2ZR4A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNAAQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 45
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr4A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr4A02
1O6WA 3IHZA 3KABA 2JX8A 1FKKA 4TW7A 1FAPA 4GIVA 4QT2A 1Q6UA 4G50A 1M5YA 4LAYA 3WH0A 1FKTA 1ZK6A 2XP4A 1Q6IA 2UZ5A 3VAWA 2ZQSA 2LPVA 3PRBA 4FAPA 4ODMA 3KAHA 2RSEA 2KO7A 3KACA 4IQ2A 4LAXA 3KZ7A 2PBCA 1A7XA 1F8AB 2MF9A 2DG4A 1I5HW 1EYMA 5BXJA 4QIBA 1U79A 4ODQA 1EQ3A 2PPNA 3EY6A 1ROTA 1NSGA 2JZVA 5I98A 2OFNA 4DRIA 2ZQVA 5DIUA 1D7JA 1EG4A 1QZ2A 2VN1A 4W9QA 2AWGA 4DRMA 2YSFA 3GPKA 4W9PA 3UI4A 2XP5A 2MPHA 1PBKA 4U85A 5J6EA 2RURA 4LAWA 4DRHA 3O5OA 3UQAA 1D7HA 4ODPA 5D75A 2E45A 3NI6A 5HW6A 1J4RA 1EG3A 2LJ4A 2MLZA 2PV2A 2KE0A 4TW8A 2YSBA 2Y78A 3UI6A 3CNGA 5HWBA 3O5RA 2XP3A 3UQIA 2MLYA 2PPPA 2DK1A 2RUDA 3UQBA 3MDYB 4ITZA 1J4HA 1YATA 4TNSA 4JFIA 1QPFA 1N1AA 2ZR4A 4JFJA 3ODKA 3CGMA 4IPXA 3FAPA 2PPOA 3M85A 3KAIA 4DRKA 1FKJA 4U84A 4GGQA 1TK7A 2L2SA 2KXQA 1K9QA 2FAPA 2KI3A 1YW5A 1BKFA 3JXVA 2XP9A 3O5KA 1JVWA 2DG9A 2DG3A 2Q5AA 1WMVA 1L1PA 3O5FA 4JFLA 4C02B 2ITKA 5HW8A 3PA7A 5AHTA 2LGOA 3RFWA 3O5JA 2ZQTA 4DT4A 2M3OW 4DRQA 2XP6A 5DIVA 1ROUA 1ZCNA 2RQSA 5HW7A 2M08A 4TX0A 1FKIA 1D7IA 4DRNA 1R9HA 3IK8A 4DH0A 3UF8A 4QT3A 3JYMA 4DRJA 2D9FA 2F4EA 3O5IA 4J4NA 4ODKA 2LAJA 4NNRA 1PINA 3O5EA 2XPAA 4J4OA 3IKDA 2MDIA 4DZ2A 5HWCA 3KAGA 4R0XA 4MSPA 4ODLA 4O2TA 3O5DA 4DROA 2K8IA 3KADA 1J6YA 3M7NA 2YSHA 2JV4A 2M8JA 2YSIA 2RUCA 3LE4A 4REXA 2DMVA 4DIPA 1HXVA 1FJDA 4U86A 2FKEA 2M2AA 2DJYA 1FKHA 2XPBA 4ODNA 1B6CA 1NMVA 1FKLA 3NTPA 2M8IA 1FKFA 3O5QA 2KR7A 2ZAJA 1Q6HA 4LAVA 4JYSA 2LKNA 2DWVA 3UI5A 5HKGA 3TDBA 1KT1A 2RE3A 2YSGA 2XP8A 2IF4A 1FKRA 3RGCA 3O5LA 4DZ3A 2ZR6A 5DITA 4E5RA 5CQ2A 2KGJA 1J4IA 2BA1A 4G2PA 2F21A 2L4JA 4BF8A 3O5GA 2MNTA 2F2DA 4MGVA 5B8IC 3H9RB 3TCZA 2EZ5W 1F40A 2DK7A 3IKGA 3JYJA 3KCEA 1TCOC 1NMWA 2PV3A 1K9RA 3KAFA 3OOBA 4JFKA 4JFMA 2N87A 4TYOA 1FKBA 5HUAA 2M1IA 2ZQUA 1BL4A 1Q1CA 2VCDA 1FKDA 4ODOA 4ODRA 1FKSA 1C9HA 1FKGA 3CGNA 4W9OA 3PRDA 4FN2A 1P5QA 2RUQA 5GPGA 2MLXA 4N19A 5HTGA 1JNTA 1D6OA 2JXWA 2JMFA 2KFWA 5HT1A 3B7XA 3TC5A 3I6CA 1FD9A 1WR7A 1T11A 4TW6A 3NRKA 1W26A 2XP7A 1JNSA 1JMQA 3L4HA 3O5MA 1QPLA 3LUOA 1Y0OA 2PV1A 4DRPA 4IQCA 3O5PA 2ZR5A 1KT0A
chains in the Genus database with same CATH superfamily
2DPEA 1K9TA 3ARWA 5E65A 1O6WA 3IHZA 4AY1A 3KABA 1O6IA 4ZPTR 1GUVA 4ZS6A 1E6NA 2JX8A 1HKKA 3ARSA 1FKKA 3PRAA 4TW7A 3FXYA 2YBTA 1FAPA 2B31A 3WD0A 4GIVA 4QT2A 2OWOA 5E5WA 2AOSA 2YAJB 1UR8A 1Q6UA 1KFWA 4G50A 1M5YA 3LKXB 1GRJA 4LAYA 3WH0A 1FKTA 1ZK6A 2XP4A 4Z2IA 1W9VA 1Q6IA 2UZ5A 3VAWA 1LJYA 2Y8NB 2ZQSA 3WD4A 2LPVA 1ZBVA 3PRBA 5U47A 4FAPA 4ODMA 1LQ0A 3KAHA 2RSEA 5GQBA 2WLYA 2KO7A 1HKMA 3KACA 4IQ2A 4LAXA 1E15A 3KZ7A 4L3NA 2PBCA 2G41A 1A7XA 1F8AB 1W9PA 2MF9A 5GPRA 4Z2JA 1IX5A 1RP5A 2DG4A 3QOKA 1I5HW 1E6PA 5DO2A 1XHGA 3B9EA 4P8VA 1D2KA 1EYMA 3FSBA 5BXJA 4QIBA 3RM4A 2ESCA 1U79A 5E66A 1W9UA 1E44A 4ODQA 1EQ3A 1LG1A 2FDMA 5HBFA 2PPNA 3EY6A 1ROTA 1NSGA 1E6ZA 4IT6A 2JZVA 5I98A 2A3BA 2OFNA 1ZB5A 4DRIA 2ZQVA 1FFRA 3ARXA 3AS2A 5DIUA 1D7JA 1LL7A 1EG4A 4Z2LA 2WAEA 3G6MA 1ZBWA 3WD1A 1QZ2A 2VN1A 3RMEA 4W9QA 2AWGA 4DRMA 3CHDA 2YSFA 3GPKA 4W9PA 1HJVA 3UI4A 2XP5A 1ZBCA 2MPHA 1PBKA 4U85A 4DWSC 5J6EA 2RURA 4LAWA 4DRHA 1EDQA 3MCBB 3PQHA 3O5OA 2WLZA 4NZCA 3UQAA 1D7HA 1GOIA 3B9DA 4A0UA 2P4VA 4ODPA 3WD3A 2A3AA 4P8UA 1LG2A 5D75A 2E45A 3NI6A 5HW6A 3LKXA 1EG3A 1J4RA 1EHNA 1W1PA 2LJ4A 2MLZA 2PV2A 1LL6A 2KE0A 4S3JA 3W4RA 1CTNA 4TW8A 2YSBA 2Y78A 2DT3A 3UI6A 4R5EA 3CNGA 3B9AA 5HWBA 3O5RA 2XP3A 3WIJA 1FFQA 3UQIA 2MLYA 2PPPA 1XRVA 2DK1A 2DT0A 2RUDA 3UQBA 3MDYB 4ITZA 3CHEA 1J4HA 1WB0A 1ZU8A 1OGBA 1YATA 4TNSA 3WQVA 1NWTA 2O92A 4JFIA 1QPFA 1ZL1A 1N1AA 4IT4A 2WM0A 2ZR4A 4JFJA 3ODKA 3CGMA 4WKAA 4IPXA 3FAPA 3AS1A 2PPOA 3M85A 3KAIA 4DRKA 1FKJA 4U84A 4W5UA 4NSBA 4GLXA 4GGQA 1TK7A 2L2SA 4HBOA 2KXQA 5DF0A 1K9QA 2FAPA 2KI3A 4Z2HA 1WAWA 1YW5A 1BKFA 3JXVA 2A3CA 4MNJA 4MPKA 2XP9A 3O5KA 1JVWA 2DG9A 2DG3A 3OA5A 2Q5AA 1HJXA 1WMVA 5E62A 4HARA 2EULA 1L1PA 3O5FA 4JFLA 4MTVA 4C02B 2ITKA 3ALGA 4Z2GA 5HW8A 3PA7A 4ZPVR 4QZVB 4URIA 1E9LA 5AHTA 2LGOA 4WIWA 3MCBA 3RFWA 3O5JA 2ZQTA 4DT4A 2M3OW 4DRQA 4Z2KA 3ARUA 2XP6A 1OWQA 1H0GA 3ALFA 5DIVA 4MNMA 1ROUA 1LL4A 1ZCNA 1OGGA 2RQSA 5HW7A 2M08A 1TR8A 4TX0A 1FKIA 4WK9A 4ML4A 1D7IA 4DRNA 1R9HA 3IK8A 4S3KA 3WKZA 4DH0A 3UF8A 4QT3A 1FLCA 3AS3A 2YBUA 3JYMA 4DRJA 2D9FA 2F4EA 3O5IA 3B8SA 4J4NA 3EIPA 4ODKA 2LAJA 3WL0A 4NNRA 2G8ZA 1PINA 3O5EA 2XPAA 4J4OA 1TFVA 4DWSB 1GPFA 4Q7NA 3IKDA 4XAKA 1SR0A 4L72B 3FY1A 2MDIA 4DZ2A 5HWCA 1ZBKA 3KAGA 4R0XA 4P8XA 2DSVA 3AS0A 4WKHA 4MSPA 4ODLA 4O2TA 3FSCA 4Q22A 3PR9A 1W1TA 3O5DA 4DROA 2O9OA 2K8IA 3KADA 2DT2A 1J6YA 4LGXA 3ARTA 3M7NA 2YSHA 2JV4A 2M8JA 1WNOA 2YSIA 2RUCA 4DWSD 1X6LA 3LE4A 4REXA 2DMVA 4DIPA 1HXVA 5E64A 1FJDA 4U86A 2FKEA 4A0TA 2M2AA 2DJYA 3GU0A 1FKHA 2XPBA 4ODNA 5JH8A 1B6CA 1NMVA 2WK2A 1FKLA 1NWRA 1W1VA 1UR9A 3NTPA 2M8IA 1FKFA 3ARQA 3ARRA 3O5QA 2KR7A 2WADA 2ZAJA 4UDMA 1Q6HA 1H0IA 4JYSA 4LAVA 3WD2A 2LKNA 2DWVA 3UI5A 5HKGA 3MQHA 3TDBA 1KT1A 3CHCA 2RE3A 3BXWA 1HKJA 2YSGA 4WJXA 1ITXA 1NWSA 2XP8A 2ETNA 2IF4A 3AQUA 1FKRA 1SYTA 4MNLA 3O5LA 3RGCA 4DZ3A 2ZR6A 5DITA 4E5RA 5CQ2A 3G6LA 2KGJA 1J4IA 3FS8A 2BA1A 4G2PA 2F21A 2L4JA 4KR0B 4BF8A 3CZ8A 3O5GA 2MNTA 2F2DA 2DSZA 1EIBA 4MGVA 1NH6A 1E6RA 4DWSA 3H9RB 5B8IC 2A3EA 3TCZA 1HJWA 2EZ5W 2DSUA 2DT1A 3GTYX 1F40A 2DK7A 3IKGA 3JYJA 2QRVA 3ARZA 3CHFA 3KCEA 1TCOC 4MAVA 1W1YA 1NMWA 2PV3A 3WL1A 1K9RA 3KAFA 3OOBA 2DSWA 4JFKA 4JFMA 3ARVA 4KQZA 2N87A 1JNEA 4P8WA 3MQGA 3BMBA 4TYOA 1FKBA 5HUAA 2M1IA 4WKFA 3CH9A 2ZQUA 1X6NA 1BL4A 1Q1CA 3RM9A 3RM8A 2VCDA 1FKDA 4ZPWR 4ODOA 4ODRA 1FKSA 1C9HA 1FKGA 3CGNA 4PTMA 3WQWA 4W9OA 3PRDA 4FN2A 3ARYA 1P5QA 2RUQA 5GPGA 2MLXA 4N19A 5HTGA 1JNDA 1JNTA 1JCHB 1D6OA 2JXWA 1HKIA 2JMFA 3ARPA 5DEZA 2KFWA 5HT1A 4HBEA 2QF8A 3B7XA 3TC5A 2B5UB 3I6CA 1FD9A 1WR7A 1RD6A 1T11A 4TW6A 3NRKA 1VF8A 1W26A 3AROA 2XP7A 1JNSA 1JMQA 3L4HA 2IUZA 3O5MA 1QPLA 3LUOA 1Y0OA 2PI6A 2OLHA 2PV1A 4DRPA 4IQCA 4MNKA 1NWUA 2F23A 3O5PA 2ZR5A 2PN0A 1KT0A
chains in the Genus database with same CATH topology
2DPEA 1K9TA 3ARWA 5E65A 1O6WA 3IHZA 4AY1A 3KABA 1O6IA 4ZPTR 1GUVA 4ZS6A 1E6NA 2JX8A 1HKKA 3ARSA 1FKKA 3PRAA 4TW7A 3FXYA 2YBTA 1FAPA 2B31A 3WD0A 4GIVA 4QT2A 2OWOA 5E5WA 2AOSA 2YAJB 1UR8A 1Q6UA 1KFWA 4G50A 1M5YA 3LKXB 4LAYA 3WH0A 1FKTA 1ZK6A 2XP4A 4Z2IA 1W9VA 1Q6IA 2UZ5A 3VAWA 1LJYA 2Y8NB 2ZQSA 3WD4A 2LPVA 1ZBVA 3PRBA 5U47A 4FAPA 4ODMA 1LQ0A 3KAHA 2RSEA 5GQBA 2WLYA 2KO7A 1HKMA 3KACA 4IQ2A 4LAXA 1E15A 3KZ7A 4L3NA 2PBCA 2G41A 1A7XA 1F8AB 1W9PA 2MF9A 5GPRA 4Z2JA 1IX5A 1RP5A 2DG4A 3QOKA 1I5HW 1E6PA 5DO2A 1XHGA 3B9EA 4P8VA 1D2KA 1EYMA 3FSBA 5BXJA 4QIBA 3RM4A 2ESCA 1U79A 5E66A 1W9UA 4ODQA 1EQ3A 1LG1A 2FDMA 5HBFA 2PPNA 3EY6A 1ROTA 1NSGA 1E6ZA 4IT6A 2JZVA 5I98A 2A3BA 2OFNA 1ZB5A 4DRIA 2ZQVA 1FFRA 3ARXA 3AS2A 5DIUA 1D7JA 1LL7A 1EG4A 4Z2LA 2WAEA 3G6MA 1ZBWA 3WD1A 1QZ2A 2VN1A 3RMEA 4W9QA 2AWGA 4DRMA 3CHDA 2YSFA 3GPKA 4W9PA 1HJVA 3UI4A 2XP5A 1ZBCA 2MPHA 1PBKA 4U85A 4DWSC 5J6EA 2RURA 4LAWA 4DRHA 1EDQA 3MCBB 3PQHA 3O5OA 2WLZA 4NZCA 3UQAA 1D7HA 1GOIA 3B9DA 4A0UA 4ODPA 3WD3A 2A3AA 4P8UA 1LG2A 5D75A 2E45A 3NI6A 5HW6A 3LKXA 1EG3A 1J4RA 1EHNA 1W1PA 2LJ4A 2MLZA 2PV2A 1LL6A 2KE0A 4S3JA 3W4RA 1CTNA 4TW8A 2YSBA 2Y78A 2DT3A 3UI6A 4R5EA 3CNGA 3B9AA 5HWBA 3O5RA 2XP3A 3WIJA 1FFQA 3UQIA 2MLYA 2PPPA 1XRVA 2DK1A 2DT0A 2RUDA 3UQBA 3MDYB 4ITZA 3CHEA 1J4HA 1WB0A 1ZU8A 1OGBA 1YATA 4TNSA 3WQVA 1NWTA 2O92A 4JFIA 1QPFA 1ZL1A 1N1AA 4IT4A 2WM0A 2ZR4A 4JFJA 3ODKA 3CGMA 4WKAA 4IPXA 3FAPA 3AS1A 2PPOA 3M85A 3KAIA 4DRKA 1FKJA 4U84A 4W5UA 4NSBA 4GLXA 4GGQA 1TK7A 2L2SA 4HBOA 2KXQA 5DF0A 1K9QA 2FAPA 2KI3A 4Z2HA 1WAWA 1YW5A 1BKFA 3JXVA 2A3CA 4MNJA 4MPKA 2XP9A 3O5KA 1JVWA 2DG9A 2DG3A 3OA5A 2Q5AA 1HJXA 1WMVA 5E62A 4HARA 1L1PA 3O5FA 4JFLA 4MTVA 4C02B 2ITKA 3ALGA 4Z2GA 5HW8A 3PA7A 4ZPVR 4QZVB 4URIA 1E9LA 5AHTA 2LGOA 4WIWA 3MCBA 3RFWA 3O5JA 2ZQTA 4DT4A 2M3OW 4DRQA 4Z2KA 3ARUA 2XP6A 1OWQA 1H0GA 3ALFA 5DIVA 4MNMA 1ROUA 1LL4A 1ZCNA 1OGGA 2RQSA 5HW7A 2M08A 1TR8A 4TX0A 1FKIA 4WK9A 4ML4A 1D7IA 4DRNA 1R9HA 3IK8A 4S3KA 3WKZA 4DH0A 3UF8A 4QT3A 1FLCA 3AS3A 2YBUA 3JYMA 4DRJA 2D9FA 2F4EA 3O5IA 3B8SA 4J4NA 4ODKA 3WL0A 2LAJA 4NNRA 2G8ZA 1PINA 3O5EA 2XPAA 4J4OA 1TFVA 4DWSB 1GPFA 4Q7NA 3IKDA 4XAKA 1SR0A 4L72B 3FY1A 2MDIA 4DZ2A 5HWCA 1ZBKA 3KAGA 4R0XA 4P8XA 2DSVA 3AS0A 4WKHA 4MSPA 4ODLA 4O2TA 3FSCA 4Q22A 3PR9A 1W1TA 3O5DA 4DROA 2O9OA 2K8IA 3KADA 2DT2A 1J6YA 4LGXA 3ARTA 3M7NA 2YSHA 2JV4A 2M8JA 1WNOA 2YSIA 2RUCA 4DWSD 1X6LA 3LE4A 4REXA 2DMVA 4DIPA 1HXVA 5E64A 1FJDA 4U86A 2FKEA 4A0TA 2M2AA 2DJYA 1FKHA 2XPBA 4ODNA 5JH8A 1B6CA 1NMVA 2WK2A 1FKLA 1NWRA 1W1VA 1UR9A 3NTPA 2M8IA 1FKFA 3ARQA 3ARRA 3O5QA 2KR7A 2WADA 2ZAJA 1Q6HA 1H0IA 4JYSA 4LAVA 3WD2A 2LKNA 2DWVA 3UI5A 5HKGA 3MQHA 3TDBA 1KT1A 3CHCA 2RE3A 3BXWA 1HKJA 2YSGA 4WJXA 1ITXA 1NWSA 2XP8A 2IF4A 3AQUA 1FKRA 1SYTA 4MNLA 3O5LA 3RGCA 4DZ3A 2ZR6A 5DITA 4E5RA 5CQ2A 3G6LA 2KGJA 1J4IA 3FS8A 2BA1A 4G2PA 2F21A 2L4JA 4KR0B 4BF8A 3CZ8A 3O5GA 2MNTA 2F2DA 2DSZA 1EIBA 4MGVA 1NH6A 1E6RA 4DWSA 3H9RB 5B8IC 2A3EA 3TCZA 1HJWA 2EZ5W 2DSUA 2DT1A 1F40A 2DK7A 3IKGA 3JYJA 2QRVA 3ARZA 3CHFA 3KCEA 1TCOC 4MAVA 1W1YA 1NMWA 2PV3A 3WL1A 1K9RA 3KAFA 3OOBA 2DSWA 4JFKA 4JFMA 3ARVA 4KQZA 2N87A 1JNEA 4P8WA 3MQGA 4TYOA 1FKBA 5HUAA 2M1IA 4WKFA 3CH9A 2ZQUA 1X6NA 1BL4A 1Q1CA 3RM9A 3RM8A 2VCDA 1FKDA 4ZPWR 4ODOA 4ODRA 1FKSA 1C9HA 1FKGA 3CGNA 4PTMA 3WQWA 4W9OA 3PRDA 4FN2A 3ARYA 1P5QA 2RUQA 5GPGA 2MLXA 4N19A 5HTGA 1JNDA 1JNTA 1D6OA 2JXWA 1HKIA 2JMFA 3ARPA 5DEZA 2KFWA 5HT1A 4HBEA 2QF8A 3B7XA 3TC5A 3I6CA 1FD9A 1WR7A 1RD6A 1T11A 4TW6A 3NRKA 1VF8A 1W26A 3AROA 2XP7A 1JNSA 1JMQA 3L4HA 2IUZA 3O5MA 1QPLA 3LUOA 1Y0OA 2PI6A 2OLHA 2PV1A 4DRPA 4IQCA 4MNKA 1NWUA 3O5PA 2ZR5A 1KT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6W A;  3IHZ A;  3KAB A;  2JX8 A;  1FKK A;  4TW7 A;  1FAP A;  4GIV A;  4QT2 A;  1Q6U A;  4G50 A;  1M5Y A;  4LAY A;  3WH0 A;  1FKT A;  1ZK6 A;  2XP4 A;  1Q6I A;  2UZ5 A;  3VAW A;  2ZQS A;  2LPV A;  3PRB A;  4FAP A;  4ODM A;  3KAH A;  2RSE A;  2KO7 A;  3KAC A;  4IQ2 A;  4LAX A;  3KZ7 A;  2PBC A;  1A7X A;  1F8A B;  2MF9 A;  2DG4 A;  1I5H W;  1EYM A;  5BXJ A;  4QIB A;  1U79 A;  4ODQ A;  1EQ3 A;  2PPN A;  3EY6 A;  1ROT A;  1NSG A;  2JZV A;  5I98 A;  2OFN A;  4DRI A;  2ZQV A;  5DIU A;  1D7J A;  1EG4 A;  1QZ2 A;  2VN1 A;  4W9Q A;  2AWG A;  4DRM A;  2YSF A;  3GPK A;  4W9P A;  3UI4 A;  2XP5 A;  2MPH A;  1PBK A;  4U85 A;  5J6E A;  2RUR A;  4LAW A;  4DRH A;  3O5O A;  3UQA A;  1D7H A;  4ODP A;  5D75 A;  2E45 A;  3NI6 A;  5HW6 A;  1J4R A;  1EG3 A;  2LJ4 A;  2MLZ A;  2PV2 A;  2KE0 A;  4TW8 A;  2YSB A;  2Y78 A;  3UI6 A;  3CNG A;  5HWB A;  3O5R A;  2XP3 A;  3UQI A;  2MLY A;  2PPP A;  2DK1 A;  2RUD A;  3UQB A;  3MDY B;  4ITZ A;  1J4H A;  1YAT A;  4TNS A;  4JFI A;  1QPF A;  1N1A A;  2ZR4 A;  4JFJ A;  3ODK A;  3CGM A;  4IPX A;  3FAP A;  2PPO A;  3M85 A;  3KAI A;  4DRK A;  1FKJ A;  4U84 A;  4GGQ A;  1TK7 A;  2L2S A;  2KXQ A;  1K9Q A;  2FAP A;  2KI3 A;  1YW5 A;  1BKF A;  3JXV A;  2XP9 A;  3O5K A;  1JVW A;  2DG9 A;  2DG3 A;  2Q5A A;  1WMV A;  1L1P A;  3O5F A;  4JFL A;  4C02 B;  2ITK A;  5HW8 A;  3PA7 A;  5AHT A;  2LGO A;  3RFW A;  3O5J A;  2ZQT A;  4DT4 A;  2M3O W;  4DRQ A;  2XP6 A;  5DIV A;  1ROU A;  1ZCN A;  2RQS A;  5HW7 A;  2M08 A;  4TX0 A;  1FKI A;  1D7I A;  4DRN A;  1R9H A;  3IK8 A;  4DH0 A;  3UF8 A;  4QT3 A;  3JYM A;  4DRJ A;  2D9F A;  2F4E A;  3O5I A;  4J4N A;  4ODK A;  2LAJ A;  4NNR A;  1PIN A;  3O5E A;  2XPA A;  4J4O A;  3IKD A;  2MDI A;  4DZ2 A;  5HWC A;  3KAG A;  4R0X A;  4MSP A;  4ODL A;  4O2T A;  3O5D A;  4DRO A;  2K8I A;  3KAD A;  1J6Y A;  3M7N A;  2YSH A;  2JV4 A;  2M8J A;  2YSI A;  2RUC A;  3LE4 A;  4REX A;  2DMV A;  4DIP A;  1HXV A;  1FJD A;  4U86 A;  2FKE A;  2M2A A;  2DJY A;  1FKH A;  2XPB A;  4ODN A;  1B6C A;  1NMV A;  1FKL A;  3NTP A;  2M8I A;  1FKF A;  3O5Q A;  2KR7 A;  2ZAJ A;  1Q6H A;  4LAV A;  4JYS A;  2LKN A;  2DWV A;  3UI5 A;  5HKG A;  3TDB A;  1KT1 A;  2RE3 A;  2YSG A;  2XP8 A;  2IF4 A;  1FKR A;  3RGC A;  3O5L A;  4DZ3 A;  2ZR6 A;  5DIT A;  4E5R A;  5CQ2 A;  2KGJ A;  1J4I A;  2BA1 A;  4G2P A;  2F21 A;  2L4J A;  4BF8 A;  3O5G A;  2MNT A;  2F2D A;  4MGV A;  5B8I C;  3H9R B;  3TCZ A;  2EZ5 W;  1F40 A;  2DK7 A;  3IKG A;  3JYJ A;  3KCE A;  1TCO C;  1NMW A;  2PV3 A;  1K9R A;  3KAF A;  3OOB A;  4JFK A;  4JFM A;  2N87 A;  4TYO A;  1FKB A;  5HUA A;  2M1I A;  2ZQU A;  1BL4 A;  1Q1C A;  2VCD A;  1FKD A;  4ODO A;  4ODR A;  1FKS A;  1C9H A;  1FKG A;  3CGN A;  4W9O A;  3PRD A;  4FN2 A;  1P5Q A;  2RUQ A;  5GPG A;  2MLX A;  4N19 A;  5HTG A;  1JNT A;  1D6O A;  2JXW A;  2JMF A;  2KFW A;  5HT1 A;  3B7X A;  3TC5 A;  3I6C A;  1FD9 A;  1WR7 A;  1T11 A;  4TW6 A;  3NRK A;  1W26 A;  2XP7 A;  1JNS A;  1JMQ A;  3L4H A;  3O5M A;  1QPL A;  3LUO A;  1Y0O A;  2PV1 A;  4DRP A;  4IQC A;  3O5P A;  2ZR5 A;  1KT0 A; 
#chains in the Genus database with same CATH topology
 2DPE A;  1K9T A;  3ARW A;  5E65 A;  1O6W A;  3IHZ A;  4AY1 A;  3KAB A;  1O6I A;  4ZPT R;  1GUV A;  4ZS6 A;  1E6N A;  2JX8 A;  1HKK A;  3ARS A;  1FKK A;  3PRA A;  4TW7 A;  3FXY A;  2YBT A;  1FAP A;  2B31 A;  3WD0 A;  4GIV A;  4QT2 A;  2OWO A;  5E5W A;  2AOS A;  2YAJ B;  1UR8 A;  1Q6U A;  1KFW A;  4G50 A;  1M5Y A;  3LKX B;  1GRJ A;  4LAY A;  3WH0 A;  1FKT A;  1ZK6 A;  2XP4 A;  4Z2I A;  1W9V A;  1Q6I A;  2UZ5 A;  3VAW A;  1LJY A;  2Y8N B;  2ZQS A;  3WD4 A;  2LPV A;  1ZBV A;  3PRB A;  5U47 A;  4FAP A;  4ODM A;  1LQ0 A;  3KAH A;  2RSE A;  5GQB A;  2WLY A;  2KO7 A;  1HKM A;  3KAC A;  4IQ2 A;  4LAX A;  1E15 A;  3KZ7 A;  4L3N A;  2PBC A;  2G41 A;  1A7X A;  1F8A B;  1W9P A;  2MF9 A;  5GPR A;  4Z2J A;  1IX5 A;  1RP5 A;  2DG4 A;  3QOK A;  1I5H W;  1E6P A;  5DO2 A;  1XHG A;  3B9E A;  4P8V A;  1D2K A;  1EYM A;  3FSB A;  5BXJ A;  4QIB A;  3RM4 A;  2ESC A;  1U79 A;  5E66 A;  1W9U A;  1E44 A;  4ODQ A;  1EQ3 A;  1LG1 A;  2FDM A;  5HBF A;  2PPN A;  3EY6 A;  1ROT A;  1NSG A;  1E6Z A;  4IT6 A;  2JZV A;  5I98 A;  2A3B A;  2OFN A;  1ZB5 A;  4DRI A;  2ZQV A;  1FFR A;  3ARX A;  3AS2 A;  5DIU A;  1D7J A;  1LL7 A;  1EG4 A;  4Z2L A;  2WAE A;  3G6M A;  1ZBW A;  3WD1 A;  1QZ2 A;  2VN1 A;  3RME A;  4W9Q A;  2AWG A;  4DRM A;  3CHD A;  2YSF A;  3GPK A;  4W9P A;  1HJV A;  3UI4 A;  2XP5 A;  1ZBC A;  2MPH A;  1PBK A;  4U85 A;  4DWS C;  5J6E A;  2RUR A;  4LAW A;  4DRH A;  1EDQ A;  3MCB B;  3PQH A;  3O5O A;  2WLZ A;  4NZC A;  3UQA A;  1D7H A;  1GOI A;  3B9D A;  4A0U A;  2P4V A;  4ODP A;  3WD3 A;  2A3A A;  4P8U A;  1LG2 A;  5D75 A;  2E45 A;  3NI6 A;  5HW6 A;  3LKX A;  1EG3 A;  1J4R A;  1EHN A;  1W1P A;  2LJ4 A;  2MLZ A;  2PV2 A;  1LL6 A;  2KE0 A;  4S3J A;  3W4R A;  1CTN A;  4TW8 A;  2YSB A;  2Y78 A;  2DT3 A;  3UI6 A;  4R5E A;  3CNG A;  3B9A A;  5HWB A;  3O5R A;  2XP3 A;  3WIJ A;  1FFQ A;  3UQI A;  2MLY A;  2PPP A;  1XRV A;  2DK1 A;  2DT0 A;  2RUD A;  3UQB A;  3MDY B;  4ITZ A;  3CHE A;  1J4H A;  1WB0 A;  1ZU8 A;  1OGB A;  1YAT A;  4TNS A;  3WQV A;  1NWT A;  2O92 A;  4JFI A;  1QPF A;  1ZL1 A;  1N1A A;  4IT4 A;  2WM0 A;  2ZR4 A;  4JFJ A;  3ODK A;  3CGM A;  4WKA A;  4IPX A;  3FAP A;  3AS1 A;  2PPO A;  3M85 A;  3KAI A;  4DRK A;  1FKJ A;  4U84 A;  4W5U A;  4NSB A;  4GLX A;  4GGQ A;  1TK7 A;  2L2S A;  4HBO A;  2KXQ A;  5DF0 A;  1K9Q A;  2FAP A;  2KI3 A;  4Z2H A;  1WAW A;  1YW5 A;  1BKF A;  3JXV A;  2A3C A;  4MNJ A;  4MPK A;  2XP9 A;  3O5K A;  1JVW A;  2DG9 A;  2DG3 A;  3OA5 A;  2Q5A A;  1HJX A;  1WMV A;  5E62 A;  4HAR A;  2EUL A;  1L1P A;  3O5F A;  4JFL A;  4MTV A;  4C02 B;  2ITK A;  3ALG A;  4Z2G A;  5HW8 A;  3PA7 A;  4ZPV R;  4QZV B;  4URI A;  1E9L A;  5AHT A;  2LGO A;  4WIW A;  3MCB A;  3RFW A;  3O5J A;  2ZQT A;  4DT4 A;  2M3O W;  4DRQ A;  4Z2K A;  3ARU A;  2XP6 A;  1OWQ A;  1H0G A;  3ALF A;  5DIV A;  4MNM A;  1ROU A;  1LL4 A;  1ZCN A;  1OGG A;  2RQS A;  5HW7 A;  2M08 A;  1TR8 A;  4TX0 A;  1FKI A;  4WK9 A;  4ML4 A;  1D7I A;  4DRN A;  1R9H A;  3IK8 A;  4S3K A;  3WKZ A;  4DH0 A;  3UF8 A;  4QT3 A;  1FLC A;  3AS3 A;  2YBU A;  3JYM A;  4DRJ A;  2D9F A;  2F4E A;  3O5I A;  3B8S A;  4J4N A;  3EIP A;  4ODK A;  2LAJ A;  3WL0 A;  4NNR A;  2G8Z A;  1PIN A;  3O5E A;  2XPA A;  4J4O A;  1TFV A;  4DWS B;  1GPF A;  4Q7N A;  3IKD A;  4XAK A;  1SR0 A;  4L72 B;  3FY1 A;  2MDI A;  4DZ2 A;  5HWC A;  1ZBK A;  3KAG A;  4R0X A;  4P8X A;  2DSV A;  3AS0 A;  4WKH A;  4MSP A;  4ODL A;  4O2T A;  3FSC A;  4Q22 A;  3PR9 A;  1W1T A;  3O5D A;  4DRO A;  2O9O A;  2K8I A;  3KAD A;  2DT2 A;  1J6Y A;  4LGX A;  3ART A;  3M7N A;  2YSH A;  2JV4 A;  2M8J A;  1WNO A;  2YSI A;  2RUC A;  4DWS D;  1X6L A;  3LE4 A;  4REX A;  2DMV A;  4DIP A;  1HXV A;  5E64 A;  1FJD A;  4U86 A;  2FKE A;  4A0T A;  2M2A A;  2DJY A;  3GU0 A;  1FKH A;  2XPB A;  4ODN A;  5JH8 A;  1B6C A;  1NMV A;  2WK2 A;  1FKL A;  1NWR A;  1W1V A;  1UR9 A;  3NTP A;  2M8I A;  1FKF A;  3ARQ A;  3ARR A;  3O5Q A;  2KR7 A;  2WAD A;  2ZAJ A;  4UDM A;  1Q6H A;  1H0I A;  4JYS A;  4LAV A;  3WD2 A;  2LKN A;  2DWV A;  3UI5 A;  5HKG A;  3MQH A;  3TDB A;  1KT1 A;  3CHC A;  2RE3 A;  3BXW A;  1HKJ A;  2YSG A;  4WJX A;  1ITX A;  1NWS A;  2XP8 A;  2ETN A;  2IF4 A;  3AQU A;  1FKR A;  1SYT A;  4MNL A;  3O5L A;  3RGC A;  4DZ3 A;  2ZR6 A;  5DIT A;  4E5R A;  5CQ2 A;  3G6L A;  2KGJ A;  1J4I A;  3FS8 A;  2BA1 A;  4G2P A;  2F21 A;  2L4J A;  4KR0 B;  4BF8 A;  3CZ8 A;  3O5G A;  2MNT A;  2F2D A;  2DSZ A;  1EIB A;  4MGV A;  1NH6 A;  1E6R A;  4DWS A;  3H9R B;  5B8I C;  2A3E A;  3TCZ A;  1HJW A;  2EZ5 W;  2DSU A;  2DT1 A;  3GTY X;  1F40 A;  2DK7 A;  3IKG A;  3JYJ A;  2QRV A;  3ARZ A;  3CHF A;  3KCE A;  1TCO C;  4MAV A;  1W1Y A;  1NMW A;  2PV3 A;  3WL1 A;  1K9R A;  3KAF A;  3OOB A;  2DSW A;  4JFK A;  4JFM A;  3ARV A;  4KQZ A;  2N87 A;  1JNE A;  4P8W A;  3MQG A;  3BMB A;  4TYO A;  1FKB A;  5HUA A;  2M1I A;  4WKF A;  3CH9 A;  2ZQU A;  1X6N A;  1BL4 A;  1Q1C A;  3RM9 A;  3RM8 A;  2VCD A;  1FKD A;  4ZPW R;  4ODO A;  4ODR A;  1FKS A;  1C9H A;  1FKG A;  3CGN A;  4PTM A;  3WQW A;  4W9O A;  3PRD A;  4FN2 A;  3ARY A;  1P5Q A;  2RUQ A;  5GPG A;  2MLX A;  4N19 A;  5HTG A;  1JND A;  1JNT A;  1JCH B;  1D6O A;  2JXW A;  1HKI A;  2JMF A;  3ARP A;  5DEZ A;  2KFW A;  5HT1 A;  4HBE A;  2QF8 A;  3B7X A;  3TC5 A;  2B5U B;  3I6C A;  1FD9 A;  1WR7 A;  1RD6 A;  1T11 A;  4TW6 A;  3NRK A;  1VF8 A;  1W26 A;  3ARO A;  2XP7 A;  1JNS A;  1JMQ A;  3L4H A;  2IUZ A;  3O5M A;  1QPL A;  3LUO A;  1Y0O A;  2PI6 A;  2OLH A;  2PV1 A;  4DRP A;  4IQC A;  4MNK A;  1NWU A;  2F23 A;  3O5P A;  2ZR5 A;  2PN0 A;  1KT0 A; 
#chains in the Genus database with same CATH homology
 2DPE A;  1K9T A;  3ARW A;  5E65 A;  1O6W A;  3IHZ A;  4AY1 A;  3KAB A;  1O6I A;  4ZPT R;  1GUV A;  4ZS6 A;  1E6N A;  2JX8 A;  1HKK A;  3ARS A;  1FKK A;  3PRA A;  4TW7 A;  3FXY A;  2YBT A;  1FAP A;  2B31 A;  3WD0 A;  4GIV A;  4QT2 A;  2OWO A;  5E5W A;  2AOS A;  2YAJ B;  1UR8 A;  1Q6U A;  1KFW A;  4G50 A;  1M5Y A;  3LKX B;  4LAY A;  3WH0 A;  1FKT A;  1ZK6 A;  2XP4 A;  4Z2I A;  1W9V A;  1Q6I A;  2UZ5 A;  3VAW A;  1LJY A;  2Y8N B;  2ZQS A;  3WD4 A;  2LPV A;  1ZBV A;  3PRB A;  5U47 A;  4FAP A;  4ODM A;  1LQ0 A;  3KAH A;  2RSE A;  5GQB A;  2WLY A;  2KO7 A;  1HKM A;  3KAC A;  4IQ2 A;  4LAX A;  1E15 A;  3KZ7 A;  4L3N A;  2PBC A;  2G41 A;  1A7X A;  1F8A B;  1W9P A;  2MF9 A;  5GPR A;  4Z2J A;  1IX5 A;  1RP5 A;  2DG4 A;  3QOK A;  1I5H W;  1E6P A;  5DO2 A;  1XHG A;  3B9E A;  4P8V A;  1D2K A;  1EYM A;  3FSB A;  5BXJ A;  4QIB A;  3RM4 A;  2ESC A;  1U79 A;  5E66 A;  1W9U A;  4ODQ A;  1EQ3 A;  1LG1 A;  2FDM A;  5HBF A;  2PPN A;  3EY6 A;  1ROT A;  1NSG A;  1E6Z A;  4IT6 A;  2JZV A;  5I98 A;  2A3B A;  2OFN A;  1ZB5 A;  4DRI A;  2ZQV A;  1FFR A;  3ARX A;  3AS2 A;  5DIU A;  1D7J A;  1LL7 A;  1EG4 A;  4Z2L A;  2WAE A;  3G6M A;  1ZBW A;  3WD1 A;  1QZ2 A;  2VN1 A;  3RME A;  4W9Q A;  2AWG A;  4DRM A;  3CHD A;  2YSF A;  3GPK A;  4W9P A;  1HJV A;  3UI4 A;  2XP5 A;  1ZBC A;  2MPH A;  1PBK A;  4U85 A;  4DWS C;  5J6E A;  2RUR A;  4LAW A;  4DRH A;  1EDQ A;  3MCB B;  3PQH A;  3O5O A;  2WLZ A;  4NZC A;  3UQA A;  1D7H A;  1GOI A;  3B9D A;  4A0U A;  4ODP A;  3WD3 A;  2A3A A;  4P8U A;  1LG2 A;  5D75 A;  2E45 A;  3NI6 A;  5HW6 A;  3LKX A;  1EG3 A;  1J4R A;  1EHN A;  1W1P A;  2LJ4 A;  2MLZ A;  2PV2 A;  1LL6 A;  2KE0 A;  4S3J A;  3W4R A;  1CTN A;  4TW8 A;  2YSB A;  2Y78 A;  2DT3 A;  3UI6 A;  4R5E A;  3CNG A;  3B9A A;  5HWB A;  3O5R A;  2XP3 A;  3WIJ A;  1FFQ A;  3UQI A;  2MLY A;  2PPP A;  1XRV A;  2DK1 A;  2DT0 A;  2RUD A;  3UQB A;  3MDY B;  4ITZ A;  3CHE A;  1J4H A;  1WB0 A;  1ZU8 A;  1OGB A;  1YAT A;  4TNS A;  3WQV A;  1NWT A;  2O92 A;  4JFI A;  1QPF A;  1ZL1 A;  1N1A A;  4IT4 A;  2WM0 A;  2ZR4 A;  4JFJ A;  3ODK A;  3CGM A;  4WKA A;  4IPX A;  3FAP A;  3AS1 A;  2PPO A;  3M85 A;  3KAI A;  4DRK A;  1FKJ A;  4U84 A;  4W5U A;  4NSB A;  4GLX A;  4GGQ A;  1TK7 A;  2L2S A;  4HBO A;  2KXQ A;  5DF0 A;  1K9Q A;  2FAP A;  2KI3 A;  4Z2H A;  1WAW A;  1YW5 A;  1BKF A;  3JXV A;  2A3C A;  4MNJ A;  4MPK A;  2XP9 A;  3O5K A;  1JVW A;  2DG9 A;  2DG3 A;  3OA5 A;  2Q5A A;  1HJX A;  1WMV A;  5E62 A;  4HAR A;  1L1P A;  3O5F A;  4JFL A;  4MTV A;  4C02 B;  2ITK A;  3ALG A;  4Z2G A;  5HW8 A;  3PA7 A;  4ZPV R;  4QZV B;  4URI A;  1E9L A;  5AHT A;  2LGO A;  4WIW A;  3MCB A;  3RFW A;  3O5J A;  2ZQT A;  4DT4 A;  2M3O W;  4DRQ A;  4Z2K A;  3ARU A;  2XP6 A;  1OWQ A;  1H0G A;  3ALF A;  5DIV A;  4MNM A;  1ROU A;  1LL4 A;  1ZCN A;  1OGG A;  2RQS A;  5HW7 A;  2M08 A;  1TR8 A;  4TX0 A;  1FKI A;  4WK9 A;  4ML4 A;  1D7I A;  4DRN A;  1R9H A;  3IK8 A;  4S3K A;  3WKZ A;  4DH0 A;  3UF8 A;  4QT3 A;  1FLC A;  3AS3 A;  2YBU A;  3JYM A;  4DRJ A;  2D9F A;  2F4E A;  3O5I A;  3B8S A;  4J4N A;  4ODK A;  3WL0 A;  2LAJ A;  4NNR A;  2G8Z A;  1PIN A;  3O5E A;  2XPA A;  4J4O A;  1TFV A;  4DWS B;  1GPF A;  4Q7N A;  3IKD A;  4XAK A;  1SR0 A;  4L72 B;  3FY1 A;  2MDI A;  4DZ2 A;  5HWC A;  1ZBK A;  3KAG A;  4R0X A;  4P8X A;  2DSV A;  3AS0 A;  4WKH A;  4MSP A;  4ODL A;  4O2T A;  3FSC A;  4Q22 A;  3PR9 A;  1W1T A;  3O5D A;  4DRO A;  2O9O A;  2K8I A;  3KAD A;  2DT2 A;  1J6Y A;  4LGX A;  3ART A;  3M7N A;  2YSH A;  2JV4 A;  2M8J A;  1WNO A;  2YSI A;  2RUC A;  4DWS D;  1X6L A;  3LE4 A;  4REX A;  2DMV A;  4DIP A;  1HXV A;  5E64 A;  1FJD A;  4U86 A;  2FKE A;  4A0T A;  2M2A A;  2DJY A;  1FKH A;  2XPB A;  4ODN A;  5JH8 A;  1B6C A;  1NMV A;  2WK2 A;  1FKL A;  1NWR A;  1W1V A;  1UR9 A;  3NTP A;  2M8I A;  1FKF A;  3ARQ A;  3ARR A;  3O5Q A;  2KR7 A;  2WAD A;  2ZAJ A;  1Q6H A;  1H0I A;  4JYS A;  4LAV A;  3WD2 A;  2LKN A;  2DWV A;  3UI5 A;  5HKG A;  3MQH A;  3TDB A;  1KT1 A;  3CHC A;  2RE3 A;  3BXW A;  1HKJ A;  2YSG A;  4WJX A;  1ITX A;  1NWS A;  2XP8 A;  2IF4 A;  3AQU A;  1FKR A;  1SYT A;  4MNL A;  3O5L A;  3RGC A;  4DZ3 A;  2ZR6 A;  5DIT A;  4E5R A;  5CQ2 A;  3G6L A;  2KGJ A;  1J4I A;  3FS8 A;  2BA1 A;  4G2P A;  2F21 A;  2L4J A;  4KR0 B;  4BF8 A;  3CZ8 A;  3O5G A;  2MNT A;  2F2D A;  2DSZ A;  1EIB A;  4MGV A;  1NH6 A;  1E6R A;  4DWS A;  3H9R B;  5B8I C;  2A3E A;  3TCZ A;  1HJW A;  2EZ5 W;  2DSU A;  2DT1 A;  1F40 A;  2DK7 A;  3IKG A;  3JYJ A;  2QRV A;  3ARZ A;  3CHF A;  3KCE A;  1TCO C;  4MAV A;  1W1Y A;  1NMW A;  2PV3 A;  3WL1 A;  1K9R A;  3KAF A;  3OOB A;  2DSW A;  4JFK A;  4JFM A;  3ARV A;  4KQZ A;  2N87 A;  1JNE A;  4P8W A;  3MQG A;  4TYO A;  1FKB A;  5HUA A;  2M1I A;  4WKF A;  3CH9 A;  2ZQU A;  1X6N A;  1BL4 A;  1Q1C A;  3RM9 A;  3RM8 A;  2VCD A;  1FKD A;  4ZPW R;  4ODO A;  4ODR A;  1FKS A;  1C9H A;  1FKG A;  3CGN A;  4PTM A;  3WQW A;  4W9O A;  3PRD A;  4FN2 A;  3ARY A;  1P5Q A;  2RUQ A;  5GPG A;  2MLX A;  4N19 A;  5HTG A;  1JND A;  1JNT A;  1D6O A;  2JXW A;  1HKI A;  2JMF A;  3ARP A;  5DEZ A;  2KFW A;  5HT1 A;  4HBE A;  2QF8 A;  3B7X A;  3TC5 A;  3I6C A;  1FD9 A;  1WR7 A;  1RD6 A;  1T11 A;  4TW6 A;  3NRK A;  1VF8 A;  1W26 A;  3ARO A;  2XP7 A;  1JNS A;  1JMQ A;  3L4H A;  2IUZ A;  3O5M A;  1QPL A;  3LUO A;  1Y0O A;  2PI6 A;  2OLH A;  2PV1 A;  4DRP A;  4IQC A;  4MNK A;  1NWU A;  3O5P A;  2ZR5 A;  1KT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...