2ZR0A

Msreca-q196e mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
326
structure length
316
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINELRETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
total genus 96
structure length 316
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr0A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr0A01
2F3TA 1XB2A 2XGJA 2FOLA 2QRZA 1JECA 1G291 3QKSA 4NYJQ 2Q0HA 4XWAA 4GL2A 2PEYA 3BIFA 3AEZA 4IRUB 1E2JA 1NIJA 2OM2A 5FPSA 1OXUA 5FFMA 4R98A 2A2ZA 4B2LA 1J8YF 2BV3A 1F5NA 4DRZA 4DUGA 4QG7A 2VQSA 3WBKA 1Q20A 1TQDA 4IDQA 5FBLB 1S9DA 5EZ6B 1Z0IA 2QAGA 4DLYA 1G20E 3SYLA 1R5OA 3B6EA 4M8NE 3R9WA 3IKJA 3T35A 1HH4A 3H0KA 4LOAA 4PC2A 3QI2A 1Q21A 1XTKA 4U02A 2YINC 1W47A 1CLUA 3CR8A 4PAOA 3NH9A 3RSLA 4DT1A 4BLPA 2V4ZA 1GILA 5JJLA 4C7OB 1QVAA 4FIDA 4GOJA 3Q8XB 3A1WA 1OXVA 5KDLA 1WB9A 4LYFA 2WOOA 2AWOA 4D2IA 4OHVA 2QROA 4YQFA 3BK7A 3WYFA 4CEIA 2R6CA 1II8A 2GF0A 1XCGB 3IBYA 1GZSA 1VPLA 3WHLA 5L3QA 4B3GA 2QGZA 4NL4H 1OB5A 1Z83A 5B58C 5BYKA 4TL8A 2ZJ5A 3FVQA 4PQYA 3NEJA 4WIAA 3ADCA 4B73A 2QP3A 3JZAA 1ZVQA 4MRPA 4US1R 4D4KA 2F9MA 1E4VA 1K8RA 1KTVA 3KX2A 5CDFE 1XDBA 4MRNA 1E1RA 3SU8A 1CS4C 4CYMA 2ODEA 3E5HA 1X8KA 4DUGD 3FHCB 4BZXA 1Z28A 1D5CA 1G7SA 1TX4B 4W9MC 4GI7A 3SR0A 4NCJA 1JPNA 2FWRA 3THWB 2CJWA 1X3SA 1DE0A 1GFIA 4L5BA 1MR3F 2IF0A 4UNNA 4XH9B 3PUYA 4QM7A 2VP0A 3OIVA 2VSFA 4HUQA 1IOZA 5JCPA 4QJ5A 3TGPA 1UKYA 2A9KA 3CRQA 4H9GA 1CULC 4TSFA 4ZDKA 5DN6A 4B71A 4JJKA 4EFLA 1IY2A 4A0RA 2XSZA 3TQFA 3RYTC 4EJSA 1ZM4A 2ZUBA 5EE3A 5B2ZA 1NLFA 4PC3A 1ZUIA 2ZI4A 3IHLA 2E9SA 2ZRPA 5EUQB 1OXSC 3FYHA 3MMPA 4DB4A 5HKKD 2ZJOA 4Q4HA 3V9PA 1E1RD 1XPRA 1NSTA 2AXPA 2JLRA 4Y0VA 5AJVB 5CDFA 3SJAA 2FDCA 4PZZA 1X8JA 2IEZA 1KIMA 4Q03A 3TUZC 4URXR 2WBLC 4JSYA 2UKDA 3RRMA 4LC1A 4G5QA 1S1CA 2EU8A 4OJQA 1E0JA 2VPPA 1D2EA 4PANA 1TUEA 2IXEA 3KKOA 4BASA 1Z06A 3C5HA 4CW7A 1W0JA 5A4JA 4TSFD 4IXNA 5DN6D 1DAGA 3NBZC 3B1WA 3AGQA 3K0CC 2WWIA 3IO3A 2ODNA 2XSZD 4LJAA 4S2EA 3SYKA 3ZDQA 1VYTA 2JAQA 1WQ1R 3GEHA 4DIDA 2O8FA 1E2MA 2VP4A 5TDHA 4XSGA 3K70B 1N6HA 4Z51A 2GXQA 5KDOA 3GLIB 3QJYA 1RPZA 1EXMA 1JXMA 5G53C 5JS8A 2ZE5A 3I4LA 4HZUA 4TQUS 2W0SA 5GVRA 3BBPA 4N3NA 3EW9A 5H68A 1AA3A 2XXAA 4LBVA 1YR8A 1E2NA 2G83A 4HB4A 4Q00A 1RYFA 4LBZA 4ESHA 4OK5A 4PSKA 2W58A 4O2LA 1U9IA 2FGJA 3NWJA 4B32A 4B6EA 2ZSDA 2QAGC 4MYHA 2PT5A 2PZEA 2JLXA 3B1VA 4LZZA 3W5IA 2CCGA 3CX6A 3W6NA 1XTQA 4JLAA 4DSTA 3VHXA 1NJGA 4L9SA 3WBJA 2C95A 1N6PA 2KJQA 4NU0A 1ESNA 1NMXA 4TMXA 1JI0A 2QE7D 1FW6A 5K8IA 2XZLA 4JL5A 2R6DA 1DOAA 1KY2A 2ECKA 2CEAA 3T1TA 2BMFA 2NMVA 3OE7A 5A5GA 1LTQA 4HLUA 2I1VB 1KOFA 1CKEA 1ZBDA 3ASZA 3OAAA 1P60A 1CJVC 3VQTA 4B3DA 4B3FX 3HR7A 4C0SA 1UF9A 4O25A 4Q1DA 2I4IA 3LNCA 2C9OA 5BXQC 2C77A 2JLQA 3I8XA 3CRW1 3I8SA 3KKQA 4UNQA 2JJ2A 1ZNWA 1KAOA 1N6KA 4EFMA 1R0ZA 1YQTA 3GJ3A 5D3MB 4BLTA 3EZ7A 3ASYA 1E9BA 5CM9C 4W5HA 2B7CA 4ZO4A 2DY1A 2WJHA 2V55B 1KAGA 2YKGA 4UNSA 4KVGA 1PV4A 3AF3A 4MYCA 5UKDA 3THXB 1BIFA 2YNMA 3BFVA 4E09A 2PMKA 1G64A 3KUDA 1YZLA 3MLEA 4MYTA 4BRWA 1IJEA 2C04A 3K0AA 4PC7A 1YRBA 1E4YA 4D4LA 5JHHB 4D26A 1EK0A 4DLRA 1U2RA 1UDWA 1UPTA 3H4MA 2FNAA 3VR3A 3HYTA 3KZ1E 3TR5A 1OIVA 2GVZC 4EJSC 3ZVLA 3OE7D 2PMDA 4DDUA 5FOVA 3AVVA 4C0KA 4KAXA 3HPRA 4Z1MA 1UBEA 2KB0A 4J0QA 5LPNA 4M22A 1EFTA 1OB2A 2JJ2D 1FOEB 3EZFA 3TE6A 1UKVY 3GCGA 1LNZA 3L43A 1WMSA 3B60A 4YDHB 3ZQ6A 4CEHA 3CRVA 2VIIA 3T15A 3B1YA 1E9AA 2OCYC 4PPGA 1VHLA 3ZLJA 3S1AB 1HQYE 4FCWA 5DH9A 4V0OA 4PQFA 3PXGA 5JWHA 2WMOB 2ZVQX 4CEJA 3QKRA 3PUWA 4E03A 4UXIA 2GILA 4KXFB 4BEJA 1VCOA 1A7JA 2BIFA 2OHFA 3X1YA 1FZQA 2JATA 4B43A 4CGZA 4I4LA 3MJHA 3B85A 2ZRHA 4OHZA 1Z6TA 1PUIA 2NG1A 2OAQ1 1S8FA 3IQXA 2YJTD 1GKYA 2A5FA 1YR6A 1YU9A 4Q4JA 5CITA 1WA5A 5JJIA 1BS1A 2J5XA 4TTRA 4Q1CA 4PTLA 2GEVA 3KTAB 4LWZA 5E4FA 4ZCIA 3NKVA 1D2NA 2OBMA 1P9RA 5TARA 4QGGA 2CVHA 3PEVA 5DLQC 2IS1A 1XXHE 2B6HA 1E79A 3BWDD 3ZD7A 3AP1A 1IXRC 4QJ3A 1TQ4A 5JS7A 3SS8A 3AKEA 1U9IC 1G5TA 1HUQA 2ZR9A 1U90A 3P20A 4DLWA 2C78A 3DOFA 3GJ5A 2REBA 1CP2A 4FWIB 4KHZA 3WYGA 2EWVA 4NYJR 3ZQJA 2IYQA 1SKYE 1SVIA 3DKVA 2QPOA 4JLOA 4DHEA 2QN6A 2FG5A 4AG6A 2WKQA 5J40A 4LJ7A 1Q44A 3KKMA 2GJAA 4A6XA 2DR3A 4P4SA 1YRAA 4OQMA 4HLUC 3RRNA 3B13B 3UKDA 4BQSA 2J87A 1OIXA 2RCNA 1US8B 2QEQA 4NYIR 3GD7A 2PLFA 4RD0A 4WBSA 1OE0A 1N5JA 4MKGA 4YONB 1UBFA 1G6HA 1KI6B 1XZPA 2W6JA 5FTJA 2IHYA 3A6PC 3I62A 1DAKA 4KLZA 2JLVA 3BD9A 3K0EA 4NONA 3AVUA 3PVSA 1ZD9A 1BMFD 1Q1QA 1XXHA 4TLEA 2VBCA 2J0QA 5L3SB 2XEXA 2O0HA 5JSZA 4YMVA 2ZRCA 2NTYC 5TY0A 2RGNA 4U7DA 3LVRE 5KTYA 4IEEA 2YC2C 4LHXA 4LUCA 3NDPA 4OQFA 2VSXA 4HDCA 1G7TA 4TMKA 2O8BA 2Q21A 4D82A 4B33A 3UK6A 5F9HA 3FHOA 1YZKA 4DEYA 1KK3A 1KDPA 1CJKC 1AKEA 5EXXA 4RZ3A 1MABA 2IEYA 2GNOA 1SVMA 3K9GA 2D62A 3LXXA 2RMKA 5EP3A 2QGNA 5LB4A 2F1JA 4AIIA 3AB3A 1KNQA 1VIYA 2FN4A 4MQBA 3QPVA 4PO9A 3GLHE 2W2VA 4NCIA 5E3HA 2OESA 1T8TA 5BQ5A 3CPHA 1OH7A 2AR7A 2FZ4A 3PUXA 4DB2A 2X19A 1HY3A 4GZMA 4GNKA 4EPVA 3U4QA 3OFNA 4I1SA 2ZS7A 2FFQA 2BC9A 1I2DA 1C1YA 1CTQA 1XJQA 1NL3A 3ECCA 1NVUQ 2ANCA 5EE0A 2BMJA 3L8YA 1FNNA 1W4RA 3I3SR 3PEWA 1GTVA 1WRBA 2ZYUX 4RVCA 2WKPA 2QORA 4PR0A 3CR7A 2PZGA 2AK2A 2VHQA 1YR9A 2BM1A 1QRAA 3R9XA 1OW3B 2QAJA 5DNYB 3EC2A 2WWWA 4ZI3A 3EASA 2EW1A 5HR5A 3SNHA 2MSEB 2ZTSA 4M0LA 4G5RA 4JLBA 1RRFA 4F92B 5F9FA 3EZ9A 3GLHA 4FINA 4YLGA 3QKTA 3MFYA 4M4SA 1RE0A 5KNDA 3B9QA 2ZEJA 3SBEA 4I1VA 1P62B 2CBZA 1KO5A 2UZ3A 2V54A 1QG4A 3OFND 5FTLA 1A4RA 2C9CA 1XEXA 1BYIA 1IJFA 4MRSA 1ZUNB 4IOJA 5CM8B 5KO2A 1MO4A 4L16A 3CIOA 5CIWA 2D7DA 1E94E 4EPRA 1G3RA 5EXPA 5IF9A 4TYYA 4JKYA 1F2UB 1KK2A 1RFLA 2OFXA 1ODFA 2XTMA 1R8QA 4TZ6A 2GAAA 5KNCA 2ZSEA 1A2BA 2NGRA 4G5GA 1NVVR 4ACBA 4EFNA 1KO1A 2JASA 1IN5A 3LW7A 2FA9A 3K09C 1IQPA 3TUIC 1GSIA 3I5XA 2N42A 2RGAA 4F7WA 3EPJA 4ON9A 2GXSA 5KSPA 1GP2A 1Z6YA 3P26A 4FMBB 1F2TA 4LV6A 5DSZA 3THYB 4YMWA 1G8HA 2D2EA 1KSGA 5KSOA 3NDBB 2ZU0C 4KBFA 5FTNA 3SC3A 5BYJA 4M9XA 3BB1A 2Z43A 1FQJA 1EESA 4F93B 3E2IA 2ZRDA 1RKBA 2QENA 3AVYA 3PUZA 3Q3JB 2DB3A 3A1TA 1F48A 4C0AC 2QG6A 1Z47A 4PO8A 1P2TA 4NTZA 4Q9HA 5JWOA 1S96A 2RGNC 1IN7A 1J99A 3AP2A 1S3SA 2QBYA 1S1MA 5TXGA 4C30A 1AK2A 1HEIA 4OJKA 2DWOA 3UMRA 4QXAA 4YXWA 3J81k 1RJ9B 1XEWY 4QGFA 2IBMA 3R20A 2C8VA 2IYLD 3KXKA 1CRQA 1LS6A 2GK7A 3KQLA 1YZNA 1EFUA 2FPKA 3HYRA 3TAUA 5E7JA 4D80A 3RC3A 1KJYA 4D0GA 4QC2A 3ICEA 1DEKA 4ZKEA 2HLDA 4BFXA 1RRCA 4OBEA 3UG6A 4WZBE 3IEVA 2EFGA 1KK0A 4QM6A 2DWPA 1ZIPA 3KB2A 3VU9B 2FFAA 4L9WA 2VYFA 2IUUA 1FMLA 4F4CA 5KPJA 1T9HA 4JBWA 3WRYC 5BN3A 2IT1A 3A1SA 2IXFA 2ZRIA 4M2LA 4LBWA 4RKFA 3EZ6A 2XX3A 5CYOA 3DO6A 2QL6A 1CIPA 2YWFA 4MGIR 2ZJAA 1P5ZB 4KSBA 4LYHA 3U7FB 1R8SA 2ZE7A 4OI4A 1TL7C 4XIGS 1C4OA 3GJ0A 4ESVA 5AWFC 2J1LA 1G7RA 4O3MA 4YXWD 4Q9IA 1DG1G 2D06A 2N1BA 4JVLA 2ERXA 4RSGA 3WHKA 4LPSA 4NCKA 3ADDA 1IAQA 2DWQA 1J8MF 2QPAA 5FL7A 1E9RA 1S4QA 4O2RA 4HAXA 3KUCA 1NG9A 1KKMA 4NCHA 1XD9A 2HLDD 2P3SA 2FFBA 3A4MA 3KL4A 3R7WA 4TL9A 5IDVA 1DO0A 1OIWA 2HXSA 1W7AA 3MD0A 2WZQA 2O8EA 1ZNYA 2WM9B 1PVOA 1AS3A 4JZKA 5FPYA 3B7GA 4A8JA 2R8RA 1NVXQ 4FN5A 3HP1A 3W5JA 2BCGY 4ZV4A 1KZGB 2XNSA 4MUBA 5JECA 3K0FA 1SXJB 1NN1A 4MRRA 3QF4A 3F5FA 3RRYA 1GDDA 4UKDA 5DHAA 2GCNA 4LJ4A 1Q1BA 4DKXA 2X8AA 2PJRA 1Q3TA 2YC4C 5FL7D 5EE1A 5K8UA 1OXTA 3NBXX 4LY6A 2F7SA 3V00A 2R6GA 3AF2A 3TSZA 4PPFA 1IBRA 1SVOA 3DMNA 4LJ6A 1VMAA 4UJ3A 4OHWA 2F6RA 1ESMA 2ORWA 4KI0A 2FMXA 1YZTA 4GMXA 4LHWA 3WMEA 2GJ8A 1FX0B 2AL7A 4D0NA 4LSGA 3UPUA 5E7MA 2OV2A 3AVTA 1VHTA 3IBGA 4XJXA 4DCTA 4DLZA 4PC6A 4PX9A 4LHZA 4B35A 1MOZA 1LF0A 2ZE8A 3FMIA 5A0FA 2QTFA 1E9FA 3B78A 3B82A 3IHWA 3LFUA 4LYJA 5HZHA 3PEYA 1R6BX 5KDDA 4MITA 1VG0B 2H8KA 4Q7LA 2ZRLA 4ZIRA 1U99A 1LFDB 1OKKA 1O87A 1JNYA 3JZMA 1YHNA 1UBGA 5CJ2A 4POAA 4HLDA 2AKAB 2VA8A 3TAHA 3GLGB 3QG1A 1W49A 4NYIQ 3ZIAA 1U0HC 2BEJA 5AJZA 4A2QA 2G1KA 1P61B 1DAMA 3B2EA 1Z0AA 2HUPA 1KO4A 3QXCA 4UXJA 1W4BA 5LDDC 1X86B 2XTZA 4US2R 1GOTA 1BH2A 2FPLA 2EFEB 2VHCA 2PBRA 3DZDA 2A3RA 5B30A 2WWYA 3CH4B 4WZAE 1G3MA 1VYUA 3KKPA 1COWA 4JBXA 4AI6A 4OKSA 3D31A 2PH1A 1G3QA 1WDTA 1F60A 4D6PA 2XNDA 4B34A 3T06B 1Z2AA 2ZROA 5HKKA 1E99A 1Z6AA 1CU1A 2QA5A 3FGNA 2P2LA 3NH6A 1F6BA 1OKKD 4LBYA 4QOSA 2OCBA 2O8CA 4R7ZA 1XZQA 1HT1E 3QXXA 3UG7A 4W7SA 4URYR 4WXPA 5FBVB 2J3EA 3TIFA 4JL8A 2PEZA 3ZIAD 2J0UA 5IT5A 4G0NA 4PHTA 1Z6GA 5JHGB 3CUEF 1H65A 3BC1A 3C5CA 4ARZB 3WYAA 2IUTA 5IK2D 1JR3E 3RSOA 1NKTA 2SHKA 3QNUA 3T1OA 3K8YA 2KBEA 4DSNA 1GNPA 3TVDA 3FOZA 1Z0DA 1NBME 3R9IA 4HLCA 1G3UA 3P32A 2H57A 4Q48A 2K5UA 1G16A 4RD4A 1P9WA 5EE9A 2Z6VA 1P9NA 3CNLA 4HDOB 3EPKA 1COWD 1GIAA 1QF9A 3U44B 3BFXA 3B9PA 2Z0MA 3FMFA 4XWKA 4C0QC 4Q1AA 1ZNZA 3A58B 2XNDD 3EC1A 1E9SA 2VO1A 4P4UA 2V9PA 1NY5A 2V7QD 4GOKA 4IXMA 4NP6A 4XSHA 1SHKA 4G1UC 3IO5A 4WVFA 1G8GA 2OXRA 4A8JC 4TTPA 1VCIA 1G6OA 3CH5A 3ETLA 4M1YA 2HCBA 5GJWC 2ZETA 2P0EA 2CE7A 4TMWA 1AZSC 4N0EA 3KJEA 4Q21A 1W1WA 2QP9X 3UIEA 1MRSA 3LRPA 1EG7A 5DE3A 1PZNA 4BFWA 2HF9A 4OI2A 2A5DA 3FWYA 4G5OA 3KXLA 5JI2E 4RZUA 2FJUA 5DI9A 5BWMA 1KSJA 1XTIA 4JLJA 2ZRFA 1D9ZA 5DGXA 5CK4A 5FUWA 4TYQA 2GZDA 4DZZA 1JR3A 4JYBA 2JA1A 4GFDA 1Z5ZA 2ZJZA 4JYCA 3FFAA 4Q18A 4PQRA 2ASEA 1ZM3A 2QQEA 3LY5A 2J46A 2QE7A 4BFSA 1P73A 4RFSB 1NBMA 3BB4A 2HYIC 4C7OA 1E2EA 3IIMA 5JBQA 3M0EA 4NBSA 3HPQA 2B8WA 2ZJYA 5BN5A 1XPOA 2F43B 2R44A 3I72A 1P2VA 2GBLA 4HB0A 4JT2A 1X8LA 3GJ4A 3T34A 4HAWA 2ZUCA 3N2EA 1DADA 4X8OA 1CJTC 1DAIA 1E2GA 1NVVQ 4XTCS 3QXSA 5EQTA 4KJZA 1HURA 4JVSB 2ONKA 4Q9KA 4DWJA 1KHTA 1L7VC 3U3JA 4B3BA 2IK8A 3L2OB 2VEDA 3AUXA 4V0ME 2X77A 2QI9C 5CYPA 2GZHA 4AK9A 5P21A 3W90A 4WAUA 4BRUA 4BZQA 2ZAMA 421PA 5B64A 1KMHB 2Q3FA 3QOFA 2F9LA 4KV9A 4NHOA 3THWA 1Z6XA 4X8HA 1JR3D 4V02A 5TB5A 1JJ7A 4PHHA 1E2LA 1IN8A 2NO0A 2XOKD 1QHHB 1N6NA 3BE4A 4QNMA 5EJEA 3HR8A 1NBMD 2VRWA 5KHOC 2WPDD 4JIMA 1EFCA 4M9SA 4BFVA 3QF7A 4DEXA 3Q72A 5AUPB 3T61A 2C2HA 5FOXA 3NVAA 2AD5A 2FEMA 2QMOA 1Z0KA 3MSXA 4Q7MB 4BLRA 3GLIE 2C99A 2C98A 3W8NA 4GDFA 1ZCAA 4A2PA 4RD6A 3LBNA 2IS4A 4O0MA 4QL3A 4HLQB 4MDFA 3HU1A 4YC7A 4CT5A 4JLPA 4PSAA 3CPJB 3X1XA 4LC0A 3O8DA 1ZINA 4IDPA 4JLDA 1MO5A 2QMUA 2ZAOA 2LCFA 3MUFA 4JKIA 4V0MA 3DHWC 3RS5A 2BWJA 2ZANA 3CLVA 1DVRA 5FI0B 2GCPA 4OK3A 4DCSA 3FFBA 3GLFB 4MH0R 4HI0E 1KJZA 3A8TA 2O8DB 4WXRA 4EPYA 4LHVA 1MKYA 3HU3A 2HXYA 4HZIA 1SKQA 3SHFA 2L0XA 2YWHA 4DLVA 2J0SA 1R5NA 4JLVA 1T0HB 1XFAA 2FU5C 3UATA 3N70A 3NEYA 4E5UA 1E2KA 2OAP1 2IA5A 3TNFA 5CJPA 4Q1FA 1KDTA 3A1UA 3FTQA 221PA 1NLYA 1TU3A 2GWHA 1DPFA 2IYUA 2OE2A 2GDJA 4QGAA 2NZJA 2BCJQ 1N6RA 2HJGA 3VFDA 3RAPR 3PFIA 4Q66C 1A82A 3QE0A 5KUTA 2QTVB 4ZDJA 4ZDWA 1Z0FA 2R65A 2YOFA 3L0PA 4B75A 1TADA 4TMZA 3Q7PA 1A5TA 2Q9AA 4YDSA 2GTPA 2XJ4A 3GLIA 3UWKA 2OT3B 4OHYA 1PUJA 3I1FA 4BFTA 2QPTA 4DIEA 3U7HB 5F3WB 2P6RA 5DYGA 4Q19A 5AUQA 4HB3A 4DC9A 3PV0A 1RIFA 2OSBA 1ZW6A 4XVQA 1KSFX 1OFUX 2O0JA 2CLSA 2QRNA 3A36A 2X2FA 2WJYA 1DO2A 2IHBA 4LJ8A 2CCKA 2ZQ5A 3SJZA 2OLJA 4QKQA 3MG9A 1A2KC 1G8FA 2JLSA 3AVWA 4TL7A 1U98A 1ONBA 1G4UR 2EYUA 1XCPA 2AKYA 2X2EA 3BH0A 1FP7A 1SVKA 1TQ6A 3EWAA 1RRPA 2ZJ8A 2QP4A 3SOPA 1TUIA 2G1JA 3WMFA 2IWHA 4Z54A 1B23P 4PC1A 1NN5A 3H2YA 1E2FA 2QU8A 3CRRA 1JJVA 1G18A 3AVQA 4JMPA 4H1UA 3NIBA 4A2WA 2D2FA 1E0AA 4LJYA 2GBLC 521PA 4Q4AB 4A0FA 1E96A 2MSDB 3K70D 3LQRA 3ZVNA 1ZD8A 1HT2E 1JR6A 4B3CA 2GAOA 1JQLB 2VP6A 2W83A 1AS0A 4M53A 3QG5A 4I99A 2O0KA 4WZ6A 1ZC3A 4A9AA 4GT1A 3ZVRA 1DG3A 5BW8A 1DARA 1W2HA 3LLMA 1BMFA 3RS4A 2AFIE 1K6MA 2RGGA 1VG1A 5D3MA 5HTKA 1G5RA 3IIJA 1AQYA 3SQXA 3VHLB 3O8BA 2EFDB 1LY1A 3AKCA 1IONA 4D25A 3CPEA 5AUOB 1TEVA 4TYNA 2VP5A 3THXA 3ZS9A 1MT0A 1SZPA 4IDHA 5J4VA 4CZ2A 4JVNA 4P32A 1R10A 1Q1ZA 1XD2B 3DM9B 5JWRA 4C9BA 3QPWA 1N3BA 4K46A 3RHFA 4GSYA 2IYTA 3VKWA 3ZVMA 4A82A 3GJ7A 2BJWA 1JAIA 1S0UA 4QBIA 1CR2A 1YKSA 3O8RA 1S2MA 1J7KA 4BFYA 2OO7A 3TKLA 5FPHA 1X1RA 3NC0C 1ANKA 1TQ2A 2RHDA 4XWOA 5LD2B 1XEFA 3I32A 2DFTA 1II0A 3SHWA 1KSHA 1TNDA 3QUSA 1T3SA 3CZPA 2ATVA 2Z5FA 3E70C 3L0OA 3N5CA 4DBLC 1HV8A 5EP4A 3TVTA 5ELXA 2GVDC 1RW4A 3RLFA 3AVXA 3WNBA 3U3RA 3EARA 1G41A 1WCV1 3RS0A 2GCOB 2AD1A 1Q57A 3S1AA 1S9HA 1W36B 1E0SA 3MGCA 2JLUA 3CKLA 5HCIA 1KI2A 1KKLA 5HE9A 4JVMA 3TLXA 1T0JB 1VCMA 4IFEA 4C0HA 3OIYA 4IEIA 4EQ6B 1RYHA 2J7KA 2W2TA 3REGA 4NDZA 4DLXA 3CW2A 1XPUA 2RGBA 1N0UA 3IGFA 2WJGA 2JLWA 3VKHA 1QHSA 1TMKA 2O5VA 5DIFA 2Q6TA 2BKUA 2KWIA 2WWHA 3IIKA 4LX0A 4C3ZA 5GADl 1OH5A 3VKGA 1KO7A 3EA0A 2EFHB 2ANBA 4A0GA 2WSMA 3PITA 1N5IA 2P6NA 1A1VA 2H7VA 2WKRA 1ZRHA 2YWEA 4RFVA 3RVBA 1GNQA 3KTAA 1I4LD 2IYZA 5SZKB 3G0HA 2ZI6A 3FHTA 1K5DA 3RNLA 4KODA 2G0TA 3CO5A 2W00A 2XJ9A 3VR6A 3EXAA 2MMCA 1XBTA 3ZZTA 4JT4A 1SULA 2J41A 2ZXUA 2R9VA 3B1ZA 1SQ5A 1XMIA 1F3OA 3TQCA 1L4UA 1S3GA 2W6IA 3TMKA 2JJ1A 2Y8EA 1XEWX 5C18A 2UZIR 1ZUHA 1Z63A 1NY6A 4BWYA 2CHVA 1XRJA 5GJVC 3L8ZA 4RCZA 4Q7KA 2GZAA 4TLCA 4TWZA 1GRRA 1IN6A 2A7QA 4US0R 1CJMA 4RZ2A 3EWSA 1XWIA 4AD8A 5EP2A 1N0VC 1FPMA 2GJSA 2NPFA 3GEEA 1ZYUA 1I4DD 5LBIA 1BOFA 3AVOA 4ZI2A 1SGWA 5L3VA 1US8A 2BVNA 4AG5A 4MGYR 2KSQA 3QVUA 3ONWA 1K5GA 3BFKA 4FMCF 3M4YA 1KI6A 1NNEA 4PXAA 3C41J 2AN9A 2FGKA 821PA 1AZTA 4UNPA 1TAGA 3G82C 2A78A 3L82B 1JBKA 4QBFA 3LO5A 2XB2A 3OIWA 4MGKR 1XCMA 3PR1A 3TK1A 1KI4A 5L3SA 1R5BA 6Q21A 5FOTA 1VTKA 1YZQA 2I1QA 4D0LB 3M6AA 2W6ID 2A5YB 1VYVA 2JJ1D 1AA9A 3BB3A 1D6JA 3B5JA 5HE8A 3TBKA 1E69A 2IC5A 3C8UA 3UANA 1E1QA 2A5JA 3ZZ0A 5FTKA 4PPQA 4TTQA 1QBKC 3TSWA 3LWNA 1RVDA 2CHGA 4X8LA 3C14C 4IVQA 4M1TA 1KMQA 1OF1A 2QMEA 1R7RA 3PG5A 4RJLA 5J4HA 2IL1A 3F0TA 1LV7A 4FCTA 2VHTA 1LW7A 1VKJA 1KI3A 4M1OA 3QIAA 3NHAA 2ZYWX 8OHMA 1XF9A 2ZU6A 1EX6A 1XTSA 4PAQA 2ZIAA 2GXAA 3CX7A 1Q1EA 1QZXA 1OV4A 3EIHA 1AIPA 1YJ5A 3LAWA 4NE2A 1ZM2A 3QVVA 3TW8B 4ILEA 4BFZA 2G3YA 2DPXA 3FE2A 1GITA 1KGDA 5J4LA 3U5ZB 2J59A 2C9YA 4B76A 621PA 5HZKA 5KPDA 1FUUA 2Z4SA 2ZITA 3HJNA 3LBIA 3FMOB 2ZI7A 4JBYA 1M7HA 2PCLA 4F4IA 1UM8A 3MWJA 3TW4A 1E1QD 2XZOA 1MO6A 2ZREA 2WIBA 3KFVA 2RH5A 2REXB 3IILA 2JIZA 5TVKA 1QHIA 3OEHA 1GG2A 3H84A 1ZP6A 5DI3B 3FB4A 2VP9A 1PLJA 1GL7A 2WJIA 3GEIA 3IQWA 3D6TB 1R0XA 1OPXA 1W46A 2CVFA 2V6JA 3CWQA 4HEJA 2P67A 5FBQB 1NN0A 2BEKA 4CT4B 5IHPA 2WWFA 1E9CA 4NPHA 1ZMXA 3CBQA 2GXUA 5FOWA 4HAUA 2ZPTX 5FR1A 2UVQA 1G1MA 1AS2A 2O52A 1G4AE 1MV5A 5AK0A 4BE7B 2ERYA 4KVAA 4W5WA 4BLQA 1U94A 2YV5A 3LDAA 1ZM9A 2NO1A 4ITRC 1M74A 2FE4A 1T91A 4M1SA 2G9NA 1JEEA 3EZ2A 1O3YA 3CNOA 1N0WA 1HE8B 3VR1A 1VIAA 3QKSB 4TYPA 1BYUA 3BXZA 1XNJA 1MO3A 1KK1A 4MGZR 1DAFA 3V4FA 4EPXA 1UFQA 3BORA 3WP1B 3QEJA 3X1DA 1CR4A 3WXMA 2JIZD 1F2UA 3OEHD 3K0SA 5L8VA 3H1TA 3L0SA 2V1XA 3PQCA 3UWOA 4R2HA 1N5LA 5K8TA 1LVGA 2FSHA 4HAVA 1WBDA 1G3IA 2QAGB 4HYYA 2OG2A 1KI9A 4C2UA 4PO1A 3F8TA 3GJXC 5ANRB 2WJJA 1OH8A 4WW0A 2BHRA 1KI8A 1H8HA 5FOSA 2E1RA 4Q9LA 1ELOA 4ABYA 1H8EA 3TSOA 2G77B 3THYA 3CZQA 1ZU5A 3AKDA 3T5DA 4DT1B 5IRCD 4AKGA 5CB6A 1V43A 1DAEA 1VDZA 2WSSA 4FXPA 4GP6A 4XD7A 3CF6R 4P4TA 3SZRA 5FUXA 3QXHA 1EX7A 3ZGXA 1ZJ6A 3P4XA 1G17A 4CEIB 1Z29A 1YVDA 1II8B 5L3QB 3QKUA 1M34E 1EFHA 3BGWA 4B48A 3PCRB 4RY2A 5H1YA 3HDTA 4KFSA 3B1XA 1WXQA 2OLKA 2HYDA 2ZJBA 5DHFA 3R8FA 2IWRA 2XTNA 1OYWA 4HDQB 1SVSA 4NYMR 2CL6X 1RJ9A 2PJZA 1Z08A 3NHBA 4FW9A 3VNVA 4LPKA 4P31A 3IPYA 4B47A 1AGPA 3C16C 4CRWB 1AGRA 1Z0JA 1HA3A 1XU4A 2IS2A 2GJ9A 2OXCA 2CJWB 1UJ2A 3AUYA 1H8HD 2CL7X 5C2JB 5JI3E 3WMGA 2ZM5A 2IYYA 4HUQB 1H8ED 3GPLA 4S35A 4IDOA 3VU9A 1TF7A 2WSSD 2VF7A 1XP8A 4DVGA 4XD7D 2OFWA 4UNRA 2KE5A 4A4DA 2GA8A 4FMDB 3JVVA 3BRWD 3SJCA 3D7MA 4C0BA 1XMJA 1JB1A 1QHGA 1T5LA 4Q02A 4UXHA 5DYIA 5FUYA 1TF2A 3K0CA 1TPZA 4EJSB 5KYKA 1OSNA 3FKQA 2IS6A 2RKOA 2F1HA 3C7KA 5F98A 3TJZA 5CLLA 3QSYA 4KO8A 1SXJE 4XTRA 2HT1A 4DJTA 2R62A 1ZNXA 2CMKA 2W0MA 3PEUA 2D74A 1W44A 4KLNA 3G5UA 4Q4HB 5IK2A 4JS0A 3TR0A 1UDXA 2J7PA 3CF0A 1CR0A 4OQLA 5E7IA 1IM2A 1XD8A 3VR4A 1OT3A 5F2EA 1M7GA 3W3ZB 4A15A 2ZI9A 1YZGA 3BERA 4PHFA 2ZRNA 1JALA 4IKEA 3TUJC 4TZ0A 2D7CA 5JCZA 4A6PA 2ONJA 4RD3A 4A0HA 4TN1A 1DBSA 3WNCA 1NI3A 2WOJA 4PSVA 1UAAA 1N6IA 2V7QA 4JSTA 2QM7A 2FSGA 3SE0A 5JMTA 2DYKA 2ZSFA 3OHMA 2VF8A 4KFUA 5FBWB 3VR2A 5B57C 4F4JA 1KJWA 1NF3A 5FPKA 3AV0B 3B8HA 1M2OB 2QT0A 1LB1B 2O8FB 5FUVA 2ODWA 4YMUA 3RS7A 3DM5A 2RGEA 3O8CA 4TLDA 3GFOA 2B7BA 2NO7A 4JLKA 4QBGB 4RD1A 3SYNA 2AFHE 3GLGE 1AJEA 1SXJA 4HZUB 1WE2A 2GESA 2AX4A 2R6AA 2XXAB 2J7PD 1HTWA 1GNRA 2OFOA 4TMTA 5GJCA 4E22A 3KJGA 1CBUA 1P2SA 3RDPA 2HDNB 3EPLA 2NQ2C 2BJVA 4IOKA 4LI0A 2FSIA 1NMZA 1BO6A 3FMPB 3K9HA 2CCJA 2WIAA 1FX0A 2LKCA 1DELA 1Z3IX 1OXXK 3THOA 3H86A 2DFNA 4UQOA 1T6NA 3P4YA 4GBMA 4GPTA 2ORVA 3T1VA 1GL6A 2GRJA 2OCAA 2ZRGA 1NKSA 3A4LA 1G9XA 2EVWX 1ZIOA 3CRMA 4V0KA 1E2PA 2CNWA 5C46F 1NLZA 4URWR 3RS2A 1KDRA 3F3YA 4QHSA 1SXJD 4DXAA 2ZRJA 5C1BA 3GLGA 2P6UA 1GM5A 4AKIA 2RGXA 2KI5A 4M21A 5EUMA 3T12A 4DLSA 1Z8FA 2ZSAA 1KY3A 1JXOA 2TMKA 2MSCB 4R2IA 2IX3A 1FFHA 2XOKA 3GMTA 3DEFA 3LA6A 4M1WA 4QHYA 5EZ5A 5EE5B 2Q9CA 1J70A 5G40A 4BEBA 3EPHA 1UBCA 1TF5A 2WPDA 3GQBA 1WBBA 4HB2A 1N6OA 4Q5IA 4LCBA 4TLAA 5JRZA 1Z07A 2P5TB 4OQNA 4M1KA 3SJBA 3BH6A 1EWRA 2V1UA 4GP7A 1TEXA 3K1JA 3MWYW 1TU4A 2FZLA 3K0AB 4CF7A 2WWGA 2OUKA 3HU2A 3CONA 3MRSA 3NBFA 3DKPA 2BM0A 2QNRA 1EFRA 3DL0A 4JLNA 1E98A 2D3WA 3QENA 4I1OA 1G21E 1FUKA 5KOYA 3IUYA 1ZAKA 3C15C 2CNWD 4QHTA 1JPJA 5LB2A 4KFRA 3SFZA 1GUAA 2AXNA 4AYTA 3IPXA 1FTSA 1D8TA 2VTKA 4LJ5A 4UJ5A 3KKNA 2PX0A 1M8PA 2ZUDA 3AF0A 1SVWA 1ZM7A 2HJVA 2XZPA 4II7A 2RGCA 1E9DA 1RRGA 2Q3MA 1CF4A 4ARZA 4URZR 1M7BA 1DTSA 1OJLA 4Q01A 4CEHB 4URUR 2YWGA 3QXJA 3U60B 2YYZA 5TMPA 1I2MA 3CB4A 1ZCBA 2BDTA 2ORIA 4RZXA 3QEOA 4DDTA 4FWTA 2VP2A 4EDHA 4BLSA 4C4PA 4BZPA 4CEJB 3QKRB 2N46A 2ZR7A 1VG9B 1T3HA 4U5XA 3U44A 4F91B 1RC8A 1XTJA 2H16A 5CIQA 1ZC4A 3QQ5A 3P27A 5EP1A 2W2XA 1EFRD 4ACAA 5FH9A 4P0TA 1W0JD 1ZU4A 1W5SA 1FMJA 1J90A 1OLOA 1QHXA 1UEIA 4V0NA 3IDQA 1ETUA 1YE8A 1GKIA 1U0LA 3QBTA 2QY9A 1PLLA 2EFCB 4Q4JB 4RCYA 2WTUA 2ZYTX 3AH8A 1M1YE 1W5TA 4QGHA 5JEDA 3Q9LA 2QM8A 1Z2CA 4IOLA 1W48A 3PENA 1SXJC 1B0UA 4Q4LA 4LDJA 2PLRA 3U6BA 4P3YA 1OYYA 4OK6A 3U61B 2ZI5A 3OESA 4I81A 1XMSA 3U3KA 3LV8A 2ZE6A 5G41A 4DDVA 1OH6A 5J4YA 5JFGA 4ZCLA 3K9NA 2R2AA 4NMMA 1IY0A 4G3XA 3W9YA 3AP3A 4DLUA 4AC9A 3KQHA 4TMVA 1Q12A 2ZRKA 1R4AA 3DZ8A 5DISB 1I4TD 1PJRA 4RFSA 2NIPA 1QG2A 2ZR0A 1XTRA 3K9LA 2RAPA 3U2QA 4LV5B 1G19A 2F43A 4LV8B 3FDIA 4BLOA 5EXTA 2ZRBA 1NIPA 4MKHA 3BJIC 1CRPA 4IW3B 4NZYA 4P4SB 2NO6A 2Q9BA 3W6PA 1SHZA 1FTNA 4I1UA 3I73A 4MUAA 2QUZA 3OAAD 4OI1A 4L4UA 2DFLA 3RANA 4Q7JB 1HE1C 5JJKA 4GZLA 3WNDA 4IVPA 2XAUA 4QJ4A 3GLFE 3C4JA 5FBRB 4LYAA 1YZUA 2AWNA 1OFIA 1KMHA 3DVLA 4DCVA 1XXHB 1KI1A 3FPAA 4V0LA 5HCNA 2FH5B 1Q22A 1WP9A 3WP0A 4IHQA 4CDGA 5AUNB 5JSZB 3D3QA 1QHHA 2VSOA 2RB4A 4YMSA 2EWWA 1E6CA 4E07A 1UKEA 4B2PA 3SI7A 2O8BB 4HATA 4ASUA 2FPMA 2QSYA 4NYMQ 1SKYB 5J47A 2FEOA 2YZ2A 2C96A 2EQBA 2F1RA 1NRJB 3QY0A 2HF8A 4PFSA 4WOPA 2JEOA 3DMDA 3RS3A 1KO8A 1MABB 1JQJC 4KITB 2B92A 4TYWA 1L8QA 3V4RA 2REOA 3NC1C 1Q3HA 4Y0AA 3SFVA 4DSOA 4LRWA 1AM4D 1UKZA 1U81A 5AJWA 2IXGA 2P65A 1YR7A 2ZJ2A 3JVUA 4M1MA 3RRZA 3KQUA 3AM1A 2QT1A 4IFBA 2NOAA 3GJ8A 2RHMA 2V3CC 5CK5A 3EAQA 5FI1B 4PPNA 1QDEA 3VNUA 1G8YA 4Z1MD 5JRJA 5C4GB 1FL9A 2J0VA 2H18A 2PL3A 4W5JA 2XITA 2WWXA 2G88A 1N2CE 3GLFA 2FV8A 3REFA 2D4HA 2BBSA 4GOXA 2O8DA 3X1WA 4LK2A 4EUNA 3WY9A 5AJYA 2WICA 3U4QB 2IYSA 3KJHA 4K81B 2BBWA 4C0LA 2ZYVX 1GRNA 1MRNA 4CVNA 1G8PA 5CLQA 4HAYA 3T5GA 4OL0A 1JEDA 4NH0A 1RZ3A 2QZ4A 1E0KA 3CNNA 5AJXA 4ASUD 2VLIA 4Q1EA 4EKDA 3GFTA 1OFTA 2CE2X 4Q9JA 2CXXA 2PZFA 3CM0A 1P75A 2VHJA 3ZD6A 1FP6A 3DOEA 5FPTA 4YMTA 4MKFA 3K09A 3MWKA 4G01B 3ND8A 1KNXA 1UEJA 3DPUA 4GMDA 1BKDR 1II9A 5K8LA 1G7CA 2BOVA 3X1ZA 3PJRA 4NKRA 3WRXC 4DCNA 1GKUB 2WHXA 1U0JA 1QVRA 3GLHB 3BS4A 1FQKA 4K8OA 1E79D 3Q7QA 4KU4A 5KSZA 3M1IA 3W34A 1AQUA 5FTMA 3W6OA 5KU1A 2A5GA 1XEXB 2MMGA 5J5CA 3UMFA 2HV8A 5JEEA 1P7CA 2H17A 1T4GA 3CWZA 3BOSA 4MRVA 5SZJA 2WV9A 2Z83A 2GETA 4IVRA 4IJMA 2GHIA 1Q0UA 1P6XA 3BAFA 2ODBA 2QQ0A 1J2JA 1AKYA 2KBFA 2VH5R 1NG1A 2VL7A 3KXIA 4TLBA 3K70C 2IYXA 3KQKA 4ZDIA 3CX8A 3O47A 1KZ7B 3A1VA 4Q4AA 2WVJA 2DHRA 3PUVA 4B6FA 2WAYA 3HWSA 3LQQA 4XVUA 1JAHA 2LKDA 4BPBA 2JLYA 2ZVPX 2BBOA 4GRAA 1F2TB 5FL3A 5JZVA 5GJBA 3LVQE 3NG1A 4LJ9A 4RD2A 2E87A 4HUTA 3BH7A 3MJRA 4QBHA 5G3YA 2AHOA 2W6JD 4HAZA 2WAXA 4G5SA 1HQCA 4R71A 3OEEA 2RGDA 4TQAA 4BFUA 3E1SA 3EG5A 1W2GA 3SBDA 2QBYB 1XD2A 2H1LA 2QTHA 1M6NA 3OZXA 2IW3A 3ZH9B 1LF5A 1G5PA 3W8RA 1E2HA 1DS6A 1W4AA 2OCPA 3KB1A 4QRHA 4AWXA 2ZRAA 3NXSA 4DDWA 1NSFA 5SZIA 2QMHA 4BECA 4JL6A 2I3BA 4L15A 3SQWA 4D4MA 1P3JA 3U6KA 4Z8YA 3VR5A 5KSYA 4KSCA 121PA 4M9QA 1XMVA 2JDIA 4TQ9A 3RABA 2HEIA 2J9RA 1R2QA 3AGPA 2OBLA 4RKEA 2DFKB 1NP6A 4P33A 5M04A 2GF9A 4PZYA 3U3OA 4M9ZA 2GEUA 2BKEA 1XX6A 1HYQA 1XJ0A 2J45A 2R6FA 3KQNA 1OFHA 4U00A 2OBNA 1GRQA 3LXRA 1DAHA 2NZ8A 1Y63A 2VHUA 1EWQA 2H92A 2GCOA 1E9EA 1P2UA 5KNBA 1N6LA 1N25A 2CK3A 1IXSB 1N5KA 2FX3A 3AF1A 3VAAA 5D3QA 4DLTA 4KBGA 3OEED 3X2SA 3GJ6A 2YOGA 2QSZA 3MWLA 5J4KA 1AN0A 1U8ZA 4ZKDA 3A4NA 2C03A 3KFXA 1D9XA 4EQ6A 2CLCX 1E2DA 4XOIA 2CL0X 1KDOA 4KFTA 4AY2A 3I5YA 2C5LA 1GL9B 3ICQB 4JLMA 2F1IA 2HT6A 2IYWA 4EIWA 2Q3HA 3W3AA 2JDID 3P1JA 4H1VA 1GVNB 2ZRMA 2FF7A 5FOUA 2PCJA 2EYQA 4EPWA 4MYUA 4B2IA 2ZI3A 4B44A 3R7WB 1U8AA 3EIQA 4EPTA 3LD9A 1IN4A 2DCUA 3LX5A 1W4CA 2NO9A 2O8EB 3U7EB 4FMCB 4V03A 3TH5A 2F55A 5GVSA 1TTTA 1VG8A 1W0KA 1CEEA 1X6VA 2A30A 4N0DA 4OYHA 2LWIA 2CDNA 1D2MA 2CK3D 1V5WA 3SEAA 4FCVA 4B3XA 4A8JB 3K53A 1W36D 1QHYA 4D4JA 3L0IB 2YOHA 3RWMB 5CB8A 3MAAC 2FSFA 2XB4A 3AQ4A 2B8TA 1KYIA 2V8OA 3NTUA 3T1QA 4ERNA 4MDEA 5FR2A 5G3ZA 1CR1A 3MCAA 2PT7A 4TL6A 4DSUA 3K0FB 3N2IA 1IHUA 2GJKA 4QNRA 2B21A 2HCJB 3QF4B 4OI0A 4OQXA 1NJFA 4BGDA 2BMDA 4B74A 1P4SA 5EXSA 3LLUA 1E3MA 4NCNA 3SN6A 3NBYC 1GWNA 3RC8A 1VECA 2CLDX 4KCGA 1PLKA 4TT3A 1QHNA 1Z22A 4X8MA 3GP8A 4R9UC 3VX4A 4FD2A 3ZZUA 3U7GA 4URVR 4A36A 5H8WA 3LBHA 3GFPA 5SZHB 2WMNB 3VX3A 2OEPA 1GAJA 1NN3A 1W0KD 2WJVA 3EA5A 3LH5A 1OHHA 3SDZA 2GEDA 2V6IA 1R0WA 2OZEA 3IEUA 5L3RA 4EAQA 1E32A 3AKYA 3ND9A 1X1SA 4ZIRB 3VTKA 3CF2A 4IDNA 5JLJA 1CXZA 5H70A 1R0YA 3Q5DA 2P5SA 2YVUA 4ZPXA 2GK6A 1E2QA 3ADKA 1P72A 2CHQA 4A1FA 2NPIA 4F38A 2AK3A 2GKSA 1L4YA 3AF4A 3FKSA 3EIEA 5AR1A 2OILA 3I92A 3PIRA 4XVRA 1MH1A 3ZS8A 2ZS9A 4A92A 4KYUA 5C4MA 1ZD1A 2JGNA 4MA4A 4TT3D 1NVWQ 5DO9A 1T5IA 2IYRA 4C2TA 3QPUA 1EGAA 4CIDA 2G0NA 3I61A 3DDCA 5LD2C 2FFHA 2JLZA 4OHXA 2JCSA 4IOMA 1C9KA 1FNMA 2Z4RA 4AYXA 2BBTA 1T8UA 4JJZA 2IYVA 1LS1A 1CJUC 4LGMA 3QBVA 1UADA 4HSEA 3R8CA 1OHHD 4FI3C 4FMDF 2G6BA 3EX7C 1U8YA 1IXZA 3LX8A 1SVLA 4MKIA 1W36C 3AVPA 1L2TA 5TV2A 1NMYA 1IY1A 2JJ8A 2O8CB 4AYWA 4Q1BA 1E2IA 3Q85A 4KYIB 2X1VA 3VMFA 3ZYCA 4QFMA 3TRFA 4PHGA 4WA7A 4AURA 4N1AA 4DCUA 3KDSE 2IF2A 2J0UB 3A37A 3FKSD 5DI3A 4ZCMA 5BN4A 2F3RA 3Q5EA 721PA 3OIUA 1T3LA 1VCNA 1KI7A 3LW8A 2ZS8A 1XJCA 4Q47A 3RWOA 2IUSA 3OF5A 4C0JA 3UMSA 5HPYB 3ADBA 1Y3AA 3D8BA 2ATXA 4Z8XA 3KJIA 1WF3A 2H5EA 4L8GA 4PAMA 2DBYA 3U3MA 4AKEA 4BUJA 2ZSBA 2BMEA 2YHSA 4LHYA 3ZJYA 5E95A 4AKHA 2PX3A 4D81A 3UXMA 4PZLA
chains in the Genus database with same CATH superfamily
1HRDA 1U0OC 1XB2A 2F3TA 2HLHA 2FOLA 2VC2B 2W98A 3COVA 2EGUA 2FQ1A 5CDUA 2W2PA 4BBAA 3PYMA 4H7PA 3GT3A 1TFUA 4NYJQ 3SYRA 1LJUA 4D9HA 3E35A 3AQIA 2QRGA 1VZ3A 3VYTB 1QSGA 3IQGX 2E4AA 2FKNA 4WKBA 1P0CA 4E1VA 5BNWA 3KSAC 4HRYA 4KE6A 3CLSD 1UBOS 3NJ4A 2X5NA 1DBRA 4AMVA 1B6RA 4DRZA 4MP3A 1QKKA 1FSGA 1XTTA 1LLQA 2Q99A 1CUAA 2QJTA 1X80B 5EN4A 1K6JA 4GMKA 3TD6A 5FBLB 1S9DA 3NALA 5LQRA 2QL5A 3R3HA 4WJLA 1J39A 3QHPA 1GYQA 1MDBA 3Q11A 4M8NE 1HH4A 1ULUA 3QNMA 4PC2A 4EHAA 1XTKA 1Y7IA 2V9ZA 1ZX1A 3A6HA 3T41A 4BNIA 1Y9AA 1JAYA 1CLUA 4PAOA 2ONZA 3AHCA 2V4ZA 3IAUA 1G2PA 4YV7A 1NBHA 4FIDA 4IIHA 3Q8XB 3A1WA 3PF9A 2YJZA 1JHUA 4QGBA 5F1PA 4BNJA 4Y6PA 5KOIA 4N8SA 1B3BA 4CBVA 4WNAB 3D6AA 1I7DA 1XA4A 1R0LA 3FWNA 4OHVA 3AJAA 3BK7A 4MKXA 3WYFA 3GG2A 3GUVA 1JQBA 2BEWA 4FMPA 2HD4A 1RDFA 4C87A 2XYVA 3K20A 5JPDA 1PS9A 1VPLA 2I9KA 4R51A 2XUFA 4H7EA 4CQLB 1L1RA 3FSJX 5B58C 1UDBA 2QDKA 4JUAA 5JH7B 2ZJ5A 3NUQA 1N2SA 4NAVA 1U7HA 4B73A 3OI7A 1ZCJA 2QP3A 5EHQA 4MRPA 1I13A 2BMWA 5CAEA 1FYEA 1SCIA 5HRAA 2VAXA 3OZCA 5IARA 1X8KA 1O8BA 3IXLA 4I9HA 1Z28A 4A5OA 4RJTA 2H2HA 3RVJA 5LQCA 1EFLA 4N7BA 3TMYA 1JLKA 5TQ2A 3AZQA 5E6SA 2XIJA 2H1HA 4NCJA 5TT0A 2NTJA 1N5DA 2V6BA 3ZE2B 3ZNNA 4ATNA 4I3GA 4DR5B 4QRDA 4RHEA 3ZY6A 2WT4A 1CRZA 1GFIA 1GVHA 2H29A 4JYPA 1B1AA 1OAOC 1F1BA 4LWQA 1LQ2A 5JYBA 2VSFA 4HUQA 1U2DA 1NR7A 1EHCA 1P0PA 1DX6A 1YQGA 2PKEA 2O2YA 2QNIA 4RSRA 5JCPA 2P6MA 2XCSB 3H2KA 2AQHA 2X8JA 2RI6A 2WDZA 5IVKA 1WUKS 2A9KA 1IZ8A 4UBMA 3J81A 1CULC 4TSFA 5BWCA 2P1ZA 4MI6A 2OQ2A 3VAZA 3R6WA 4ISCA 3THYA 3OSUA 1QCYA 3IQDB 2ZVDA 4FS3A 2J08A 3TQFA 1Y3DE 1ATZA 1FUIA 2YXNA 4ZZ2A 3DAYA 1SUAA 5KTMA 3BRQA 4HQNA 3GFBA 2AR0A 3GAZA 5EE3A 2GK4A 5G0TA 5AW6A 2PSHA 2VNAA 1ZUIA 3GB9A 4LF4B 2AFHA 1N57A 3FYHA 1V16A 1OYOA 1IBSA 4F5EA 2NU8B 3TX6A 5HKKD 4MUNA 8ADHA 4D9BA 2GQ0A 2R7NA 3K7EA 4GU5A 4ND2A 5JADA 2MHCA 4KUEA 2VQFB 1IEVA 2Y0CA 5JNVA 4RTJA 1KIMA 3L7IA 3LY7A 1QZZA 3QMWA 3ZDXB 4C7XA 5HM8A 5HG0A 2WI8A 2KLHA 1Y1RA 2UKDA 4NMXB 2LVBA 4G9GA 3A6JA 4XAQA 1SUEA 2WWTA 2I7CA 1XWFA 3AEUB 4MCJA 4U63A 5BURA 3L79A 3HGMA 5LU9A 4PANA 1GEEA 2A92A 2XDQA 1WCWA 4IRXA 4BB6A 2AN5A 3KKOA 1IE3A 1TO6A 4BASA 4BLWA 4DYVA 3C5HA 3E8MA 1RZRD 4TSFD 4DLPA 4IUBS 4CTMA 3NBZC 3NKLA 3UJ8A 1F17A 2IGTA 3K0CC 2CF5A 2WWIA 3IO3A 2ODNA 1QC5A 1K08A 2WNSA 4PLZA 3D5TA 4BBPA 5BUQA 2ISSD 4QXQA 3GO4A 2YBDA 3SSMA 3KQVA 5NULA 4O4LF 1VMEA 2DUJA 4B6RA 1BCSA 6LDHA 4QOFA 3G8DA 3V5NA 3DF9A 4Z51A 2GXQA 2QTWB 2NXNA 3CLTD 3FCEA 4RSHA 3DYBA 1BRTA 3GLIB 5E3JA 1JXMA 2O7QA 3LUAA 3KELA 4LNUB 5JS8A 2ZE5A 2BGWA 4EYGA 1TUGA 2JJQA 2ZWMA 2J3IA 5GVRA 2HN9A 1JHAA 2FMIA 5J2TA 4IJ5A 1YR8A 5GGXA 4AVYA 1LDGA 4DBLE 1FFCA 3QH4A 1AQ6A 3CKKA 3G79A 4LBZA 1CZUA 3PFNA 3V1UA 4L50A 3V3TA 4PSKA 1RWMA 1U3GA 2W58A 5F78A 4ADSG 2PUWA 1JZTA 4X24A 5GONB 2QAGC 4AXBA 4Z2AA 2PZEA 4YRPA 3GL9A 4LZZA 4K1XA 3W5IA 4KE7A 2HIHA 4TWJA 3CX6A 1YR1A 4QX6A 4QWMA 2BE7A 1XK6A 1RCTE 1NJGA 4L9SA 4ND8B 4X92A 4LOHA 5IDXA 5CEEA 1ESNA 3K16A 3UC9A 1GU0A 4U2EA 4RDXA 1JI0A 2HMVA 1MX9A 3UH1A 3PHBE 1FW6A 1G21A 3RRXA 1CQJA 1EK2A 1KY2A 1QFZA 1MW8X 1FU7A 1RCUA 3ZZMA 5A5GA 1G38A 4HLUA 3VSCA 3TL2A 4X66B 1CKEA 1L1QA 3IT2A 2PKXA 4PWYA 2F59A 4E4YA 5ALQA 3HR7A 5A3QA 2YXLA 1BWQA 4QREA 1I2ZA 5ELMA 2C77A 2JLQA 1E5VA 3I8XA 2JFUA 1GGJA 3KKQA 1QMGA 4KW7A 4REQA 1ZNWA 5I7RA 1A8HA 1M8GA 1N6KA 3OZBA 3V32A 1YQTA 1R0CA 1LLCA 2V7BA 1Z0ZA 3SZLA 1JU9A 4F4FA 2H00A 3EZ7A 5DSTA 2B8NA 2BGKA 4BNVA 3ZDAA 1YE3A 3LUKA 1E9BA 2W6NA 4W5HA 1ND5A 2B7CA 3P0JA 3RHZA 2RGYA 1KAGA 2V55B 3FRJA 4FGJA 3E3MA 3RUCA 4A6EA 3RSFA 1LPMA 1UDRA 4F3RA 3C1UA 3G6WA 5C51B 4E09A 2PMKA 1G64A 3N8IA 1YZLA 1FK8A 4MYTA 3S4YA 3UA3A 3K0AA 3HWX1 4K6MA 2VNSA 4PAGA 5I6DA 1RYBA 4MWCA 1SZDA 3U0BA 3AI2A 3LZ6A 4ROSA 1C7FA 3FYTA 4FYJA 4ZEXA 2AG0A 2GVZC 4BRZA 1YA4A 1Q6ZA 4KLAA 4PLPA 2PMDA 1XP5A 3FMGA 3IMKA 3IUQA 5FOVA 4B6QA 4DIMA 5IXSA 1SCUB 3BREA 1BKYA 2FEPA 1SN7A 1DCTA 1EUDB 4XCVA 4NCBA 3H9CA 1QH9A 4Z1MA 4EHKA 4JP3A 1ACLA 2BLNA 2DERA 2EP7A 3E3NA 4M22A 3UGTA 1DP4A 4IMRA 1FOEB 3TE6A 3FYDA 2C0QA 1PJQA 3T5TA 3NM6B 4OQZA 4PFQA 4E51A 3ETEA 1KJIA 3HN7A 1E9AA 1ZIYA 4XRRA 1GRCA 4IR7A 3AR4A 2H1SA 4M83A 2K2QB 4EHBA 4ZGBA 4IIGA 5IYZB 1HQYE 5CFMA 5L53A 5C1DA 1A71A 4FCWA 4WACA 3FA2A 4N7JA 3H6GA 3PXGA 3SPXA 5K3FB 4CEJA 3GPIA 5ADWA 4HZGA 1VC2A 4UXIA 1GPUA 1KHHA 3BGVA 4KXFB 4O2BF 1LKZA 3F49S 1A7JA 3X1YA 4KQXA 5FORA 3W04A 4CGZA 1JFLA 2AC4A 2WG2A 1KYZA 3DMYA 2DHCA 3C1AA 3PDHA 2ZRHA 1K2WA 8ABPA 5FV7A 1PUIA 1KKUA 3B38A 1ULHA 3EVZA 4CDNA 5CDHA 2VUSA 4ZV9A 3IQXA 3BVPA 4WX2B 1R0RE 2YJTD 5FWYA 2A5FA 5EFOA 2O2IA 2M32A 3ZD8A 2I6SA 3DDOA 5CITA 1M72A 5A4IS 3HVUA 1W8IA 5JJIA 1D8AA 3HKCB 3HGTA 4EUFA 5EJIA 2GEVA 4LWZA 4V0RA 3DPSA 3KJNA 1DJPA 1PGOA 1D2NA 2OBMA 2RKWA 2WHPA 2WSLA 4MK4A 5HK9A 1J00A 2IS1A 2ZUVA 1ZG3A 3GHHA 3HN2A 5FF9A 1E5DA 1OT5A 1JKJA 1PYGA 1HT0A 1JWAB 2I4RA 3AOGA 3USES 3FGPA 4XCXA 1JLRA 5CDGA 4DV2B 1IXRC 2ATEA 4WOJA 1W52X 1XCOA 3QV1A 1J07A 3AKEA 2J5RA 4G0UA 1T5BA 2AQKA 5KEIA 4AY2A 3RJTA 1SXHA 3TGLA 3F1KA 5FJIA 3KLMX 5D84A 3FNEA 1P7WA 4ZAWA 1U7OA 4ZAYA 3MJEA 1L7PA 3WYGA 4HQOA 1TZJA 5JY1A 4ARUA 3LE8A 1F8GA 5I3ZA 1SVIA 2J30A 5EIBD 3VPSA 4JLOA 1LDEA 5EGNA 2IIVA 3NHKA 1RWPA 3QOWA 1YK1A 2JHFA 1DINA 3LT2A 5TVGA 3VNAA 4LJ7A 4NSNA 1GPYA 2GJAA 5TMEA 4CMJA 2R6HA 4KIWA 4P4SA 1YRAA 4JDUA 1R64A 4OQMA 4S1NA 1JSLA 2AW5A 2Q3DA 1H9BA 3B13B 3DW1X 4P5EA 4CKEB 2V96A 5FQOA 5KNLA 1QIMA 1WZUA 2PPVA 2RCNA 3VZBA 5LSAA 3CSDA 5JQGA 4FHCA 3A3NA 3KLNA 4RD0A 3MQFA 3RU9A 1OE0A 2TMYA 1N5JA 1JXQA 3CC8A 4MS3A 4LJSA 1DX4A 1H2FA 3NLLA 2BW0A 3BSWA 2QMQA 4NONA 4OGGA 2QRLA 4EB0A 3AVUA 4I7EA 1Q1QA 2Z1MA 4JI3B 2J0QA 3GJSA 3VA7A 1YU6A 3LG2A 1S89A 1U0FA 4LCJA 1FVFA 4WTOA 2A0WA 2JEZA 4YASA 4YMVA 3ANLA 5JSZA 4B1FA 3LVRE 4IEEA 2IIQA 3OKAA 1EI9A 1GT91 2IPNA 4JC8A 1HR0B 4O4JA 4E13A 3ND7A 1NMQA 3BIWA 4ZT5A 2UZ1A 2VSXA 1JEYB 1SCKA 5GY7A 3FUVA 4YP9A 2BGGA 1WV0A 4CG0A 2B1GA 2Q21A 3GJTA 1N34B 2WLTA 3RU2A 1NTOA 1TEZA 1YZKA 1KIFA 1R4MA 3T5AA 3MJVA 1KK3A 3IR6A 5SYMA 4AZ3B 4XWGA 3M6LA 1KDPA 1CJKC 2G17A 4IJUA 4B80A 2FZGA 2AN4A 1XROA 3HS3A 2OCKA 5B2FA 2BDUA 1NATA 4WXMA 5D8DA 2IEYA 1FMTA 4O1MA 1D0VA 1SVMA 2FWJA 2O3JA 3LXXA 3WK4A 1UT5A 3DQZA 4IQ8A 1D4AA 1H93A 4C14A 1B6TA 2BISA 3WB9A 4EGQA 1EBBA 5AOVA 1T6XA 2Q3BA 3PPVA 3ZDRA 4JMLA 1KNQA 2FN4A 4JUCA 1NXWA 3GLKA 4HNAB 4X5OA 3QPVA 3ZGYA 3WRYA 2F67A 2W2VA 5E3HA 4FWBA 4N5IX 2FRVA 5E8RA 5BQ5A 1SC4A 1MRZA 2BZSA 4KMSA 2XYPA 1VE3A 1WHSA 1P1CA 3CPHA 3PUXA 3W05A 3H5RA 1WNFA 2X19A 5B7QA 4Q1VA 2WHRA 1D1SA 3PX3A 4MAFA 1IBMB 3FYUC 4I1SA 1UXKA 2XE6A 3EFBA 3K94A 4ER0A 4N8DA 4MMXB 2YV3A 1C1YA 5ALNA 1IZZA 1HFWA 3IA7A 1V7CA 1O0SA 3BWMA 2AF3C 3ECCA 1X70A 2ANCA 2GR9A 1HK7A 3FPBA 2BMJA 4H7KA 1W4RA 1LDBA 2WA1A 4KO1S 4OP2A 3W1WA 3MD9A 1F5SA 5CGZA 1UMDA 1EVLA 3PEWA 4EG7A 3ZN2A 2FSSA 1M67A 4J6FA 1HLDA 5B7PA 2GD6A 3L8CA 3V4VB 2VDNB 2PZGA 4L0QA 2BUCA 2GWRA 4D9JA 4Y1RA 4YDQA 2VHQA 2JBAA 4EL5A 5CNMA 1BFKA 3L0DA 1OC2A 4JP5A 5GZ6A 4ZI3A 4MR9A 1HQKA 5TPWA 3ETHA 4IYJA 4OSPA 4R8VA 2MSEB 4RY0A 2DPMA 8GPBA 5J5VA 4AT1A 4YRMA 4DR3B 4GKAA 4G5RA 4BO5A 3LBAA 1E3EA 3N86A 5KAMA 5C7OO 3EZ9A 5AKJA 4QYMA 4YLGA 3QKTA 2JGDA 1SD1A 5FB3A 2A86A 3RTGA 1RYMA 2C5FA 1U3FA 2LW7A 2CBZA 3IDOA 4IAOA 5FTLA 1QG4A 2V8BA 3GRFA 1A4RA 4RH3A 1USUA 3A1FA 1BYIA 1RHKA 2O2ZA 4MRSA 1C1XA 4TV9A 4IOJA 5CM8B 2OZLB 5EYPA 1FCJA 1JEAA 4RABA 3ZE6A 4EB8A 2Y9PB 3WWCA 4EPRA 1TI7A 3ZX4A 5KVSA 3CMMA 5K0LA 1KP9A 1TK3A 2HMYB 3NFRA 4MP6A 1JFFB 1P3Y1 1R8QA 4E21A 2GAAA 2PV0A 2ZSEA 4B40A 1P7ZA 2NGRA 1K7EB 1KO1A 3CO0S 1NHWA 3JQ6A 1F9EA 4MKRA 5C52B 3V9AA 1Z6QA 4AZTA 3VR6H 1U9CA 3EPJA 4F7WA 2XNKA 2Z3ZA 2XKKA 4FFMA 1L3CA 3O75A 2B2XA 5KSPA 3TPFA 1QTQA 1Z6YA 4RV9A 3E27A 4FMBB 3WGYA 5DSZA 2RJOA 4NNJA 2JIMA 2D2EA 1KSGA 2NT3A 3AYZB 3OU2A 4F45A 3LC7O 5FTNA 1DXYA 4I9FA 1IUPA 4ZVTA 3GBSA 3JQAA 3UV6A 3LCVB 3BB1A 4KE8A 4OM8A 3I53A 2A59A 5K3EA 3MRTA 5AT1A 2YJ6A 3GDOA 1EESA 2PS3A 4DYDA 1EVIA 2QENA 4ZVRA 1IZ0A 2E4YA 3OQBA 4ALMA 4CKZA 1CYEA 3P97A 2DB3A 3GRVA 3A1TA 1O96B 4L7QA 4CTJA 3IAEA 1DMRA 1OFVA 1Z47A 1O4WA 1NI4A 1AKNA 1P2TA 2J3KA 3KR9A 2VNHA 5JWOA 1S96A 2NUBA 1IN7A 2RGNC 3H5TA 1K68A 3QE3A 5TXGA 1W1UA 3NTOA 2FMUA 4YH1A 4EHDA 1D4ZA 2DWOA 3J81k 1SKMA 1RLIA 4URFA 4QGFA 4RK5A 2W22A 4KXXA 2H1WA 2XUKA 1LS6A 3BD7A 2XQIA 3ZHYA 2FPKA 3HYRA 5LQUA 3ZHTA 4RGYA 3ZU5A 1M0TA 2FG7C 5E7JA 3ENKA 4D80A 3RIHA 2OD7A 4MCAA 3RC3A 1KQPA 3VDNB 4D0GA 3ISTA 3I9OA 3TW0A 4NBWA 4KZKA 3DV2A 4DPMA 5KCZA 5HSGA 5B3JA 3HACA 5LYJA 1LC3A 4IMJB 4AUMA 2DBRA 2UDPA 1Q0PA 2D7JA 3E9QA 3FAZA 1ZIPA 3KB2A 3IL2A 3VU9B 2FFAA 3JQAD 2FZVA 3B12A 3DZJA 4E2ZA 2AMYA 1G60A 4UM7A 3Q7SA 4M2LA 3M3DA 4AY4A 2JBHA 4F9EA 2BP7B 4WI1A 2HQSA 2PQ2A 3DO6A 1JIKA 1H2XA 3N6VA 4KWTA 4QXOA 5U4QA 3UMVA 4CLDA 5JZOA 4Y1FA 3MCUA 5KNCH 3NOXA 4ZMRA 1X19A 3LUFA 5K6RA 1Q6YA 1YRWA 1JJIA 5F5XA 2BHTA 3UWSA 2ZJAA 1NQVA 1P5ZB 1HX7A 5L51A 4K3UA 2ZE7A 4OI4A 1IK6A 4FBLA 3GJ0A 1TTHA 1G7RA 1NWHA 3IXMA 3T7TA 4CDRA 5IJ9A 2D06A 3WHKA 1FYVA 1R9JA 2HPAA 3B1JA 2WP8J 3ZJTA 4E2FA 5GM1A 1IAQA 2DWQA 4RW0A 3FOEC 1NU6A 4PG5A 3R7LA 4BUZA 3DLBA 5EMMA 3DZKA 3AUUA 3NHLA 4O3FA 4G09A 1E3TA 1XFDA 4MYRA 5B2EA 5JD6A 5IWAB 4JBIA 3QI7A 2P2GA 1SBQA 3ESAA 1XCLA 4TL9A 3GT7A 3ZYZA 3QEBZ 2HQBA 2HXSA 3JU3A 4I1RA 3MD0A 4ZARA 1X42A 2AI3A 3RC2A 4R81A 1J49A 1WXDA 4ZMSA 2WK1A 2NADA 2WM2A 3A6KA 4TM7A 1FRNA 3T3IA 4CDMA 2D0DA 1HMYA 1AS3A 3UAGA 3B7GA 3RFXA 4HNVA 3O21A 2R8RA 1OI7A 1AKWA 1NVXQ 2HSJA 2Q2QA 4FN5A 4JKOA 4TMYA 5A3RA 1S02A 2XZTA 1ECCA 3CMCO 2INGX 3MAJA 1EQUA 1Y4AE 1VBFA 3D5QA 3R6GA 4G8BA 4JHXA 4YVFA 5JECA 2NUPA 3DE4X 4FQ5A 5KVCA 2RHBA 1SXJB 1NN1A 4MRRA 2F4NA 5DK4A 1I1NA 3ILSA 3L93A 1PQUA 1RPAA 5DPMA 2IPXA 1JDVA 4LJ4A 3DO8A 4X6XA 3OE1A 3SSNA 3DBLB 3OP4A 3KJZA 4G23A 1E4EB 1OLXA 4X54A 2H1FA 1N8NA 1TECE 1FFWA 2R00C 1TYEB 3HLYA 3NHJA 3PNSA 4I55B 4Y8VA 1RKXA 1NAIA 3NBXX 4LY6A 2IU3A 1IBRA 1SVOA 1ZXLA 2V7WA 1LLUA 3PPXA 5HS6A 1X7YA 5IJAA 3RJ5A 3B9BA 5LMUB 2FWPA 1OZ0A 1VMAA 3CUSA 3R74A 2Q5EA 4ALLA 3PXCX 3KLPX 3IIEA 3R09A 2FMXA 1GNTA 5J59A 3ONEA 5FBKA 3GBPA 2AL7A 4D0NA 5LXTB 2VJBA 1L7XA 3T9DA 1WEKA 5E4YA 3VO1A 3W79A 1EU1A 3VYSB 4F1KA 5JYDA 3AVTA 3DL2A 4DCTA 4XJXA 4F6RA 5JZMA 5FRDA 5CBKA 1MOZA 3FMIA 2EP8A 1NNSA 3MGGA 1OBOA 2BH9A 2QTFA 3B82A 1ILWA 3PFKA 5A0FA 4BIIA 5JPCA 3OTOB 2ZG6A 4MITA 1S2NA 1VBNA 1VG0B 1K7SN 2H8KA 2CFSA 2QUAA 3IP7A 3G02A 3G2KA 4EX7A 1DBIA 5GINE 4M8SA 1WKBA 2GZMA 2E0IA 2NO5A 5DNUA 3M3PA 1SUDA 3JZMA 2VOEA 1UBGA 5CJ2A 4POAA 4BU0A 1P2FA 3KEGA 1B7GO 1PJZA 2EQAA 2GGSA 4YO7A 3SLKA 3TAHA 2GAJA 3I8OA 2C5HA 3G2QA 2G1KA 4M0FA 1DAMA 4FC7A 2R48A 3F46A 1Z0AA 1YH3A 1TZMA 3EQZA 2WU0A 2XTZA 5EFZA 4US2R 3ZG6A 3KDAA 2ODPA 1GV1A 4EVQA 3GH3A 3BICA 4YRFA 4DA4A 2JH8A 4RQAA 3GQBB 1LBQA 2FW9A 2C3OA 3IESA 3ME5A 4IINA 4BNTA 5I7SA 1C9JA 3RIYA 1CUHA 4R9NA 4JBXA 1G59A 4AI6A 4ZJZA 2AT1A 4OKSA 4TXLA 5TGZA 2PH1A 4CM6A 2P0AA 1WDTA 2R6R1 5C32A 1F60A 4N6NA 1EEHA 4IS2A 3LP6A 2ZDHA 2JHAA 4MVWA 1C9NA 4FEEA 5IAJA 2CSXA 2WSBA 3LBFA 4PLHA 4S2UA 1FFGA 1TZKA 5D7BA 2FLVA 4C43A 1MPXA 4F5YA 1CU1A 1VKRA 3KQYA 3FGNA 4GZ5A 1V6SA 2RBEA 1F6BA 3L40A 4LBYA 4QOSA 2OCBA 4TS4A 3HDHA 4R7ZA 5KMGA 2IP2A 3UG7A 4CM4B 4W63A 1TD1A 2J3EA 2XCQA 5H3HA 2XKAA 1P9OA 3R5FA 4JL8A 1ISGA 1R5JA 3TX2A 3LZCA 4PHTA 1L5GB 4ESOA 1H65A 4UOQA 2E85A 1AF4A 1ADFA 1Y4ZA 4B3HA 4ES6A 1DRUA 4OATA 4XD2A 2R86A 5IK2D 3HXOA 5DP2A 1C2TA 2CLKB 2SHKA 4JBGA 3T1OA 4IICA 3K8YA 4F3CA 2KBEA 1PFKA 4DSNA 2QR2A 2UZ4A 1XZBA 3FPLA 4TXJA 3N0XA 3W2FA 3DE5X 3T3OA 1GGNA 3VZRA 2PGAA 3LUBA 3B20A 2K5UA 3P32A 1G16A 2O2DA 4Q48A 1TU0A 3K6RA 4MAAA 4D41A 4HDOB 4JCOA 3QOYA 1BE0A 1C81A 2JGEA 2BKAA 1ODLA 1UP7A 2Z0MA 1Y7HA 5FWAA 4EKNB 3RT9A 2Y99A 2FQXA 1GZ6A 1UQTA 4HYQA 4Q1AA 4C0QC 4DXDA 3EC1A 3MWEB 4JI1B 4QJBA 1OZGA 4O5AA 4XM1A 2OYCA 1E6WA 1RFGE 1DMSA 4XSHA 1OGIA 3CLKA 4NP6A 4G1UC 4WVFA 1HDGO 4A8JC 2O2CA 3LL7A 1DFIA 1X1CA 4M1ZA 4EM6A 1YJBA 2C9BA 4EUKA 3KVNA 3CH5A 4M1YA 1PG2A 5D5HA 5CTAA 3WSWA 3OQPA 2EJCA 2F4VB 2D1QA 4U3JA 3FDFA 1HYHA 3NOVA 1I6KA 1AZSC 3W1EA 5LFAA 1KEEB 3WI7A 4BMOB 2QP9X 1MRSA 1Q7EA 1EG7A 3LRPA 3NNDA 4DWVA 2ZSKA 2HF9A 4YRNA 3WA7A 3KXLA 4OBXA 4Q7EA 1E60A 4YI5A 2GNPA 4HWPA 4JLJA 3LRXA 5FUWA 5CK4A 3CNHA 1CUXA 2GZDA 3ZTWA 4WZZA 3RROA 1OWPA 2XPCA 3CEJA 3F67A 3GP3A 2VZ9A 3R0VA 4G56A 1G8KA 3R1IA 4JYCA 3B6IA 4JYBA 4JOQA 4INJA 2ASEA 1U4OA 1TAQA 1ZM3A 5PGMA 3RHSA 3DVAB 1Q1NA 4CIBA 5DASA 2MR6A 3IV9A 5SY4A 5DOVA 3BB4A 1LI4A 2I91A 3BWCA 3ELYA 2RHGB 2ESRA 3V1KA 1E1YA 4OUDB 4L4SA 4K03A 1A9ZA 2B8WA 4BO2A 1KQFA 1XJ5A 3PXDA 5AQ1A 2FPGB 1EJBA 3B8EA 4L78A 1J4AA 2HJRA 3M5CA 4KQ2A 3K5IA 1P2VA 3T6KA 1U6IA 4Z6KA 3NTLA 5J2UF 2MYUA 3BMQA 3F5QA 4AG3A 4G0VA 4UUMA 5B6IA 2ZUCA 3N2EA 2H63A 3WIDA 4A3SA 2Q28A 3R24A 1CJTC 2RD2A 4HQFA 4KJZA 1JJFA 4MS4A 4Q9KA 5DTIA 4NJMB 5LOVF 2JI8A 2B4YA 3KYBA 4JROA 2OCGA 3EVGA 3ZU4A 2IK8A 4UMVA 3QFSA 2XLBA 5FJJA 2JZOA 2VAMA 2QI9C 1G5HA 3OE4A 4M54A 1AXRA 4DUZB 3PC3A 4IXWA 2ZIVB 3IVCA 1KMHB 3WGHA 3O93A 4EY5A 1NYQA 1FFEA 3THWA 2GKGA 2MJLA 4X41A 4X8HA 4V02A 2BFFA 3I52A 4X1IA 4H2DA 5CX1B 4PHHA 3IDAA 2NO0A 4MUFA 1XNQB 3HY6A 2QN3A 1TYDE 3KR0A 3BE4A 3DEJA 4U4AA 4D3XA 5EJEA 1EIZA 1ZISA 1EDOA 2XCLA 3LGSA 5HJ7A 4CKCA 1EFCA 2KHZA 2JCBA 4FKZA 3T95A 3VHQA 3BWVA 1P44A 4DEXA 2OG1A 3CT6A 1MOPA 1SAYA 3O4HA 3DHNA 3MT7A 5KSWB 1SU4A 1CQZA 1Q0HA 1ZOLA 1D09A 1UJCA 3T61A 2O19A 3JQPA 2AD5A 3A6LA 2BKVA 3EXEA 2RHWA 4GM0A 4U0KA 2C98A 4MI9A 4BGVA 9MHTA 3MZ0A 3HZOA 1MXFA 1DGQA 4RIHA 3BFJA 1U31A 3PGJA 4O4LB 1JSXA 1NUPA 4MDFA 2Y77A 1TC2A 1TQHA 2YN0A 3MINA 3FDJA 2YJ4A 4LC0A 3WKAA 3SIXA 1XRPA 2FK7A 4HXFB 3ER9A 4JLDA 2GN2A 1VJ0A 1YCGA 2YKQA 4FDTA 1Z17A 4E4TA 4WEQA 1RXIA 2C7PA 1PWYE 3REQB 1OWMA 4HAIA 3PQFA 2BWJA 3KTDA 3L7JA 2GCPA 4OK3A 4XB1A 3KOOA 1VSVA 3Q3VA 5A4MS 4LFBB 1Y5MA 3WRXA 1NYLA 1ZD2P 2O8DB 1FW8A 4N0QA 3VUEA 2HXYA 4XIJA 2ZIEA 2J0SA 2YWHA 3O9MA 3T1YB 4JLVA 2AE2A 2CLMB 2NSYA 2HA0A 4LVOA 3TNFA 2QTNA 1XU7A 4OM7A 3H8JA 4NS4A 4RJ2A 1SXQA 3ZWQA 4GKJB 1NLYA 4P35A 1YJXA 2GWHA 3L7DA 2IYUA 5CVVA 4A8TA 5HTOA 9ABPA 4XWWA 1LSSA 1N6RA 1XZ8A 3K5HA 3RAPR 4BVAA 1A82A 2AG6A 2XB9A 4KACA 1FP2A 1TM7E 1U02A 3CLTC 2YIDA 4DG8A 2R65A 1HXHA 2Y1DA 3OLCX 4DV0B 3Q7PA 1AV7A 4L1KA 4UDYX 4X7PA 4YDSA 4OHYA 4EMSA 3ZU2A 1F8XA 2P6RA 4Q19A 2BN4A 3AFMA 3A2MA 4MR8A 4DC9A 3PV0A 1RIFA 4XVQA 1P6UA 3Q9UA 1IHXA 5ETJA 2IU4A 1E62A 3DTTA 2V6MA 2QE6A 3TPCA 1HDRA 2DUWA 3ZK9A 3SJZA 1E2UA 5ERXA 2F8TA 4QKQA 1T2FA 1MHTA 1ZD3A 2JLSA 2RGWA 5TR9A 5FFFA 3R8XA 4XX0B 5CB4A 2VHWA 1GY8A 2ZIGA 3GHYA 1RBZA 4MW9A 5BOSB 1Z5GA 5KX5A 1FSZA 2QP4A 3E7DA 2G1JA 1LC0A 3EF0A 3KAJA 2IWHA 2E2WA 4Z54A 2FWIA 3N53A 4OSOA 4NQRA 2Q6VA 2V98A 3GZNB 4X1OA 2DMRA 4H4EA 4WXEA 4G1CA 1YBHA 2Q2VA 3AVQA 5BSHA 4LGVA 3TW6A 1XVTA 3C5VA 1ZCFA 3NUGA 2D2FA 3ORQA 4FDVA 1PJ3A 2HA4A 3CG0A 1GGHA 3SX4A 2VUTA 2GBLC 521PA 4Q4AB 2NXCA 4HP8A 2EAUA 5CVCA 4YWHA 2QN8A 3AF6A 3ZVNA 3QVLA 5EIEA 1PZGA 4B3CA 2OKGA 3K31A 4MEAA 3JWGA 2VQ3A 3CXRA 1NVEA 4MARA 2M98A 1ZC3A 4JI4B 4IBOA 4LFAB 4EGSA 5BW8A 1DARA 3LLMA 5HIIA 1RLJA 3ESCA 1BMFA 1QAOA 1RQ7A 3V3KA 1O5IA 3GROA 3RS4A 2AFIE 1K6MA 3U7RA 1WHTB 1L4GA 2RGGA 1V48A 3KPUA 1YDWA 3IIJA 1AQYA 5F73A 5IF3A 2O5CA 3HA2A 3SXUA 4M9RA 3O8BA 2EFDB 4R4JA 3URKA 1GFWA 1XCBA 2IHNA 3BX1A 2J33A 2IODA 2RG7A 3QLTA 1QTIA 1SBYA 2VP5A 4IKOA 4DIBA 3O8NA 5J4VA 4JN6B 4LTDA 2FEAA 2PRJA 3BM5A 2JFXA 2EX4A 4GR4A 3ADBA 1D3AA 1QYDA 4O2AF 3PFBA 3X43A 1XQ1A 4O2BB 4BQQA 2IYTA 1CEQA 3CE9A 5ITZA 3ZVMA 1I9CA 3CKYA 3CUKA 3V4LA 1JAIA 1S0UA 1CR2A 5ALZA 3O0DA 1E7QA 1D07A 1EE2A 1HM5A 3TKLA 5FPHA 2AXQA 4ZANA 1F4PA 2R68A 4FEAA 2J3HA 1WUHS 1YJQA 5LD2B 1F0NA 4B5KA 4AJNA 3B5IA 3CLUD 5AVOA 2W48A 1M8JA 1RLMA 1XEFA 4LN1A 4OEHA 3A4TA 4RMHA 4OVKA 4YACA 1IYZA 3OCWA 1TNDA 4YRDA 3FYSA 5C81A 4MICA 4Q05A 3WLJA 3STHA 1ISRA 4DBLC 2C92A 3LOQA 5EP4A 3OFVA 4YPOA 1Z0SA 5ELXA 4J1NA 4UMEA 1VQ1A 2AFIA 1PW7A 3AVXA 3HYNA 3WNBA 1PG0A 3UQZA 1Y6FA 1G41A 4BLVA 1JBEA 4U2CA 1SKUA 1OWOA 2AG8A 1Q57A 1N2BA 3PXAA 2BL4A 3S1AA 4UE6A 1S9HA 4M87A 3DZBA 3T9CA 1ZQ9A 3I2GA 1W36B 3T3MB 1E0SA 2IRWA 3MGCA 3CY6A 5HCIA 4QUJA 5KJEA 3WIVA 3I5AA 1KKLA 3NCHA 2XUZA 1VCMA 4IFEA 3KG2A 3O83A 3OPNA 2XCUA 4CL8A 3C4QA 2YS7A 2O8NA 1AN9A 2DHEA 4KJXA 2D4AA 3BQNB 1RADA 4MUXA 5H4HA 3VU0A 1N0UA 1EWYA 2WJGA 3AF5A 4MVJM 3ZHSA 4I66A 1U7UA 4BZZA 3I9NA 4E4RA 3ENZA 4BMVA 5TPZD 5GADl 3OC0A 2EFHB 2SNIE 3D5EA 4A0GA 1QIDA 3FTPA 3PITA 1A1VA 1ADJA 2C88A 1MMFB 5DKFA 3MQ4A 1J06A 2YJ3A 2ZYHA 1ZRHA 1H5QA 2YWEA 4DQKA 4KOAA 2CD9A 3II6X 2PS1A 1GNQA 3FY4A 4NECA 3GCXA 2ZI6A 1TYZA 1K5DA 4JJIA 3RNLA 1NI5A 3JQ7B 2XJ9A 4YV1A 3BMNA 1YASA 1XBTA 3ZZTA 3DJYA 1ZH4A 3USCS 3I58A 4I2NA 3N28A 1SULA 2KPOA 3D4LA 3SHOA 2Z2JA 4DUYB 2R9VA 5FXMA 4FX5A 1L5ZA 3E18A 3TQCA 3U48A 2C7OA 4MWBA 2YY5A 2R8ZA 1I6MA 4NBRA 3AERB 3ZZ1A 5M7EA 2JJ1A 4MW1A 4N82A 5FA5A 5EIBC 3UJ6A 3V4OA 2RK6A 3M6VA 4UPDA 1SA0B 5DP1A 5C18A 3OOEA 1WZEA 1KAMA 2WR8A 1ZEMA 1RKVA 4Y7DA 3BSFA 1YOVA 5BSWA 4DMGA 1JSCA 5GJVC 4Q7KA 1X13A 3SP1A 1SOWA 2G9RA 1A9XB 4KIGA 3Q12A 4MQLA 4OFBA 5DWVA 1LTHR 4ZVMA 4EG5A 3HA7A 5EP2A 1N0VC 1FPMA 1M6EX 1E1LA 3L18A 3GEEA 5DZSA 2NPFA 1I4DD 5L3VA 1I9GA 4ZI2A 2JFYA 1US8A 3FNIA 1OILA 2KSQA 4ZVPA 5D5QA 1N2JA 2AOVA 2J85A 3ONWA 4YJ2A 2D5LA 4UFNA 5ALOA 3LSTA 1ZA2A 2EBWA 4OHBA 4PXAA 4EEXA 1NNEA 2GI4A 2IEAA 4PE5B 2GD2A 4HDSA 2FGKA 821PA 2H2FA 4UNPA 1TAGA 2JHGA 3K6SA 3DMPA 2A78A 3DMTA 3L82B 4JEIA 1S2OA 4TLMB 3C6YA 3PDWA 5AW5A 5LZ8A 1XCMA 4W1RA 5K5EA 1KI4A 5L40A 1BJRE 3T5CA 1WO8A 3RJZA 4CGYA 1VTKA 3DXFA 5CHEA 3KYIB 2QDXA 1QGED 4D0LB 3M6AA 2A5YB 3AG5A 2C1XA 2JJ1D 4NBKA 2VR1A 2ZSJA 3QY9A 2PXHA 4ZICA 3BB3A 3B5JA 5HE8A 1M2VA 2Z6QA 3JQBC 4GQAA 5JCOA 4DARA 5KYYA 1EUQA 2PZJA 3IP6A 3ZE9A 4PPQA 1QBKC 1M6VB 1CY8A 2COUA 5CURA 1ZVVA 3K73O 4M1TA 4MV7A 5KVAA 3NYQA 2QMEA 4UW9A 1R7RA 1JWLA 2X2PA 2GSDA 3F0TA 1DT5A 1LV7A 1Z38A 3E15A 3ZHZA 1KI3A 4C76A 2NUAA 2HOQA 5I9LA 1W9HA 1L7BA 1XNGA 2CXQA 2PZBA 3ZCXA 2NT4A 2JB9A 1GAEO 3MFQA 1OB5A 4NEQA 3CX7A 3TQRA 1G5QA 1NJSA 3EIHA <