HA 3NIBA 5HKKA 2O8DB 2ZJ8A 2C8VA 3TSOA 1KI1A 4QGFA 5G53C 4WOPA 4JVMA 3TUZC 5SZKB 2ODWA 2ERYA 1XX6A 2IL1A 4Q4LA 5JZVA 3U6BA 2MSEB 3FVQA 1BKDR 3K0CC 2CK3A 3GJ3A 4Q18A 2V8OA 1ZNZA 4KSCA 2GILA 1HQCA 4MDFA 3T1VA 1NLFA 1CBUA 1IXSB 1ZNWA 3KJHA 3NC1C 3QI2A 5FL7D 4AK9A 5CYOA 4Q5IA 3RRMA 2QT0A 1XNJA 2RHMA 1YZNA 2HEIA 3B85A 3X1ZA 2ZRCA 5FTKA 1D9XA 3U6KA 1Z08A 3RC8A 5D3MA 3TKLA 3RSOA 4EIWA 3QNUA 4KVGA 1NVWQ 4LBWA 1TQ4A 4IVPA 5E7JA 2FGKA 2JIZD 1ZC4A 3C14C 1NG1A 1UBFA 1W0KD 4JYBA 1L4UA 2W2VA 2BKUA 2KBEA 2OXCA 4WXPA 2GEUA 3B7GA 2F6RA 1DAEA 2BJVA 3P4YA 3ZYCA 4P4TA 4ZI3A 2CJWB 3T1TA 2R2AA 3LVRE 2AWNA 5EZ5A 1HQYE 2O8DA 4Q9JA 2EYUA 3CNOA 3CZQA 1AQYA 4XWOA 1KHTA 4RFSB 2HV8A 1IOZA 4W7SA 5CJ2A 1QHIA 1E2EA 1BIFA 1IY0A 3ZVRA 4JMPA 2DFTA 1Z0DA 1LW7A 1E69A 4LGMA 2DCUA 2GXAA 5DI3B 2NG1A 5LDDC 1T6NA 2DFKB 4KAXA 4Q48A 5KDDA 1T0JB 4GP7A 2JGNA 4M9XA 2GWHA 2QSZA 2ZVPX 1WQ1R 3ZDQA 1DVRA 2GA8A 2RKOA 5AUPB 3HU3A 3LDAA 1E1QD 3RS4A 3D6TB 3TAUA 2CCGA 4MRRA 2PCLA 1EESA 1E2QA 1N5LA 2JLUA 1AQUA 2Z6VA 3L0PA 3DZDA 1Z06A 3T5DA 1EX7A 3EWSA 4XTCS 1Z5ZA 1OYWA 1OF1A 4R7ZA 5B64A 1OH6A 5DN6D 1NN5A 4II7A 4JKYA 2ZRPA 3GJXC 4A4DA 2PX0A 3KXKA 4C0LA 2JJ2D 1E2IA 5JJIA 1P73A 3RS0A 3KKMA 4HAZA 2F3TA 3EC2A 1F3OA 2ZSDA 3U7EB 4HDOB 4B2PA 3LRPA 4NCKA 1DOAA 4ZCIA 1T4GA 1YU9A 2BV3A 3ZS9A 3DMDA 2X8AA 4ACBA 3Q85A 2IXEA 2VHTA 3KTAB 5JJLA 2OBNA 3IHLA 3SJCA 4TT3D 1W49A 1X8JA 4AC9A 4KITB 1D6JA 2FSFA 2VHCA 5DI3A 1EGAA 3RANA 2DYKA 2ZRMA 3QXJA 1RE0A 3P4XA 4Q4HA 3ICQB 2RGBA 4X8LA 3AVQA 4A0RA 4ARZA 4WZ6A 4ZO4A 2WOJA 2BHRA 4LHZA 2D7CA 2QMUA 1GNRA 4TLBA 4UNPA 2QAGC 4M21A 3P26A 2FFQA 4NYMR 4KFUA 1JPJA 1T8TA 2FZLA 3KKOA 3KUCA 3FHTA 1PJRA 4LJ6A 2YOFA 5EJEA 3NEYA 4E03A 1WB9A 2BM1A 2C03A 5EXSA 4KU4A 1KDTA 4QFMA 4UXIA 2A5JA 1WMSA 4B33A 2MSCB 2FU5C 2F43B 3PVSA 4AKEA 4LWZA 2ZUCA 1W5TA 2CLCX 4N0DA 4IJMA 3K1JA 4OHXA 2J7PD 4DLXA 1E0SA 4MUBA 3U3KA 2B6HA 5FBRB 2NTYC 2B92A 2GESA 4IFBA 4TTQA 4WIAA 3A1WA 4MYTA 1X8LA 2JLRA 1XD2B 5KSOA 1VHTA 3MUFA 1MRSA 1XD9A 1HA3A 2K5UA 1DO2A 3CM0A 4G5OA 1OLOA 4JLKA 4BE7B 1GNPA 1U81A 3U7HB 3KTAA 2XJ4A 1SXJD 2QPOA 4CYMA 3THYB 4DIDA 1UBGA 4AYWA 1N6KA 3AVOA 4AD8A 2FPMA 2D4HA 3DDCA 1GVNB 1BYIA 1J8MF 3Q72A 3V9PA 2J5XA 3A1VA 3U3JA 2JLSA 2H92A 1NLYA 1QG2A 2E9SA 2OCBA 4G5GA 2QP9X 1UADA 2W6ID 3UIEA 3VFDA 2J87A 3T12A 4EPYA 2OILA 4YDHB 1KK3A 1M8PA 4YMVA 3QKSA 1UFQA 3KB1A 4AYXA 2BMDA 4D0GA 1VPLA 1UBCA 1ZD8A 2DWOA 3FMIA 2XNDD 4QJ3A 1ZMXA 2JDID 4Z1MD 2XTMA 4BFVA 5TMPA 1KK2A 1NMXA 2N1BA 3BH7A 2WM9B 2ZI7A 4DUGA 1YZKA 1Z28A 3AF1A 1GSIA 3IBGA 2QP3A 4Q47A 4ZIRA 1MABB 4M1TA 1F48A 3VNVA 5IK2A 2FX3A 1LS6A 3A36A 3BH6A 4MKFA 4R98A 3F8TA 3EG5A 4CW7A 1MR3F 2BWJA 5AUQA 2NPFA 4PANA 3QG1A 1S8FA 4NMMA 2PBRA 3OIVA 4QC2A 3TUIC 4PQFA 3WY9A 3FMOB 2J45A 2FNAA 3RS3A 1KMHA 2FWRA 4XD7D 1TQDA 2JLWA 4EDHA 4QXAA 2C98A 4GMDA 4BLRA 3Q7PA 3NBXX 3DZ8A 1YZQA 3IQXA 1E4YA 4IFEA 4G01B 2CL0X 4GOJA 1BMFD 2JEOA 4OQNA 1IN7A 4UQOA 2QMHA 5J47A 4IDHA 4Q4AB 2WJYA 1W48A 4FWTA 4X8OA 1F2UB 4KFTA 4IVRA 3VR4A 5EUQB 5F9HA 3ECCA 4AIIA 2Q3HA 4EFNA 2ORIA 2RAPA 1S1CA 2E1RA 3D8BA 4LYAA 1OH7A 1G41A 4Y0VA 1S2MA 1W7AA 5FOSA 3DPUA 1L8QA 4HLUC 2Q0HA 3GLIE 1G1MA 5L3SB 4KO8A 3BIFA 5CJPA 1I4DD 2PX3A 1Z0IA 3OEEA 5KNCA 3AVYA 1MABA 4GZMA 1Q1ZA 4N1AA 3PUXA 3AKDA 3OE7A 5FH9A 3GLHB 3EIEA 3BE4A 1G18A 2F1IA 1W36D 1Z0FA 4DLVA 2B7CA 3UMRA 2VF8A 2FSGA 4MQBA 2F1RA 3GMTA 4MRPA 4P31A 4MYHA 4XJXA 1US8B 2A7QA 5BYKA 3OHMA 1OXUA 3VX3A 4C9BA 1A2KC 1FQJA 3UWOA 1II0A 3NHAA 2SHKA 4HB2A 5JCPA 4TL8A 1N5KA 1E2NA 3T1OA 2KE5A 1U9IC 1XB2A 4I1SA 5CM8B 3A37A 1E1RD 2C5LA 3T15A 2XTNA 3BOSA 1V43A 4PAOA 3MG9A 4AWXA 3S1AB 4PHTA 5L3VA 4TZ0A 1G7TA 4QG7A 2HUPA 1CP2A 4DLUA 2OFOA 1P62B 4KJZA 1U90A 4Q4AA 5C18A 1HUQA 2BMEA 2ZANA 4PC3A 3VQTA 1F2UA 3UPUA 2GEDA 3AP2A 4PX9A 2XGJA 4QBFA 1ZUNB 1NKTA 2ZRIA 3AB3A 2GHIA 3QF7A 1O87A 4JIMA 3D7MA 1OFHA 3LH5A 1OYYA 4HAXA 2VP2A 3A8TA 3EZ2A 1I2MA 4WW0A 2WPDD 1XTRA 2XZPA 4Q9LA 4MGZR 1A7JA 4A82A 2QPTA 4RZ2A 1C1YA 4M1OA 1CS4C 2OSBA 2EQBA 4M4SA 2OHFA 1CXZA 1AA9A 1KTVA 3EXAA 3M6AA 3QVUA 4NCNA 3GLHA 3F0TA 5K8LA 1OH8A 2REXB 1KZGB 1HY3A 2RGGA 3FKSD 3SDZA 2R6CA 1XFAA 2VYFA 3DKVA 1XEWX 5EXTA 2FV8A 1QHNA 3U5ZB 1US8A 1WE2A 2P5SA 3QOFA 2HT6A 1X86B 3I72A 5F98A 5G3YA 1EXMA 3DO6A 4RD6A 4A2PA 3L82B 4QNRA 4CDGA 4ITRC 4XH9B 1TUEA 4M8NE 3V00A 2ZYWX 3FYHA 2GF9A 4K46A 5KPJA 1FMLA 2B21A 1ZCAA 4BZPA 2QTFA 4JSYA 1T5IA 1J7KA 4NP6A 3RABA 3JZMA 5CM9C 3S1AA 3K70D 3IPYA 3ADDA 3KXIA 4OKSA 2V3CC 5JI2E 4GT1A 1VTKA 1NBMA 1TL7C 1GILA 2WSSA 2ZUDA 4OI4A 1XEXB 1VKJA 3EAQA 5EP1A 3HR8A 2A2ZA 3O8RA 4DRZA 1W36C 1HH4A 2ZYTX 2ZJ5A 4Q03A 2GXSA 3IEVA 1JQLB 3AQ4A 1M1YE 1PUIA 5KOYA 4S2EA 4FCTA 1OB2A 1XBTA 1ZVQA 1L7VC 3K9NA 3L8YA 4PPQA 1Z0AA 1OHHD 4PQRA 3FHOA 2JLQA 1U0HC 4F4JA 4LC1A 2GBLA 1G8FA 2BJWA 5DISB 1JBKA 3WMGA 1WBDA 1XTKA 2XSZA 2XTZA 1CKEA 1A4RA 2IA5A 3C5HA 3CRQA 1JQJC 2XNSA 3RAPR 1NF3A 4ZDIA 5HKKD 521PA 1NMYA 1X8KA 4V0LA 1F5NA 3O47A 5AWFC 2VSFA 3R7WB 2CHVA 2R6FA 4MRVA 1ZIPA 2QL6A 1EX6A 1K6MA 2ANCA 5TARA 4CEJB 2OO7A 4TL7A 4TYPA 5K8IA 4KI0A 1XXHB 4O3MA 1G5TA 2ZM5A 1Y3AA 2BBOA 3VU9B 3E70C 4A8JA 2H7VA 4Q1BA 2G6BA 2QEQA 3RNLA 5HZHA 4DT1A 1K8RA 4EJSA 3T06B 3CR8A 1G7CA 1WXQA 4KVAA 1XTIA 3MRSA 5AJZA 3FDIA 1T3HA 5KDOA 1RW4A 4B3FX 2CCJA 3KUDA 3GJ6A 1YR7A 4HAYA 3E1SA 5JEEA 1O3YA 1CTQA 2GJ8A 3B78A 4JL5A 4G3XA 1F6BA 1G3MA 4Q7JB 5HTKA 3L2OB 4DSOA 4F7WA 1H8EA 3K09C 3PV0A 5HE9A 4LYHA 4W9MC 3K0EA 421PA 4H9GA 1W4AA 3K70C 4Q1FA 4TSFA 1G8HA 1P61B 4DLWA 3PG5A 4EFMA 2NO7A 2ZREA 4Q02A 4WBSA 5CLLA 2NGRA 4CGZA 1DAGA 3JZAA 4JVSB 4CEJA 4FD2A 4GZLA 4AURA 1XXHA 2GZAA 2AX4A 1GDDA 2C95A 2QPAA 4B47A 1DAHA 1A82A 1XPRA 3ZD7A 3VU9A 3LV8A 1KDRA 5JSZB 3TLXA 5JMTA 4GRAA 2AD5A 3LBHA 3KQUA 1PUJA 2E87A 5JHHB 1VG1A 1UBEA 4ESHA 3FPAA 3JVVA 4GPTA 5TY0A 2C2HA 2A3RA 4BLSA 1E32A 1WCV1 2OLJA 2R6AA 3CNNA 2QQ0A 5CITA 4JJZA 3OIYA 2NO6A 3GFPA 2REBA 5AJVB 4NYJQ 4Z8YA 4EAQA 1JR3E 4P4SB 5H70A 4A1FA 1PVOA 1UDWA 1KZ7B 2FG5A 4C30A 1YR8A 2QA5A 1ZIOA 3RHFA 4CEIB 1I2DA 3D31A 3QBVA 1VYVA 1FMJA 1VDZA 2ZU0C 3U61B 2A5GA 3QPUA 5LB4A 3SJZA 4NPHA 3CH4B 3AP3A 5AJXA 1TU4A 3RRYA 3W6NA 1I4TD 3X1YA 1GL7A 4UNRA 2W00A 1Z0KA 3HWSA 3OIUA 2GZHA 4OK5A 1N0WA 1H8HD 1JR6A 3NH6A 4PO9A 1CR2A 5AR1A 1ZU5A 4B75A 2AL7A 4LI0A 1QBKC 2CCKA 3IEUA 1UF9A 4HAUA 4W5WA 2V55B 5J5CA 2UZ3A 1SVWA 1XJ0A 2PZGA 2HXYA 5JECA 3IPXA 5FTNA 4CIDA 1TQ2A 1G9XA 5CIQA 2HCBA 1AJEA 2GK7A 4XSGA 1BOFA 5JSZA 4BEBA 4LCBA 3ZQ6A 4LHXA 4Y0AA 3SU8A 2W2XA 4V0KA 4FMCF 3THWB 4HAWA 1XF9A 2MMCA 3QKRB 4Q9KA 2PJZA 1FZQA 3IIMA 1GWNA 2WWYA 1QVAA 1XP8A 2ZJAA 3R20A 4OHWA 1Q3HA 1W46A 2F3RA 2FDCA 5A5GA 2QRZA 4B71A 4P4SA 3NDPA 4V0OA 3BB3A 3AVTA 1JAHA 2ZSFA 1Q44A 2IUUA 3MSXA 1FTSA 4PHFA 5FOTA 2OT3B 3AEZA 3WRYC 3WYGA 5LPNA 2GTPA 3R9WA 1U94A 2YWHA 4I1VA 4PHHA 4UNSA 5DSZA 3Q9LA 4PSAA 2FFHA 5HZKA 1E9RA 1Y63A 2NMVA 2ZE6A 3LVQE 2ZI5A 2Q3FA 3I8SA 4YQFA 4JBXA 1VYTA 1KAOA 1R10A 3MMPA 3THXB 2OLKA 3EZ6A 1CR0A 3IILA 3ICEA 4HUQB 4HI0E 1NRJB 3OIWA 4C0HA 4W5JA 4O0MA 3FMPB 3NVAA 3B60A 2RGXA 3LW8A 5FBLB 3U60B 3G0HA 4ZDJA 1N6OA 3PENA 1OIWA 1WRBA 2CVFA 1KJWA 1R6BX 3LLMA 2QP4A 3C41J 2WZQA 5DYGA 4HZUB 2C9OA 3ZVLA 4BFYA 4TZ6A 1E79A 2ZJYA 1XCMA 2D2FA 3M0EA 3TH5A 4Q21A 1WBBA 2I3BA 2IYRA 4AYTA 4DIEA 1QHSA 4URVR 4G5RA 5EE1A 4TMZA 3VX4A 3DKPA 2AD1A 4HYYA 3TVTA 3RRZA 1HURA 4DUGD 2GETA 3H84A 4Z8XA 3PEVA 2HYIC 2OUKA 1ZM9A 1GM5A 2HDNB 4M1YA 4DCTA 3CX7A 4B48A 2GXQA 2F7SA 5CIWA 4BASA 4N3NA 2EFHB 2YZ2A 4P0TA 4PFSA 2WAXA 3CLVA 1NVVQ 3IDQA 3IKJA 4V0NA 3THXA 3WXMA 4XWAA 4TYNA 1OXVA 1XJQA 2YYZA 3LBNA 4HUQA 3LX5A 4FW9A 4YDSA 4CRWB 1E9BA 2KB0A 5L3QB 2ZS7A 5EXPA 1YZUA 4HSEA 2VH5R 1SGWA 2KBFA 4KBGA 4B43A 1NI3A 1D5CA 1GRNA 4OJKA 1KI3A 1R5OA 1CR4A 2IS6A 1ZD9A 1ZNXA 3MGCA 4LBZA 2ZIAA 4Q7LA 4BUJA 2W0SA 1R8QA 3B1YA 4V0MA 3TIFA 1BYUA 3EZFA 4C4PA 3EPKA 1JEEA 3VR6A 2OE2A 3U4QA 3X2SA 2ZJBA 1N6PA 2IC5A 4GBMA 4F93B 4AKGA 3QY0A 4KFRA 4C7OB 4HZUA 3FKQA 1DAMA 1RJ9B 2WWIA 1DPFA 4H1UA 3QXHA 1CULC 1KK1A 4C0KA 4TYWA 1AS0A 4OYHA 3U3RA 3AVVA 1J70A 1YKSA 4QBIA 2D62A 3LXRA 3VKWA 1Q12A 2QM8A 4PAMA 4HEJA 3ZIAA 1OFUX 4YMTA 2RGCA 3ETLA 2NO9A 3THOA 2FEOA 3O8BA 2JLXA 3OE7D 3GEIA 4JS0A 3DL0A 1TADA 3IHWA 4HAVA 6Q21A 1IN6A 5EE3A 4PPNA 4F38A 2J41A 2J9RA 4LX0A 1Z3IX 5L3QA 1XZQA 1QDEA 4ZI2A 1LF0A 1S0UA 1YR9A 4LV5B 3LWNA 4XWKA 3K9HA 1CRPA 4US1R 1E9SA 1Z07A 4LSGA 1MRNA 2WKQA 3TR5A 4DEYA 2JLYA 2VBCA 4U5XA 621PA 2RHDA 5EP4A 3NHBA 3VR1A 2CNWD 1RJ9A 3CWZA 1GNQA 5DGXA 4A9AA 3QXCA 1E0JA 1TF5A 2H1LA 4TQ9A 3WP0A 3K0FB 3LO5A 4DLSA 2O8CB 1X6VA 3QG5A 4L9SA 3H0KA 1KSGA 1W5SA 1KI8A 1R5NA 3REFA 5AUNB 4B2IA 4FN5A 3GEEA 1FUUA 2P67A 2P3SA 4MA4A 3EA5A 1A1VA 2Q3MA 4UKDA 2A5FA 3SHWA 3SE0A 4MUAA 4O25A 2IXGA 3TGPA 3CX6A 4URZR 1M7GA 4LV8B 2FF7A 2YNMA 3BJIC 4E07A 4DCNA 1XD8A 4NU0A 4BLTA 1N6NA 5KTYA 1Q0UA 1ZUIA 1GL6A 3A1SA 3SOPA 3F3YA 5JWHA 2QM7A 2QI9C 4NONA 3QKTA 3IIJA 4BFSA 1AM4D 1VECA 4US2R 1CJUC 1R0YA 2CJWA 5IRCD 1R0XA 3I61A 1YR6A 1KGDA 1MO5A 1AZTA 3DVLA 2A9KA 1P6XA 3EIQA 3PQCA 3IIKA 4RCZA 1N6HA 3B1ZA 1ZM7A 1Z6TA 4RFSA 1J99A 4LDJA 2IWHA 4X8HA 2O8FB 3SFZA 2QSYA 5JRJA 2EFDB 4LPSA 2CL6X 3PFIA 3EZ7A 4LBYA 3QIAA 1RRPA 1AK2A 1SQ5A 1RRGA 3K0FA 3KKNA 4EFLA 3C15C 2O8CA 2QTVB 4D4KA 3SI7A 2YHSA 2EVWX 3D3QA 2ATVA 3EPHA 4W5HA 2NZ8A 2XOKA 3H1TA 2OV2A 4WXRA 5SZHB 4XVQA 4U7DA 2MSDB 4TWZA 1FQKA 2ZUBA 4TLEA 5BWMA 4JLDA 4MGIR 3WHKA 3MJHA 2IHYA 1AZSC 1GTVA 2PH1A 1SVOA 2TMKA 1Q21A 2KWIA 4LYJA 5UKDA 3K9LA 4RD2A 1VCIA 4IVQA 4M53A 1T3SA 4NHOA 1XMVA 4DEXA 1J90A 5AJWA 3RYTC 4TQAA 2UKDA 3OEHD 2V7QA 1L2TA 1Z83A 2ZPTX 1VG0B 4A0FA 2EFEB 3NG1A 2A5DA 4BRUA 2RGNC 1CRQA 1ESMA 3CF6R 1ZD1A 3GFTA 4MGYR 2P6NA 4M9SA 2V6JA 2QE7D 2O8FA 3ZVNA 2BCGY 1TX4B 4HLCA 3ZZ0A 2XAUA 1W47A 3KB2A 2PZFA 4NYJR 4B3CA 4B35A 1J2JA 4AY2A 4QGHA 3U2QA 3UXMA 2GNOA 1UDXA 3H2YA 2UVQA 3PCRB 2G0TA 5JWOA 2JLZA 4EKDA 1SHZA 3LAWA 3W8RA 3MFYA 3CBQA 3K0CA 2BCJQ 4D25A 1D9ZA 4BGDA 2CL7X 1J8YF 2AN9A 1Z6YA 3WMEA 2IK8A 2UZIR 2Z43A 3VNUA 1UM8A 1BO6A 3AF4A 4NCJA 5FR1A 4JJKA 4D6PA 3C8UA 1SKYE 1GRRA 4IDPA 4KV9A 4MITA 1OSNA 2F43A 4Q4JB 4RCYA 1Q1QA 2ZR0A 1G4UR 3VR5A 1UPTA 2ECKA 2DWQA 2HJVA 3I5YA 1OT3A 4CEHB 1R7RA 4EQ6B 2WMNB 1MT0A 2GCOB 3GLHE 4OK6A 5DE3A 1UEJA 3CPHA 4ON9A 5M04A 3L0OA 4D4LA 3PEWA 3BGWA 4P33A 2VHQA 1JI0A 3X1WA 3PEYA 2Y8EA 2VP0A 1XD2A 4I81A 4KSBA 4JLVA 2HLDA 2N42A 2HF8A 3OAAD 3SC3A 4O2LA 3HP1A 2ZRFA 4LJ9A 4URUR 4WAUA 3THYA 4YLGA 4PTLA 3GEHA 3GFOA 2ZE8A 4XSHA 1G3RA 1SVLA 2NQ2C 4XVUA 2C9CA 4A92A 4QM7A 2CEAA 2H17A 2ATXA 1NL3A 5C4GB 2RCNA 2FSIA 3KKQA 3LBIA 3RS7A 4QKQA 3SJAA 1GUAA 4DKXA 1E6CA 2OEPA 3QSYA 1NBME 3IUYA 3GJ4A 1T0HB 5FFMA 4M22A 1ESNA 1NN3A 2GAAA 3W8NA 1NVXQ 4QGAA 3HYTA 3IO3A 5C1BA 1NSFA 3EC1A 4BZXA 1S9DA 2ONJA 5KYKA 2O0HA 4PAQA 2QAGB 1ZRHA 4RKFA 1LV7A 2IXFA 2VIIA 2J0VA 3DM5A 4L16A 4JLBA 5TDHA 3TQFA 5C4MA 4YC7A 1SXJC 3VHXA 3EX7C 3UK6A 3BD9A 3MWYW 3FOZA 4CEHA 2GKSA 4EQ6A 1FX0B 2JA1A 3WNBA 2AXPA 2H16A 3BXZA 3TVDA 1OB5A 2F55A 4LZZA 3SBEA 1SKQA 3I1FA 1COWD 3QXXA 1G8YA 5E7MA 1GZSA 1Q57A 3BERA 3UWKA 4B3BA 4OI1A 3KFVA 2JCSA 3ND9A 4RD4A 4R2HA 2ZR9A 3F5FA 3BFKA 1OE0A 1LNZA 3VKHA 1SULA 2H57A 4A6PA 1GITA 1XMIA 1DG1G 5DI9A 1JB1A 1KSFX 1EK0A 1FTNA 2J46A 3T61A 3L0IB 5HR5A 1E0AA 4ASUA 3L0SA 4L8GA 3GJ5A 1E2MA 2JIZA 2HCJB 1LTQA 1SVSA 1NG9A 3SYLA 1A2BA 3N2IA 1E2KA 1TF7A 1NVVR 1W0KA 2O0KA 4A15A 3HYRA 1KI4A 3QF4B 1IN5A 1AGRA 2QAGA 4GSYA 3WRXC 2KI5A 1OH5A 4OHYA 3ASYA 2PCJA 1GKUB 2OBLA 4JZKA 1OIXA 2Z4RA 3AV0B 3FWYA 4PPFA 2JASA 2BVNA 1KK0A 2WOOA 4LYFA 4RVCA 4UJ5A 2D7DA 5L3SA 3ZLJA 1MO4A 3CZPA 1FX0A 2IS4A 3GLFB 4DDTA 4JLJA 4L5BA 4US0R 3AF2A 3MLEA 5FOWA 5IT5A 2OBMA 5B58C 2IT1A 3R9IA 4NCHA 4EUNA 3VAAA 4B3XA 1I4LD 4M9ZA 2WKRA 3RLFA 2GF0A 3AF3A 3U44B 4URYR 1NMZA 4PPGA 3UMFA 5EE9A 2ZE5A 3Q5EA 1ZUHA 2G77B 3SN6A 1XXHE 4QJ5A 4YXWD 1Q20A 1QHYA 3LQRA 1N5JA 3SYKA 1E79D 5BN5A 2NO1A 4QHYA 3CO5A 5AK0A 3LLUA 1E1QA 4B3DA 2V1XA 2RB4A 4FMCB 1M7BA 1TEVA 1G16A 4Q00A 5EE0A 4R9UC 1ZW6A 4GNKA 1JR3D 3FB4A 1CJKC 2Z83A 4OQFA 3TBKA 5BQ5A 2ANBA 1E98A 3PUZA 4PSKA 1XTQA 3QF4A 3KXLA 2QN6A 1N2CE 2W2TA 3A58B 3MD0A 2JJ2A 3TNFA 3RSLA 4BEJA 4GP6A 5DHFA 2H18A 4ZKDA 1TUIA 1WA5A 4A0GA 3SEAA 4DSNA 2ZRNA 2IHBA 4F4IA 3GLFA 5FOVA 2JJ1A 1KKMA 1JXMA 2JAQA 2WWWA 4FWIB 4BLQA 4ERNA 4AKHA 1SXJB 5CK5A 3G5UA 4K81B 2IYYA 4MKIA 4TT3A 1XTSA 2GDJA 3GP8A 5G41A 3SR0A 5C2JB 2ZSBA 3U44A 2QUZA 4XOIA 3T34A 1LY1A 2OM2A 1G3UA 1DBSA 3B13B 2XB2A 4GL2A 1P75A 2CK3D 2ODNA 4PO1A 5DIFA 2HF9A 2PEZA 3O8CA 3W3AA 2WVJA 1N6LA 3CX8A 3L43A 2A78A 2EWWA 4TL6A 4TMWA 4BFWA 4OHVA 1IY1A 1KI2A 4PO8A 1II9A 2FOLA 5FPTA 1P2SA 2QU8A 3K8YA 2XB4A 2WMOB 3BH0A 2VP5A 1U98A 1YJ5A 3A4NA 3PITA 3BC1A 3T1QA 1XEXA 4L4UA 4MKGA 3NDBB 1XEFA 5BXQC 3AKCA 3EPJA 4IOJA 2J7PA 4MGKR 2CHQA 5H68A 1FNNA 4E22A 2HYDA 4PR0A 4RD1A 4V02A 1Q1EA 3U7GA 1JECA 3CF0A 1XTJA 1F2TB 121PA 3Q7QA 5HE8A 2CVHA 721PA 2A5YB 2IWRA 2V6IA 3BRWD 1AGPA 3I92A 1YZLA 3HR7A 5JS8A 4IRUB 3REGA 3V4RA 5A4JA 1XDBA 2PT7A 4HB4A 2Q21A 4HLUA 2F9LA 2W0MA 1C9KA 2EW1A 4BFXA 4LHWA 2F1HA 4WVFA 5TB5A 5KUTA 1Z6GA 4RD3A 3R7WA 4BPBA 3RC3A 1X3SA 5FI0B 1N25A 1W44A 3KZ1E 2DBYA 4ZCMA 3BAFA 1JEDA 2Q9AA 1E9CA 2AHOA 5EP2A 2D2EA 2FN4A 2R9VA 2QGZA 1X1SA 5JWRA 2ZRHA 2VEDA 5J40A 1Z2CA 4M1SA 4J0QA 4C2UA 4Q7MB 1U9IA 3W34A 2I1VB 2G88A 3CW2A 3TK1A 1QRAA 5H1YA 1RZ3A 2BEJA 1RFLA 2H8KA 2VQSA 5FPYA 1Z47A 1P2TA 2LCFA 4PC2A 3RVBA 1IXZA 2FPLA 2A30A 5FOXA 5SZJA 2X2EA 1E9DA 2ZRLA 1FFHA 1F2TA 1W36B 1SVKA 3KJEA 1Z6XA 2D3WA 3TE6A 3AM1A 4TYQA 1P9NA 2DY1A 3BB4A 2QRNA 1B23P 4A36A 2FE4A 1IJEA 1S3GA 3P1JA 1Q3TA 2FSHA 1W0JA 2G1JA 4BFTA 2WICA 3B8HA 1FL9A 1YQTA 4QL3A 4XTRA 5J4HA 3H86A 2LKDA 1QHHB 4F92B 4PSVA 4AG6A 2AK3A 3U7FB 1BS1A 2ODBA 2VPPA 3QEOA 3CRVA 5P21A 3R8FA 1EG7A 2C77A 1BMFA 4V0ME 4MRNA 5JHGB 2P6RA 2LKCA 2R6DA 3EWAA 1G8GA 4Q9IA 5CDFA 3CIOA 1EFCA 1P4SA 2P6UA 3K0SA 3ADBA 3ZJYA 1AS3A 4DSTA 5GJBA 4B73A 1XPUA 2X2FA 4QOSA 1G64A 4PC7A 4G0NA 5FBVB 5KU1A 1E96A 2XOKD 2OAP1 4UXHA 2I1QA 1VIYA 2CBZA 2IF2A 1NKSA 3MWLA 3MWJA 4QNMA 5LB2A 3SHFA 3TW4A 4KCGA 1KYIA 3L8ZA 1KO8A 4NCIA 3SQWA 1MO3A 2PL3A 1G5RA 2YKGA 4TN1A 3NTUA 4CEIA 2QT1A 5EUMA 4CZ2A 2VP4A 1OV4A 2FJUA 1KSJA 4DB4A 5E7IA 4S35A 2O8EB 2BBWA 2ZROA 1CJVC 3ADKA 5GJCA 2O5VA 4XIGS 1E3MA 5FUWA 2ORVA 3KJGA 4JYCA 3NWJA 3QPVA 1E2PA 5LD2C 3MCAA 4IOMA 3RWOA 4JBWA 4JVLA 3LY5A 3HU2A 3W6PA 3K70B 1NVUQ 2YJTD 4FCWA 4QBGB 1MO6A 3LA6A 1T5LA 5FR2A 4C0QC 4LJ5A 1ANKA 3KDSE 4M1WA 3OFNA 1S96A 1XJCA 4KHZA 5G3ZA 3T35A 5SZIA 1DADA 2NO0A 2GEVA 2GCPA 5IDVA 3THWA 3QKRA 4TLAA 2IYXA 4OHZA 2IEZA 1KNXA 5EQTA 1ZAKA 2DFLA 1N0UA 1TU3A 3WBJA 3QVVA 1FNMA 1GIAA 1E9AA 1P9WA 2WPDA 3GQBA 4OQXA 4ZV4A 1G17A 2FMXA 3BS4A 5FBWB 4AI6A 3W9YA 4FMDB 2VRWA 3FKSA 4M1MA 4Q7KA 3NEJA 3WP1B 2XEXA 2GJSA 1W4BA 3KQHA 2O8EA 3KKPA 1KI9A 2IYVA 3I5XA 1HTWA 5IK2D 4OL0A 1QVRA 2XZOA 3SNHA 1XCGB 4BZQA 3H4MA 1YZTA 4B6FA 3K09A 3AVXA 2IS1A 1UKEA 4G5QA 1Z0JA 5KO2A 1HE1C 4LJYA 1E2FA 4TTPA 2PMDA 4Q9HA 3AVUA 3BK7A 5JBQA 2QNRA 4L15A 4M1KA 1CIPA 1MOZA 3B1WA 5KHOC 3EA0A 1Q1BA 4DLTA 3PUWA 4JLOA 1YZGA 1UKZA 1KO1A 4TQUS 1NP6A 2WAYA 5J4KA 1E0KA 1T91A 1M2OB 1KY3A 1EWRA 1QZXA 2WJJA 2WWHA 1OIVA 3P20A 5L3RA 4EPRA 1XU4A 2FEMA 1S3SA 2VL7A 2C04A 2C78A 4UNNA 3IQWA 2EWVA 1VCOA 2GAOA 1OHHA 1G7RA 1DG3A 1KJZA 1W4RA 2ASEA 2BDTA 4C0JA 3OF5A 2B8WA 3J81k 1NY6A 3BFVA 1N6RA 5LBIA 3GPLA 3WNDA 5FBQB 2EU8A 3TSWA 4IXNA 4TYYA 2P0EA 3U3OA 1RKBA 4IHQA 5BN4A 4MH0R 1XWIA 2C9YA 5KSZA 2WSMA 1U8ZA 2QROA 1IJFA 3OEED 4WZAE
chains in the Genus database with same CATH superfamily
1KMQA 4C6TB 2IEBA 2VAVA 3JWPA 1TMOA 5H5JA 4EB6A 3H1AA 2FQ1A 3A2KA 3VYWA 5FUXA 3RYHA 5FTMA 1TFRA 3NJRA 2XXJA 5HYVA 1Y5RA 4U6QA 2O9JA 4IQ0A 4I5GA 1OILA 5E2AA 2OFXA 4XPIB 2I99A 3BPSA 3ANSA 3H5NA 2CDNA 4EVQA 1XOIA 3VAZA 3L5KA 5AVXA 1CVRA 3RO7A 2LZ0A 3AEKA 2G4CA 1AK1A 1QLHA 2YC4C 2VT7A 4DDUA 3CF2A 2DHQA 3SX4A 3ZV4A 3BFXA 1T34A 3EDRA 1I8TA 1W87A 2CSXA 1SKUA 4CM5A 4JQOA 1W1WA 3HABA 3RBAA 1XT6A 4W5RA 3F6EX 4HL6A 4NECA 2XYRA 4LHYA 3CZ5A 4MP3A 4ESEA 2GEJA 1MFPA 1R4AA 4DBLC 4K03A 4M86A 4LRWA 4O2AB 3AL3A 3FYDA 3VI3B 1PR0A 5ESWA 4LFCB 3BA1A 2J5BA 2A94A 5DVZA 4L7QA 4N9WA 1TCUA 2WV9A 2O57A 3JSAA 1V0JA 2LIVA 3IAFA 1VJRA 4FNGA 1F6WA 1I3MA 2QXYA 4KOAA 2ZSAA 1GNTA 4D46A 1A9RA 4D96A 4UDNA 2OHJA 4RPKA 3BHIA 5BXYA 1NQTA 1G21B 2RG7A 2FQWA 2B5OA 2VDMB 4L0QA 2W2KB 4OU5A 4A23A 4CVNA 4V03A 3ADCA 5FOQA 4OGKA 4D3SA 1L4YA 1P1IA 3PB3A 1IWBB 4KXWA 1GADO 1FU8A 3SZRA 5SY4A 2O54A 3ANXA 2YCBA 5IUNC 1BKSB 1KVTA 1NGSA 1UXGA 4J1TC 2VTDA 3STXA 3IEIA 1D8AA 2JD2A 2QL5A 4YBRA 5DIZA 1ZGGA 3VGPA 3WJAA 4C89A 3IO5A 4HLQB 2GRJA 3ZTWA 1PZFA 3VUEA 1T9HA 1WF6A 5BV8A 1SQGA 1EE1A 2X7HA 2ZYUX 4OJMX 1SUPA 4FLMA 2YWEA 1QONA 3F49S 3KHKA 2XCOA 3A6ZA 4NBSA 2ONCA 2QSJA 1CERA 2BPOA 3R5TA 3WYNA 2Y0CA 5H82A 4DRXA 1TKRA 1QHXA 3AEQB 4HGRA 3V48A 1TCVA 4Q05A 4RIIA 1YB1A 2W98A 4RLHA 3UJDA 4YYEA 5JPDA 4G1UC 2CE2X 3SBOA 2XQIA 1HLFA 1DEAA 3LECA 1C8VB 1FSGA 4RM2A 3SDBA 2R65A 2IUTA 1IQPA 2RKWA 2GPYA 1QHGA 1KI7A 1M1UA 1LS1A 4URXR 1SU7A 3DV0A 3RU3A 3U3MA 1QTIA 3ZY4A 1K5DA 3N5KA 4L28A 2BI7A 5JS7A 2FDXA 2ZQ5A 3KR0A 1OPXA 2WF8A 3HHEA 4MKXA 3RUCA 5LYYA 2DPXA 5DLQC 5KWJA 1ZJJA 3DMGA 4IWNA 2PKXA 4OHBA 4FMDF 4D9JA 4R8RA 3DDSA 2JJ1D 2P41A 2XUQA 2H1CA 3OU2A 4P3YA 4NXMB 3I23A 1RQLA 2YN4A 3UCXA 1H3FA 3PSAA 1M1ZA 1X1EA 3V7UA 5DNYB 1I4OA 1ZU4A 2XQKA 2FZEA 2D06A 3ONVA 5DLDA 4N49A 4C0BA 1J2TA 2CLFB 3MERA 4YAIA 5IF9A 2HQRA 2GH1A 5L8VA 3D6UA 2NPIA 4Y7CA 2OCKA 1JAYA 4LCJA 3OZRA 4GPEA 4HWRA 1ADJA 3DV9A 4H7HA 5SYNA 2YQ4A 4Z86A 1GR1A 1WKBA 4LOKA 1Y3FE 2P4UA 4JLNA 1RRCA 2AR9A 2I6FA 3Q7EA 5LYJB 1XPOA 3REOA 1JXAA 3N8HA 4IJ6A 2AI2A 2R00C 5C1IA 3QKSB 5B1SA 4Z4HA 1T29A 3COWA 5H7XA 5TPWA 1PWZA 4TTTS 3ZWCA 2VDRB 1E9FA 4I4TA 1QFMA 3BZBA 2PNJA 3FUWA 1A95A 4G26A 4UM8B 1M2EA 4NL4H 1GRQA 1EP1B 1GNLA 1U4SA 1XWWA 1FYVA 4B1FA 4D26A 3ZGNA 4FONA 2NVOA 4G67A 2QTVA 3AB8A 3FPEA 1RIFA 1CUZA 3DLIA 3ULKA 3JQ8B 1EUZA 2IUSA 2OVFA 2QLLA 2C54A 2VPXA 3MRVA 5B2ZA 4YMSA 1DZ3A 3BMNA 3A3PA 4DXAA 4CR8A 5F3WB 1UPUA 2D1FA 4F1KA 1XMPA 1VC2A 4RZUA 1MZPA 3EAGA 4AZ3B 2PT5A 4BJ1A 4PN7A 1TPZA 1A7UA 3WOVA 3OPYI 4TKUB 3B82A 1EFPA 3C3EA 2F48A 4OUDA 4S0XA 1BRTA 3HV0A 1H8ED 5IWCA 3QVOA 2MMGA 1XRJA 1Z5NA 4RV4A 1YJBA 1JHDA 1EPUA 5DWVA 1DIHA 1DARA 2ONJA 3TPZA 4C4ZA 3KKZA 1XHLA 1GZUA 4HPWA 2R8EA 2HHLA 3WNCA 1QYRA 1X1QA 4PBRA 2GEKA 4OX9Y 4BO6A 3HWRA 4I3FA 5KYUB 1X42A 3MT8A 3VZQA 3FIJA 4W63A 3WISA 1OASA 2ADFA 3CPJB 3I8OA 1SAYA 1VIMA 2XVXA 4Q66C 3SZLA 1SPBS 2QENA 4CFSA 1V5GA 2FKAA 3COVA 3DHWC 4ZDKA 4DZRA 4P0PB 3HCDA 2B2XA 4X9XA 4UE2A 5J4YA 1Y98A 4D0SA 2XITA 4INJA 3NOXA 2X5NA 2D0DA 2C20A 2VJQA 3DHVA 3KBOA 3QEMB 4DDVA 3MJFA 1Z39A 1RYMA 3CR3C 4UMVA 1Z8FA 4TXJA 4UMFA 1LW6E 4MQEB 1E4EA 4OGFA 1TM2A 2CLLB 4CT5A 4IUCS 1JALA 4EHNA 5A4FS 4RA6B 5E6SA 3V7WA 4QPCA 2NYVA 4B44A 1V95A 1N9ZA 3R5SA 2ISSD 3QWBA 1WWKA 2Z5VA 5TGDA 3K9CA 2WYUA 3NBYC 4YMUA 3SM9A 2HXGA 3OC0A 3OQJA 3DQQA 4UNQA 4FOLA 3T5TA 3TIVA 5IHPA 3EEFA 3A6JA 2N47A 4U4AA 1Z75A 3UV7A 6PFKA 4KKXB 1LBQA 2E49A 5IJ9A 4KR7A 1D2MA 4XD2A 3Q3EA 4EJMA 2CLDX 2EZ9A 5HCIA 2ZI4A 3FZEA 5JT1A 5JO9A 2ZS9A 4WLFA 3DAHA 4BX0A 1XELA 2IEAA 4Q4JA 5FA5A 2H2IA 2HI0A 2F9MA 2HREA 3GA5A 5K45A 2F1JA 1AT1A 5E2IA 1L5YA 3K8ZA 1H0SA 4B34A 3FYUA 5CHEA 3I6IA 4ZHQB 3UATA 2MHCA 5I4CA 3EPLA 4YRFA 2RH8A 2GCOA 5HNKA 2JGRA 2YQZA 4RY9A 2VJMA 2FRDC 3LYAA 4RVFA 4NH0A 1KDVA 3GPIA 1D4AA 3LHKA 5DYNA 4HJXA 1GG2A 1RCTE 3FUTA 1E1CA 4QSHA 4HNHA 4KZPA 2GCEA 4QJ4A 3RIMA 2OBYA 3N2KB 5FNVB 1R0BA 2VSOA 3IJ5A 4EBFA 2PUEA 1UEIA 1MG0A 3FAKA 1E1MA 3N0VA 3NBFA 1VHQA 3DZJA 4UCQA 3KYDA 4UHEA 2YJ3A 4RTRA 1RKXA 4NOLA 3AGPA 2E37A 5E0KB 5JLJA 4DDWA 1C7QA 1SHKA 3MWDA 3RRNA 2YINC 2AN1A 2ET6A 3Q5DA 4O1IA 1BN6A 3NRBA 4XUCA 4JL8A 3LC2O 4DBZA 4FR2A 1KU0A 2QAJA 2A9FA 3JQGB 4BDSA 2ZT5A 5MN6A 2EIXA 3COZA 3KOOA 4NKRA 2ZAOA 5K8TA 4A8HA 4QBKA 2HW8A 4RKEA 4HEQA 4UTNA 1OQAA 4J7UA 5KYWB 3ESZA 3S8MA 1N3BA 3NQ41 3X1XA 3OP4A 2HA5A 1NJFA 3FW1A 3NPMA 1UM9A 5C7OO 5IXSA 4YCAA 1EK5A 4IWYA 3U4GA 2AFVA 3VNAA 2C97A 3OCWA 2EF0A 4OHPA 2R2GA 2FG6C 4HB3A 3N5CA 4RZIA 1R1DA 3GH3A 3V8PA 1M6HA 3E22B 3B6EA 4OI2A 2FWAA 1O94A 3M6XA 1K86A 2Z5FA 3SS8A 4DB2A 2O59A 1VLHA 3KSZO 1Z15A 4ARAA 5KNBA 3OUUA 4D98A 2IOYA 1KQGA 3UUEA 2CNWA 4KB5A 3JWJA 4U2KA 3CG0A 4TMXA 1P3JA 3LWBA 3ZHCA 4N12A 4LC0A 3NNDA 2PLRA 2I9PA 5TQVA 3EVEA 5FAXA 1X14A 4GQBA 5T6MA 5DNCA 3FNIA 2BEKA 1SC3A 1UDBA 3FN4A 3RI3A 3UGKA 1S01A 1YACA 3MJ4A 3UMJA 4I1PA 4KZKA 2O8BA 2X1VA 5ALJA 4LYEA 1H66A 3A1FA 4P7KA 1X87A 4LVNA 5EUBA 2PQ6A 4MGEA 2Q6TA 5GONA 3CLUD 3F6SA 1A9SA 3PUHA 4DCSA 1V8FA 2IYQA 2XUFA 3P32A 3RS5A 4HNGA 1XRNA 2L0XA 3N6XA 3O8NA 1I2BA 1V9CA 4B3IA 2C2WA 2UVPB 2Z9BA 1L5QA 2J59A 4XFJA 4QYIA 4BVLA 1O5OA 1XCJA 2FMHA 4GSKA 1T3LA 2MINB 2OHXA 3MF4A 2REOA 2GZSA 3BTOA 1Y3HA 3KYJB 3O5AA 3WGJA 1N1GA 3LCJA 4BEWA 3V1TC 1UFRA 2DQZA 2WE8A 1ZH6A 3QEJA 3QLUA 4RVHA 1LI7A 1W93A 3RFVA 1BDIA 2QG9A 3IV9A 4L0DA 4PHGA 3A4LA 1QG6A 3IP3A 1UXHA 2MSLA 4D57A 1Z4OA 1DJMA 1EG2A 3B1VA 5AKLA 4ZO7A 1M74A 2PMKA 4M87A 4NESA 3KZXA 4EJSB 5ED4A 1E2UA 2XMSA 2Q3JA 1F4PA 1WP9A 3H7IA 3HYNA 2AJLI 2OAQ1 2NYRA 1FSPA 4RWZA 1PLJA 3C85A 2EOAA 4LE2A 4LV6A 4MXDA 4ND5A 3EF0A 4RD0A 4IILA 1L7PA 1MJ5A 2EJWA 4NMWA 1AIPA 2PTGA 2ZVQX 3N86A 2NZ2A 3AJ8A 5DULA 3VZRA 5AVWA 5I5EA 3ERCA 4D42A 5BW8A 1I3OA 4P5PA 4IOKA 4EH1A 4MQ5A 1USUA 2KPOA 5BPFA 3DXYA 1XA3A 1R8YA 2R8YA 3JARA 4LUCA 1GKYA 2F1OA 3F8SA 3LIIA 5GIOE 1ZSNA 5E9WA 1P2GA 4ZCTA 2VRCA 3CKLA 2ZRAA 2QBYB 3RVKA 3VC1A 1S9HA 2NU6B 5TQ0A 1NATA 3R8XA 3ZU2A 1QRSA 3L6CA 5C7LO 2Y1OA 1SBQA 1N4DA 3ZIAD 1IY2A 1C3VA 1JIXA 4J0DA 3SCZA 3Q15C 1QC5B 3LUFA 1OI7A 3OEHA 2CHGA 3NAGA 1PFVA 3OM1A 4N5MA 1WMBA 4UHKA 3BMQB 4CKBB 1AXEA 1G20E 2XE6A 2FFJA 3W3ZB 4RLSA 2ZE7A 4WFQA 1E9EA 1FB5A 5L7TA 1T5SA 1U0LA 1SUIA 4PCAA 4QEZA 4D74A 5KJ1A 3EGCA 5E3HA 3AI3A 3L7LA 2VP6A 1H6DA 1Z4JA 1XRSB 3X3HA 1DKNA 1U1FA 3WHLA 4PCVA 1SXJA 3TM5A 4CTMA 3QVGA 1HT1E 3R4VA 1AURA 3IVXA 2JFZA 1EFHA 5KJCA 1PNOA 1W4CA 1CS0A 1SUCA 1IAQA 1X7XB 1CCWA 5K3DA 5KREA 1GL3A 4M8LA 1YD7A 2W2NA 4Q6BA 4KPYA 3VOBA 4DIFA 3HZHA 4WDRA 1EXWA 2PMWB 2YJGA 1XDDA 3DWIA 1M7HA 2CDBA 1AKEA 1MT3A 1U2GC 2CEKA 2W6IA 1E59A 1NLMA 3B3GA 3D1VA 5TEWA 3UCEA 1EVIA 1M1YB 3EQ7A 1M2JA 4FDAA 4TZKA 1PF7E 3TW6A 1NNI1 1VJTA 4MCAA 3ZX4A 4EX7A 3DTYA 4MVJP 2RD2A 3C1UA 1D8TA 3AEUA 3TQOA 5F2KA 1JPUA 2OC4A 3D6NB 2PKQO 5A1JA 9ATCA 4RENA 1G8KA 3WGGA 1X7YB 2JBHA 5AK6A 4LY3A 4Z0TA 4EF4A 1UDRA 3CJRA 1P1RA 4GOXA 4G8BA 2IQ5A 1VLQA 4MKHA 3B7PA 5ICMA 5AW0A 2DJIA 4DSAA 3I05A 2GVZC 4JCCA 3PXCX 1Y7LA 1FOEB 1R5BA 2WM2A 3OE4A 3X1JA 5IBCA 2P75A 1AB6A 4W9NA 1ZP6A 3K2IA 2FMKA 2YNMD 2HN9A 1YE8A 1JT9A 1H2EA 1NDQA 1FPQA 1H2RS 3MT0A 4HX5A 1YB4A 5CT6A 4NMXB 2AKEA 1L5RA 2O48X 1C29B 1V4VA 1WL8A 2P35A 4UMEA 3SJBA 3VPHA 3WRXA 5INTA 2I4IA 1BXGA 1L7AA 3NYQA 1NIJA 1KO4A 3P2YA 1GQQA 1THTA 2J07A 2VHJA 3OAAA 5D1HA 4Z7QB 1AHPA 2QVYX 2RK4A 1TKAA 1X7GA 3FLMA 1OX4B 1E7YA 1FUKA 3TE7A 3R9KA 5EJGA 3HDQA 4M7OA 4DCVA 4C3UA 4I3GA 5ALGA 1GY8A 2RGDA 3RJ9A 4JBHA 2WJ4A 1II8B 2HU7A 1C0LA 5KSYA 3PICA 1V48A 4G1BA 3OWXA 4BLPA 2N46A 4HYEA 3WL8A 2KQUA 4TMVA 6GPBA 5ICFA 2B1JA 2OD2A 1UKAA 3LFUA 1R8XA 2ZSIA 4HDRB 1IXRC 2Z1MA 3DBRA 1QCCA 4C0WA 1SG9A 2H07A 2G25A 1NVBA 4MPDA 4MLPA 4R9VA 5CK4A 1RZRA 3NVKI 3BORA 2I6TA 3KBBA 1HKUA 2C8JA 2D1TA 3BGSA 4B32A 1A0OA 3R5KA 821PA 3A28A 4QVKA 3A25A 2XIJA 4KACA 4AMGA 2WZCA 1V35A 4DF3A 1IIBA 2FEXA 2RHWA 4G0PA 3O9MA 3A2MA 5EL0A 3CUEF 4OFXA 4NE7A 1KHHA 4EPXA 4OXNA 2NXWA 4OCZA 4NMLA 3KU4A 4PGFA 3PQEA 4LKOA 2QJRA 4ZVMA 1ODTC 4GR4A 3UPDA 4FLEA 1O6BA 1RYYA 1NF9A 1UZLA 2DUJA 3H5VA 4N0PA 4WXEA 2LDYA 4ZZ0A 3ZVMA 3DAFA 1RXSA 4P35A 1T2DA 4ED9A 1SVMA 1Y3BE 1A8HA 1XL1A 1PZHA 3LX8A 3WK8A 3C16C 3STWA 2I4NA 2DAPA 2JIDA 3ZGYA 3DPSA 2RHGB 3IMKA 5ICCA 1PLKA 3CNLA 3SKVA 2Z6UA 2C61A 2YHIA 3CH6A 1JSZA 2C2YA 3KL2A 1QHHA 1MJFA 2SKCA 5D3QA 1E1RA 1ZM4A 2JFXA 2R5NA 5TGTA 2OCYC 1N6IA 1P5ZB 3OPXA 1KEKA 2W6JD 1A4UA 1LX7A 3DMNA 1E89A 3IP5A 4FZ5A 4BRWA 5AVZA 1G6HA 1EQ2A 2YOHA 4Q3OA 4E1BA 3WYFA 1LDMA 5FWYB 3INYA 1Y1RA 1SVIA 1P1JA 3VTFA 2AOTA 3UO8B 4P7GA 4HDQB 1PNRA 1UFVA 2ODAA 1AS2A 3RG2A 2RE8A 3GT7A 2JIBA 5KYTA 1ZCBA 3DP9A 1AUVA 2B7LA 2WTXA 4EB3A 2Q1TA 3KX2A 2GN0A 5ENVA 3I5UA 2OQIA 4MPTA 4ND8A 4DLRA 5A3RA 3ESBA 5CVUA 1JILA 4LYDA 3W7AA 4FCVA 4BNWA 2XPCA 2XMDA 2ZQZA 1XJWA 1U3TA 4I8IA 4EG1A 3M3DA 3IGFA 3EGOA 2XMQA 3CN9A 1HRDA 3AY6A 2BZSA 1T3TA 4ZZ3A 2I3DA 2IXDA 4IOLA 1G8MA 3WRWA 3WWEA 1DIBA 3N87A 2BISA 1P2UA 5JSYA 2DR2A 1Z7BA 3AFMA 1V4NA 2JLYA 3G8BA 1T2EA 1G3QA 4REQA 5EE5B 2CXTA 4XYGA 1WY7A 5L7YA 4KGVA 5F1YA 1A76A 4EYEA 3PJEA 3KAPA 4CV0A 3E84A 1QYDA 3KLPX 3OHPA 2QX7A 4WASA 4C76A 3B8EA 4B81A 5EP3A 4L3VA 2XCIA 3ACDA 2P5TB 3K71B 5KVQA 3Q3GE 2ZIVB 5LZ2A 5AI0A 3ORRA 2IPOA 4EZEA 3D43A 4EBBA 2CJYA 2AFHA 2XUJA 1UKVY 3JXEA 3ZK8A 5GVSA 5I6DA 3O95A 2BCEA 3NYWA 4UVHA 1ZIYA 2ZR8A 5EHGA 2ZDHA 4N6OA 2H3HA 5ITZA 1K8YB 3HV2A 4PS1A 4Y8VA 5H8WA 2QTBA 4PLZA 4L85A 2GWRA 2Y1LA 3OICA 3CB4A 4Z54A 1SN7A 2CB0A 3DL7A 4X85A 5AUOB 1KDZA 1AK9A 5BUSA 2CXXA 2OZEA 1B2RA 2RAUA 1RAEA 1M1NA 2ZZNA 1VGVA 1DC6A 1JP7A 3DEFA 4U63A 3W5HA 4I1RA 4BNLA 3ZDAA 5T8KA 3AMVA 3GHYA 1ND6A 4U9IS 4K6FA 4WGFA 4KP7A 4XDYA 4BO8A 4QJIA 3WV5A 1WQ3A 3TWOA 1H65A 4IDFA 3DR3A 4C6HA 3LSTA 3ESAA 1I1NA 1Q14A 2J85A 4UTRA 3NIBA 1W2HA 1I14A 5HKKA 2PKQP 3LYUA 4J43A 4O02B 4YTEA 3STUA 4HMPA 1DU4A 1F8YA 4MKZA 3DHEA 3U1BA 4UM5A 5GWXA 2P79A 3DEHA 1T0IA 2BGLA 4BO7A 3DTVA 2ZYDA 4DA0A 2ERYA 3ROFA 5JZVA 3RSGA 2DLCX 1YGYA 1DAOA 2XWBF 3DC7A 3RJMA 3GJ3A 1QKKA 1ZNZA 3AL2A 4IICA 4F3RA 1NPYA 2WIJA 3AR8A 5A9SB 1NLFA 3AZQA 3I1YA 1WCXA 1IXSB 2HMAA 1BS9A 5FL7D 2ZSJA 2D0IA 1ZEMA 5CX4A 1X77A 3I2IA 1WM1A 3WIOA 5F35A 1XNJA 3O73A 4G0QA 5LA6B 2ZRCA 5H80A 3LO8A 3FFXA 1SXIA 3HKDA 3U6KA 4ZVLA 1QP7A 4RTSA 2GD2A 3TKLA 5AW3A 4NF2A 5LBUA 4EIWA 1I7LA 2VDOB 4AICA 4KVGA 3WGZA 1LH0A 3O4JA 1TQ4A 4LBWA 2OR3A 1FTYA 2A67A 4NAHA 2AN4A 4Q9DA 4B9EA 4KGZA 4LQ4A 1EUDA 3DMHA 4RPHA 3KEMA 2YIDA 3B1FA 3EG9A 4Z99A 1W0KD 4JYBA 5SYAA 5IH7A 1L4UA 1XVLA 2ATEA 5TJHA 5KZMB 4HO1X 5MHTA 5HDBB 2GEUA 3B7GA 4F3CA 3PRYA 4G37A 4ZI3A 1ZEJA 3EQ2A 3AOEA 3T1TA 1ENOA 3LVRE 3QLVC 5BR4A 3ZDDA 2AWNA 2B37A 4FHGA 2UUOA 3K35A 1J0XO 1JR2A 3HXKA 3LGSA 1VSBA 5BV2P 3H3FA 3CNOA 1CJSA 2FUCA 5D87A 4Z3DA 4BCCA 3OOYA 2Q3EA 3N53A 1E2EA 4Y2VA 1JBEA 3KZOA 3T7CA 1A1SA 3L92A 4I50B 1RLMA 1LW7A 1E69A 3EFBA 3GRAA 1XRMA 1U0NA 3BSWA 3GWGA 4LGMA 3I6ZA 1H23A 4ONEA 4OJYA 4XPIA 3RBXA 2B4KA 3KYBA 4BMYA 4Q48A 4KAXA 1YK0A 4GLFA 1SJ9A 2PL1A 2AVDA 4PE5B 1SOWA 3OOJA 1KP2A 4GP7A 3STYA 2BH2A 2H0AA 3SICE 1T24A 4M9XA 3OOEA 1Y3DE 4PHCA 4IKPA 4RF2A 3W8EA 5IFKA 2BZ0A 3G0OA 5DHQA 3MTDA 3PHIA 5A7HA 1R16A 2OL4A 1MOPA 3C6YA 1MENA 3LDAA 3RS4A 5SY9A 2UUCB 1XNGA 2WFAA 1NSYA 1V1JA 3EDYA 2ECPA 5ALRA 1B15A 3P9PA 5LMNB 4J2TA 1JW9B 2GB4A 3EWSA 4AO8A 2QUKA 2AYXA 2P9TA 4ZYVA 4O2AA 5JBNA 3LHFA 1F1BA 4PLGA 4EA6A 5B55A 3JQAD 2ID9A 1L5WA 5DN6D 1OH6A 4II7A 3FUCA 4DANA 5KHLB 5ALOA 4RDHA 4EJ2A 5DPMA 5ARCA 2PX0A 3O3CA 3TX2A 1TM4E 3HB0A 1FP4B 3R5FA 2Y66A 4IF4A 1FDWA 3KXKA 2AS0A 4WBNB 1DC5A 2ZIXB 3RS0A 5AK4A 4ZVPA 3H42B 2F3TA 3WICA 3ZTYA 3MWGA 3ZNNA 2ZSDA 3FF4A 3U7EB 5HUQA 4JB0A 3UUGA 1NDHA 3LRPA 4ZOQI 1XXLA 1FFYA 3OU6A 1DOAA 4B6PA 2BV3A 3IDAA 4XLTA 3ZS9A 3DMDA 1I1OA 3UB4A 1NT2A 3E61A 2TS1A 4B7CA 1Y0BA 2A9PA 4BB6A 2AW3A 4TT3D 3OD1A 3BQNB 4KAJA 2GLTA 1D6JA 1VJCA 1T2VA 1AY0A 1M75A 3RANA 1NOKA 1ZZGA 3NHYA 2W6MA 1XDGA 4HS4A 1U1IA 4FYXA 4G8CA 2VUSA 3A9SA 1CRZA 4WMLA 2WOJA 4WZ6A 4ZO4A 3AG6A 2QMUA 1M8GA 4GHWA 5LSAA 4TLBA 2O7NA 3P26A 2UDPA 4M21A 1KZ6A 2FFQA 2JZNA 4O3FA 2HM7A 2Q0SA 1ZOPA 1NDUA 3FX2A 1UQUA 3KUCA 4UPVA 3UT0A 1AQIA 2BZ1A 1PJRA 3FHTA 4U6NA 4A2CA 1S2OA 4HT3B 1S2IA 2BUAA 3HRHA 3PXXA 3N28A 1ZQ9A 4NVRA 3T7JA 2A5JA 1WMSA 1WXGA 1IUKA 3KM0A 3TEJA 3CV3A 2FU5C 3DCJA 2HRDA 4LOJA 2PV0A 1Q7BA 3P45A 3ROPA 3RC7A 3UAZA 2GX6A 4MR8A 2BMAA 4S24A 1A88A 1U0SY 1APBA 2YV3A 1J2UA 3U3KA 2BONA 1G60A 2B92A 2EKLA 2GESA 2R1VA 1D4OA 4N6GA 1YQXA 4UFNA 4PN3A 4B3MB 1XD2B 4LN1A 1AE1A 2I3AA 4MVJI 4K6HA 1ECJA 4AW9A 1D1QA 1OLOA 1GNPA 1HYGA 1IMOA 1U81A 3EIOA 3TZCA 2Z2JA 2XJ4A 2QPOA 3BSYA 2FXVA 1A9TA 2HU5A 3VH4A 3MRXA 1CUBA 2AG1A 3KEFA 1J21A 4KXYA 4ZYYA 1VPVA 1BYIA 1J8MF 1Y8CA 2AF3C 3TN7A 3V9PA 4ERXA 1PQ4A 3GIDA 3KR9A 2WU0A 3MTGA 3MXTA 3MNFA 4INZA 4JLSA 2CF6A 4PYKA 3VFDA 4JHLA 2Q4OA 1U0BB 1IB0A 1N2ZA 2QW1A 2WWRA 2OILA 1UFKA 4EPYA 2PMFA 5K0FA 5A04A 4YHHB 2PRKA 3L4EA 1WAMA 3QKSA 4OGGA 2BMDA 3D8SA 2XHZA 4WNYA 4WESA 3NTQA 4HYTA 4V2IA 4MP8A 5L3ZA 3LOUA 5HKBA 2OCXA 1EGQA 3T6KA 2ECFA 1M66A 2HNAA 2JFQA 4BFVA 4Z1MD 3N8KA 5U1PA 2N1BA 4ZD6A 1SU6A 3BH7A 2WM9B 3ONNA 2WWTA 2FUG1 4I19A 4MKRA 5KSWB 1CZHA 3ISJA 1FIUA 3A6FA 2ZWIA 4TROA 1PGNA 5JU6A 3WGHA 1JWLA 1YZKA 4OHCA 4D5GA 3AF1A 4AS1A 1V45E 5JE8A 2CVOA 3ZI7A 4DNFA 4Q47A 2QN3A 5JNRA 1MABB 1VGQA 4M1TA 3RYFB 1QMPA 3H87A 4BGUA 5JDCC 1UR5A 1E8DA 1HNXB 2IYPA 2JH8A 3DMPA 4LG1A 4LMPA 4R98A 2AG5A 3FGOA 2DP4E 3NJ8A 3G9UA 3SQNA 4AZ3A 4CW7A 4N7MA 4EG6A 5AUQA 4B84A 2QUJA 4BQPA 3K4QA 4PANA 4MR7B 1N57A 1S8FA 3RR2A 3HUEA 4G9GA 3JD3A 4HKTA 2H1SA 4QC2A 4R8MA 4PQFA 4KQHA 5KU7A 2G04A 4QO7A 2W6QA 3FMOB 3LY9A 3P0HA 3RS3A 2FNAA 1TO1E 3DLTA 4EG5A 3MOGA 2JLWA 4O4LB 1UT6A 1X9HA 2NV2B 3B3AA 3MW8A 5BQ3A 4QXAA 2A57A 1ZJWA 4J0CA 1IOLA 2C98A 3I1JA 4HQFA 3I9JA 3T7SA 5FAKA 1R4MB 1GTMA 4PZUA 1T3GA 4RXMA 5BW4A 2AE1A 1XQ9A 1RWQA 3OY2A 1AMNA 1X1AA 3RQIA 2ARKA 2NU8A 5KB3A 4IFEA 3C39A 2CL0X 1B7GO 4KIUA 1BMFD 2XT6A 1NVMB 2ZCUA 1U3UA 2QE6A 1MOSA 2QJFA 2QMHA 4UQOA 4IDHA 4BZZA 1ZMOA 4RWEA 4KFTA 5EWLB 4IVRA 4UPDA 4LMBA 3RE1A 4PYOA 2FW6A 5IH3A 2I7CA 4EMBA 2ORIA 4GL4A 1S1CA 1OH7A 1A9ZA 2GT1A 1UOOA 3IDFA 1N2BA 3FTPA 1S2MA 5FOSA 4ZTUB 3AY3A 3HUTA 2Q0HA 1UBLS 3VPAA 4F1WA 3ELUA 4M7PA 3UWSA 3FOFC 3OEEA 5G0TA 4FFWA 4GZMA 5K0TA 5KNCA 4X1IA 4L4XA 1ILEA 4YRAA 3AKDA 2D13A 3RTDA 3GLHB 4L50A 2Q62A 5IKMA 1NC1A 1XQ1A 4ECAA 1HFEL 4BAUA 3CLRC 4RGBA 1Z0FA 1FSFA 2B7CA 4IV8A 2F1RA 1EAYA 2Q5HA 4MYHA 1L6RA 4RJKA 1AKQA 1QZZA 2R1UA 3OHMA 5E9AA 4BBJA 4DMKA 1LBSA 3UWOA 4PNHA 3ST7A 5H3HA 2PWYA 4AZVA 2AW5A 2WYVA 1QUEA 4KH1A 4TL8A 3N8IA 4EJ6A 5H3LA 1TJYA 4W6QA 3QWHA 3PC3A 3A37A 5CM8B 5HG0A 5BNWA 4YJ3F 1V43A 1OFUA 2OAEA 4LXUA 3AHEA 3C3CA 3IQDB 4PHTA 1BW9B 1G7TA 3KELA 1QR6A 5BSHA 3FNEA 5I45A 1JFSA 3U5TA 3BMOA 2WEKA 1F8GA 3CUVA 2WUWE 3H9GA 2OFOA 5IW8A 2IZ1A 2OWEA 2AZXA 2ZANA 3UPUA 1B8OA 3WSVA 3OQPA 1E3SA 3DLHA 3JAWB 2PH5A 3FCYA 1UMCB 2ZRIA 2WVHA 3N2KA 5FNVA 5IVDA 2GHIA 3V1KA 3QF7A 1DL5A 1RYZA 1O87A 3CNQS 4JIMA 4LTMA 5CH8A 3S40A 2QK4A 2ZW9A 1L5VA 3FYTA 1EB9A 3QA3E 4N48A 1UBOS 4WJKB 2VP2A 3EZ2A 1NC3A 4PCUA 5K8UA 1HDRA 1XTRA 1YDHA 1ZLYA 2XZPA 4Q9LA 4YP9A 4DDMA 5JZMA 3LF1A 1BA2A 1AC5A 2QPTA 2JLCA 2XB8A 5DBIA 2GO1A 3CZ4A 4NZ9A 1KRWA 2XMCA 1CXZA 2YV2A 3GDGA 1OH8A 1JHVA 4NCNA 1K9VF 1HY3A 3VVCA 2CFSA 4AY5A 5EXTA 2HK9A 1XEWX 4D9HA 4BY9E 3EUFA 1QHNA 1RAHA 5FUBA 1HXHA 1GZ7A 1VB5A 2ILVA 4OOFA 3ZU5A 5G3YA 3AYZB 3U17A 4ALIA 2HSZA 1CQPA 4XH9B 2VKQA 4M8NE 1GA1A 1M8FA 2GF9A 3LMKA 5EKTA 5CFOA 1N2IA 2DKOA 3GU3A 1ZCAA 4U7JA 4MUGA 1EVJA 1Y4DE 4OD0A 3A26A 3K70D 3IPYA 4YWJA 3A6KA 3ADDA 3KXIA 4UMDA 3GG2A 3DZCA 1H1TA 5CYGA 1AV7A 1YAJA 2XZDA 5KTSA 5BSKA 1KEUA 4RLFA 3PFHA 3ETJA 1M2HA 2EJUA 3HS3A 4G0XA 4OI4A 1XEXB 1VKJA 5EP1A 2ZUTA 4L08A 4F86A 2EJCA 4RQAA 3KS9A 4RQBA 4ZYUA 2ZYTX 3CISA 2PU7A 2DBVO 2NM0A 1OA0A 3G0IA 2P9CA 3FOWA 4PVCA 3TRJA 4NOMA 1DC8A 3PHLA 1ZVQA 1SHUX 1TZ2A 3I2FA 2BSXA 4PPQA 3L7NA 1CUWA 4DQXA 5DBFA 1ESDA 1Z5WA 4JASB 1J4AA 1OHHD 3HKCB 3M8KA 1EDZA 1NXPA 1V16B 2AMYA 1U0HC 4I7EA 4EITA 4F4JA 4LC1A 5LQMA 4JFRA 1VPTA 2GBLA 2BJWA 4ZZIA 4D56A 1WBDA 4DIMA 3GAZA 2C29D 1F2VA 2XTZA 4NS4A 3DFZA 3T95A 1JQJC 4BE4A 5A5DA 1TLLA 1Y3IA 3RAPR 1OFVA 3UNXA 3OJFA 4DSZA 3IODA 521PA 4EKNB 4V0LA 1KZHA 2R79A 1L0BA 3GA7A 1LEHA 1ZL2A 3HU5A 4LJLA 1B8PA 3C7CB 3TDKA 3R7WB 2R6FA 3B89A 3TOCA 2Q5FA 1IRIA 1THZA 4RGQA 3PD7A 1AG9A 2ANCA 2DE0X 4CEJB 4BU0A 5HFAA 4G5FA 2A33A 1ZI8A 4E1VA 5EUCA 3WTCA 1GCOA 3RRXA 2F4NA 3NHSA 1WZ2A 3DW3X 1K2VN 1MJGA 1Z35A 4NZPA 3QX7A 4Q93A 5F78A 3STTA 3ZE7A 2ZM5A 2BBOA 2PE5A 2QUAA 3QU9A 4KO4S 3E70C 3CLSC 2I2BA 2WFZA 3N2GB 4L22A 3WLKX 5HZHA 5I9IA 5K0ZA 1B93A 4EJSA 5F64A 4KTVE 2FVYA 4LJSA 4QU0A 1KZ9A 5I8ZA 4EW2A 2J3JA 2QYSA 2QRHA 3ROKA 1J42A 2ZKIA 1F3LA 5AJZA 4I0WB 4IR7A 4ZYTA 3WLOA 2XA2A 3LPCA 1CV2A 5JXJA 4RMIA 4XX0B 4PIVA 1A8PA 4OGWA 2O7VA 3I01M 4DJTA 3QVJA 1CTQA 4LI3X 4OATA 1SQSA 2EFJA 5DK6A 1FMTA 4Q7JB 3VZSA 2V5AA 3L2OB 2BELA 4FOOA 1OC4A 4EY6A 1H8EA 5ADWA 1KZ4A 1Z73A 2G67A 1J1UA 2PKCA 3U7JA 2OQRA 4W9MC 3HY3A 2Q1XA 2BFEB 2R7MA 4L75A 4YP0A 2Z5GA 3RHTA 1IL0A 2FZVA 2EX1A 2NU6A 4RV5A 3LCUA 2NO7A 4TUYA 3QEAZ 1KARA 3VISA 2Y77A 1XZNA 2ZREA 1QH8B 1QC5A 2NGRA 3F4BA 3VA7A 1IBKB 2P30A 3RUPA 1RHMA 1VI2A 3QEKA 1P9LA 1JQ3A 4JVSB 3TQIA 4FD2A 4CKBA 5MGNA 1UCFA 3V4SA 2GZ1A 3CA8A 1T43A 3GNTA 2C95A 2QPAA 4N65A 3RARA 4GLBA 1R12A 1A82A 4B47A 3ZD7A 4KR2A 3LVBA 5THXA 1BA3A 3VU9A 3HB5X 2QKYA 3ME5A 4IJ5A 5JSZB 2XVAA 2YH2A 2IV2X 3KQUA 2AD5A 3ILYA 3BSFA 3R6GA 1PR2A 1XF1A 1VG1A 5LLSA 2C92A 1R9GA 5JHHB 1ITZA 1IZ9A 1U1EA 4GPTA 4XPZA 3IR5A 4BLSA 3K31A 3PFGA 1ZI6A 2GJ4A 3CNNA 3BE5A 3BRSA 2ENWA 2QQ0A 5CITA 5KQGA 1F2DA 1CK4A 2NO6A 1EHCA 2QZJA 4GMKA 1C9NA 2C2MA 2JGJA 3W79A 4CEIB 3RHFA 1DC4A 1N2CA 3N7UA 4UDXX 4AB1A 1M6VB 2J6HA 1JHMA 4CLDA 4P83A 3U61B 2A5GA 1PGQA 5LB4A 1V6CA 1P0FA 3SJZA 4NPHA 4MW6A 1X7YA 1Y80A 2PZJA 4M7WA 1A9PA 3OZBA 3PHBE 3RRYA 3W2EA 1VPEA 2BP7B 3W6NA 3X1YA 3Q7SA 5JAOA 2COEA 2NZXA 5KJEA 2GZHA 1N0WA 3L49A 4WV3A 1H8HD