2ZR0A

Msreca-q196e mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
316
Chain Sequence
b'APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINELRETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 96
structure length 316
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr0A01
3T06B 2FZLA 5HR5A 2Z5FA 2DHRA 1D2EA 4HAVA 1ZCBA 4I99A 1T4GA 5DIFA 4YMTA 3QG5A 1TX4B 2WPDD 1GDDA 1KDOA 4OQNA 4DCSA 3FOZA 4BFUA 3A8TA 2XTMA 1G3RA 2ZRGA 3D6TB 3UMFA 5BWMA 2HT1A 3R7WB 2IYVA 3SFVA 2A5DA 4LJ6A 1IN5A 4Q9LA 4FW9A 3THWA 5IK2A 5JFGA 5ANRB 1EWRA 2AKAB 2GJAA 4HB0A 5KHOC 4I81A 1E69A 5B2ZA 1KSJA 2RGGA 2NG1A 4RD6A 3TAUA 3EX7C 3EZFA 1TMKA 4LHYA 2D3WA 2C2HA 4PO1A 2IEYA 1T6NA 2H16A 3NG1A 2QMUA 3U3KA 1DAHA 4EDHA 4KV9A 4Z1MD 1Z6XA 2ZRMA 2QEQA 2A5YB 4PHFA 2GJSA 4MQBA 1OIWA 1GRNA 2P6RA 1NVVQ 5L3VA 4HDOB 2ZJ8A 1F2UA 1E2DA 1KK2A 3LLUA 4GOJA 4KFUA 5CITA 1VYVA 2GETA 4FMCB 1HQYE 4CEIB 1UKZA 4PZLA 3KZ1E 1FPMA 2IYSA 1U0HC 1W4AA 2V54A 4LZZA 4M1KA 2JEOA 1YZNA 1ZM3A 1NBMA 2G9NA 3GLIB 3S1AA 4PR0A 2ATXA 2ZS9A 4L5BA 3RAPR 1CR2A 3T5DA 2XJ4A 4RD2A 4TWZA 3LVQE 4ZO4A 2EFDB 5JWRA 4BFTA 5FBLB 3C16C 1Q1EA 2WZQA 1Y63A 1U8ZA 3SYLA 3PFIA 2VEDA 2AX4A 2GWHA 2ZSEA 5H68A 4A8JB 4NBSA 2FGKA 4KXFB 2GJ9A 2RAPA 4P33A 1M6NA 5EE9A 4DLRA 3I1FA 2O52A 1M74A 2B92A 2WVJA 121PA 1P3JA 3A4MA 4JLJA 1JPJA 2QG6A 4MRRA 4DEXA 4DKXA 5JMTA 4DWJA 4JLOA 2J0UB 1PJRA 2J41A 1R5OA 1T0HB 4F92B 3U6BA 2O8EB 3EWAA 5SZKB 3H2YA 2IS1A 3K70B 3U4QA 5KU1A 2XZPA 2F43B 2W2XA 3CF6R 4QGGA 1MO5A 3D31A 2JJ1A 2FN4A 1NJFA 1ZD8A 1N3BA 3U5ZB 1UKVY 4OQMA 4RVCA 4Q5IA 1YR8A 5BN4A 1DEKA 3DKPA 2V1XA 3AV0B 4QOSA 3CH4B 1TADA 4NONA 5EP3A 1QZXA 3H86A 3OFNA 2GJ8A 2OO7A 2GKSA 3K09A 2B7BA 3TH5A 1DAMA 3FHCB 2VSOA 1RKBA 2C9OA 1U9IA 3EW9A 3C15C 4LYHA 2XJ9A 3BB3A 1G17A 3CNNA 5B58C 1S9DA 2KBEA 5FPYA 1Z28A 2ZU0C 4QBGB 4QBFA 3EC2A 2VHUA 4BRUA 1F3OA 3G0HA 4M0LA 2ZS7A 2V3CC 1YRBA 1J8YF 5JRJA 1SXJE 2ZVPX 2YOFA 4Q4JB 1DAFA 2R6FA 3VHXA 4CW7A 2FX3A 1HA3A 3LBHA 2HUPA 2EFEB 2YWGA 2FGJA 2VL7A 3AP2A 5GJBA 3NTUA 3FMOB 4DHEA 3PV0A 4Q1FA 3L0OA 4HUTA 4A4DA 2ZRLA 2VRWA 1R2QA 2QM7A 2J3EA 3IILA 5CK5A 4B3GA 3DPUA 5FR2A 1XTQA 3IEUA 3ONWA 1EFTA 1YZLA 2QQ0A 5BW8A 3EIEA 4AWXA 3BWDD 3EPJA 4GP7A 1QHGA 4FMCF 2PJZA 3GJ7A 4UJ5A 1FUUA 5JI3E 4I1UA 2XSZD 1T8TA 4MDFA 3HU2A 3TRFA 2QMHA 2F1RA 5CJPA 4KVGA 4XWOA 4R7ZA 4LBVA 3TGPA 1JR6A 2F1JA 2ZM5A 4WZAE 4RZ3A 1SHZA 2J9RA 1DBSA 3O47A 1GTVA 4B74A 2IYWA 5AWFC 5D3MB 4A0RA 1W4RA 5JS7A 1YJ5A 3TR0A 6Q21A 2VYFA 2CNWD 4HAYA 4XD7D 1P2VA 4IW3B 1PUIA 3VTKA 3EAQA 3VFDA 2Q9BA 3LW7A 4LHWA 2ONKA 1PUJA 2ORIA 1UBCA 1TEVA 3W34A 2CCGA 3ZDQA 3CPHA 1JR3E 1AZSC 2F7SA 2AKYA 2QROA 5CIWA 2E87A 1JPNA 1Z2AA 2CHVA 3EA0A 2CCKA 3D3QA 1AA3A 2V8OA 2IXEA 3T35A 4W5HA 4FD2A 1YE8A 1CJUC 5FI0B 2GCPA 3CRW1 4YMSA 2QP4A 1W7AA 4X8HA 1M2OB 1WCV1 4C7OB 4Q1BA 2P5SA 4PX9A 4KVAA 4GMDA 3M4YA 1KNXA 4WXPA 3IQWA 3VR6A 1NLFA 1XCMA 4AURA 3BFVA 1JI0A 3ZVMA 4PAOA 3TSZA 4HAWA 3VKWA 4B3BA 3IQXA 4NCJA 2QZ4A 4NH0A 1AQUA 1TAGA 4QNRA 4W7SA 2RGNC 3CRVA 3QNUA 4KFSA 3Q5EA 3RSOA 1M34E 3HU1A 5JI2E 3SEAA 1US8B 2G0NA 1FX0B 2PCLA 4MYCA 5GJWC 4E07A 5J4VA 3HYTA 5E4FA 4AKGA 3OEHA 4AY2A 1A2BA 4G5SA 2JGNA 5JECA 3AF2A 3BH0A 4OHWA 2QNRA 2J1LA 1E1RA 4W5JA 4ARZA 5UKDA 3RC3A 2PH1A 2OXRA 4NCKA 1FTSA 3TW8B 1KAGA 3A1TA 1R5NA 4V0LA 2PX0A 4IJMA 3SJAA 2W2VA 1Z6AA 3L43A 5FL3A 3V9PA 5KDDA 2WJYA 2W6IA 4C0LA 1G5PA 3KKPA 4RFSA 1IN6A 5EXTA 1D9ZA 1M1YE 1KI4A 3TMKA 3R20A 2BC9A 1EK0A 1ZM4A 1OF1A 2PZEA 4C0BA 2UZ3A 2IC5A 3ICEA 3OAAD 2QSYA 3WRYC 2JIZA 2XNDA 1N6OA 4PC7A 4Q9JA 5H8WA 2AL7A 3LD9A 4TQ9A 4JL6A 2AR7A 3CRMA 3KJHA 1IOZA 5AJVB 3SBDA 1OV4A 3JVUA 4B76A 1NNEA 3BS4A 2FFQA 2Q3MA 2HXYA 4DUGA 2GEDA 1EGAA 1HH4A 3QIAA 4OJQA 2D62A 3H4MA 4WAUA 2ZROA 5C1BA 1AK2A 1PZNA 2IYTA 1GOTA 3NDBB 3CUEF 3NBZC 2XTNA 3GJ4A 3WHLA 2Z6VA 3P4XA 3OHMA 4RD1A 3VU9A 4ZCMA 2J46A 1ZVQA 2RB4A 1XXHA 3CWQA 2PEYA 4GNKA 4H1VA 3QJYA 3RRMA 2EYQA 2OBMA 1IN8A 1L4UA 3Q8XB 3REFA 2W83A 1GRRA 3A36A 4OQXA 4BEBA 1KHTA 2GJKA 3RC8A 1II8A 2G3YA 1KI9A 1P62B 2WIBA 4PPGA 3PUZA 3RSLA 2K5UA 1JAIA 4IVQA 5K8TA 2EFHB 4V0NA 4ZIRA 4JYCA 2D06A 1J99A 3B7GA 3GJ6A 4D0LB 5AUPB 4QHSA 1KJWA 1ZINA 4Q7LA 1BO6A 1IBRA 1KAOA 3B6EA 3BK7A 3WNBA 3I62A 4TT3D 1NY6A 1DOAA 4URYR 1P7CA 4TMVA 4TYQA 4QBHA 4UNPA 5J5CA 1ZD9A 3LNCA 4G5OA 1YZQA 1DAEA 1I4LD 1UKYA 4LJ8A 4M9SA 4A82A 3ZZ0A 5CB6A 1Z0AA 2JLQA 4C2TA 2F3TA 1NVWQ 5FUVA 5G3ZA 2QPAA 4QG7A 4B73A 4LYJA 5JJIA 2YWHA 4DDVA 1G7RA 1LS1A 1N6NA 2QRZA 1ZAKA 4HLUA 3SC3A 2R8RA 1BYIA 1E0SA 1XWIA 4KAXA 4YC7A 2GRJA 2P3SA 4TLCA 2E9SA 4OHZA 3A58B 3MMPA 1D9XA 3EXAA 5DGXA 3SN6A 1CIPA 1NVXQ 3SNHA 1A2KC 3RHFA 5FFMA 4DB4A 3QF4B 1CJVC 3F0TA 3LQQA 3SJCA 1WBDA 5JRZA 5JHHB 5GADl 3K0SA 3GEEA 2XGJA 3MWKA 4DT1A 2QSZA 1I2DA 1TU4A 5EE0A 3W6NA 1JNYA 5G40A 3PUVA 1MT0A 1W49A 2RGAA 3DZDA 1RPZA 4MGYR 4WXRA 4G1UC 4C0HA 3DOFA 4KYIB 5FPKA 2O8FB 2FZ4A 4LPSA 4OI0A 3ZZTA 1DTSA 1PV4A 3W5IA 4JKYA 2QBYA 3UPUA 3R9XA 5LB2A 2ZI7A 5C18A 2ZYTX 4IVPA 2G88A 3K9LA 1Q1ZA 3EZ2A 5G3YA 2ZI6A 3P1JA 1G4UR 5SZIA 3U7EB 3WNCA 1NRJB 1U0LA 2NGRA 3JVVA 3IEVA 4ZDJA 4LBZA 1G8HA 2ZYWX 3P20A 4PFSA 1COWA 2NO1A 1UBEA 2FF7A 1W0JA 2H1LA 1GSIA 3GJ8A 1VMAA 1AA9A 2XOKA 5FL7A 3TLXA 4DLZA 3O8RA 3FKQA 1CTQA 1RJ9B 3KQUA 5FUXA 4NYJR 3I72A 5E3HA 3CF2A 1KI1A 4G0NA 3UG6A 1VYUA 4Q03A 4PZYA 2RHDA 3BB4A 4UXHA 2QP9X 2J7PD 4NTZA 3U60B 2O8BB 5JBQA 4U02A 1CF4A 2VF8A 4E22A 4KFTA 3SOPA 1G8GA 1XMSA 1JR3D 2DYKA 1YZUA 4XWAA 1Z47A 4ZKEA 4IDQA 1E9FA 3IIKA 2NTYC 1G4AE 2O0HA 2CVFA 4S35A 4PZZA 2DPXA 4A1FA 5JS8A 2NO9A 5LD2B 1R0WA 3AUXA 2GK6A 4A0GA 4B44A 3N5CA 3I5XA 5B30A 3KB2A 3LXXA 5DI9A 1MRSA 4B48A 2LKCA 3O8DA 2BEJA 1J2JA 1H65A 1N2CE 2PX3A 1N5IA 5IDVA 4CT5A 2VTKA 3RLFA 3EC1A 1DS6A 5KTYA 2V9PA 1E2HA 4CIDA 3AVXA 1ZUNB 1Z22A 2ZS8A 4WA7A 1AIPA 4Q7JB 2EU8A 1DG1G 1CP2A 2YWEA 2Z83A 1J7KA 5DYGA 1EXMA 4D2IA 1ZW6A 2ZE6A 3IBGA 2GVZC 2NO0A 3GPLA 2JASA 2ZQ5A 3IKJA 1ZNXA 1DAGA 3L0IB 4P3YA 1W4BA 4B2LA 5EQTA 2H18A 3NH6A 4DXAA 2B6HA 2WAYA 4BFSA 4RKEA 1G16A 5HCNA 4TMTA 1OH6A 1DELA 1JECA 5AUNB 3VR3A 3LY5A 4EQ6B 4O2RA 4PQFA 1YZKA 3O8BA 3W3ZB 4C0AC 2RKOA 1Q3HA 1MH1A 3A1SA 4DVGA 1WB9A 3PXGA 3AM1A 2ZANA 1WE2A 2XZOA 3E5HA 2REOA 1IXSB 2OCPA 2G1JA 1E2QA 4TLEA 1JEDA 1K6MA 4HAXA 4C30A 4MRPA 4A6XA 5FI1B 3PR1A 1XTRA 2IUUA 1LV7A 3IO5A 1E2LA 4GOKA 4JLAA 3TQFA 3VR1A 1CEEA 2BWJA 2KWIA 3PUWA 2OFXA 4LRWA 1E2KA 1A1VA 3GLHB 1VIYA 3AP1A 4TLDA 1VG9B 3G82C 2V7QA 4LSGA 2O8CA 1QHIA 3PEWA 4HLDA 2ZEJA 2QAGC 4M8NE 5JWHA 2IT1A 3AVVA 2IS4A 1NF3A 1TF5A 1MABB 4JVNA 3UXMA 4YMUA 1SVOA 4DSNA 4B3CA 1EG7A 1OSNA 3QI2A 5EZ6B 1P2SA 2ZU6A 3AKDA 4YDHB 3WP1B 1W2HA 3PUYA 2ZUBA 3NEYA 4KHZA 2ZUDA 3FKSA 1E32A 3VX4A 4TTQA 3KQKA 5CB8A 4OBEA 5EZ5A 2JCSA 3KXKA 3MAAC 4MITA 4DB2A 4HYYA 5EP1A 3RVBA 3FTQA 2HV8A 3WYFA 1S2MA 5JLJA 3GLFA 3BXZA 4OI2A 1ZNYA 2F3RA 1UJ2A 2GAAA 2RHMA 4D6PA 3DVLA 1FP7A 4O3MA 1ZYUA 2BMEA 5KOYA 2QE7D 4JT2A 3THYA 2A3RA 2CVHA 4F4JA 3PIRA 1H8ED 2O0KA 2WPDA 3W9YA 5BYKA 2IXFA 3THXB 3W90A 1WA5A 4HAUA 1AN0A 2FSGA 2G77B 1EFRD 1GL7A 3CZQA 4EJSB 3NBXX 5AUOB 1OYWA 2H8KA 3TVDA 1GG2A 4QM7A 2ZJ5A 1CXZA 1R8QA 3DDCA 3OE7D 2GF0A 3HPQA 1K8RA 1P60A 3NHAA 1NN0A 2C98A 3EIHA 4DDUA 1ESNA 4MRNA 2FU5C 2HT6A 3H0KA 4URZR 3A1WA 5J47A 4NP6A 1XD9A 2XAUA 4BFXA 4YXWD 2CMKA 4FMDB 1G1MA 3OIUA 4HZUB 4Z1MA 1CRPA 3I92A 3WHKA 2JLRA 4FCWA 4AKEA 4MKGA 1TPZA 2DBYA 4DDTA 4DJTA 4ZPXA 3ZS8A 4O2LA 1GKYA 3LBIA 5KNDA 3K9GA 1SKYE 4KSBA 3TJZA 1AS3A 2EFCB 3SI7A 2JATA 5DI3A 1RYFA 2I4IA 4DLVA 1W0KD 2QUZA 4OI1A 8OHMA 1UDWA 3TUZC 4HLQB 1PLKA 2CE7A 1OHHA 3QKSB 3C8UA 4RSGA 1TQ6A 3SZRA 1Z6YA 1KZ7B 3HWSA 2FSIA 2WMOB 3TK1A 1ZRHA 1Z8FA 5E7MA 3QXJA 2ZRFA 4GZMA 1ZIPA 1BOFA 4LOAA 3N2IA 1QG2A 2ZUCA 4M9XA 4BPBA 2C95A 2QMEA 3GP8A 1YKSA 4YLGA 3PG5A 2EWWA 4HUQB 2WWXA 2R65A 3F8TA 3VAAA 1IXRC 3AB3A 2BOVA 4ZI3A 3IPYA 4Q7KA 4QM6A 2AXNA 4KBGA 4DSOA 5CDFE 2ANBA 3NBFA 1CU1A 3A1VA 1XMVA 1L7VC 4ZKDA 1RVDA 4GT1A 4P4SB 4TMXA 1KSFX 5DN6A 1OXSC 2EWVA 4DIDA 3GCGA 3WXMA 3K8YA 4OQFA 3A1UA 2GVDC 4HATA 1WF3A 2YOHA 5KSPA 3SHWA 1DE0A 1UKEA 2VH5R 2B8TA 2OHFA 4OK6A 2P0EA 2I1VB 1XRJA 2FA9A 5HKKD 2FSHA 2BBWA 1P9NA 1N6KA 2WIAA 1T3HA 3X1YA 4JVLA 1UAAA 3WYAA 4KBFA 2DWPA 1II0A 1IHUA 2WWGA 2FNAA 3LDAA 2EW1A 4CEHA 4BEJA 2GA8A 3AGPA 1FQKA 3CRQA 5CYOA 2EVWX 1X1RA 2O8DA 4RY2A 2AD1A 3LWNA 2RGXA 4W5WA 5BQ5A 4MDEA 1HT1E 1T3LA 3BORA 1R5BA 3GEIA 3CPEA 3IUYA 1U8YA 1ELOA 4LYFA 5D3QA 5AJZA 4NL4H 1N5JA 4ZCLA 4ZDKA 2J0QA 2PMDA 2YINC 1E9SA 2CLSA 1KGDA 3IIMA 3C14C 3TIFA 3WRXC 3W3AA 1R8SA 4D25A 2QAGB 1YR9A 1SHKA 3IDQA 5AUQA 1W36C 1XF9A 4IOJA 1F60A 1VCIA 1E2JA 3Q7PA 1VKJA 3FGNA 3KKQA 2QP3A 2J45A 3EIQA 1V43A 4V0ME 2PZFA 3QBVA 5EUQB 3U44B 1IQPA 4O25A 4PSVA 3AF0A 4IRUB 2C9CA 2WJHA 2ZRNA 1E2GA 1HTWA 2JLSA 3K9HA 3GLHE 4M4SA 2CK3D 1JAHA 1I2MA 4D4LA 2L0XA 1MOZA 3SBEA 3T61A 1XEXA 4FMDF 2DY1A 2JA1A 3FB4A 4B33A 4LI0A 1SULA 4JS0A 5IF9A 4MH0R 4BFYA 2C03A 3B60A 4OKSA 2Q21A 4UNSA 4D26A 4IDNA 5FUYA 2F1IA 2OM2A 3LXRA 2RGDA 1GM5A 1EFUA 4PPQA 5DLQC 1E9DA 2BHRA 1G3MA 4KI0A 1Z0IA 3DMNA 3MGCA 3OEED 2OEPA 4AG5A 2I1QA 2XSZA 2RGBA 4A0FA 2YOGA 2FG5A 2OLJA 4A9AA 2FFBA 4N0DA 621PA 1HE1C 4P4UA 3CKLA 4LJAA 5FTMA 1VHTA 4Q4AA 5AJXA 2ODWA 3GQBA 1HV8A 2RGNA 2P5TB 3UATA 4BRWA 3E1SA 1G6HA 2GZDA 2WSSD 4BLRA 4XTRA 421PA 1NIPA 2WOOA 2Y8EA 4NYJQ 3KQLA 4FI3C 1N0WA 2IYUA 3X1ZA 5F98A 3K0FB 5C4GB 3TVTA 2OAP1 1FP6A 2CNWA 4XD7A 2X19A 4ZV4A 3KQNA 4TZ0A 2A2ZA 1N25A 4H9GA 1T3SA 3T1QA 3SE0A 4KFRA 3NDPA 2QMOA 4PHTA 4UNQA 1CRQA 3FFAA 5IK2D 3LO5A 2ZI4A 4TL6A 3BIFA 1XU4A 4V03A 3F3YA 1GNPA 2GCOA 5B64A 1RW4A 3L8ZA 4PANA 4CDGA 1AS0A 4B6FA 4LHVA 3EPKA 3QVVA 3B85A 4BLTA 4LDJA 4M1SA 4Q9IA 2QENA 3LBNA 4N1AA 4F91B 1ZNZA 1CJKC 5DNYB 2E1RA 3W8RA 4QGAA 3RS5A 4Y0AA 5DISB 4Q4HB 1OYYA 3CB4A 3B5JA 1XD2B 3IO3A 1RRFA 1G9XA 5DHFA 3VR2A 4QJ3A 2BKEA 4I1SA 1OFHA 1NBMD 1OW3B 1T0JB 3I61A 2ECKA 2X2FA 1IN4A 4U7DA 2AWNA 2G1KA 2VSFA 1W4CA 4ZDIA 4C0JA 4LUCA 1E2FA 1IAQA 1T8UA 2OUKA 2IYZA 3P4YA 3U7FB 2Q3HA 3B2EA 3CO5A 1MV5A 1VYTA 5HZHA 1G8PA 2WOJA 4YMWA 1Q3TA 5E7IA 2YC2C 4A92A 1H8HD 1JBKA 1E0JA 1CJMA 1U90A 3AVYA 3VKHA 4NMMA 2IHYA 2ZI5A 2ZJAA 3UKDA 1JJ7A 1VG8A 3NHBA 5KDOA 1UBFA 1ZC3A 2ZJ2A 3OIWA 1XXHE 2B21A 3MUFA 2BM0A 4V0KA 2WMNB 4LC1A 2OAQ1 4MRSA 4QC2A 3U2QA 3B1XA 1G64A 1MKYA 1L2TA 3GD7A 2TMKA 4F4CA 5JSZA 3I5YA 1KYIA 2OCBA 4FCTA 4LWZA 3EZ7A 1S4QA 1R10A 2GILA 3OAAA 1Z63A 1F2TB 5DHAA 1P73A 1NY5A 2ZSBA 4Y0VA 2QGNA 1W36B 4LJ9A 4CEJB 3BGWA 4IOLA 5AR1A 1NP6A 3DO6A 3PITA 4KODA 1R4AA 3K0AA 5L3QB 4B2PA 3ZVLA 4Z8XA 4DRZA 2D74A 3WYGA 1KI6B 1E9RA 1RYHA 5FOSA 5BXQC 3GJ0A 2P67A 2GXAA 1Z29A 3A4NA 4X8MA 1E2PA 3GFPA 3OZXA 4Q9HA 5CM9C 4F7WA 2ASEA 5JCPA 4OHXA 1TQ2A 5KNCA 1ZIOA 4JSYA 4OHYA 1RC8A 3O8CA 4ABYA 5AK0A 4AYWA 4B32A 3MCAA 1UF9A 2WJIA 5L3SB 3QENA 4BECA 5KPJA 5BYJA 1MO6A 1Z6TA 1G5TA 1X86B 4HSEA 2CEAA 3Q7QA 2GBLC 2G6BA 3UG7A 1UEJA 2FH5B 3RS3A 1P61B 4ZCIA 4JLVA 1BYUA 1Q57A 4G3XA 4DDWA 1E0KA 5L8VA 2ZRBA 3SYNA 1N6RA 1GKIA 1P5ZB 2HCBA 2EFGA 3AKCA 2NOAA 3GLGB 4TT3A 2CJWB 3CR7A 5J4LA 4MUAA 1S9HA 2J0VA 3KTAA 4JBWA 4PXAA 2ZRIA 521PA 1E94E 5ELXA 4A2WA 1ZU5A 4MKFA 1ONBA 2NZ8A 1S1CA 1XCPA 4CZ2A 2YKGA 1E9CA 2HJGA 3WY9A 4GDFA 5G53C 2IX3A 1XPRA 3ECCA 4RD0A 2GEVA 1Q22A 1HE8B 2OZEA 3QKRA 3SU8A 4ASUA 3BFXA 2XX3A 4B43A 2ERXA 4D81A 3Q9LA 2QA5A 5FTJA 2BMFA 2A5FA 3RS0A 1E79D 4JL8A 2NO6A 2XB4A 1TTTA 1ZUIA 1BKDR 4XOIA 1CR4A 5DE3A 5FUWA 4F38A 5FTKA 3EG5A 3UANA 2XXAA 1SXJA 3LX5A 2Z0MA 4WOPA 1DAKA 2PBRA 3KXIA 1FNNA 4Q21A 1U9IC 2ZE7A 1EFHA 3ZQJA 1OH7A 5LD2C 3KFVA 2ZRDA 5EUMA 3B1ZA 5LBIA 1HURA 2REBA 4DLSA 3B1WA 3SJBA 2WWHA 2EQBA 5FTNA 5FBVB 2Q9CA 4DCNA 1E9BA 1L4YA 4JJKA 1QHHA 2IF0A 3B1VA 1NI3A 1ZMXA 1F6BA 2WHXA 2WJGA 4TL8A 4BE7B 1QRAA 2CL6X 4S2EA 1G7CA 4C4PA 1N6IA 4AC9A 2VLIA 3EZ6A 4AD8A 3SR0A 4ZDWA 4TMZA 2ZREA 1TF2A 2KI5A 2YVUA 2KE5A 2A78A 2CXXA 2R62A 2ZITA 5FBWB 1DAIA 2W6JD 2QI9C 2BVNA 1F48A 4JL5A 2AFHE 1KMHA 4E03A 1C4OA 4JLNA 1KSGA 4C0QC 5JZVA 1G7SA 1KJYA 3LAWA 1SGWA 5CLLA 1W48A 4JBYA 3PEVA 4UNRA 1EWQA 2F55A 2FMXA 3A37A 4X8LA 3KQHA 4P4SA 3THWB 1WMSA 2ZE5A 5DH9A 4N3NA 4DZZA 4XSGA 2D2FA 4WW0A 1YQTA 4DLYA 4ON9A 4EFNA 1FTNA 1E98A 4US0R 1UPTA 3FDIA 3K0CC 4C0KA 1NL3A 3R7WA 2BCGY 5JWOA 2X77A 1PLJA 4TMWA 1RE0A 1VG1A 3OIYA 2BJWA 1KI7A 1JR3A 1LNZA 5JHGB 4B71A 4ITRC 5TXGA 1QG4A 4R71A 2QN6A 3AVWA 1E1RD 2QTFA 4IDPA 1RRCA 1F2UB 1NN5A 5BN5A 5GJCA 5H70A 5JEDA 1KOFA 2UZIR 5DO9A 3NBYC 2W6ID 2N42A 2C77A 5LDDC 3S1AB 1OKKD 2VIIA 3GFTA 3HPRA 4ESVA 2ZTSA 1A7JA 3Q85A 3THOA 3FMPB 3ZVNA 4JVSB 2V6IA 4DCTA 2IUSA 4PPNA 1QVRA 4MGIR 4CEIA 4P4TA 3VR4A 2GF9A 1JXOA 3RRNA 5TV2A 3KFXA 2GXUA 2XNDD 4DLXA 1R0ZA 5FOWA 3GLIA 3U7GA 4GOXA 1KO7A 4JBXA 1HQCA 4NYMR 5HE9A 3BE4A 4M9ZA 4TSFA 4YXWA 2HDNB 4AYTA 4TN1A 4IEEA 1OB5A 4Q9KA 2J87A 5C46F 4ZI2A 4NCHA 4EIWA 1KO5A 1QHXA 1XJ0A 1IM2A 1IONA 3VNVA 2ZE8A 1WBBA 3CH5A 4A8JA 2F1HA 2FV8A 5FOXA 1XPOA 3K9NA 4TLBA 1SKYB 2FSFA 4EJSC 3QKUA 2WKPA 4HAZA 3I8XA 1G21E 2DFLA 4NPHA 1OPXA 1P9RA 3QG1A 4URXR 5KNBA 3U4QB 2OE2A 5G41A 1P75A 4BFVA 4PC3A 4UXIA 2ZR7A 1KO4A 4NCIA 1P6XA 2AFIE 3AP3A 4Q02A 1E1QA 2OCYC 2WWIA 2J0UA 1G291 1JQLB 2J0SA 1D2MA 2FFAA 3R9IA 1AJEA 2O8EA 2R6AA 2F43A 1QHYA 1XTSA 2GXSA 3QSYA 2ZIAA 4NZYA 2D2EA 4TQUS 3FHOA 4IKEA 4W9MC 1NJGA 5FPSA 3X2SA 3ZYCA 1KJZA 1NMXA 2PZGA 3QBTA 1EFCA 3CRRA 4L9SA 3M0EA 1ETUA 2ZSAA 1U0JA 2JDID 3GLGE 2H92A 2RGEA 4RCYA 3R9WA 3Q72A 2JLZA 2H7VA 2J5XA 3NH9A 4QL3A 1WDTA 1OIVA 2V55B 3M6AA 3WBJA 4L16A 2HYIC 4A6PA 2Z4RA 1ZNWA 2REXB 4RZXA 3RS7A 1GWNA 5F9FA 1G18A 1K5DA 4D4MA 1S0UA 1Z07A 3QXCA 1P2UA 2WV9A 3CX8A 3FMIA 3AF3A 1QBKC 2QY9A 4LV8B 4WVFA 3TUJC 2X1VA 2RGCA 3AVPA 3ZIAD 2JLXA 1NKSA 1XX6A 3QVUA 3AGQA 4Q4JA 1N6PA 2C99A 2QE7A 1G5RA 3DM9B 3IHLA 4EPVA 1M7GA 2OFOA 1H8EA 2NO7A 3PJRA 3NEJA 4PTLA 4BZQA 1TQ4A 1DPFA 1EFRA 1QHNA 1EX6A 2W58A 3BBPA 2ZAOA 3ND9A 3PUXA 2ZRAA 2YNMA 3OE7A 2A7QA 2A30A 2BDTA 2W0MA 1DVRA 4MGZR 2FJUA 3HR7A 3U61B 3AVUA 2DWQA 1DARA 3KKOA 2J7KA 4HDQB 1OE0A 5L3RA 5KSOA 1OB2A 4M22A 1A82A 2B8WA 1ZUHA 1OFUX 3A4LA 4RD4A 3X1WA 4C2UA 2CL0X 3QOFA 1GKUB 4Q1EA 1ZM7A 1COWD 1OXXK 3W5JA 4RZ2A 4EKDA 2MMGA 1Q44A 1QDEA 4A2PA 4C9BA 1VPLA 1B0UA 2R6CA 3R8CA 1GNQA 2XOKD 1X6VA 3H1TA 2MSCB 4K81B 3SFZA 1E4VA 1W0KA 4HLUC 4B34A 1S3SA 4M1TA 4NDZA 2BM1A 1G6OA 3C7KA 1IN7A 2VO1A 5D3MA 1KIMA 1XD8A 3SYKA 4NKRA 1CS4C 5CIQA 4Z54A 1CULC 1W47A 2NIPA 2VP4A 3B13B 4RFVA 5CYPA 5HCIA 3GEHA 2OLKA 3ZLJA 1F2TA 4EPTA 2FDCA 4V02A 2R6DA 2CLDX 4IDHA 4HI0E 1GNRA 2SHKA 4BFWA 1QVAA 1RZ3A 1M8PA 1O3YA 3V00A 3AKYA 2Q9AA 3QF7A 4QHTA 4M21A 4X8OA 1XEFA 1HEIA 2IYQA 4BLQA 3LVRE 4HLCA 2IL1A 3P27A 4C7OA 1NBME 5LPNA 3B1YA 2WAXA 1XDBA 4DEYA 1XPUA 2VP5A 1SVIA 2C96A 2WWFA 5L3SA 2G0TA 5HKKA 4TMKA 3ZD6A 2ZJYA 1UADA 3H84A 2AWOA 1Q1BA 2YV5A 4DLUA 3DEFA 4ARZB 1CLUA 2QT1A 4IEIA 3TAHA 4LGMA 2QQEA 3V4FA 2ZVQX 1US8A 1T5IA 2QL6A 3R8FA 1MO3A 1FX0A 4PC1A 3QY0A 4MKHA 3C4JA 2QORA 2VF7A 1C9KA 3WMGA 4GZLA 3DL0A 3KKMA 4KLZA 4RFSB 1ZCAA 1ZD1A 4BZPA 3EPLA 3QXHA 3LLMA 4TYNA 2OV2A 1U8AA 1XEWX 3B9QA 4FIDA 2V6JA 2JJ2D 3OF5A 4LC0A 2IF2A 2ZRCA 2P6NA 4R9UC 1KY3A 1GL6A 1RRPA 2UKDA 3P26A 3TQCA 5CLQA 3AH8A 2RMKA 1W5TA 3TE6A 1KMQA 2LCFA 2ZRKA 2EYUA 2QU8A 4D4KA 3B82A 2WWWA 1GVNB 3LV8A 1PVOA 4D0GA 1KKLA 2IWHA 1HY3A 1X8LA 2WKQA 2KBFA 3TSWA 2CL7X 1G3UA 5C4MA 1W36D 1M7BA 4FMBB 2ZPTX 4QNMA 1TUEA 2CK3A 1OH5A 3N70A 1D2NA 4LJ7A 4DC9A 4NE2A 3C5CA 4Q1AA 1Q1QA 4DSUA 4Z8YA 3VU9B 3FVQA 4JIMA 4JSTA 4M53A 2HYDA 1XXHB 5A5GA 1P2TA 5EXXA 2IYRA 1XTKA 4XVUA 2DFNA 3DKVA 3LW8A 4Z51A 4DCVA 2AHOA 5HPYB 2HJVA 3EPHA 2HLDD 4L15A 1II8B 4LJYA 2OFWA 3U7HB 1FL9A 2BKUA 4ZIRB 3OEEA 3AVOA 3Q5DA 2NPFA 3NKVA 2ERYA 3T1OA 2VHQA 4KJZA 1OXTA 4MGKR 3OESA 1GIAA 1WP9A 4URWR 2WKRA 4BGDA 3BOSA 2OBLA 2WSSA 2VP2A 3TUIC 3ZD7A 3IGFA 1SVSA 3T1VA 3VX3A 4CF7A 4EFLA 2GCNA 1BMFD 3JZAA 4QRHA 1ZBDA 4TTRA 3VNUA 2IXGA 5EJEA 1KI3A 1GUAA 4DLWA 4TL7A 2IEZA 4R2HA 4URUR 4CGZA 3HP1A 1RRGA 1Z0JA 4ACBA 1CBUA 2HF9A 1QHSA 1JJVA 3MWJA 1AKYA 3PEUA 2ZSDA 3L2OB 3TR5A 2FOLA 2WJJA 4PSAA 1Q20A 2N1BA 3BD9A 1AS2A 2OSBA 3I4LA 1E9AA 1VDZA 3DHWC 3LFUA 4DT1B 3U3OA 2ZXUA 4RJLA 2BMJA 5TMPA 1NKTA 1S8FA 4Q47A 2ONJA 4XJXA 5FH9A 4C0SA 3QF4A 3MJHA 5HE8A 2O5VA 2W0SA 2C5LA 3NC0C 2QPOA 4D80A 3T15A 3FYHA 4L4UA 2ZYVX 4GSYA 1OHHD 2VPPA 2QBYB 4AKHA 2VP9A 1PLLA 2Z43A 4FWIB 4NYMQ 2XITA 2DFTA 3SHFA 1Z2CA 3U3JA 1FW6A 4GPTA 4HZIA 1GRQA 1AKEA 4I4LA 1O87A 1NSTA 2O8FA 2IA5A 3BERA 3HU3A 3TSOA 1R7RA 1H8HA 1NN1A 1A5TA 1J8MF 1KDTA 4IOMA 4MYHA 2BCJQ 4MA4A 4RD3A 1GFIA 4MYUA 4NU0A 3T34A 2GBLA 1E6CA 2DB3A 2IS6A 5JEEA 5CM8B 1EESA 3LRPA 4LK2A 5GVRA 2XTZA 3QE0A 2ODBA 5DN6D 1KK1A 1TEXA 4WZBE 1P72A 3VR5A 4AIIA 2WICA 3NXSA 2AN9A 2FE4A 4EPXA 2CE2X 1EX7A 4RCZA 3K0EA 1FQJA 3EZ9A 2JLVA 4M1OA 1NMZA 3QKTA 2OESA 3GJXC 4OJKA 2ZAMA 4L9WA 4E09A 2H5EA 1ZM9A 1K5GA 3GJ5A 4JT4A 1RJ9A 1N0UA 1KI2A 1XBTA 4Q19A 4R2IA 5HZKA 3PEYA 1NLYA 3RDPA 1ZC4A 1TU3A 3ADDA 2C04A 3WNDA 3N2EA 2O8BA 1S1MA 721PA 4LBWA 3MWLA 4OQLA 2PEZA 2ZR0A 3EWSA 1JB1A 4GBMA 2A9KA 1P4SA 4LCBA 2O0JA 1NLZA 4GL2A 5CDFA 2IBMA 4GFDA 4KITB 1KY2A 4IDOA 1NIJA 4TL9A 2CCJA 2QRNA 4MYTA 4PAQA 2AD5A 1V5WA 5CJ2A 5F9HA 4UJ3A 1UBGA 3I3SR 2HCJB 2IUTA 1NG1A 1G20E 1KNQA 1NSFA 5FOVA 4Q00A 4UKDA 3UK6A 2ZRPA 2IYXA 3KDSE 1XMJA 1FUKA 3HYRA 2BBOA 3DOEA 4LX0A 3NWJA 1DG3A 5C2JB 4CYMA 5BN3A 2GAOA 3FMFA 3AQ4A 3T12A 1XB2A 3RNLA 2BIFA 1UEIA 2QT0A 3M1IA 1GILA 4CVNA 3TNFA 1JQJC 821PA 4JZKA 2VSXA 2ZRHA 4P0TA 4B3FX 2R44A 3DM5A 4M1YA 1ZU4A 2WJVA 1S3GA 1TUIA 4JYBA 4D4JA 4K8OA 5FPTA 4JVMA 5JJKA 3BAFA 4U5XA 3ETLA 1P9WA 2OCAA 1W2GA 1UDXA 3BRWD 3HR8A 1TF7A 3NVAA 3HJNA 4OK3A 3CONA 3CX7A 3L0SA 4EQ6A 1G8FA 3MG9A 1HUQA 4HEJA 5AJWA 5H1YA 1L8QA 1E79A 5TB5A 2WSMA 3FPAA 3QPWA 4D82A 1LFDB 2WM9B 5FOTA 3F5FA 4JLPA 1AM4D 3KL4A 2JJ1D 3MRSA 4JLMA 2CHQA 2O8CB 1Z5ZA 2FPKA 4V0MA 2IYYA 2YJTD 4FN5A 4BLPA 4JLDA 3K0CA 2GESA 1JEEA 1HYQA 4V0OA 3LQRA 4TYYA 1SZPA 3CBQA 1KK3A 2WWYA 1KDPA 3GLHA 3NC1C 1XFAA 2CHGA 1XJQA 4II7A 5A4JA 1LF5A 4LHXA 3OFND 4ILEA 1Z06A 1Q12A 4B3DA 5KO2A 1YU9A 1JALA 3AVQA 3BB1A 1MABA 3RYTC 2PL3A 2P6UA 4AI6A 1T9HA 2F6RA 4BLSA 2Q3FA 5J4YA 3KUCA 2PCJA 3KUDA 1SKQA 4BZXA 5KDLA 3QEOA 4GI7A 3GLFB 4F93B 3PQCA 2VHTA 1DO0A 3GMTA 1OFIA 2HF8A 2QTHA 3RWOA 2ZI9A 1HT2E 3LX8A 3THYB 2W6JA 1IJFA 4C3ZA 4M1MA 1KKMA 1LTQA 4Q1CA 3MLEA 3EARA 4QBIA 1VCMA 2J59A 4IFBA 5DYIA 4R98A 1NG9A 3MJRA 4J0QA 3QXXA 3B9PA 3KJEA 5K8UA 4TYPA 4DCUA 5FTLA 2VHJA 4QJ4A 5IRCD 4MUBA 4POAA 1WRBA 2OT3B 3K53A 4UXJA 1VECA 4WZ6A 3VHLB 3GLIE 3THXA 1J70A 3I32A 4TQAA 5EXSA 4KU4A 2VQSA 4EJSA 4M9QA 1VHLA 4DIEA 4WIAA 1MO4A 3SS8A 3PENA 2QAJA 1DO2A 3IBYA 2NZJA 1SVMA 1E4YA 2AK2A 5EXPA 1SVKA 2VP0A 1G7TA 3K09C 1E96A 3RRYA 1KK0A 4HZUA 3UIEA 1XCGB 3GFOA 1KZGB 4JJZA 5DI3B 2I3BA 1W5SA 1WXQA 2YWFA 3REGA 1G41A 1XJCA 2X2EA 3D8BA 1GITA 2PJRA 1OKKA 2FPMA 1X3SA 1LY1A 1E0AA 5B57C 1D6JA 2OBNA 4PSKA 4PHGA 4IXNA 1I4TD 1Z0KA 3UMRA 1BH2A 3AEZA 2Q0HA 4WBSA 1S96A 4JKIA 4LJ4A 5KYKA 5P21A 2GZAA 3FHTA 3VQTA 2IW3A 3QEJA 4AK9A 3QKSA 2GXQA 1MR3F 4HB2A 3CWZA 2GDJA 1Z08A 3VMFA 1X8KA 3CX6A 1YRAA 3ASZA 2IK8A 1U81A 3QUSA 4PAMA 3T1TA 1RFLA 3CR8A 5EP2A 4HUQA 2GHIA 1J90A 2DR3A 4NYIQ 4NCNA 3WMEA 4PO8A 1VCNA 1OJLA 2LKDA 3W6PA 4Q4LA 1YR6A 2C78A 1N0VC 4HB4A 5F3WB 4AYXA 4Q66C 1W46A 1SVWA 1N6HA 5J4HA 5TY0A 4M1WA 2FFHA 1E99A 1VTKA 4E5UA 4Q01A 4CT4B 4RKFA 2BEKA 4CEHB 1E3MA 5AJYA 5J4KA 4B3XA 1E2EA 2J7PA 3K1JA 2O8DB 2WBLC 3IIJA 4EPRA 2ODEA 2ANCA 1MRNA 3JZMA 2KJQA 3OEHD 3UWKA 4ERNA 2JJ8A 4XSHA 3QPVA 2ODNA 2DFKB 4BUJA 4ESHA 5KSZA 2F9LA 3WMFA 2JDIA 4H1UA 1TNDA 4YDSA 3E2IA 4LV6A 1OXUA 1NVVR 4JLBA 5E95A 1KI8A 2XZLA 5JJLA 3TBKA 5KPDA 4KSCA 5TDHA 2LWIA 1VCOA 1N6LA 3KJGA 4ASUD 4TLAA 2PT5A 2NQ2C 4FINA 4DSTA 2FEMA 4PQYA 1OH8A 4LBYA 1VG0B 2QAGA 5EE5B 4IXMA 4A2QA 1FNMA 4KYUA 1YZGA 2VA8A 5A0FA 1GAJA 1AGRA 2VP6A 4OK5A 2JIZD 3G5UA 4BWYA 3IHWA 3MD0A 4EUNA 3ZIAA 1SXJD 3J81k 1D8TA 4QGHA 4F4IA 1G3IA 2FPLA 1XEXB 3ZVRA 2C8VA 2OILA 3U44A 1XMIA 1YZTA 4QGFA 4XH9B 5E7JA 4DUGD 4Q18A 2ZRJA 1F5NA 1WQ1R 3RWMB 2BJVA 3AVTA 1U2RA 4OL0A 1X1SA 4RZUA 2MSDB 2V1UA 4LPKA 3CM0A 2ZJZA 3CW2A 1G19A 1UFQA 3W8NA 1CR0A 1YHNA 4BFZA 2ATVA 1R0XA 2XEXA 3A6PC 1CKEA 2OXCA 1XTIA 4U00A 2GEUA 4Q4AB 1OXVA 3GLFE 4XVRA 3FWYA 2V4ZA 2P65A 1NMYA 2XNSA 1ZP6A 3CNLA 1Z0DA 4G5GA 4QJ5A 4EPWA 4A0HA 4YQFA 1ESMA 1AZTA 1SVLA 4US1R 3PCRB 3KX2A 5K8LA 3EASA 2DCUA 3V4RA 1XP8A 3BH6A 4L8GA 2W2TA 4HB3A 1IY2A 4HDCA 1GL9B 3MWYW 1RIFA 3L82B 2ZJOA 3Q3JB 4PC6A 4BASA 3SQXA 3CPJB 1KSHA 4K46A 1D5CA 2GCOB 1T5LA 1SXJC 3K0FA 2MSEB 3LA6A 1CR1A 1T91A 1UM8A 2YYZA 3I73A 3RS2A 3RANA 2H17A 3B8HA 2WTUA 1BIFA 4IHQA 4M2LA 4A15A 5TVKA 3UMSA 3CF0A 3ICQB 1CJTC 2R2AA 2PLFA 1W44A 2IWRA 1N5LA 5TARA 3U3RA 4LYAA 4BLOA 4UNNA 5IHPA 1XZPA 4MRVA 2R9VA 3C5HA 1XEWY 2PLRA 2ORWA 4XVQA 5FBRB 3QQ5A 1IJEA 3AKEA 4BQSA 3L0PA 3U6KA 5GJVC 4ACAA 2NMVA 2XB2A 4P31A 5FR1A 5EE1A 4Q4HA 3SQWA 4GMXA 5LB4A 1JXMA 1Z6GA 3MFYA 1XD2A 5FPHA 4KLNA 3FE2A 2FWRA 1E2IA 3BJIC 1XNJA 221PA 3VKGA 2QM8A 2R6GA 4I1VA 4GP6A 4TSFD 2VHCA 4NHOA 1Z3IX 5KUTA 1OLOA 3GJ3A 4P32A 2BBSA 2GTPA 3RRZA 3L8YA 1VIAA 3ZQ6A 3EA5A 4IVRA 2ZYUX 3UWOA 1FOEB 2VBCA 4YONB 3QPUA 4LY6A 2F9MA 2DWOA 2YHSA 3BH7A 3CLVA 4XIGS 5JSZB 4QFMA 3AF4A 2AXPA 1C1YA 5EP4A 5GVSA 4A36A 2JJ2A 5FOUA 1W0JD 2JLYA 3KKNA 1G3QA 5FL7D 1Z0FA 1E2NA 3ADKA 3CZPA 1ANKA 4FXPA 1DADA 4OHVA 1E1QD 3IPXA 2ZI3A 5IT5A 1X8JA 1N5KA 1SQ5A 2QPTA 4EPYA 3D7MA 3RABA 2PMKA 1B23P 4PO9A 3K0AB 2D7CA 1M7HA 2X8AA 2CDNA 2MMCA 3RS4A 4G5RA 5J40A 2W00A 3K70D 2KSQA 1IXZA 1NN3A 4Q7MB 2ORVA 4QHYA 1FFHA 3MSXA 4EAQA 3KB1A 5CK4A 4CEJA 5FBQB 2BBTA 2CBZA 2HEIA 4G01B 4I1OA 1BS1A 3OIVA 5EE3A 4YMVA 5JCZA 4TYWA 5L3QA 1LW7A 2IHBA 3ZH9B 4LHZA 1KI6A 4PQRA 1LVGA 1YVDA 3DZ8A 3WBKA 4PPFA 1II9A 4UQOA 1AQYA 2JLUA 4B35A 5SZHB 2HLDA 2IYLD 1OFTA 1U94A 3HDTA 4B6EA 3SDZA 3P32A 3X1XA 2HXSA 5SZJA 4A8JC 1TL7C 2GK7A 3TKLA 1QF9A 2YC4C 3ASYA 1TQDA 4FWTA 1A4RA 1KO1A 1U99A 2ZJBA 2ZSFA 3CNOA 3LH5A 4FCVA 2UVQA 4OYHA 2JAQA 4AKIA 1YR7A 4DBLC 1LS6A 1LB1B 3KTAB 4LV5B 2Z4SA 3C41J 2G83A 4Q48A 4B75A 4CRWB 2RH5A 4EFMA 1FMJA 5HTKA 2KB0A 1BMFA 2AK3A 2D4HA 2QTVB 4QKQA 2FEOA 3QKRB 4PC2A 3GLGA 2D7DA 1Z83A 2CJWA 3K70C 3NIBA 1GZSA 1OIXA 3ND8A 1Y3AA 1R0YA 2A5GA 1FMLA 2NPIA 4KO8A 3ZS9A 3ZZUA 2BMDA 1KTVA 4O0MA 1FZQA 3ADCA 4OI4A 3ZGXA 1XZQA 2B7CA 3BC1A 2XXAB 1SXJB 3TW4A 4B2IA 2ZR9A 4DLTA 4XTCS 2JLWA 4Q1DA 4TTPA 3AF1A 5DSZA 3QXSA 1IY1A 4GRAA 1U98A 4JMPA 1ZM2A 3WP0A 4AG6A 3E70C 2PT7A 5F2EA 1R6BX 4MKIA 4URVR 1LF0A 1Q21A 3AUYA 3T5GA 1IY0A 1KO8A 1ODFA 2V7QD 4IFEA 2N46A 3SJZA 1G8YA 4D0NA 4US2R 1OT3A 1I4DD 1QHHB 3KXLA 3KJIA 1NVUQ 2GNOA 3PVSA 3ADBA 1Q0UA 2CLCX 3ZJYA 4G5QA 4N0EA 2Q6TA 3I8SA 3FFBA 3X1DA 2OG2A 4IOKA 4LJ5A 1E2MA 2P2LA 3W6OA 3DMDA 1AGPA 4NYIR 2C9YA 2H57A 3FKSD 4JLKA 4B47A 2A5JA 2BV3A 5KSYA 1W1WA 1GP2A 1E9EA 3U3MA 3BFKA 1KMHB 3CIOA 2GZHA 4KCGA 2ZETA 4TZ6A 4XWKA 3B78A 2YZ2A 5M04A 2IS2A 4QXAA 5K8IA 1ZJ6A 2RCNA 1KDRA 4PHHA 1XTJA 2QGZA
chains in the Genus database with same CATH superfamily
3T06B 3ZIDA 2WWVD 4Z4CA 2AKEA 4K28A 3L6RA 4GECA 2FZLA 3SE7A 5IVKA 5NLLA 2DHRA 1LUAA 3H75A 3HH8A 2TRSB 5IJZA 3DPIA 1T4GA 4I99A 1PL8A 2EGHA 2VXOA 5DIFA 3UA4A 2FN3A 2PRZA 2Q0QA 1TX4B 2NVOA 3PNQA 1KDOA 1QVZA 3P9NA 5LA6F 1N75A 1X7XA 3WGUA 5IEJA 3FRJA 2ZRGA 3VH3A 2HT1A 1TQHA 3CURA 4R8KA 2IYVA 1JHPA 3V34A 4LJ6A 1ZSVA 4OFXA 1AV6A 5EMJA 5JFGA 3LX6A 5CFOA 5DBOA 4FC6A 4Z3DA 1N0HA 4KSYA 2QVZX 9LDTA 4LYYA 5KHOC 5B2ZA 4I5IA 3K92A 1KSJA 3TAUA 3SNKA 4HV4A 5AK5A 1TMKA 2PDAA 1OR8A 2BE7A 2R7LA 3NG1A 5BV1A 2JRBA 3ZJTA 1P2BA 4WOJA 1Z6XA 4Z1MD 1H4TA 2QEQA 3M6XA 1IRIA 2FLWA 4RPKA 2P6RA 4MO9A 2GN9A 5EJ6A 1YRHA 1QO9A 2HJSA 2WFLA 3B3FA 2H2IA 5AKLA 5BSRA 4J7AA 4LY0A 1QYDA 2ZJ8A 3H7AA 1EIZA 1QYVA 3A6FA 3UK7A 3ZDRA 4JJ6A 1UDCA 4DR6B 4Y6SA 1MJGM 5CITA 1VYVA 2H11A 2GETA 4FMCB 1HQYE 4CEIB 1DAPA 3H19A 4XWGA 2OWEA 4IXDA 2WNSA 4LZZA 1JNXX 4YJGA 2B34A 1WV0A 2JEOA 4G86A 3QW4B 4CHTA 5KTNA 1GPLA 4DMHA 1T6ZA 2ATXA 3RAPR 3T5DA 1KVRA 2XJ4A 4X7RA 4LDQA 4MYRA 5SY4A 1ULBA 1DRJA 4TWZA 1UBLS 2HA5A 4QYMA 4U7FA 5EPEA 1PYGA 1VJ5A 1XAJA 2OD7A 4H0NA 3SLKA 3NASA 4PBRA 1T4MA 4XW2A 4CUZA 3TKYA 3H9CA 1R9GA 3PFIA 1GG8A 4GX0A 2P90A 4RV4A 2NVUB 4KXFB 5IS2A 4P33A 1T4CB 3SYTA 3O26A 2FZVA 4DOMA 3TLGA 5MGBA 1NR1A 4RVUA 2WVJA 121PA 2ATCA 3DYVA 3PE6A 4QWWA 3GCZA 1JPJA 2QG6A 4MRRA 3A0UA 4B85A 4DKXA 2YQ4A 3E5MA 4KQ2A 4GYKA 3JQFC 4WACA 1PJRA 1UK9A 1M6HA 3ZHSA 4A3SA 4TVSA 1E2BA 4U6NA 2Q6IA 3ZI7A 5KX5F 3U4QA 3JYNA 1Y5MA 5H02A 3R6WA 4QGGA 1PQYA 1OI2A 2VTBA 3DFMA 5IASA 3CUUA 1QWSA 1Z13A 2EXXA 1RP7A 1ZD8A 1NDQA 1UKVY 1EM6A 1UP4A 2B0CA 3NBAA 3R7SA 1P33A 4S05A 1VI5A 4IILA 1YR8A 4QDOA 5BN4A 1F4VA 2AMVA 2KQUA 3HEMA 3MUOA 2BGWA 2B3TA 4RTKA 2R86A 3HUUA 2YWCA 1YO6A 5A9RA 1J4AA 4JQCA 4X45A 3OFNA 3FSRA 4C6TB 1GCAA 3ZY5A 4GBGA 3ESYA 2FKAA 3HKDA 4MUKA 3HKBA 4DC0A 3OY2A 2V6GA 3LDUA 4DMFA 2FN7A 3OTOB 4YFVA 2DTEA 3GK3A 2VSOA 4OHBA 3JQDA 3RT7A 4K0KB 1E60A 1L1QA 1FK8A 3ZI0A 2V7EA 3DYBA 1U9IA 3EW9A 1P4JA 2QRUA 5JXGA 1J56A 1G17A 3BB3A 3CNNA 2KBEA 5FPYA 4Z7OB 4OX9B 4QBFA 2FMUA 3V2IA 5KC9A 1DP4A 3HVRA 2QW1A 1CUVA 1PJSA 2ZYRA 1Y8RB 1YCFA 2ZS7A 1P0FA 4GE0A 2V3CC 1FU7A 1YRBA 1L6RA 2I3GA 1J8YF 2DKOA 3HYLA 1T35A 2YOFA 2ZVPX 3PF8A 4FZ5A 3BZWA 4Q4JB 3V55A 4ESEA 2BGGA 4QUDA 1A4XA 3VHXA 4XIFA 2FX3A 2H1CA 3E3LA 1R4NA 1S8NA 2YWGA 3RIEA 1BGVA 3R6GA 4RK5A 4UMFA 2YZGA 1VCHA 1D0IA 4Q1FA 4QGBA 3L0OA 4HUTA 4RTJA 4A4DA 2PGLA 4NF2A 4ETIA 3DTVA 1Q74A 2X4DA 1ODLA 4NZNA 2DHCA 2MYNA 1ZH4A 4UBJA 3W2FA 3ZCPA 5FR2A 3CXRA 5KNLA 1UK6A 1KFKB 1PJ3A 4NFLA 3OWXA 1RMYA 1RAHA 5DULA 1FS4A 2FFJA 3F8SA 3DWFA 4E2XA 3OOSA 1QHGA 1WTAA 1YJAA 1WXHA 3IV7A 3OUUA 3V5NA 1CUYA 2PJZA 4NQRA 3B1KA 1U0TA 3GJ7A 1J9ZA 2WU0A 2R1TA 1I51A 5J2TF 2XSZD 2E37A 4MDFA 2BDUA 2WSLA 3E3NA 3GEBA 4UNRA 2GTHA 1WW2A 3TL6A 3ZK7A 5A7FA 1TKCA 2HH9A 3FB1A 2FZWA 3MMNA 3QIVA 4KVGA 1GR1A 5AW4A 1S6YA 3TIIA 1K27A 3KOOA 3OWOA 2WAMA 2ZM5A 1MA3A 1JEQB 2IH5A 2QTMA 3D1VA 1GTVA 3O47A 1ZHOA 2G5PA 5BW5A 3DONA 5IHXA 1X7WB 3GAZA 3OPYB 1JDJA 4I3GA 1YJ5A 5LUBA 3TR0A 5A06A 4ETMA 4ZQIA 2OOKA 2CUKA 2JIQA 4IW3B 3VTKA 4ZT3A 1O97C 5LQRA 1AUQA 4ZEVA 4JV5B 3L7JA 4LHWA 2ONKA 1PUJA 2ORIA 1TEVA 4X93A 5KQRA 3IT1A 3IEIA 2CCGA 3QLJA 4WN3A 1RI3A 1ID1A 2P79A 3AEXA 4KDFA 2F7SA 3FOFC 1YKFA 1LSJA 1ZMOA 2AKYA 2QROA 3BX1A 2ZJ4A 4MI1A 1RP1A 2JIPA 5CIWA 1HDZA 3DLIA 2CHVA 5MN5A 4M46A 1YZHA 1AA3A 5AM1A 1E58A 3ZJUA 4C20A 3IL2A 1Z35A 3HVHA 2V8OA 1JDSA 1QTRA 2G0AA 2IXEA 4KPFC 4J4BA 4DV5B 1YTUA 1B93A 3NT4A 2I4NA 2P27A 3CRW1 4YMSA 2QP4A 1QQTA 1M2OB 1P2DA 3IULA 3KIPA 3PFHA 3IR6A 4BX3A 4C7OB 1RM5A 2P5SA 2P9GA 1J00A 1SUDA 4MWCA 1H2EA 1DRWA 4N82A 4ASUA 4UBOA 5JE8A 3ZJ4A 1RC0A 3F6YA 2NXJA 3LUJA 4P08A 4AZTA 5GINE 5DB4A 3VR2D 5GM2A 4WNIA 4AURA 3AG6A 3BFVA 2I2XB 3NORA 1R15A 2A0UA 2PYDA 1NQ5A 1UMKA 5BRNA 3TSZA 3PHLA 4Z9AA 1J24A 1N2GA 5CVDA 3VKWA 3ORYA 5I7VA 3AERB 5C1OA 1TAGA 1RQ2A 1L5FA 4WBNF 3BD8A 3LF2A 4L4XA 3RSOA 5E6UA 1QYCA 1C7RA 5KNBH 1M34E 2IGBA 5JXHA 1SA0B 3SEAA 4EX7A 5GAJA 5JDCA 3ZZMA 1FX0B 2WVHA 5GJWC 4EI7A 4DN6A 3SVLA 3TXXA 4AKGA 2I6FA 4AY2A 5B1SA 1A2BA 4MTCA 2DQZA 1KMIY 3BH0A 4MQEA 5DU2A 2QRJA 1B14A 1WBJB 3ROMA 2Q99A 5ALYA 4ARZA 3HEAA 5UKDA 3TIXB 3PC8A 2QV0A 2OXRA 1IC6A 2GT1A 3GVCA 3HBLA 2WE8A 3AI1A 2MIIA 2R6HA 4QSHA 4BMOB 2W2VA 4HAOA 5CA1F 5FL3A 4L4RA 3VAYA 1S8OA 3HYCA 4G97A 4DBLE 4V1CB 1C8VB 5B1IA 1DBWA 1HSZA 1D9ZA 2COEA 4DBZA 1J0XO 4CLDA 4CIYA 1JPUA 5TMDA 4G24A 1EK0A 4BVAA 4BATA 3PI7A 1A9XB 3ICEA 3EJWA 4X9XA 4CUKA 2WKWA 4UDYX 4E08A 2HPAA 2QSYA 4IH4A 1SXPA 3A14A 3ILSA 5I47A 1G20A 1W25A 4PC7A 2GBIA 3ETHA 5H8WA 2AL7A 4TQ9A 4FX5A 1YB4A 3KJHA 1P81A 1J07A 5AJVB 1OV4A 5CBPA 1OPRA 2C3MA 3PWZA 3QBDA 3QVLA 3WYNA 1EFLA 3BS4A 3NXKA 4EHKA 5FWNA 3IFSA 1HH4A 1BG6A 4X7PA 5EIHA 1D2GA 3WMXA 4DA9A 5B7GA 3IURA 3O3MB 3R0VA 3L0YA 5C1BA 1UBJS 2JH8A 4QT0A 4QLAA 4P35A 5A3SA 1AK2A 2C3PA 1J49A 1GOTA 2EDAA 3NDBB 1WULS 1K89A 1M2NA 1L8AA 3BMQA 2XCIA 3CUEF 3NBZC 2XTNA 1VMEA 3GJ4A 1CPYA 2FEXA 4R81A 3WHLA 5FRDA 1E1MA 2D13A 4CL8A 3OHMA 4PYNA 1XKLA 1ZVQA 1ACJA 1VL8A 3CU5A 4DQKA 4P0PB 2R6ZA 4JR0A 3PA8A 4GNKA 4BJ3A 1MAWA 3RRMA 2EYQA 4PN3A 5BSWA 4DV3B 2VZ8A 2UYYA 1U0GA 7MHTA 3Q5GA 5IYZF 3AUFA 3Q8XB 1ISSA 5BNWA 2GJKA 3RC8A 2G3YA 1KI9A 2WIBA 5I3CA 4PPGA 3RSLA 4YJFB 1JAIA 1FMTA 5IABA 4YRLA 1ZG3A 4ZIRA 1EVZA 3DS8A 5KVSA 5B5SA 4GR4A 4C7XA 1EFPA 1S8AA 1XVLA 2WAOA 2IY8A 3GJ6A 4M9CA 5CLIA 3R5SA 4Q7LA 1IBRA 1MXFA 1KAOA 1ZXXA 3B6EA 3BK7A 1HORA 2OZLA 4WOKA 3Q41A 2Z9DA 1DOAA 2CLEB 1P7CA 3JVDA 3MGKA 2EZ9A 4QBHA 4TYQA 4UNPA 4AROA 4KMRA 2XLBA 1VLQA 4C7KA 2BGMA 5F64A 4ZXPA 1AHPA 2C20A 4D8YA 3ZV7A 2CHFA 2GHTA 2VUUA 2VOJA 3R24A 1UKYA 2A1TR 5E2AA 5JISA 2JLQA 3MZ0A 1VBNA 3DMGA 4XYEA 5DM70 4X1YA 4BU0A 1NVWQ 1T1JA 4XQ9A 2J3QA 1EUCB 3RAFC 3RVSA 3G68A 1O89A 2JBAB 4LYJA 2YWHA 1AO3A 1N6NA 4I5DA 3TSCA 4KYVA 5GP1A 1BYIA 3G5MA 2BTEA 2GRJA 3ACDA 4LXYA 1NUSA 1C1DB 2OVBA 1GAWA 3LPMA 2QL7A 1CIPA 1HF3A 1INLA 1Z4LA 3TCNA 3RHFA 1LU9A 1PJQA 4AMVA 2GUGA 4YY3B 1TM2A 2YQ5A 2I7XA 2C5AA 1L8XA 3WGZA 2YWBA 5K8JB 1CZKA 2HHJA 3GEEA 1I36A 4MPPA 2XGJA 3MWKA 5AICA 3RVRA 1IVNA 5IXYA 2FB9A 4P80A 3DXXA 3L1HA 5EE0A 3W6NA 1BJTA 1JNYA 1FW8A 2V9ZA 5FA6A 3PUVA 5EZSA 1W49A 2MYUA 3ECSA 3G5AA 3DZDA 1OROA 2FWAA 4WXRA 4G1UC 4KYIB 4KREA 1XNHA 2O8FB 2FZ4A 3EDMA 1SWWA 1UCFA 3L6BA 4CLHA 3LUHA 3KQPA 1J8VA 1IVYA 1LBIA 3WLSA 1EWKA 4CG3A 3UPUA 2JPDA 1MHTA 3QU9A 3ETGA 4FGSA 5C18A 1W76A 2WHEA 4W4TA 2AVNA 5G3YA 3O4JA 3P1JA 1L5ZA 4UEOA 3WNCA 3PL1A 3U7EB 2C5FA 4HTAA 4N8SA 4QNNA 1NRJB 1PFQA 2NUTB 3ZDZB 5JMWA 5IBQA 2E6KA 3JVVA 1E6LA 4YP1A 4YRGA 4WKPA 1P3DA 4EYKA 2E5FA 3IEVA 4F84A 1C8KA 4ED9A 1XZBA 2IPLA 2ZYWX 4QIHA 2GZMA 5K03A 3BBLA 4Y2SA 3JQAB 3O83A 4Q15A 3FGPA 4HF7A 4I08A 2ZIUB 1VMAA 3L0ZA 2XOKA 3TLXA 3FUUA 1YBAA 3FKQA 4YNBA 1QPBA 3AR4A 1ZGHA 2XUQA 4OQZA 5FUXA 1KI1A 1RXIA 2UYQA 3G85A 4GM0A 3KCNA 4U4AA 3UOGA 3QEBZ 2QP9X 1TK3A 4RJKA 2QK4A 1SCKA 1AKRA 2J7PD 4NTZA 1X1CA 1ZGAA 2Z04A 3EIXA 4ARIA 1GUDA 3LS2A 1CF4A 2VF8A 3RYCA 1JF8A 3ZX4A 2FWJA 1XMSA 3AXSA 1G8JA 1YAHA 1O58A 2ZSUA 3IDFA 4RK1A 1BDJA 2NTYC 1ZUWA 3AOEC 4EA6A 5IT9A 1UAGA 2BHLA 2BFWA 3ERCA 1G4AE 1W88B 3Q15C 2P4EA 4PZZA 1L5RA 8ATCA 4X6XA 2RFLA 1K06A 2DPXA 1NPTO 4A1FA 3WIEA 5LD2B 4FUTA 3FOAA 3ORSA 5JR3A 3H6KA 3ZKAA 3WWDA 1WPRA 2GK6A 5EYPA 1Z0ZA 4A0GA 3GBSA 4NPCA 4BGEA 4DIMA 4B48A 1TK9A 4TS9A 4L28A 4CM1A 3F6BX 4EY3A 3TF5A 4YQEA 1FSPA 2C8LA 4FE4A 1KRXA 1H65A 1N2CE 1N5IA 4WNAA 5E9AA 2GN1A 2AYZA 2H08A 2QKYA 3NAMA 5IDVA 5GZ1A 2WK1A 1TYEB 4UBKA 1Q1NA 4PS0A 2HIHA 3QHQA 3IP9A 4JJEA 2O5RA 1PU2A 1ZUNB 2ZS8A 3A3PA 4WA7A 1AIPA 3IT3A 5T4EA 2EU8A 3X1JA 4GX5A 2Z83A 4G1CA 3VDMA 4D2IA 3ZDXB 4AS2A 4FP9A 4AJNA 4IV5A 2A9OA 4M54A 4OD0A 4MR8B 1ZNXA 4F5WA 4S04A 2IXAA 2AUNA 1W4BA 4NENA 2XUDA 2H18A 1NAHA 4J4TA 4MXDA 1ZMTA 2B6HA 5ESWA 4DXAA 2WAYA 2DT8A 4JQZA 4RKEA 4EUSA 5L3ZA 1E1NA 4L7VA 4TMTA 5KTKA 1OH6A 4X85A 4DWVA 1FXWF 4UE3S 1DELA 3EVFA 2AZDA 4O4LF 3C7DB 2YJNA 3NB0A 5JJCA 5E38A 3ZWCA 2YRXA 3H9GA 3O0TA 1YZKA 4UUPA 3C97A 4C0AC 1M83A 3IUJA 4P58A 1W5AA 1N8TA 3R7NA 3UMCA 1NU8A 4N4AA 3OKCA 3PXGA 2ZANA 2J30A 4AZ0B 3BWYA 4DVGA 2PZMA 4NBUA 3E5HA 4D3FA 2OCPA 1X2BA 3ZY4A 4TLEA 4RYLA 1ULSA 5FI1B 1XTRA 3HBFA 3E61A 3LNTA 4JLAA 2WZBA 1GG5A 2Y92A 3HLYA 4Q16A 3LDFA 2KWIA 3PUWA 3OCUA 5LDGA 3V2UA 2XGGA 1E2KA 1DINA 1WPGA 3DF9A 3AP1A 3KJFA 5LA6B 3G82C 6LDHA 1GTRA 3F97A 2V7QA 4LSGA 2O8CA 3PEWA 2ZEJA 2I4MA 1PR3A 2QAGC 3JATB 4IYRA 5HJ7A 2XXBA 1G98A 1W52X 5B1EA 1MABB 4JVNA 1LBQA 4DSNA 2Z8XA 1PSWA 1EG7A 4YI5A 1P2SA 2P9ZA 5DBGA 5KJ1A 4TMFA 4ZAVA 2VUSA 3WP1B 2RKBA 2ZKIA 1R6XA 1WKCA 3DE6X 1WLYA 1XWFA 2ZUDA 1KIFA 2EEPA 3MCTA 3FKSA 1RJFA 1E32A 4XARA 3SQLA 5LSAA 2HWWA 2JGEA 3NKFA 3C2QA 4KK4A 4MTLA 1XDWA 5CB8A 3KQKA 3CJTA 5EZ5A 3ZHBA 1VKZA 2PL9A 4RQBA 3OA2A 1L7NA 4QEDA 1CE8B 4H6PA 2PLAA 1Z2EA 5BWLA 3FTQA 2EW2A 4A2CA 1IEVA 1EZ1A 2HMWA 5KOHA 4OI2A 3QPAA 1K8XB 2I7DA 4O3MA 3TMAA 2ZWVA 4ZEXA 2BMEA 4KX3A 5KOYA 4L3VA 2EQ5A 3BN3A 1O8CA 3R8XA 3JQ9A 1MC4A 5IDXA 3KPUA 1I94B 1LNQA 2O0KA 4KIGA 2ADOA 3SZOA 2IXFA 3THXB 1XZHA 4W6ZA 1UODA 1YQEA 2PXAA 3P2IA 4IJWA 4BRZA 5T5QA 3CZQA 3MWEA 4CM9D 4RQAA 2P6OA 2VHWA 3NBXX 4WJZA 5DOZA 3RT1A 1X80B 1DU4A 3PDIA 1DI0A 2PZKA 4FFLA 1JTFA 1UBMS 4QM7A 1FRNA 2ZJ5A 4XQGA 3W9SA 4DVJA 1BVHA 2FQ1A 2QPLA 3P94A 4MS3B 1HL7A 1Y6ZA 3DFKA 4QA9A 1K8RA 3B6IA 1SXIA 4G8DA 4UREA 4UHDA 3EIHA 5I9SA 3T52A 2XDAA 4G0XA 5HS4A 2PX5A 1QOZA 1T1EA 1XLUA 1DEAA 3A9UA 3E6AA 3BUSA 1I3MA 3HDJA 3M6LA 4TV8B 4BUCA 1CRPA 4DQVA 1YK1A 3N0RA 1QYIA 1SMKA 2QWXA 3DVAB 2JLRA 3VSCA 1ZS9A 2REQB 3VPXA 2NZVG 3FYTA 3ZE0B 1BE1A 2WQZA 3WLAA 4ZPXA 3BMCA 4DJTA 3DAHA 1FNBA 2OECA 3M5WA 4FK8A 3A25A 5TQ2A 5LXTA 4LTNA 4EJMA 1C3LA 1YGYA 2Z2ZA 1R18A 1RYBA 2X1LA 3OO1A 5G2OA 3DYIA 1PK9A 2PUTA 3UAZA 1KWGA 5FFNA 2QUZA 3FLAA 3TUZC 2V03A 1YJXA 3IHTA 4HLQB 3URMA 4BMZA 1YCHA 1U2DC 2SECE 2GD1O 2K4MA 1TQ6A 2LTAA 1TZKA 1Z6YA 3FDZB 3CV3A 5E4YA 3F7TA 2LDBA 2FSIA 4LKRA 2VZ0A 5FWYA 2WJ6A 5DASA 1A2QA 1ISGA 1KEUA 4MULA 1WM1A 1ZIPA 1BOFA 3M5DA 4N49A 2ZUCA 1GGKA 1CX9B 1DRUA 2FPIB 4O2BA 2C95A 4AJJA 1YKSA 1O95D 5LQCA 3PU6A 3GF4A 3DSRA 1TM1E 3LZCA 2R65A 3NRCA 2I5PO 4KQHA 5A4IS 2AXEA 2XI4A 2ZP1A 3HVIA 1G1AA 1D4FA 1JIVA 2AXNA 3IUBA 3UPTA 2Y2UA 3NIDB 3T7EA 4YRZA 2H9YA 5EIAA 3T54A 1J8QA 1L7VC 4EHJA 5L45A 1PNQA 1BJRE 3PGXA 1OXSC 1WEKA 2ZB4A 4L50A 5E0OA 4UUAA 3UUEA 2QZZA 4OAPA 3WXMA 2G5TA 3A0RB 4FHDA 1P91A 1PWZA 4HATA 3L01A 2XKJE 3GG9A 2YOHA 1BE0A 5KSPA 4WLEA 1SOMA 4ZC8A 4W1QA 4OOEA 3C6MA 4OK6A 4YT4A 2H63A 4JXKA 2P0EA 1MAAA 2PBLA 5ELMA 1NXWA 3VI3B 4CTJA 3O1LA 1I14A 3S44A 1T3HA 1L7AA 4YUZA 1YB7A 4LXQA 1KY4A 1SQ6A 1UAAA 3WQHA 1IHUA 3C4QA 2C9MA 3OJCA 4M9UA 1M76A 1OU0A 2FP4B 4FFBA 4S1PA 2AF4C 3IQDB 2RK4A 2IVFA 2WABA 5ALKA 1KJIA 3S8MA 3VHRA 1YHYA 2IZ1A 4BWGA 1N2BA 3CEPB 3L02A 1ZD3A 1KMCA 4I1IA 3GP5A 4MUJA 5DYGA 2Y6VA 1YUNA 5EJIA 2GD6A 3IUYA 4OMFG 1G0NA 1ELOA 1EA7A 3O2QB 3K6SA 1NVDA 3IAM1 2CLSA 3SSMA 3EXIB 3C14C 3WRXC 4OAQA 3W3AA 3Q8WA 3THRA 3A26A 1R8SA 4KQXA 5I6DA 1YR9A 5BRAA 5TGTA 1H2FA 2FN9A 5F21A 4A27A 1C9MA 2C4VA 1E3IA 2PMBA 1RE1A 4M7PA 3R7FA 3H2SA 2O3QA 3TOCA 5KZMB 2GLTA 2R25B 1V11B 1GGEA 3TN7A 1P1CA 1PJ8A 3CEMA 2O05A 2J45A 3ROFA 4K6FA 2NADA 3EIQA 1V43A 5L7WA 2PMFA 1VMDA 3QBVA 3C3WA 1RPJA 5GPBA 3I6QA 3R5KA 1RADA 4PSVA 2SKDA 4GEKA 4HN4B 1SBCA 4AUKA 5HZGA 3DEHA 5K0FA 4JI0B 1GA6A 5AI4A 1HT0A 1JSLA 2JLSA 2P30A 3ZIUA 1G42A 3T8YA 4D9EA 1FTQA 4AJPA 2CK3D 2VTEA 2X14A 3GCWA 1I2MA 2NSJA 4D9HA 5IZCA 4YALA 2L0XA 2O8NA 2VQ3A 3T61A 4E13A 3IAM6 1OXBB 5IAEA 5IF9A 1PUXA 2CZQA 4BFYA 3FF4A 2JZOA 3K5PA 4O08A 4DLAA 3DQPA 3AT1A 4NZOA 4UNSA 3S29A 2W2PA 1GG9A 1XZIA 2OM2A 3BRWA 3DNFA 3O9ZA 5FWXB 5CB4A 1EFUA 3PJGA 3BA6A 1VFNA 2HZBA 1E9DA 3NJ8A 2BHRA 5CM2Z 1N92A 2P69A 1QS0B 1M1UA 4G23A 3UB3A 5EJ8A 3HABA 3DMNA 1SUPA 2OEPA 1EA5A 4UUBA 4A0FA 2RGBA 3GN2A 3KSRA 5AXAA 5LZ9A 3H4IA 3IHKA 4N0DA 1HE1C 2WG2A 1ECPA 3CKLA 4P4UA 1JMKC 5FTMA 3S6JA 1QGDA 4Q4AA 4AY4A 1HV8A 2AG8A 3OECA 1SU6A 1XQ1A 4WLNA 1KGSA 4BRWA 1J22A 1G6HA 4WERA 4H3HB 2J3LA 4DJAA 2WSSD 1WDWB 4LWOA 2WB4A 4XTRA 4P34A 3KV3O 3I1JA 1KE2A 1TC2A 4KXUA 4NYJQ 4JOQA 5F98A 4GMHA 1C50A 1CVIA 1DIRA 1NJ1A 2OAP1 2WYVA 3KQNA 2X19A 3E8SA 5TPWA 4WBNB 1K4MA 1N25A 4H9GA 1KPHA 2VDOB 3UAOA 4UNQA 4PHTA 2DQKA 2QMOA 3LBAA 1CRQA 1A5SB 1DIGA 3G6KA 3NHSA 3O75A 1ZZGA 2ZI4A 2FUKA 3RVOA 2PGAA 1RXVA 4V03A 1XHEA 4UM5A 1NZDA 4NBVA 2QTWB 2YFKA 4CDGA 4B6FA 1SO8A 3H1FA 4LVOA 1GU7A 3L7MA 5B3LA 2O2XA 3EPKA 3QVVA 3HXTA 3SDSA 1KEZA 3Q7SA 4WN9A 1X9IA 1Q2UA 3U4DA 4DPKA 5CA1B 2AG0A 3UAXA 2QENA 4JBGA 3S7TA 3D2CA 4CL0A 4N1AA 5JH7A 2VNHA 1VJCA 2C2WA 4X65B 2Q6OA 3P71T 1M1ZA 2GFQA 1K0UA 1TCUA 3WYDA 4F2HA 2X58A 1OYYA 2J3IA 4MVJP 2C4KA 1RRFA 4NK4A 3RGGA 3OU6A 4LAFA 1M6VA 2PL5A 4JC5A 4ESOA 4EWLA 1OA1A 1PL6A 1ZBQA 2OVFA 3FI9A 3IMFA 3PD0A 1T0JB 5EIBC 3I61A 1UPFA 4U7DA 1C3VA 3IQZA 1QIMA 1W4CA 1YDMA 4ZDIA 5HX7A 4X63A 2F00A 1T0PA 2IYZA 3P4YA 2J9FB 3GV0A 1Y1PA 4RVDA 5JD5A 2EBHX 3FZNA 1WHSA 2M1XA 2EL9A 2WOJA 3EEYA 3R6DA 3C3KA 5ALQA 5FEUA 1A8IA 2VHZA 4X1IB 1N7GA 3H9UA 2PV0A 5BNFA 3HZZA 3HGTA 1RRKA 2HHAA 3KELA 3C3JA 4DR3B 3RARA 3OX1A 4WHMA 3VKVA 1CJMA 5IUJC 5EWLB 3E3AA 4IDGA 2NTJA 3NYQA 4BQQA 2IHYA 3H5NA 3VKHA 4CXMA 1LI5A 2OQ2A 3LC7O 2B2XA 4IVNA 5KDOA 1IWOA 1ZC3A 1ZK3A 2E5WA 4KN9S 3WFIA 1JFSA 1VKRA 4H7DA 2OAQ1 2Y0CA 3UCFA 3NAQA 5E3JA 2CUNA 3OP4A 4H16A 2TMKA 3ISVA 4JOCA 3SC2B 4XVCA 2H0AA 3JD4A 1KYIA 5G4KA 2GPTA 5K3FA 2IU0A 2QVCA 4X84A 4Z5XA 3V1TC 4FOOA 2MJLA 1Z63A 3LT0A 1JKXA 1YGPA 2ZSBA 1IQRA 1KY5A 2QGNA 1JU3A 2X15A 4LJ9A 4CEJB 5IPFA 1L5MA 3DO6A 3PITA 4IZOA 4Z9FA 3AHJA 2ZB2A 4HGYA 2D74A 3MGAA 1EEXB 2BSXA 4MV0A 3WYGA 1E9RA 5AVXA 1L0BA 1L7OA 1QR2A 1EQ2A 2NP7A 5AXBA 1P7VA 5BXQC 3A4NA 5CFQA 1E2PA 1X19A 1HDCA 3O2NA 3OZXA 4M8KA 3CVOA 2ASEA 1YQXA 2NYUA 3ZE8A 1H9CA 2YZKA 1J33A 1L4HA 1UQRA 2WF8A 2E4VA 2ACKA 2PGXA 4HGRA 3L8GA 5H80A 4OHYA 4E7PA 4YAJA 4ERXA 1I7LA 4G1EB 1QZ3A 3WBFA 4AYWA 2QIPA 2W8BA 3I9JA 2CXPA 2KW5A 4LNHA 1R9MA 3R0XA 2VJPA 4E4TA 2WUVA 1MO6A 4OQEA 4PE5B 2EERA 4QZVA 3R6TA 2CEAA 3Q7QA 2CZGA 2XB8A 3UG7A 5JDIA 1UEJA 1DBVO 5THQA 2NUPA 2BISA 5D85A 2I03A 4R0NA 2V5AA 5CIYA 3IEPA 4EHAA 3NQ41 3LHFA 1A1SA 2PYZA 1OQAA 2OC4A 3DE0X 3H18A 3M70A 4G3XA 4YECA 1DT3A 4CM4A 5IULC 2R5FA 2W43A 2ZRBA 4J29A 1N6RA 3WYEA 4EHNA 4X1KA 2EFGA 3RC1A 3AKCA 4MKZA 1S2NA 2NOAA 3IMCA 5K5EA 1XNQB 3JVIA 2J0VA 2QD4A 3DTVD 2YASA 4JBWA 4PXAA 3L0DA 1J0CA 3QVJA 4MKFA 3A04A 4OXYA 4CI9A 4BLUA 4YP6A 1S1CA 4GVLA 2P9FA 1E9CA 2J9XB 3NHZA 4Z7JA 1X7DA 3JWGA 2BMVA 1JHQA 5U9CA 1YS7A 4RPCA 5G53C 1DTWA 1OGJA 1FUYB 2QTVA 3PB3A 3DW1X 3N1UA 4HXYA 4KGXA 4RD0A 1JQAA 2D00A 3HRHA 2XX3A 4PQEA 3SU8A 4CODB 3DMPA 3L0BA 2CXRA 2QA5A 4IIVA 5DCYA 1GYQA 5FTJA 2A5FA 1RTTA 3V7NA 3OLWA 1PJTA 2F67A 3KAJA 4V3CA 4DJDC 2NO6A 2XB4A 5I48A 4FT2A 3EZNA 3Q3EA 5CH5A 4BB9A 4ZK6A 1Y98A 1OAOA 3H9QA 4F2DA 4F96A 4ZICA 4C7BA 4ZK2A 2XXAA 1SXJA 4B82A 4IIJB 4XYLA 1UMBA 3KSBC 4WOPA 2QN8A 5J3JA 4FQ8A 5BOSB 3KXIA 5HIAA 4G4SO 5TSDA 4ZEMA 2ZE7A 1PCXA 2GNPA 2X9LA 5LD2C 5ALEA 1DXYA 4FKZA 2ISCA 1PS0A 3HCFA 4K9SA 1WZEA 3QVMA 3I0MA 3AK4A 3BM5A 5HRUA 5EZYF 3UAGA 3DOIA 5CHYA 4Z0PA 1QFZA 4RBNA 2FQXA 1TD9A 3PZRA 3UXYA 3O8LA 3W06A 3DAPA 1B1CA 1BEEA 2NNLD 4UNIA 4ZOBA 1SG0A 2ZWAA 4JJKA 2O6HA 1FP2A 3WSTA 4G84A 4J0GA 4XUDA 2WHXA 1FBNA 1J2UA 5LKRA 2A67A 2RDMA 3NDRA 1G7CA 1N6IA 4EOGA 3FOBA 3RIXA 4YJ3F 4ND3A 2XZDA 3KZVA 1JFFA 3AUKA 1O5TA 3W2TA 3KRTA 2I4TA 2CXXA 5ALOA 4H31A 4P81A 1OU4A 2H8GA 2WNIA 3P5SA 2W6JD 2X3YA 3CZAA 1G5QA 3JQ8A 4U0JA 3KKZA 4JL5A 1XLVA 1C4OA 1QPGA 3D4LA 4QDJA 4JLNA 2HN9A 4I1RA 1KSGA 4C0QC 4GPEA 5G4LA 1X7XB 1SGWA 1RWKA 4JBYA 4UE2A 1J42A 3A2MA 3BFPA 2FPPA 3EXG2 5DWVA 2GDZA 2G71A 4BNMA 3A37A 4X8LA 1MB3A 1BJKA 1S3IA 4WZAA 2QNBA 4P4SA 4QXRA 2ZE5A 5FLYA 4FHZA 3SBXA 5DH9A 5J5VA 2VQDA 2DPHA 4YRJA 3T5GA 4XSGA 1CSEE 2ECOA 4NE9A 1MFPA 1P2GA 5HRAA 1RYEA 1RHJA 2C1ZA 3CTMA 4GZ5A 4ON9A 4EFNA 3RCBA 3LF1A 1IPEA 4PSUA 3FDIA 5H82A 3D9QX 5JCJD 1NL3A 3PXDA 3ESXA 5ALDA 4TMWA 2XCTB 1SUIA 2JGKA 3A9SA 1VG1A 2H3EA 2QG9A 3GLSA 1DV2A 1KI7A 2DWCA 5ES3A 2WFLB 2X1MA 1Y3FE 5TXGA 1QG4A 5GWXA 5LYJF 2A9RA 4Z2AA 1U63A 2QN6A 1XTUA 1DWQA 2QTFA 2OXEA 4LQLA 1NN5A 5TEWA 4EY5A 3JX9A 4OQDA 1N2EA 5HIKA 3FPKA 1F4PA 5H70A 1YASA 4NFYA 2Q4BA 2J4DA 5GZ6A 2UZIR 3EWNA 4L6CA 4G2TA 4O3FA 2Y4NA 2PD3A 1LCIA 3KFLA 4BCDA 4YJGB 2N42A 2C77A 3EWIA 4GE3A 2OYSA 1SB9A 4M1QA 4MINA 4B7XA 4F8YA 4KHPB 1MA0A 2M6KA 2V98A 1OKKD 1LKZA 3ABRB 3BK1A 3H3FA 2ZTSA 3Q85A 4ESVA 4QQNA 1GFSA 2OORC 4X00A 4WXEA 2CMHA 5LZ2A 2E7ZA 3W1VA 1MGPA 4Q7QA 1YJBA 1QPZA 1U0SY 1JFVA 2WSYB 4EF5A 3F6RA 4W9NA 4KIFA 3RRNA 5FV7A 1FRQA 5TJHA 4AY6A 2GXUA 4GGMX 1MAUA 1TO1E 3MTIA 2B2CA 5FOWA 3GLIA 3U7RA 3PGJA 1F9AA 1Q0HA 2K87A 1GO2A 2AQ8A 1HQCA 5HE9A 4TSFA 5CFZA 3TLGB 1GTJ1 1KETA 1V47A 4Q9KA 3A6JA 1IL0A 1U8TA 4NCHA 4UVDA 4P98A 5JG7A 4FFVA 4JXXA 2QMYA 2VNSA 2Q1UA 4LG1A 2QVGA 3CH5A 4C1BA 1C3OA 1LDMA 2JFQA 2DSTA 4LIPD 5LXTF 4AMUA 3BTOA 5A5VA 3E84A 2WT9A 3QKUA 4ZGGA 3HB1A 4PGGA 5C5EA 2Q7OE 3AJ9A 3GFSA 3VO2A 4URXR 3U4QB 1P9RA 2WKSA 2IOHA 3LFTA 3L7KA 4BO6A 4KXMA 2VTBB 1IBSA 3A1NA 1XZ8A 1M1YA 1EDBA 3G3EA 4C7MA 2OCYC 3DEZA 1UPAA 2AN5A 3ZD9A 5BQFA 3FVWA 4JODA 1Z6QA 2J0UA 2X4IA 2E18A 2JCBA 3AUTA 3FUXA 1D2MA 2FFAA 4Q3EA 4IO0A 1OWMA 4FS8A 3TZBA 3K2BA 2CDBA 4IXWA 4NZ9A 4O2BF 4REOA 5BN4B 5K3DA 5MFPA 3FZGA 1D1PA 3P96A 3Q7EA 3A9VA 3GDGA 3O1IC 1DXHA 2GXSA 3DLAA 3R5HA 4QRIA 1Y4ZA 5CGQB 2QQGA 4JHXA 5DSTA 3DPSA 3GEPA 3UH0A 4F2GA 3FHOA 3RFFA 1MOPA 2DUNA 5K51A 3ZYCA 4BE4A 3HKDB 1K98A 1U4NA 3HKBB 3TFOA 1OOEA 3M0EA 5HF6A 5A3QA 1ETUA 1NE2A 1U0JA 3IP1A 5HUQA 4AZWA 2FEPA 2RGEA 3Q6IA 4RCYA 2JANA 2D54A 2Y1FA 4LZNA 4QL3A 4YPFA 1WDTA 1QH9A 2V55B 1L5GB 1L4EA 2NACA 5F1PA 4F9FA 3ANMA 4EO4A 2CKMA 4L57A 4DMRA 3CT6A 2ZVDA 1F51E 1ZNWA 3UCXA 1UJCA 1G18A 4JU9A 1O6GA 1Z07A 1X2EA 3VHXB 1JG4A 1P0QA 1JG2A 2P68A 3FMIA 1R4NB 1RD4A 4EYSA 5A1TA 4WVFA 1ORRA 3TUJC 1ZOPA 2CFIA 2HU8A 3CVXA 5BW6B 2IOQA 3F3SA 2I7VA 3QE3A 4OJNA 2G8NA 1XX6A 2OR3A 4FYKA 4YDRA