2ZR4A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNAAQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr4A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr4A02
2ZQSA 1FJDA 5HWBA 5HKGA 2DJYA 4DRIA 1NSGA 1KT1A 2KGJA 2MF9A 4TYOA 4N19A 3RGCA 1FKLA 4TW6A 3KAHA 2DK7A 3WH0A 3PRBA 2ZAJA 2RE3A 2M2AA 2PV1A 1HXVA 2XP6A 4JFMA 3UI6A 3H9RB 2KO7A 2ITKA 2MLXA 5D75A 1FAPA 1Q6HA 1QPLA 1U79A 1M5YA 3CNGA 3UQBA 2RUDA 2MDIA 2XP8A 4TX0A 5AHTA 1BKFA 4C02B 2Y78A 4GGQA 4DT4A 2ZQVA 3JXVA 2YSFA 3OOBA 1JVWA 1PINA 3O5MA 2LKNA 3CGMA 1TCOC 4DH0A 4MSPA 2F4EA 2M08A 5HW7A 1FKDA 2JZVA 4IPXA 2DG9A 2FKEA 1J4IA 2IF4A 2DG3A 2KE0A 3FAPA 1PBKA 4GIVA 4W9OA 4DZ3A 2PPOA 3GPKA 2LAJA 4JFJA 4NNRA 2RUCA 1F40A 4W9PA 5HUAA 2JMFA 2FAPA 3TDBA 2PV2A 4ODLA 3MDYB 3IKGA 2RUQA 2YSIA 2XP4A 1J6YA 2D9FA 1EG4A 3PA7A 2M8IA 2ZQTA 2JV4A 1NMWA 1FKJA 2YSHA 4R0XA 3VAWA 5BXJA 1D7JA 4LAXA 2ZR4A 2UZ5A 5HWCA 3RFWA 3KAFA 4JYSA 5GPGA 4IQCA 4DRKA 3I6CA 1Y0OA 4JFLA 3UQIA 1K9QA 2XP7A 2M8JA 2VN1A 5J6EA 2DMVA 4DRNA 2XP3A 4LAVA 2F21A 3O5DA 3L4HA 1A7XA 1D6OA 4E5RA 3ODKA 1FKFA 5HT1A 2MLYA 2MNTA 1FKKA 4U84A 1WR7A 1ROTA 2N87A 2RQSA 3EY6A 1W26A 4TNSA 4MGVA 1B6CA 2M3OW 5DIVA 3KCEA 1WMVA 2K8IA 1ROUA 2RSEA 4IQ2A 1Q6IA 1TK7A 3O5FA 1FKRA 4QIBA 4G2PA 1EG3A 3O5JA 3NTPA 1T11A 2KFWA 3IHZA 2KXQA 4DROA 4LAWA 1F8AB 4QT3A 3KAIA 1FKBA 2XPAA 2PV3A 5DITA 3CGNA 4DRMA 2KI3A 2BA1A 3O5OA 1FKSA 2MPHA 2XP9A 2RURA 2PPNA 4DRJA 4ODKA 4U85A 2L4JA 2XPBA 1FKGA 1EQ3A 1FKIA 4ODNA 3JYJA 4J4OA 3O5RA 2PBCA 2E45A 4FN2A 2XP5A 1QPFA 1NMVA 3KABA 3B7XA 4U86A 3O5GA 4BF8A 3NI6A 1ZK6A 1YATA 3UI4A 1D7HA 1JMQA 1BL4A 3LUOA 4ODRA 3M7NA 1Q6UA 1D7IA 4ITZA 1JNTA 1L1PA 3IKDA 1QZ2A 4ODOA 2YSBA 4ODMA 1J4HA 3O5KA 2JXWA 1C9HA 1J4RA 5B8IC 2F2DA 3M85A 2LPVA 1N1AA 4REXA 3TCZA 4JFIA 3IK8A 1FD9A 1JNSA 3NRKA 4TW7A 3TC5A 2OFNA 4ODQA 2EZ5W 5HTGA 3O5QA 2AWGA 3LE4A 3KACA 3O5LA 3UI5A 2ZQUA 4LAYA 2DWVA 2KR7A 5DIUA 2VCDA 2DG4A 1K9RA 4DRQA 2JX8A 2DK1A 2L2SA 1YW5A 3O5PA 1R9HA 4JFKA 3KZ7A 1ZCNA 1O6WA 4QT2A 5HW6A 2ZR5A 3PRDA 4W9QA 4O2TA 5HW8A 3O5EA 2ZR6A 4G50A 1KT0A 2M1IA 3JYMA 3O5IA 2YSGA 4DZ2A 4TW8A 4DRPA 2PPPA 1FKTA 4DIPA 4ODPA 3UF8A 2LJ4A 1EYMA 4DRHA 1I5HW 3KADA 4J4NA 4FAPA 5I98A 1FKHA 1P5QA 3UQAA 5CQ2A 2LGOA 1Q1CA 2MLZA 3KAGA 2Q5AA
chains in the Genus database with same CATH superfamily
1OWQA 2ZQSA 3ARZA 2WAEA 1EDQA 1FJDA 5HWBA 4S3JA 2DJYA 4DRIA 5HKGA 1NSGA 1FFRA 1KT1A 2KGJA 2MF9A 1E9LA 4TYOA 3WL0A 2DSVA 4N19A 3RGCA 1W1YA 1FKLA 4TW6A 3KAHA 3CH9A 2DK7A 3B9EA 3WH0A 3PRBA 2ZAJA 2RE3A 4MNLA 1LL7A 2M2AA 2PV1A 1E44A 1HXVA 2XP6A 1O6IA 4JFMA 1W1VA 4Z2GA 3UI6A 3H9RB 2KO7A 2ITKA 2MLXA 3CHCA 5D75A 1K9TA 2DT0A 3CHEA 3WD2A 1X6LA 1FAPA 2DT1A 5JH8A 1Q6HA 1TFVA 4MNJA 1X6NA 1QPLA 2YBTA 1U79A 1M5YA 1ZBVA 3CNGA 3UQBA 4PTMA 5DO2A 2RUDA 2MDIA 2XP8A 4TX0A 5AHTA 1BKFA 5DF0A 5GQBA 4C02B 3ARXA 1E6ZA 3MQGA 1SR0A 2Y78A 2P4VA 3W4RA 4GGQA 3ARYA 3BXWA 4DT4A 2ZQVA 3JXVA 2YSFA 3OOBA 1FLCA 1JVWA 4Z2HA 1JCHB 1PINA 4A0UA 1LG1A 1W1PA 1XRVA 1LL4A 3O5MA 1HKJA 2LKNA 3CGMA 3RM8A 1TCOC 4DH0A 4MSPA 3LKXA 2F4EA 2M08A 5HW7A 1FKDA 2JZVA 4IPXA 2DG9A 2FKEA 1J4IA 2IF4A 2DG3A 2KE0A 3FAPA 1PBKA 4GIVA 4P8VA 4W9OA 3ARQA 2G8ZA 4DZ3A 2PPOA 3GPKA 2LAJA 1NH6A 4JFJA 4NNRA 2RUCA 1EIBA 1RD6A 1F40A 1ZBCA 4HBOA 4W9PA 5HUAA 2JMFA 2FAPA 3TDBA 2PV2A 4ODLA 3MDYB 3IKGA 2RUQA 2YSIA 2XP4A 2PN0A 1J6YA 4Z2KA 3WQVA 2D9FA 3GTYX 4P8WA 4DWSD 1EG4A 3PA7A 2M8IA 2ZQTA 2B5UB 4L3NA 2JV4A 1NMWA 4HBEA 3ARWA 5E62A 1FKJA 2YSHA 3AQUA 4R0XA 3WD0A 3VAWA 5BXJA 3FSBA 1D7JA 4LAXA 4URIA 1H0IA 2ZR4A 2UZ5A 5HWCA 2DT2A 3KAFA 3RFWA 4JYSA 1D2KA 1HKMA 5GPGA 4IQCA 4DRKA 4ZPVR 3I6CA 2OWOA 1Y0OA 1E6PA 2G41A 4JFLA 3UQIA 1K9QA 2XP7A 4Z2IA 2M8JA 2VN1A 5J6EA 2DMVA 4DRNA 4AY1A 3FXYA 2XP3A 1E6NA 2QF8A 4Q7NA 4LAVA 2F21A 4WKHA 3AROA 3ARSA 5GPRA 3FSCA 3O5DA 3L4HA 3WD3A 1A7XA 1D6OA 3WIJA 3ARTA 2ESCA 4E5RA 4R5EA 3MQHA 4WKFA 3ODKA 1FKFA 5HT1A 2MLYA 2MNTA 3RMEA 1FKKA 4Z2JA 4U84A 1WR7A 1ZB5A 1ROTA 2O92A 2WADA 2N87A 4DWSC 2RQSA 5HBFA 3EY6A 1W26A 3AS2A 4TNSA 4MGVA 4MTVA 1B6CA 2YAJB 3RM9A 2M3OW 5DIVA 4LGXA 2ETNA 1IX5A 3PR9A 3KCEA 1WMVA 2K8IA 3ALFA 5E5WA 1NWRA 2YBUA 4KQZA 3CHFA 1ROUA 2RSEA 4IQ2A 1ZU8A 1JNDA 3FS8A 1FFQA 1Q6IA 1TK7A 3G6LA 3O5FA 2OLHA 1FKRA 2DT3A 4QIBA 4G2PA 1EG3A 3O5JA 3NTPA 1W9PA 2WM0A 1T11A 2KFWA 3IHZA 2KXQA 4DROA 4LAWA 1F8AB 4P8UA 4QT3A 3WD4A 3KAIA 1FKBA 2Y8NB 3RM4A 1KFWA 2XPAA 2PV3A 5DITA 3CGNA 4QZVB 4DRMA 1LL6A 3AS1A 2KI3A 1JNEA 2IUZA 2BA1A 3O5OA 1FKSA 2MPHA 2XP9A 2QRVA 2A3BA 2RURA 2WLZA 2PPNA 4DRJA 4ODKA 1NWSA 4U85A 2L4JA 2XPBA 1LG2A 1FKGA 5U47A 1E15A 2WK2A 5E64A 1NWTA 1EQ3A 1GRJA 1OGGA 3B9AA 2A3AA 1FKIA 4MPKA 1OGBA 4ODNA 3JYJA 4J4OA 3PRAA 4DWSB 3O5RA 2PBCA 2E45A 4FN2A 2XP5A 3QOKA 4WK9A 1QPFA 1NMVA 5E66A 1XHGA 3KABA 1W9VA 3B7XA 2F23A 4U86A 3O5GA 4BF8A 4UDMA 4MNMA 3NI6A 1W1TA 1ZK6A 1YATA 3UI4A 1D7HA 3WL1A 1JMQA 1BL4A 3LUOA 4ODRA 3ARVA 1SYTA 4Z2LA 3M7NA 1Q6UA 2B31A 1ZL1A 1TR8A 1D7IA 2DSZA 4ITZA 1JNTA 1L1PA 3IKDA 1QZ2A 1ZBWA 3ALGA 4ODOA 3AS3A 2YSBA 4ML4A 1HKIA 4ODMA 1J4HA 3ARUA 3O5KA 2JXWA 2DSWA 3BMBA 1C9HA 4WJXA 1J4RA 2PI6A 5B8IC 1H0GA 1GPFA 2F2DA 3ARRA 5E65A 3M85A 3PQHA 1WAWA 2LPVA 3CZ8A 1RP5A 1N1AA 4REXA 3TCZA 3G6MA 2A3CA 4KR0B 4W5UA 4JFIA 1ZBKA 1FD9A 1NWUA 3IK8A 1JNSA 3NRKA 4TW7A 3TC5A 2OFNA 4ODQA 4P8XA 2EZ5W 5HTGA 2AOSA 3O5QA 1WNOA 3MCBB 1ITXA 2AWGA 3LE4A 3WD1A 3KACA 3O5LA 3UI5A 2ZQUA 3AS0A 4IT4A 4LAYA 2DWVA 2KR7A 4DWSA 3B8SA 1E6RA 5DIUA 1LQ0A 2VCDA 2DG4A 1K9RA 2A3EA 4ZPWR 4DRQA 4Q22A 2JX8A 2DK1A 2L2SA 4WIWA 1UR9A 1YW5A 3B9DA 4ZPTR 4MAVA 3WQWA 1UR8A 3CHDA 2O9OA 3O5PA 1R9HA 4MNKA 4JFKA 3KZ7A 1ZCNA 1O6WA 3WKZA 4QT2A 3FY1A 5HW6A 1WB0A 2ZR5A 3EIPA 1HJXA 3PRDA 4W9QA 4GLXA 2WLYA 4O2TA 1CTNA 1VF8A 3OA5A 5HW8A 3O5EA 2ZR6A 3GU0A 1HJVA 4A0TA 4G50A 4NSBA 1GUVA 1KT0A 1HKKA 2M1IA 4XAKA 1LJYA 3JYMA 3O5IA 1HJWA 2YSGA 4DZ2A 4TW8A 4IT6A 4DRPA 2PPPA 5DEZA 1FKTA 4DIPA 4ZS6A 4ODPA 3ARPA 3UF8A 2LJ4A 1EYMA 4DRHA 1I5HW 3KADA 1GOIA 1W9UA 4J4NA 1EHNA 4FAPA 5I98A 4NZCA 2DPEA 1FKHA 1P5QA 3UQAA 4S3KA 2EULA 4HARA 5CQ2A 2FDMA 2LGOA 4L72B 3MCBA 4WKAA 1Q1CA 2MLZA 3LKXB 2DSUA 3KAGA 2Q5AA
chains in the Genus database with same CATH topology
1OWQA 2ZQSA 3ARZA 2WAEA 1EDQA 1FJDA 5HWBA 4S3JA 2DJYA 4DRIA 5HKGA 1NSGA 1FFRA 1KT1A 2KGJA 2MF9A 1E9LA 4TYOA 3WL0A 2DSVA 4N19A 3RGCA 1W1YA 1FKLA 4TW6A 3KAHA 3CH9A 2DK7A 3B9EA 3WH0A 3PRBA 2ZAJA 2RE3A 4MNLA 1LL7A 2M2AA 2PV1A 1HXVA 2XP6A 1O6IA 4JFMA 1W1VA 4Z2GA 3UI6A 3H9RB 2KO7A 2ITKA 2MLXA 3CHCA 5D75A 1K9TA 2DT0A 3CHEA 3WD2A 1X6LA 1FAPA 2DT1A 5JH8A 1Q6HA 1TFVA 4MNJA 1X6NA 1QPLA 2YBTA 1U79A 1M5YA 1ZBVA 3CNGA 3UQBA 4PTMA 5DO2A 2RUDA 2MDIA 2XP8A 4TX0A 5AHTA 1BKFA 5DF0A 5GQBA 4C02B 3ARXA 1E6ZA 3MQGA 1SR0A 2Y78A 3W4RA 4GGQA 3ARYA 3BXWA 4DT4A 2ZQVA 3JXVA 2YSFA 3OOBA 1FLCA 1JVWA 4Z2HA 1PINA 4A0UA 1LG1A 1W1PA 1XRVA 1LL4A 3O5MA 1HKJA 2LKNA 3CGMA 3RM8A 1TCOC 4DH0A 4MSPA 3LKXA 2F4EA 2M08A 5HW7A 1FKDA 2JZVA 4IPXA 2DG9A 2FKEA 1J4IA 2IF4A 2DG3A 2KE0A 3FAPA 1PBKA 4GIVA 4P8VA 4W9OA 3ARQA 2G8ZA 4DZ3A 2PPOA 3GPKA 2LAJA 1NH6A 4JFJA 4NNRA 2RUCA 1EIBA 1RD6A 1F40A 1ZBCA 4HBOA 4W9PA 5HUAA 2JMFA 2FAPA 3TDBA 2PV2A 4ODLA 3MDYB 3IKGA 2RUQA 2YSIA 2XP4A 1J6YA 4Z2KA 3WQVA 2D9FA 4P8WA 4DWSD 1EG4A 3PA7A 2M8IA 2ZQTA 4L3NA 2JV4A 1NMWA 4HBEA 3ARWA 5E62A 1FKJA 2YSHA 3AQUA 4R0XA 3WD0A 3VAWA 5BXJA 3FSBA 1D7JA 4LAXA 4URIA 1H0IA 2ZR4A 2UZ5A 5HWCA 2DT2A 3KAFA 3RFWA 4JYSA 1D2KA 1HKMA 5GPGA 4IQCA 4DRKA 4ZPVR 3I6CA 2OWOA 1Y0OA 1E6PA 2G41A 4JFLA 3UQIA 1K9QA 2XP7A 4Z2IA 2M8JA 2VN1A 5J6EA 2DMVA 4DRNA 4AY1A 3FXYA 2XP3A 1E6NA 2QF8A 4Q7NA 4LAVA 2F21A 4WKHA 3AROA 3ARSA 5GPRA 3FSCA 3O5DA 3L4HA 3WD3A 1A7XA 1D6OA 3WIJA 3ARTA 2ESCA 4E5RA 4R5EA 3MQHA 4WKFA 3ODKA 1FKFA 5HT1A 2MLYA 2MNTA 3RMEA 1FKKA 4Z2JA 4U84A 1WR7A 1ZB5A 1ROTA 2O92A 2WADA 2N87A 4DWSC 2RQSA 5HBFA 3EY6A 1W26A 3AS2A 4TNSA 4MGVA 4MTVA 1B6CA 2YAJB 3RM9A 2M3OW 5DIVA 4LGXA 1IX5A 3PR9A 3KCEA 1WMVA 2K8IA 3ALFA 5E5WA 1NWRA 2YBUA 4KQZA 3CHFA 1ROUA 2RSEA 4IQ2A 1ZU8A 1JNDA 3FS8A 1FFQA 1Q6IA 1TK7A 3G6LA 3O5FA 2OLHA 1FKRA 2DT3A 4QIBA 4G2PA 1EG3A 3O5JA 3NTPA 1W9PA 2WM0A 1T11A 2KFWA 3IHZA 2KXQA 4DROA 4LAWA 1F8AB 4P8UA 4QT3A 3WD4A 3KAIA 1FKBA 2Y8NB 3RM4A 1KFWA 2XPAA 2PV3A 5DITA 3CGNA 4QZVB 4DRMA 1LL6A 3AS1A 2KI3A 1JNEA 2IUZA 2BA1A 3O5OA 1FKSA 2MPHA 2XP9A 2QRVA 2A3BA 2RURA 2WLZA 2PPNA 4DRJA 4ODKA 1NWSA 4U85A 2L4JA 2XPBA 1LG2A 1FKGA 5U47A 1E15A 2WK2A 5E64A 1NWTA 1EQ3A 1OGGA 3B9AA 2A3AA 1FKIA 4MPKA 1OGBA 4ODNA 3JYJA 4J4OA 3PRAA 4DWSB 3O5RA 2PBCA 2E45A 4FN2A 2XP5A 3QOKA 4WK9A 1QPFA 1NMVA 5E66A 1XHGA 3KABA 1W9VA 3B7XA 4U86A 3O5GA 4BF8A 4MNMA 3NI6A 1W1TA 1ZK6A 1YATA 3UI4A 1D7HA 3WL1A 1JMQA 1BL4A 3LUOA 4ODRA 3ARVA 1SYTA 4Z2LA 3M7NA 1Q6UA 2B31A 1ZL1A 1TR8A 1D7IA 2DSZA 4ITZA 1JNTA 1L1PA 3IKDA 1QZ2A 1ZBWA 3ALGA 4ODOA 3AS3A 2YSBA 4ML4A 1HKIA 4ODMA 1J4HA 3ARUA 3O5KA 2JXWA 2DSWA 1C9HA 4WJXA 1J4RA 2PI6A 5B8IC 1H0GA 1GPFA 2F2DA 3ARRA 5E65A 3M85A 3PQHA 1WAWA 2LPVA 3CZ8A 1RP5A 1N1AA 4REXA 3TCZA 3G6MA 2A3CA 4KR0B 4W5UA 4JFIA 1ZBKA 1FD9A 1NWUA 3IK8A 1JNSA 3NRKA 4TW7A 3TC5A 2OFNA 4ODQA 4P8XA 2EZ5W 5HTGA 2AOSA 3O5QA 1WNOA 3MCBB 1ITXA 2AWGA 3LE4A 3WD1A 3KACA 3O5LA 3UI5A 2ZQUA 3AS0A 4IT4A 4LAYA 2DWVA 2KR7A 4DWSA 3B8SA 1E6RA 5DIUA 1LQ0A 2VCDA 2DG4A 1K9RA 2A3EA 4ZPWR 4DRQA 4Q22A 2JX8A 2DK1A 2L2SA 4WIWA 1UR9A 1YW5A 3B9DA 4ZPTR 4MAVA 3WQWA 1UR8A 3CHDA 2O9OA 3O5PA 1R9HA 4MNKA 4JFKA 3KZ7A 1ZCNA 1O6WA 3WKZA 4QT2A 3FY1A 5HW6A 1WB0A 2ZR5A 3PRDA 1HJXA 4W9QA 4GLXA 2WLYA 4O2TA 1CTNA 1VF8A 3OA5A 5HW8A 3O5EA 2ZR6A 1HJVA 4A0TA 4G50A 4NSBA 1GUVA 1KT0A 1HKKA 2M1IA 4XAKA 1LJYA 3JYMA 3O5IA 1HJWA 2YSGA 4DZ2A 4TW8A 4IT6A 4DRPA 2PPPA 5DEZA 1FKTA 4DIPA 4ZS6A 4ODPA 3ARPA 3UF8A 2LJ4A 1EYMA 4DRHA 1I5HW 3KADA 1GOIA 1W9UA 4J4NA 1EHNA 4FAPA 5I98A 4NZCA 2DPEA 1FKHA 1P5QA 3UQAA 4S3KA 4HARA 5CQ2A 2FDMA 2LGOA 4L72B 3MCBA 4WKAA 1Q1CA 2MLZA 3LKXB 2DSUA 3KAGA 2Q5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQS A;  1FJD A;  5HWB A;  5HKG A;  2DJY A;  4DRI A;  1NSG A;  1KT1 A;  2KGJ A;  2MF9 A;  4TYO A;  4N19 A;  3RGC A;  1FKL A;  4TW6 A;  3KAH A;  2DK7 A;  3WH0 A;  3PRB A;  2ZAJ A;  2RE3 A;  2M2A A;  2PV1 A;  1HXV A;  2XP6 A;  4JFM A;  3UI6 A;  3H9R B;  2KO7 A;  2ITK A;  2MLX A;  5D75 A;  1FAP A;  1Q6H A;  1QPL A;  1U79 A;  1M5Y A;  3CNG A;  3UQB A;  2RUD A;  2MDI A;  2XP8 A;  4TX0 A;  5AHT A;  1BKF A;  4C02 B;  2Y78 A;  4GGQ A;  4DT4 A;  2ZQV A;  3JXV A;  2YSF A;  3OOB A;  1JVW A;  1PIN A;  3O5M A;  2LKN A;  3CGM A;  1TCO C;  4DH0 A;  4MSP A;  2F4E A;  2M08 A;  5HW7 A;  1FKD A;  2JZV A;  4IPX A;  2DG9 A;  2FKE A;  1J4I A;  2IF4 A;  2DG3 A;  2KE0 A;  3FAP A;  1PBK A;  4GIV A;  4W9O A;  4DZ3 A;  2PPO A;  3GPK A;  2LAJ A;  4JFJ A;  4NNR A;  2RUC A;  1F40 A;  4W9P A;  5HUA A;  2JMF A;  2FAP A;  3TDB A;  2PV2 A;  4ODL A;  3MDY B;  3IKG A;  2RUQ A;  2YSI A;  2XP4 A;  1J6Y A;  2D9F A;  1EG4 A;  3PA7 A;  2M8I A;  2ZQT A;  2JV4 A;  1NMW A;  1FKJ A;  2YSH A;  4R0X A;  3VAW A;  5BXJ A;  1D7J A;  4LAX A;  2ZR4 A;  2UZ5 A;  5HWC A;  3RFW A;  3KAF A;  4JYS A;  5GPG A;  4IQC A;  4DRK A;  3I6C A;  1Y0O A;  4JFL A;  3UQI A;  1K9Q A;  2XP7 A;  2M8J A;  2VN1 A;  5J6E A;  2DMV A;  4DRN A;  2XP3 A;  4LAV A;  2F21 A;  3O5D A;  3L4H A;  1A7X A;  1D6O A;  4E5R A;  3ODK A;  1FKF A;  5HT1 A;  2MLY A;  2MNT A;  1FKK A;  4U84 A;  1WR7 A;  1ROT A;  2N87 A;  2RQS A;  3EY6 A;  1W26 A;  4TNS A;  4MGV A;  1B6C A;  2M3O W;  5DIV A;  3KCE A;  1WMV A;  2K8I A;  1ROU A;  2RSE A;  4IQ2 A;  1Q6I A;  1TK7 A;  3O5F A;  1FKR A;  4QIB A;  4G2P A;  1EG3 A;  3O5J A;  3NTP A;  1T11 A;  2KFW A;  3IHZ A;  2KXQ A;  4DRO A;  4LAW A;  1F8A B;  4QT3 A;  3KAI A;  1FKB A;  2XPA A;  2PV3 A;  5DIT A;  3CGN A;  4DRM A;  2KI3 A;  2BA1 A;  3O5O A;  1FKS A;  2MPH A;  2XP9 A;  2RUR A;  2PPN A;  4DRJ A;  4ODK A;  4U85 A;  2L4J A;  2XPB A;  1FKG A;  1EQ3 A;  1FKI A;  4ODN A;  3JYJ A;  4J4O A;  3O5R A;  2PBC A;  2E45 A;  4FN2 A;  2XP5 A;  1QPF A;  1NMV A;  3KAB A;  3B7X A;  4U86 A;  3O5G A;  4BF8 A;  3NI6 A;  1ZK6 A;  1YAT A;  3UI4 A;  1D7H A;  1JMQ A;  1BL4 A;  3LUO A;  4ODR A;  3M7N A;  1Q6U A;  1D7I A;  4ITZ A;  1JNT A;  1L1P A;  3IKD A;  1QZ2 A;  4ODO A;  2YSB A;  4ODM A;  1J4H A;  3O5K A;  2JXW A;  1C9H A;  1J4R A;  5B8I C;  2F2D A;  3M85 A;  2LPV A;  1N1A A;  4REX A;  3TCZ A;  4JFI A;  3IK8 A;  1FD9 A;  1JNS A;  3NRK A;  4TW7 A;  3TC5 A;  2OFN A;  4ODQ A;  2EZ5 W;  5HTG A;  3O5Q A;  2AWG A;  3LE4 A;  3KAC A;  3O5L A;  3UI5 A;  2ZQU A;  4LAY A;  2DWV A;  2KR7 A;  5DIU A;  2VCD A;  2DG4 A;  1K9R A;  4DRQ A;  2JX8 A;  2DK1 A;  2L2S A;  1YW5 A;  3O5P A;  1R9H A;  4JFK A;  3KZ7 A;  1ZCN A;  1O6W A;  4QT2 A;  5HW6 A;  2ZR5 A;  3PRD A;  4W9Q A;  4O2T A;  5HW8 A;  3O5E A;  2ZR6 A;  4G50 A;  1KT0 A;  2M1I A;  3JYM A;  3O5I A;  2YSG A;  4DZ2 A;  4TW8 A;  4DRP A;  2PPP A;  1FKT A;  4DIP A;  4ODP A;  3UF8 A;  2LJ4 A;  1EYM A;  4DRH A;  1I5H W;  3KAD A;  4J4N A;  4FAP A;  5I98 A;  1FKH A;  1P5Q A;  3UQA A;  5CQ2 A;  2LGO A;  1Q1C A;  2MLZ A;  3KAG A;  2Q5A A; 
#chains in the Genus database with same CATH topology
 1OWQ A;  2ZQS A;  3ARZ A;  2WAE A;  1EDQ A;  1FJD A;  5HWB A;  4S3J A;  2DJY A;  4DRI A;  5HKG A;  1NSG A;  1FFR A;  1KT1 A;  2KGJ A;  2MF9 A;  1E9L A;  4TYO A;  3WL0 A;  2DSV A;  4N19 A;  3RGC A;  1W1Y A;  1FKL A;  4TW6 A;  3KAH A;  3CH9 A;  2DK7 A;  3B9E A;  3WH0 A;  3PRB A;  2ZAJ A;  2RE3 A;  4MNL A;  1LL7 A;  2M2A A;  2PV1 A;  1E44 A;  1HXV A;  2XP6 A;  1O6I A;  4JFM A;  1W1V A;  4Z2G A;  3UI6 A;  3H9R B;  2KO7 A;  2ITK A;  2MLX A;  3CHC A;  5D75 A;  1K9T A;  2DT0 A;  3CHE A;  3WD2 A;  1X6L A;  1FAP A;  2DT1 A;  5JH8 A;  1Q6H A;  1TFV A;  4MNJ A;  1X6N A;  1QPL A;  2YBT A;  1U79 A;  1M5Y A;  1ZBV A;  3CNG A;  3UQB A;  4PTM A;  5DO2 A;  2RUD A;  2MDI A;  2XP8 A;  4TX0 A;  5AHT A;  1BKF A;  5DF0 A;  5GQB A;  4C02 B;  3ARX A;  1E6Z A;  3MQG A;  1SR0 A;  2Y78 A;  2P4V A;  3W4R A;  4GGQ A;  3ARY A;  3BXW A;  4DT4 A;  2ZQV A;  3JXV A;  2YSF A;  3OOB A;  1FLC A;  1JVW A;  4Z2H A;  1JCH B;  1PIN A;  4A0U A;  1LG1 A;  1W1P A;  1XRV A;  1LL4 A;  3O5M A;  1HKJ A;  2LKN A;  3CGM A;  3RM8 A;  1TCO C;  4DH0 A;  4MSP A;  3LKX A;  2F4E A;  2M08 A;  5HW7 A;  1FKD A;  2JZV A;  4IPX A;  2DG9 A;  2FKE A;  1J4I A;  2IF4 A;  2DG3 A;  2KE0 A;  3FAP A;  1PBK A;  4GIV A;  4P8V A;  4W9O A;  3ARQ A;  2G8Z A;  4DZ3 A;  2PPO A;  3GPK A;  2LAJ A;  1NH6 A;  4JFJ A;  4NNR A;  2RUC A;  1EIB A;  1RD6 A;  1F40 A;  1ZBC A;  4HBO A;  4W9P A;  5HUA A;  2JMF A;  2FAP A;  3TDB A;  2PV2 A;  4ODL A;  3MDY B;  3IKG A;  2RUQ A;  2YSI A;  2XP4 A;  2PN0 A;  1J6Y A;  4Z2K A;  3WQV A;  2D9F A;  3GTY X;  4P8W A;  4DWS D;  1EG4 A;  3PA7 A;  2M8I A;  2ZQT A;  2B5U B;  4L3N A;  2JV4 A;  1NMW A;  4HBE A;  3ARW A;  5E62 A;  1FKJ A;  2YSH A;  3AQU A;  4R0X A;  3WD0 A;  3VAW A;  5BXJ A;  3FSB A;  1D7J A;  4LAX A;  4URI A;  1H0I A;  2ZR4 A;  2UZ5 A;  5HWC A;  2DT2 A;  3KAF A;  3RFW A;  4JYS A;  1D2K A;  1HKM A;  5GPG A;  4IQC A;  4DRK A;  4ZPV R;  3I6C A;  2OWO A;  1Y0O A;  1E6P A;  2G41 A;  4JFL A;  3UQI A;  1K9Q A;  2XP7 A;  4Z2I A;  2M8J A;  2VN1 A;  5J6E A;  2DMV A;  4DRN A;  4AY1 A;  3FXY A;  2XP3 A;  1E6N A;  2QF8 A;  4Q7N A;  4LAV A;  2F21 A;  4WKH A;  3ARO A;  3ARS A;  5GPR A;  3FSC A;  3O5D A;  3L4H A;  3WD3 A;  1A7X A;  1D6O A;  3WIJ A;  3ART A;  2ESC A;  4E5R A;  4R5E A;  3MQH A;  4WKF A;  3ODK A;  1FKF A;  5HT1 A;  2MLY A;  2MNT A;  3RME A;  1FKK A;  4Z2J A;  4U84 A;  1WR7 A;  1ZB5 A;  1ROT A;  2O92 A;  2WAD A;  2N87 A;  4DWS C;  2RQS A;  5HBF A;  3EY6 A;  1W26 A;  3AS2 A;  4TNS A;  4MGV A;  4MTV A;  1B6C A;  2YAJ B;  3RM9 A;  2M3O W;  5DIV A;  4LGX A;  2ETN A;  1IX5 A;  3PR9 A;  3KCE A;  1WMV A;  2K8I A;  3ALF A;  5E5W A;  1NWR A;  2YBU A;  4KQZ A;  3CHF A;  1ROU A;  2RSE A;  4IQ2 A;  1ZU8 A;  1JND A;  3FS8 A;  1FFQ A;  1Q6I A;  1TK7 A;  3G6L A;  3O5F A;  2OLH A;  1FKR A;  2DT3 A;  4QIB A;  4G2P A;  1EG3 A;  3O5J A;  3NTP A;  1W9P A;  2WM0 A;  1T11 A;  2KFW A;  3IHZ A;  2KXQ A;  4DRO A;  4LAW A;  1F8A B;  4P8U A;  4QT3 A;  3WD4 A;  3KAI A;  1FKB A;  2Y8N B;  3RM4 A;  1KFW A;  2XPA A;  2PV3 A;  5DIT A;  3CGN A;  4QZV B;  4DRM A;  1LL6 A;  3AS1 A;  2KI3 A;  1JNE A;  2IUZ A;  2BA1 A;  3O5O A;  1FKS A;  2MPH A;  2XP9 A;  2QRV A;  2A3B A;  2RUR A;  2WLZ A;  2PPN A;  4DRJ A;  4ODK A;  1NWS A;  4U85 A;  2L4J A;  2XPB A;  1LG2 A;  1FKG A;  5U47 A;  1E15 A;  2WK2 A;  5E64 A;  1NWT A;  1EQ3 A;  1GRJ A;  1OGG A;  3B9A A;  2A3A A;  1FKI A;  4MPK A;  1OGB A;  4ODN A;  3JYJ A;  4J4O A;  3PRA A;  4DWS B;  3O5R A;  2PBC A;  2E45 A;  4FN2 A;  2XP5 A;  3QOK A;  4WK9 A;  1QPF A;  1NMV A;  5E66 A;  1XHG A;  3KAB A;  1W9V A;  3B7X A;  2F23 A;  4U86 A;  3O5G A;  4BF8 A;  4UDM A;  4MNM A;  3NI6 A;  1W1T A;  1ZK6 A;  1YAT A;  3UI4 A;  1D7H A;  3WL1 A;  1JMQ A;  1BL4 A;  3LUO A;  4ODR A;  3ARV A;  1SYT A;  4Z2L A;  3M7N A;  1Q6U A;  2B31 A;  1ZL1 A;  1TR8 A;  1D7I A;  2DSZ A;  4ITZ A;  1JNT A;  1L1P A;  3IKD A;  1QZ2 A;  1ZBW A;  3ALG A;  4ODO A;  3AS3 A;  2YSB A;  4ML4 A;  1HKI A;  4ODM A;  1J4H A;  3ARU A;  3O5K A;  2JXW A;  2DSW A;  3BMB A;  1C9H A;  4WJX A;  1J4R A;  2PI6 A;  5B8I C;  1H0G A;  1GPF A;  2F2D A;  3ARR A;  5E65 A;  3M85 A;  3PQH A;  1WAW A;  2LPV A;  3CZ8 A;  1RP5 A;  1N1A A;  4REX A;  3TCZ A;  3G6M A;  2A3C A;  4KR0 B;  4W5U A;  4JFI A;  1ZBK A;  1FD9 A;  1NWU A;  3IK8 A;  1JNS A;  3NRK A;  4TW7 A;  3TC5 A;  2OFN A;  4ODQ A;  4P8X A;  2EZ5 W;  5HTG A;  2AOS A;  3O5Q A;  1WNO A;  3MCB B;  1ITX A;  2AWG A;  3LE4 A;  3WD1 A;  3KAC A;  3O5L A;  3UI5 A;  2ZQU A;  3AS0 A;  4IT4 A;  4LAY A;  2DWV A;  2KR7 A;  4DWS A;  3B8S A;  1E6R A;  5DIU A;  1LQ0 A;  2VCD A;  2DG4 A;  1K9R A;  2A3E A;  4ZPW R;  4DRQ A;  4Q22 A;  2JX8 A;  2DK1 A;  2L2S A;  4WIW A;  1UR9 A;  1YW5 A;  3B9D A;  4ZPT R;  4MAV A;  3WQW A;  1UR8 A;  3CHD A;  2O9O A;  3O5P A;  1R9H A;  4MNK A;  4JFK A;  3KZ7 A;  1ZCN A;  1O6W A;  3WKZ A;  4QT2 A;  3FY1 A;  5HW6 A;  1WB0 A;  2ZR5 A;  3EIP A;  1HJX A;  3PRD A;  4W9Q A;  4GLX A;  2WLY A;  4O2T A;  1CTN A;  1VF8 A;  3OA5 A;  5HW8 A;  3O5E A;  2ZR6 A;  3GU0 A;  1HJV A;  4A0T A;  4G50 A;  4NSB A;  1GUV A;  1KT0 A;  1HKK A;  2M1I A;  4XAK A;  1LJY A;  3JYM A;  3O5I A;  1HJW A;  2YSG A;  4DZ2 A;  4TW8 A;  4IT6 A;  4DRP A;  2PPP A;  5DEZ A;  1FKT A;  4DIP A;  4ZS6 A;  4ODP A;  3ARP A;  3UF8 A;  2LJ4 A;  1EYM A;  4DRH A;  1I5H W;  3KAD A;  1GOI A;  1W9U A;  4J4N A;  1EHN A;  4FAP A;  5I98 A;  4NZC A;  2DPE A;  1FKH A;  1P5Q A;  3UQA A;  4S3K A;  2EUL A;  4HAR A;  5CQ2 A;  2FDM A;  2LGO A;  4L72 B;  3MCB A;  4WKA A;  1Q1C A;  2MLZ A;  3LKX B;  2DSU A;  3KAG A;  2Q5A A; 
#chains in the Genus database with same CATH homology
 1OWQ A;  2ZQS A;  3ARZ A;  2WAE A;  1EDQ A;  1FJD A;  5HWB A;  4S3J A;  2DJY A;  4DRI A;  5HKG A;  1NSG A;  1FFR A;  1KT1 A;  2KGJ A;  2MF9 A;  1E9L A;  4TYO A;  3WL0 A;  2DSV A;  4N19 A;  3RGC A;  1W1Y A;  1FKL A;  4TW6 A;  3KAH A;  3CH9 A;  2DK7 A;  3B9E A;  3WH0 A;  3PRB A;  2ZAJ A;  2RE3 A;  4MNL A;  1LL7 A;  2M2A A;  2PV1 A;  1HXV A;  2XP6 A;  1O6I A;  4JFM A;  1W1V A;  4Z2G A;  3UI6 A;  3H9R B;  2KO7 A;  2ITK A;  2MLX A;  3CHC A;  5D75 A;  1K9T A;  2DT0 A;  3CHE A;  3WD2 A;  1X6L A;  1FAP A;  2DT1 A;  5JH8 A;  1Q6H A;  1TFV A;  4MNJ A;  1X6N A;  1QPL A;  2YBT A;  1U79 A;  1M5Y A;  1ZBV A;  3CNG A;  3UQB A;  4PTM A;  5DO2 A;  2RUD A;  2MDI A;  2XP8 A;  4TX0 A;  5AHT A;  1BKF A;  5DF0 A;  5GQB A;  4C02 B;  3ARX A;  1E6Z A;  3MQG A;  1SR0 A;  2Y78 A;  3W4R A;  4GGQ A;  3ARY A;  3BXW A;  4DT4 A;  2ZQV A;  3JXV A;  2YSF A;  3OOB A;  1FLC A;  1JVW A;  4Z2H A;  1PIN A;  4A0U A;  1LG1 A;  1W1P A;  1XRV A;  1LL4 A;  3O5M A;  1HKJ A;  2LKN A;  3CGM A;  3RM8 A;  1TCO C;  4DH0 A;  4MSP A;  3LKX A;  2F4E A;  2M08 A;  5HW7 A;  1FKD A;  2JZV A;  4IPX A;  2DG9 A;  2FKE A;  1J4I A;  2IF4 A;  2DG3 A;  2KE0 A;  3FAP A;  1PBK A;  4GIV A;  4P8V A;  4W9O A;  3ARQ A;  2G8Z A;  4DZ3 A;  2PPO A;  3GPK A;  2LAJ A;  1NH6 A;  4JFJ A;  4NNR A;  2RUC A;  1EIB A;  1RD6 A;  1F40 A;  1ZBC A;  4HBO A;  4W9P A;  5HUA A;  2JMF A;  2FAP A;  3TDB A;  2PV2 A;  4ODL A;  3MDY B;  3IKG A;  2RUQ A;  2YSI A;  2XP4 A;  1J6Y A;  4Z2K A;  3WQV A;  2D9F A;  4P8W A;  4DWS D;  1EG4 A;  3PA7 A;  2M8I A;  2ZQT A;  4L3N A;  2JV4 A;  1NMW A;  4HBE A;  3ARW A;  5E62 A;  1FKJ A;  2YSH A;  3AQU A;  4R0X A;  3WD0 A;  3VAW A;  5BXJ A;  3FSB A;  1D7J A;  4LAX A;  4URI A;  1H0I A;  2ZR4 A;  2UZ5 A;  5HWC A;  2DT2 A;  3KAF A;  3RFW A;  4JYS A;  1D2K A;  1HKM A;  5GPG A;  4IQC A;  4DRK A;  4ZPV R;  3I6C A;  2OWO A;  1Y0O A;  1E6P A;  2G41 A;  4JFL A;  3UQI A;  1K9Q A;  2XP7 A;  4Z2I A;  2M8J A;  2VN1 A;  5J6E A;  2DMV A;  4DRN A;  4AY1 A;  3FXY A;  2XP3 A;  1E6N A;  2QF8 A;  4Q7N A;  4LAV A;  2F21 A;  4WKH A;  3ARO A;  3ARS A;  5GPR A;  3FSC A;  3O5D A;  3L4H A;  3WD3 A;  1A7X A;  1D6O A;  3WIJ A;  3ART A;  2ESC A;  4E5R A;  4R5E A;  3MQH A;  4WKF A;  3ODK A;  1FKF A;  5HT1 A;  2MLY A;  2MNT A;  3RME A;  1FKK A;  4Z2J A;  4U84 A;  1WR7 A;  1ZB5 A;  1ROT A;  2O92 A;  2WAD A;  2N87 A;  4DWS C;  2RQS A;  5HBF A;  3EY6 A;  1W26 A;  3AS2 A;  4TNS A;  4MGV A;  4MTV A;  1B6C A;  2YAJ B;  3RM9 A;  2M3O W;  5DIV A;  4LGX A;  1IX5 A;  3PR9 A;  3KCE A;  1WMV A;  2K8I A;  3ALF A;  5E5W A;  1NWR A;  2YBU A;  4KQZ A;  3CHF A;  1ROU A;  2RSE A;  4IQ2 A;  1ZU8 A;  1JND A;  3FS8 A;  1FFQ A;  1Q6I A;  1TK7 A;  3G6L A;  3O5F A;  2OLH A;  1FKR A;  2DT3 A;  4QIB A;  4G2P A;  1EG3 A;  3O5J A;  3NTP A;  1W9P A;  2WM0 A;  1T11 A;  2KFW A;  3IHZ A;  2KXQ A;  4DRO A;  4LAW A;  1F8A B;  4P8U A;  4QT3 A;  3WD4 A;  3KAI A;  1FKB A;  2Y8N B;  3RM4 A;  1KFW A;  2XPA A;  2PV3 A;  5DIT A;  3CGN A;  4QZV B;  4DRM A;  1LL6 A;  3AS1 A;  2KI3 A;  1JNE A;  2IUZ A;  2BA1 A;  3O5O A;  1FKS A;  2MPH A;  2XP9 A;  2QRV A;  2A3B A;  2RUR A;  2WLZ A;  2PPN A;  4DRJ A;  4ODK A;  1NWS A;  4U85 A;  2L4J A;  2XPB A;  1LG2 A;  1FKG A;  5U47 A;  1E15 A;  2WK2 A;  5E64 A;  1NWT A;  1EQ3 A;  1OGG A;  3B9A A;  2A3A A;  1FKI A;  4MPK A;  1OGB A;  4ODN A;  3JYJ A;  4J4O A;  3PRA A;  4DWS B;  3O5R A;  2PBC A;  2E45 A;  4FN2 A;  2XP5 A;  3QOK A;  4WK9 A;  1QPF A;  1NMV A;  5E66 A;  1XHG A;  3KAB A;  1W9V A;  3B7X A;  4U86 A;  3O5G A;  4BF8 A;  4MNM A;  3NI6 A;  1W1T A;  1ZK6 A;  1YAT A;  3UI4 A;  1D7H A;  3WL1 A;  1JMQ A;  1BL4 A;  3LUO A;  4ODR A;  3ARV A;  1SYT A;  4Z2L A;  3M7N A;  1Q6U A;  2B31 A;  1ZL1 A;  1TR8 A;  1D7I A;  2DSZ A;  4ITZ A;  1JNT A;  1L1P A;  3IKD A;  1QZ2 A;  1ZBW A;  3ALG A;  4ODO A;  3AS3 A;  2YSB A;  4ML4 A;  1HKI A;  4ODM A;  1J4H A;  3ARU A;  3O5K A;  2JXW A;  2DSW A;  1C9H A;  4WJX A;  1J4R A;  2PI6 A;  5B8I C;  1H0G A;  1GPF A;  2F2D A;  3ARR A;  5E65 A;  3M85 A;  3PQH A;  1WAW A;  2LPV A;  3CZ8 A;  1RP5 A;  1N1A A;  4REX A;  3TCZ A;  3G6M A;  2A3C A;  4KR0 B;  4W5U A;  4JFI A;  1ZBK A;  1FD9 A;  1NWU A;  3IK8 A;  1JNS A;  3NRK A;  4TW7 A;  3TC5 A;  2OFN A;  4ODQ A;  4P8X A;  2EZ5 W;  5HTG A;  2AOS A;  3O5Q A;  1WNO A;  3MCB B;  1ITX A;  2AWG A;  3LE4 A;  3WD1 A;  3KAC A;  3O5L A;  3UI5 A;  2ZQU A;  3AS0 A;  4IT4 A;  4LAY A;  2DWV A;  2KR7 A;  4DWS A;  3B8S A;  1E6R A;  5DIU A;  1LQ0 A;  2VCD A;  2DG4 A;  1K9R A;  2A3E A;  4ZPW R;  4DRQ A;  4Q22 A;  2JX8 A;  2DK1 A;  2L2S A;  4WIW A;  1UR9 A;  1YW5 A;  3B9D A;  4ZPT R;  4MAV A;  3WQW A;  1UR8 A;  3CHD A;  2O9O A;  3O5P A;  1R9H A;  4MNK A;  4JFK A;  3KZ7 A;  1ZCN A;  1O6W A;  3WKZ A;  4QT2 A;  3FY1 A;  5HW6 A;  1WB0 A;  2ZR5 A;  3PRD A;  1HJX A;  4W9Q A;  4GLX A;  2WLY A;  4O2T A;  1CTN A;  1VF8 A;  3OA5 A;  5HW8 A;  3O5E A;  2ZR6 A;  1HJV A;  4A0T A;  4G50 A;  4NSB A;  1GUV A;  1KT0 A;  1HKK A;  2M1I A;  4XAK A;  1LJY A;  3JYM A;  3O5I A;  1HJW A;  2YSG A;  4DZ2 A;  4TW8 A;  4IT6 A;  4DRP A;  2PPP A;  5DEZ A;  1FKT A;  4DIP A;  4ZS6 A;  4ODP A;  3ARP A;  3UF8 A;  2LJ4 A;  1EYM A;  4DRH A;  1I5H W;  3KAD A;  1GOI A;  1W9U A;  4J4N A;  1EHN A;  4FAP A;  5I98 A;  4NZC A;  2DPE A;  1FKH A;  1P5Q A;  3UQA A;  4S3K A;  4HAR A;  5CQ2 A;  2FDM A;  2LGO A;  4L72 B;  3MCB A;  4WKA A;  1Q1C A;  2MLZ A;  3LKX B;  2DSU A;  3KAG A;  2Q5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...