2ZR4A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNAAQWERPSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 45
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr4A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr4A02
2LKNA 4JFLA 1Q6IA 2LGOA 4LAYA 3VAWA 1ROUA 2LPVA 2RUCA 2RSEA 2YSHA 2ZQSA 1F40A 2FAPA 4ODKA 3O5OA 1N1AA 2KXQA 3NI6A 2EZ5W 4N19A 1YATA 2MF9A 1BL4A 1J4RA 3IHZA 3LE4A 2RUQA 4JYSA 5HUAA 2XP9A 2D9FA 3M7NA 3O5IA 4TW7A 5HW8A 2BA1A 1J4IA 1FKJA 3O5FA 3RFWA 2DG9A 1FAPA 3JXVA 5GPGA 1TCOC 3NRKA 2DWVA 2YSGA 3O5LA 3CNGA 2MLXA 3H9RB 4FN2A 3WH0A 1FKSA 2RURA 2MLYA 4MSPA 1T11A 4G50A 3JYMA 5HWBA 2M1IA 1PINA 2XPBA 2Q5AA 2L4JA 2RE3A 1FKLA 2F4EA 2KE0A 2UZ5A 3O5KA 3EY6A 3TDBA 3L4HA 4REXA 1EG4A 3KACA 4JFMA 2MPHA 3O5GA 3O5DA 2LJ4A 4DRIA 4DZ3A 3PRDA 2YSBA 2XP7A 2JXWA 2PV1A 4TNSA 5I98A 1FKTA 4U86A 4G2PA 1K9RA 4ODRA 4ODOA 1FJDA 4DRKA 1YW5A 2MLZA 4TYOA 3PRBA 2L2SA 1B6CA 1D7IA 2KGJA 4U85A 1ZCNA 4E5RA 2PPNA 4JFJA 5DIVA 4QIBA 1WR7A 2ZR5A 1D7HA 3NTPA 1FKBA 2Y78A 1K9QA 3UI4A 4BF8A 1FKIA 3O5JA 5HT1A 2F21A 4DIPA 2DG3A 1JVWA 5HWCA 2LAJA 4W9QA 2PV2A 1KT0A 1Q1CA 1D6OA 2ITKA 2KFWA 3KZ7A 1FKHA 3UI5A 4C02B 4DRJA 1FKGA 2XP3A 2PV3A 3O5PA 2M2AA 2ZAJA 5CQ2A 1NMWA 2KO7A 2JZVA 2KR7A 3IKGA 2ZR6A 2XP4A 1P5QA 2XP5A 1FKFA 2MNTA 3I6CA 1W26A 5B8IC 1O6WA 1EYMA 4R0XA 4IPXA 2DK7A 3FAPA 5AHTA 2FKEA 1R9HA 3M85A 2VN1A 4W9PA 3UQIA 3UQAA 3UF8A 2IF4A 1F8AB 2XP6A 2RQSA 2N87A 1Q6UA 1Q6HA 4DH0A 4J4OA 2VCDA 4QT3A 5BXJA 3TC5A 1U79A 2XP8A 4ODPA 5HKGA 1FKKA 1PBKA 2PPOA 2PPPA 4TX0A 3MDYB 3O5MA 2KI3A 3IKDA 5DIUA 2JV4A 1ROTA 4DRQA 2YSIA 4W9OA 3RGCA 3KCEA 2M8JA 1L1PA 1C9HA 2AWGA 4NNRA 1HXVA 2E45A 4J4NA 4ODQA 1JMQA 2DJYA 3KADA 1NSGA 4ODMA 4TW8A 2DMVA 4DRMA 4LAVA 1BKFA 1JNSA 4DRNA 1QZ2A 4LAXA 5D75A 2XPAA 1D7JA 4O2TA 5HW7A 1EG3A 2MDIA 2DG4A 3KAGA 1WMVA 2ZQUA 2RUDA 2OFNA 1FD9A 4IQ2A 4QT2A 4TW6A 2M08A 4LAWA 3UI6A 2YSFA 2K8IA 2F2DA 3JYJA 4ITZA 1FKRA 4IQCA 2DK1A 1KT1A 3KAFA 1FKDA 4ODNA 3CGNA 5HTGA 3ODKA 2JMFA 1EQ3A 4MGVA 4JFIA 3LUOA 1ZK6A 4DROA 1J6YA 3TCZA 3O5RA 4GIVA 2JX8A 4DZ2A 3O5EA 4DT4A 3OOBA 2ZQVA 3IK8A 4ODLA 1J4HA 3UQBA 1JNTA 3PA7A 2ZR4A 4DRHA 1QPFA 3KABA 1Y0OA 3B7XA 5J6EA 5HW6A 1M5YA 3KAHA 1TK7A 2M3OW 1QPLA 1NMVA 2M8IA 4FAPA 4U84A 3CGMA 4GGQA 3KAIA 4JFKA 4DRPA 2ZQTA 1A7XA 3GPKA 5DITA 3O5QA 2PBCA 1I5HW
chains in the Genus database with same CATH superfamily
4JFLA 1NWSA 1Q6IA 1F40A 2QF8A 1H0GA 1H0IA 4N19A 4IT6A 1BL4A 1ZBKA 2RUQA 3WL1A 4P8WA 3W4RA 5HW8A 1ZB5A 3ARRA 1FKJA 5HUAA 2DG9A 4GLXA 2DWVA 3FSBA 3CNGA 2WK2A 4G50A 2M1IA 3WIJA 1HKKA 2F4EA 4DZ3A 1LL7A 4S3JA 4DRIA 2DSWA 4P8XA 3B9DA 1E44A 3B9EA 3LKXA 4AY1A 1GRJA 4U86A 4ODOA 1GUVA 4Z2LA 4TYOA 2L2SA 1ZCNA 1JNEA 5E64A 2ZR5A 2DT3A 4LGXA 1W1YA 2F21A 4HBEA 3ARQA 2PV2A 2OLHA 3CHEA 1FKGA 2XP3A 2PV3A 3RM9A 2M2AA 5CQ2A 2KR7A 3ALGA 2JZVA 2B31A 2FDMA 2ZR6A 4Z2KA 3AS1A 2Y8NB 1RP5A 3FAPA 3UQIA 4MTVA 5DO2A 3ARPA 1F8AB 4P8VA 3LKXB 2VCDA 4QT3A 3TC5A 4HBOA 2PPOA 1SYTA 4TX0A 1W1VA 3IKDA 4DRQA 4Z2HA 1LQ0A 4A0UA 3PRAA 2E45A 4TW8A 2DJYA 1EHNA 2DMVA 1W1TA 4LAXA 4WK9A 4DWSC 1EG3A 4IQ2A 2RUDA 3BXWA 2A3BA 1EDQA 2M08A 4LAWA 2AOSA 3JYJA 2DK1A 4ODNA 3CGNA 4HARA 1E15A 5U47A 2JX8A 3O5EA 3OOBA 4Z2GA 4ZPTR 1NMVA 1NWTA 1SR0A 2ESCA 3KAIA 1K9TA 4KR0B 4MNKA 1A7XA 2A3AA 2LKNA 4LAYA 5GQBA 1ROUA 3AQUA 2FAPA 4ODKA 1N1AA 2KXQA 1HKJA 2EZ5W 1E9LA 1J4RA 4TW7A 4WKFA 2BA1A 3O5FA 1GPFA 4MNMA 4FN2A 2MLXA 2RURA 2MLYA 1T11A 1UR9A 2KE0A 3ARYA 3QOKA 1EG4A 3O5GA 4Q7NA 2PV1A 4TNSA 1FKTA 4A0TA 1YW5A 3RMEA 3WD0A 3PRBA 3AS0A 1W9UA 2KGJA 4E5RA 2WLYA 4JFJA 2G41A 3WD4A 4QIBA 1WR7A 1FLCA 2F23A 1K9QA 3FY1A 3UI4A 3OA5A 1HKMA 1ZU8A 4DIPA 2DG3A 1JVWA 2LAJA 1Q1CA 3O5PA 1ZBCA 2XP4A 1FKFA 2DK7A 5AHTA 3GTYX 3M85A 1FFRA 3UQAA 3UF8A 4R5EA 3RM8A 2RQSA 4DWSB 5BXJA 1U79A 5HBFA 2XP8A 4MNLA 4URIA 2PPPA 5DIUA 1ROTA 3RGCA 1C9HA 4Q22A 4Z2IA 5E65A 1HXVA 2PI6A 4J4NA 4ODQA 1JMQA 3KADA 1NSGA 2DSZA 4LAVA 1JNSA 1QZ2A 5D75A 3ALFA 2XPAA 4ML4A 2DSVA 3KAGA 1WMVA 2OFNA 4TW6A 3UI6A 2K8IA 2F2DA 3B8SA 4IQCA 4S3KA 1HJVA 4W5UA 2JMFA 1O6IA 3RM4A 4MGVA 3LUOA 4GIVA 1D2KA 1GOIA 4L3NA 2ZQVA 3PA7A 1Y0OA 2DPEA 2O9OA 5HW6A 1M5YA 1TK7A 2M3OW 4FAPA 2M8IA 3FXYA 3CGMA 1TFVA 4DRPA 2ZQTA 3O5QA 4KQZA 2LGOA 2LPVA 3ARSA 1JCHB 2RUCA 2RSEA 3ARVA 2YSHA 3O5OA 3NI6A 1XRVA 1YATA 2MF9A 2IUZA 3IHZA 3LE4A 4JYSA 2OWOA 1FAPA 1ZBWA 5GPGA 1WNOA 2YSGA 1KFWA 4MSPA 1ITXA 1FKSA 2A3CA 1W9VA 3JYMA 1PINA 3O5KA 2Q5AA 2RE3A 1FKLA 1OGBA 3ARUA 3TDBA 2WM0A 1LG1A 4REXA 4JFMA 2MPHA 3O5DA 4DWSA 2YSBA 2JXWA 3WQWA 2P4VA 4G2PA 4DRKA 1B6CA 1D7IA 2PPNA 5DIVA 3WD1A 1XHGA 3NTPA 5GPRA 3MCBA 1OWQA 1JNDA 3CH9A 3WKZA 5DF0A 1KT0A 2KFWA 4DRJA 4P8UA 1E6PA 1NWUA 1HJXA 1P5QA 2XP5A 3GU0A 5B8IC 1O6WA 1EYMA 1X6LA 5E66A 2FKEA 1R9HA 4UDMA 2N87A 1Q6HA 4J4OA 4QZVB 4ODPA 1EIBA 1FKKA 3O5MA 2KI3A 2ETNA 1LL6A 2JV4A 4MNJA 3MQHA 2M8JA 1LJYA 3MCBB 3CZ8A 3WL0A 2WADA 1RD6A 4DRNA 4IT4A 4O2TA 2MDIA 1FD9A 2YSFA 4ITZA 4L72B 5JH8A 1TR8A 3KAFA 1FKDA 2YBTA 3WQVA 2B5UB 3EIPA 3WD2A 2PN0A 3PR9A 1J6YA 5DEZA 3TCZA 2QRVA 1J4HA 1JNTA 5E5WA 5J6EA 2YBUA 1NWRA 3KAHA 4WKAA 5E62A 4U84A 4MAVA 4JFKA 4WKHA 1I5HW 4WIWA 3FSCA 1W9PA 3VAWA 2ZQSA 3CHDA 1UR8A 3G6MA 3PQHA 4MPKA 2XP9A 2D9FA 3M7NA 3O5IA 1J4IA 3RFWA 1X6NA 3JXVA 1TCOC 3NRKA 3O5LA 4XAKA 1OGGA 3UI5A 3ARWA 3AS2A 3WH0A 3H9RB 5HWBA 1NH6A 2XPBA 4QT2A 2L4JA 2UZ5A 2WLZA 2A3EA 3L4HA 3EY6A 2EULA 3KACA 1HKIA 2WAEA 1LG2A 2LJ4A 3PRDA 1E6NA 2XP7A 2DSUA 5I98A 1K9RA 4ODRA 1FJDA 2MLZA 4U85A 2O92A 4ZS6A 1D7HA 1FKBA 4WJXA 2Y78A 1WAWA 4BF8A 1FFQA 1FKIA 3O5JA 5HT1A 5HWCA 4W9QA 1W1PA 3B9AA 1D6OA 2ITKA 3KZ7A 1CTNA 1FKHA 4C02B 4Z2JA 2ZAJA 2KO7A 1NMWA 3IKGA 3I6CA 2MNTA 3CHFA 1W26A 4R0XA 4IPXA 4ZPVR 1E6RA 4ZPWR 4W9PA 2VN1A 4NZCA 2DT1A 2IF4A 2XP6A 3MQGA 1HJWA 1Q6UA 4DH0A 3ARXA 5HKGA 1PBKA 4DWSD 3MDYB 3G6LA 2YSIA 4W9OA 3KCEA 1L1PA 2AWGA 4NNRA 1ZL1A 4ODMA 3ARZA 4DRMA 1BKFA 1D7JA 5HW7A 2DG4A 2ZQUA 1FKRA 1KT1A 2DT0A 1LL4A 3CHCA 5HTGA 3ODKA 1EQ3A 3BMBA 4JFIA 2YAJB 1ZK6A 3AROA 1E6ZA 3O5RA 4DROA 4DZ2A 4NSBA 3FS8A 4DT4A 1IX5A 3IK8A 4ODLA 3UQBA 2G8ZA 2ZR4A 4DRHA 1QPFA 3KABA 3ARTA 3B7XA 1VF8A 1QPLA 1WB0A 4GGQA 3WD3A 1ZBVA 3GPKA 3AS3A 5DITA 4PTMA 2DT2A 2PBCA
chains in the Genus database with same CATH topology
4JFLA 1NWSA 1Q6IA 1F40A 2QF8A 1H0GA 1H0IA 4N19A 4IT6A 1BL4A 1ZBKA 2RUQA 3WL1A 4P8WA 3W4RA 5HW8A 1ZB5A 3ARRA 1FKJA 5HUAA 2DG9A 4GLXA 2DWVA 3FSBA 3CNGA 2WK2A 4G50A 2M1IA 3WIJA 1HKKA 2F4EA 4DZ3A 1LL7A 4S3JA 4DRIA 2DSWA 4P8XA 3B9DA 3B9EA 3LKXA 4AY1A 4U86A 4ODOA 1GUVA 4Z2LA 4TYOA 2L2SA 1ZCNA 1JNEA 5E64A 2ZR5A 2DT3A 4LGXA 1W1YA 2F21A 4HBEA 3ARQA 2PV2A 2OLHA 3CHEA 1FKGA 2XP3A 2PV3A 3RM9A 2M2AA 5CQ2A 2KR7A 3ALGA 2JZVA 2B31A 2FDMA 2ZR6A 4Z2KA 3AS1A 2Y8NB 1RP5A 3FAPA 3UQIA 4MTVA 5DO2A 3ARPA 1F8AB 4P8VA 3LKXB 2VCDA 4QT3A 3TC5A 4HBOA 2PPOA 1SYTA 4TX0A 1W1VA 3IKDA 4DRQA 4Z2HA 1LQ0A 4A0UA 3PRAA 2E45A 4TW8A 2DJYA 1EHNA 2DMVA 1W1TA 4LAXA 4WK9A 4DWSC 1EG3A 4IQ2A 2RUDA 3BXWA 2A3BA 1EDQA 2M08A 4LAWA 2AOSA 3JYJA 2DK1A 4ODNA 3CGNA 4HARA 1E15A 5U47A 2JX8A 3O5EA 3OOBA 4Z2GA 4ZPTR 1NMVA 1NWTA 1SR0A 2ESCA 3KAIA 1K9TA 4KR0B 4MNKA 1A7XA 2A3AA 2LKNA 4LAYA 5GQBA 1ROUA 3AQUA 2FAPA 4ODKA 1N1AA 2KXQA 1HKJA 2EZ5W 1E9LA 1J4RA 4TW7A 4WKFA 2BA1A 3O5FA 1GPFA 4MNMA 4FN2A 2MLXA 2RURA 2MLYA 1T11A 1UR9A 2KE0A 3ARYA 3QOKA 1EG4A 3O5GA 4Q7NA 2PV1A 4TNSA 1FKTA 4A0TA 1YW5A 3RMEA 3WD0A 3PRBA 3AS0A 1W9UA 2KGJA 4E5RA 2WLYA 4JFJA 2G41A 3WD4A 4QIBA 1WR7A 1FLCA 1K9QA 3FY1A 3UI4A 3OA5A 1HKMA 1ZU8A 4DIPA 2DG3A 1JVWA 2LAJA 1Q1CA 3O5PA 1ZBCA 2XP4A 1FKFA 2DK7A 5AHTA 3M85A 1FFRA 3UQAA 3UF8A 4R5EA 3RM8A 2RQSA 4DWSB 5BXJA 1U79A 5HBFA 2XP8A 4MNLA 4URIA 2PPPA 5DIUA 1ROTA 3RGCA 1C9HA 4Q22A 4Z2IA 5E65A 1HXVA 2PI6A 4J4NA 4ODQA 1JMQA 3KADA 1NSGA 2DSZA 4LAVA 1JNSA 1QZ2A 5D75A 3ALFA 2XPAA 4ML4A 2DSVA 3KAGA 1WMVA 2OFNA 4TW6A 3UI6A 2K8IA 2F2DA 3B8SA 4IQCA 4S3KA 1HJVA 4W5UA 2JMFA 1O6IA 3RM4A 4MGVA 3LUOA 4GIVA 1D2KA 1GOIA 4L3NA 2ZQVA 3PA7A 1Y0OA 2DPEA 2O9OA 5HW6A 1M5YA 1TK7A 2M3OW 4FAPA 2M8IA 3FXYA 3CGMA 1TFVA 4DRPA 2ZQTA 3O5QA 4KQZA 2LGOA 2LPVA 3ARSA 2RUCA 2RSEA 3ARVA 2YSHA 3O5OA 3NI6A 1XRVA 1YATA 2MF9A 2IUZA 3IHZA 3LE4A 4JYSA 2OWOA 1FAPA 1ZBWA 5GPGA 1WNOA 2YSGA 1KFWA 4MSPA 1ITXA 1FKSA 2A3CA 1W9VA 3JYMA 1PINA 3O5KA 2Q5AA 2RE3A 1FKLA 1OGBA 3ARUA 3TDBA 2WM0A 1LG1A 4REXA 4JFMA 2MPHA 3O5DA 4DWSA 2YSBA 2JXWA 3WQWA 4G2PA 4DRKA 1B6CA 1D7IA 2PPNA 5DIVA 3WD1A 1XHGA 3NTPA 5GPRA 3MCBA 1OWQA 1JNDA 3CH9A 3WKZA 5DF0A 1KT0A 2KFWA 4DRJA 4P8UA 1E6PA 1NWUA 1HJXA 1P5QA 2XP5A 5B8IC 1O6WA 1EYMA 1X6LA 5E66A 2FKEA 1R9HA 2N87A 1Q6HA 4J4OA 4QZVB 4ODPA 1EIBA 1FKKA 3O5MA 2KI3A 1LL6A 2JV4A 4MNJA 3MQHA 2M8JA 1LJYA 3MCBB 3CZ8A 3WL0A 2WADA 1RD6A 4DRNA 4IT4A 4O2TA 2MDIA 1FD9A 2YSFA 4ITZA 4L72B 5JH8A 1TR8A 3KAFA 1FKDA 2YBTA 3WQVA 3WD2A 3PR9A 1J6YA 5DEZA 3TCZA 2QRVA 1J4HA 1JNTA 5E5WA 5J6EA 2YBUA 1NWRA 3KAHA 4WKAA 5E62A 4U84A 4MAVA 4JFKA 4WKHA 1I5HW 4WIWA 3FSCA 1W9PA 3VAWA 2ZQSA 3CHDA 1UR8A 3G6MA 3PQHA 4MPKA 2XP9A 2D9FA 3M7NA 3O5IA 1J4IA 3RFWA 1X6NA 3JXVA 1TCOC 3NRKA 3O5LA 4XAKA 1OGGA 3UI5A 3ARWA 3AS2A 3WH0A 3H9RB 5HWBA 1NH6A 2XPBA 4QT2A 2L4JA 2UZ5A 2WLZA 2A3EA 3L4HA 3EY6A 3KACA 1HKIA 2WAEA 1LG2A 2LJ4A 3PRDA 1E6NA 2XP7A 2DSUA 5I98A 1K9RA 4ODRA 1FJDA 2MLZA 4U85A 2O92A 4ZS6A 1D7HA 1FKBA 4WJXA 2Y78A 1WAWA 4BF8A 1FFQA 1FKIA 3O5JA 5HT1A 5HWCA 4W9QA 1W1PA 3B9AA 1D6OA 2ITKA 3KZ7A 1CTNA 1FKHA 4C02B 4Z2JA 2ZAJA 2KO7A 1NMWA 3IKGA 3I6CA 2MNTA 3CHFA 1W26A 4R0XA 4IPXA 4ZPVR 1E6RA 4ZPWR 4W9PA 2VN1A 4NZCA 2DT1A 2IF4A 2XP6A 3MQGA 1HJWA 1Q6UA 4DH0A 3ARXA 5HKGA 1PBKA 4DWSD 3MDYB 3G6LA 2YSIA 4W9OA 3KCEA 1L1PA 2AWGA 4NNRA 1ZL1A 4ODMA 3ARZA 4DRMA 1BKFA 1D7JA 5HW7A 2DG4A 2ZQUA 1FKRA 1KT1A 2DT0A 1LL4A 3CHCA 5HTGA 3ODKA 1EQ3A 4JFIA 2YAJB 1ZK6A 3AROA 1E6ZA 3O5RA 4DROA 4DZ2A 4NSBA 3FS8A 4DT4A 1IX5A 3IK8A 4ODLA 3UQBA 2G8ZA 2ZR4A 4DRHA 1QPFA 3KABA 3ARTA 3B7XA 1VF8A 1QPLA 1WB0A 4GGQA 3WD3A 1ZBVA 3GPKA 3AS3A 5DITA 4PTMA 2DT2A 2PBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKN A;  4JFL A;  1Q6I A;  2LGO A;  4LAY A;  3VAW A;  1ROU A;  2LPV A;  2RUC A;  2RSE A;  2YSH A;  2ZQS A;  1F40 A;  2FAP A;  4ODK A;  3O5O A;  1N1A A;  2KXQ A;  3NI6 A;  2EZ5 W;  4N19 A;  1YAT A;  2MF9 A;  1BL4 A;  1J4R A;  3IHZ A;  3LE4 A;  2RUQ A;  4JYS A;  5HUA A;  2XP9 A;  2D9F A;  3M7N A;  3O5I A;  4TW7 A;  5HW8 A;  2BA1 A;  1J4I A;  1FKJ A;  3O5F A;  3RFW A;  2DG9 A;  1FAP A;  3JXV A;  5GPG A;  1TCO C;  3NRK A;  2DWV A;  2YSG A;  3O5L A;  3CNG A;  2MLX A;  3H9R B;  4FN2 A;  3WH0 A;  1FKS A;  2RUR A;  2MLY A;  4MSP A;  1T11 A;  4G50 A;  3JYM A;  5HWB A;  2M1I A;  1PIN A;  2XPB A;  2Q5A A;  2L4J A;  2RE3 A;  1FKL A;  2F4E A;  2KE0 A;  2UZ5 A;  3O5K A;  3EY6 A;  3TDB A;  3L4H A;  4REX A;  1EG4 A;  3KAC A;  4JFM A;  2MPH A;  3O5G A;  3O5D A;  2LJ4 A;  4DRI A;  4DZ3 A;  3PRD A;  2YSB A;  2XP7 A;  2JXW A;  2PV1 A;  4TNS A;  5I98 A;  1FKT A;  4U86 A;  4G2P A;  1K9R A;  4ODR A;  4ODO A;  1FJD A;  4DRK A;  1YW5 A;  2MLZ A;  4TYO A;  3PRB A;  2L2S A;  1B6C A;  1D7I A;  2KGJ A;  4U85 A;  1ZCN A;  4E5R A;  2PPN A;  4JFJ A;  5DIV A;  4QIB A;  1WR7 A;  2ZR5 A;  1D7H A;  3NTP A;  1FKB A;  2Y78 A;  1K9Q A;  3UI4 A;  4BF8 A;  1FKI A;  3O5J A;  5HT1 A;  2F21 A;  4DIP A;  2DG3 A;  1JVW A;  5HWC A;  2LAJ A;  4W9Q A;  2PV2 A;  1KT0 A;  1Q1C A;  1D6O A;  2ITK A;  2KFW A;  3KZ7 A;  1FKH A;  3UI5 A;  4C02 B;  4DRJ A;  1FKG A;  2XP3 A;  2PV3 A;  3O5P A;  2M2A A;  2ZAJ A;  5CQ2 A;  1NMW A;  2KO7 A;  2JZV A;  2KR7 A;  3IKG A;  2ZR6 A;  2XP4 A;  1P5Q A;  2XP5 A;  1FKF A;  2MNT A;  3I6C A;  1W26 A;  5B8I C;  1O6W A;  1EYM A;  4R0X A;  4IPX A;  2DK7 A;  3FAP A;  5AHT A;  2FKE A;  1R9H A;  3M85 A;  2VN1 A;  4W9P A;  3UQI A;  3UQA A;  3UF8 A;  2IF4 A;  1F8A B;  2XP6 A;  2RQS A;  2N87 A;  1Q6U A;  1Q6H A;  4DH0 A;  4J4O A;  2VCD A;  4QT3 A;  5BXJ A;  3TC5 A;  1U79 A;  2XP8 A;  4ODP A;  5HKG A;  1FKK A;  1PBK A;  2PPO A;  2PPP A;  4TX0 A;  3MDY B;  3O5M A;  2KI3 A;  3IKD A;  5DIU A;  2JV4 A;  1ROT A;  4DRQ A;  2YSI A;  4W9O A;  3RGC A;  3KCE A;  2M8J A;  1L1P A;  1C9H A;  2AWG A;  4NNR A;  1HXV A;  2E45 A;  4J4N A;  4ODQ A;  1JMQ A;  2DJY A;  3KAD A;  1NSG A;  4ODM A;  4TW8 A;  2DMV A;  4DRM A;  4LAV A;  1BKF A;  1JNS A;  4DRN A;  1QZ2 A;  4LAX A;  5D75 A;  2XPA A;  1D7J A;  4O2T A;  5HW7 A;  1EG3 A;  2MDI A;  2DG4 A;  3KAG A;  1WMV A;  2ZQU A;  2RUD A;  2OFN A;  1FD9 A;  4IQ2 A;  4QT2 A;  4TW6 A;  2M08 A;  4LAW A;  3UI6 A;  2YSF A;  2K8I A;  2F2D A;  3JYJ A;  4ITZ A;  1FKR A;  4IQC A;  2DK1 A;  1KT1 A;  3KAF A;  1FKD A;  4ODN A;  3CGN A;  5HTG A;  3ODK A;  2JMF A;  1EQ3 A;  4MGV A;  4JFI A;  3LUO A;  1ZK6 A;  4DRO A;  1J6Y A;  3TCZ A;  3O5R A;  4GIV A;  2JX8 A;  4DZ2 A;  3O5E A;  4DT4 A;  3OOB A;  2ZQV A;  3IK8 A;  4ODL A;  1J4H A;  3UQB A;  1JNT A;  3PA7 A;  2ZR4 A;  4DRH A;  1QPF A;  3KAB A;  1Y0O A;  3B7X A;  5J6E A;  5HW6 A;  1M5Y A;  3KAH A;  1TK7 A;  2M3O W;  1QPL A;  1NMV A;  2M8I A;  4FAP A;  4U84 A;  3CGM A;  4GGQ A;  3KAI A;  4JFK A;  4DRP A;  2ZQT A;  1A7X A;  3GPK A;  5DIT A;  3O5Q A;  2PBC A;  1I5H W; 
#chains in the Genus database with same CATH topology
 4JFL A;  1NWS A;  1Q6I A;  1F40 A;  2QF8 A;  1H0G A;  1H0I A;  4N19 A;  4IT6 A;  1BL4 A;  1ZBK A;  2RUQ A;  3WL1 A;  4P8W A;  3W4R A;  5HW8 A;  1ZB5 A;  3ARR A;  1FKJ A;  5HUA A;  2DG9 A;  4GLX A;  2DWV A;  3FSB A;  3CNG A;  2WK2 A;  4G50 A;  2M1I A;  3WIJ A;  1HKK A;  2F4E A;  4DZ3 A;  1LL7 A;  4S3J A;  4DRI A;  2DSW A;  4P8X A;  3B9D A;  1E44 A;  3B9E A;  3LKX A;  4AY1 A;  1GRJ A;  4U86 A;  4ODO A;  1GUV A;  4Z2L A;  4TYO A;  2L2S A;  1ZCN A;  1JNE A;  5E64 A;  2ZR5 A;  2DT3 A;  4LGX A;  1W1Y A;  2F21 A;  4HBE A;  3ARQ A;  2PV2 A;  2OLH A;  3CHE A;  1FKG A;  2XP3 A;  2PV3 A;  3RM9 A;  2M2A A;  5CQ2 A;  2KR7 A;  3ALG A;  2JZV A;  2B31 A;  2FDM A;  2ZR6 A;  4Z2K A;  3AS1 A;  2Y8N B;  1RP5 A;  3FAP A;  3UQI A;  4MTV A;  5DO2 A;  3ARP A;  1F8A B;  4P8V A;  3LKX B;  2VCD A;  4QT3 A;  3TC5 A;  4HBO A;  2PPO A;  1SYT A;  4TX0 A;  1W1V A;  3IKD A;  4DRQ A;  4Z2H A;  1LQ0 A;  4A0U A;  3PRA A;  2E45 A;  4TW8 A;  2DJY A;  1EHN A;  2DMV A;  1W1T A;  4LAX A;  4WK9 A;  4DWS C;  1EG3 A;  4IQ2 A;  2RUD A;  3BXW A;  2A3B A;  1EDQ A;  2M08 A;  4LAW A;  2AOS A;  3JYJ A;  2DK1 A;  4ODN A;  3CGN A;  4HAR A;  1E15 A;  5U47 A;  2JX8 A;  3O5E A;  3OOB A;  4Z2G A;  4ZPT R;  1NMV A;  1NWT A;  1SR0 A;  2ESC A;  3KAI A;  1K9T A;  4KR0 B;  4MNK A;  1A7X A;  2A3A A;  2LKN A;  4LAY A;  5GQB A;  1ROU A;  3AQU A;  2FAP A;  4ODK A;  1N1A A;  2KXQ A;  1HKJ A;  2EZ5 W;  1E9L A;  1J4R A;  4TW7 A;  4WKF A;  2BA1 A;  3O5F A;  1GPF A;  4MNM A;  4FN2 A;  2MLX A;  2RUR A;  2MLY A;  1T11 A;  1UR9 A;  2KE0 A;  3ARY A;  3QOK A;  1EG4 A;  3O5G A;  4Q7N A;  2PV1 A;  4TNS A;  1FKT A;  4A0T A;  1YW5 A;  3RME A;  3WD0 A;  3PRB A;  3AS0 A;  1W9U A;  2KGJ A;  4E5R A;  2WLY A;  4JFJ A;  2G41 A;  3WD4 A;  4QIB A;  1WR7 A;  1FLC A;  2F23 A;  1K9Q A;  3FY1 A;  3UI4 A;  3OA5 A;  1HKM A;  1ZU8 A;  4DIP A;  2DG3 A;  1JVW A;  2LAJ A;  1Q1C A;  3O5P A;  1ZBC A;  2XP4 A;  1FKF A;  2DK7 A;  5AHT A;  3GTY X;  3M85 A;  1FFR A;  3UQA A;  3UF8 A;  4R5E A;  3RM8 A;  2RQS A;  4DWS B;  5BXJ A;  1U79 A;  5HBF A;  2XP8 A;  4MNL A;  4URI A;  2PPP A;  5DIU A;  1ROT A;  3RGC A;  1C9H A;  4Q22 A;  4Z2I A;  5E65 A;  1HXV A;  2PI6 A;  4J4N A;  4ODQ A;  1JMQ A;  3KAD A;  1NSG A;  2DSZ A;  4LAV A;  1JNS A;  1QZ2 A;  5D75 A;  3ALF A;  2XPA A;  4ML4 A;  2DSV A;  3KAG A;  1WMV A;  2OFN A;  4TW6 A;  3UI6 A;  2K8I A;  2F2D A;  3B8S A;  4IQC A;  4S3K A;  1HJV A;  4W5U A;  2JMF A;  1O6I A;  3RM4 A;  4MGV A;  3LUO A;  4GIV A;  1D2K A;  1GOI A;  4L3N A;  2ZQV A;  3PA7 A;  1Y0O A;  2DPE A;  2O9O A;  5HW6 A;  1M5Y A;  1TK7 A;  2M3O W;  4FAP A;  2M8I A;  3FXY A;  3CGM A;  1TFV A;  4DRP A;  2ZQT A;  3O5Q A;  4KQZ A;  2LGO A;  2LPV A;  3ARS A;  1JCH B;  2RUC A;  2RSE A;  3ARV A;  2YSH A;  3O5O A;  3NI6 A;  1XRV A;  1YAT A;  2MF9 A;  2IUZ A;  3IHZ A;  3LE4 A;  4JYS A;  2OWO A;  1FAP A;  1ZBW A;  5GPG A;  1WNO A;  2YSG A;  1KFW A;  4MSP A;  1ITX A;  1FKS A;  2A3C A;  1W9V A;  3JYM A;  1PIN A;  3O5K A;  2Q5A A;  2RE3 A;  1FKL A;  1OGB A;  3ARU A;  3TDB A;  2WM0 A;  1LG1 A;  4REX A;  4JFM A;  2MPH A;  3O5D A;  4DWS A;  2YSB A;  2JXW A;  3WQW A;  2P4V A;  4G2P A;  4DRK A;  1B6C A;  1D7I A;  2PPN A;  5DIV A;  3WD1 A;  1XHG A;  3NTP A;  5GPR A;  3MCB A;  1OWQ A;  1JND A;  3CH9 A;  3WKZ A;  5DF0 A;  1KT0 A;  2KFW A;  4DRJ A;  4P8U A;  1E6P A;  1NWU A;  1HJX A;  1P5Q A;  2XP5 A;  3GU0 A;  5B8I C;  1O6W A;  1EYM A;  1X6L A;  5E66 A;  2FKE A;  1R9H A;  4UDM A;  2N87 A;  1Q6H A;  4J4O A;  4QZV B;  4ODP A;  1EIB A;  1FKK A;  3O5M A;  2KI3 A;  2ETN A;  1LL6 A;  2JV4 A;  4MNJ A;  3MQH A;  2M8J A;  1LJY A;  3MCB B;  3CZ8 A;  3WL0 A;  2WAD A;  1RD6 A;  4DRN A;  4IT4 A;  4O2T A;  2MDI A;  1FD9 A;  2YSF A;  4ITZ A;  4L72 B;  5JH8 A;  1TR8 A;  3KAF A;  1FKD A;  2YBT A;  3WQV A;  2B5U B;  3EIP A;  3WD2 A;  2PN0 A;  3PR9 A;  1J6Y A;  5DEZ A;  3TCZ A;  2QRV A;  1J4H A;  1JNT A;  5E5W A;  5J6E A;  2YBU A;  1NWR A;  3KAH A;  4WKA A;  5E62 A;  4U84 A;  4MAV A;  4JFK A;  4WKH A;  1I5H W;  4WIW A;  3FSC A;  1W9P A;  3VAW A;  2ZQS A;  3CHD A;  1UR8 A;  3G6M A;  3PQH A;  4MPK A;  2XP9 A;  2D9F A;  3M7N A;  3O5I A;  1J4I A;  3RFW A;  1X6N A;  3JXV A;  1TCO C;  3NRK A;  3O5L A;  4XAK A;  1OGG A;  3UI5 A;  3ARW A;  3AS2 A;  3WH0 A;  3H9R B;  5HWB A;  1NH6 A;  2XPB A;  4QT2 A;  2L4J A;  2UZ5 A;  2WLZ A;  2A3E A;  3L4H A;  3EY6 A;  2EUL A;  3KAC A;  1HKI A;  2WAE A;  1LG2 A;  2LJ4 A;  3PRD A;  1E6N A;  2XP7 A;  2DSU A;  5I98 A;  1K9R A;  4ODR A;  1FJD A;  2MLZ A;  4U85 A;  2O92 A;  4ZS6 A;  1D7H A;  1FKB A;  4WJX A;  2Y78 A;  1WAW A;  4BF8 A;  1FFQ A;  1FKI A;  3O5J A;  5HT1 A;  5HWC A;  4W9Q A;  1W1P A;  3B9A A;  1D6O A;  2ITK A;  3KZ7 A;  1CTN A;  1FKH A;  4C02 B;  4Z2J A;  2ZAJ A;  2KO7 A;  1NMW A;  3IKG A;  3I6C A;  2MNT A;  3CHF A;  1W26 A;  4R0X A;  4IPX A;  4ZPV R;  1E6R A;  4ZPW R;  4W9P A;  2VN1 A;  4NZC A;  2DT1 A;  2IF4 A;  2XP6 A;  3MQG A;  1HJW A;  1Q6U A;  4DH0 A;  3ARX A;  5HKG A;  1PBK A;  4DWS D;  3MDY B;  3G6L A;  2YSI A;  4W9O A;  3KCE A;  1L1P A;  2AWG A;  4NNR A;  1ZL1 A;  4ODM A;  3ARZ A;  4DRM A;  1BKF A;  1D7J A;  5HW7 A;  2DG4 A;  2ZQU A;  1FKR A;  1KT1 A;  2DT0 A;  1LL4 A;  3CHC A;  5HTG A;  3ODK A;  1EQ3 A;  3BMB A;  4JFI A;  2YAJ B;  1ZK6 A;  3ARO A;  1E6Z A;  3O5R A;  4DRO A;  4DZ2 A;  4NSB A;  3FS8 A;  4DT4 A;  1IX5 A;  3IK8 A;  4ODL A;  3UQB A;  2G8Z A;  2ZR4 A;  4DRH A;  1QPF A;  3KAB A;  3ART A;  3B7X A;  1VF8 A;  1QPL A;  1WB0 A;  4GGQ A;  3WD3 A;  1ZBV A;  3GPK A;  3AS3 A;  5DIT A;  4PTM A;  2DT2 A;  2PBC A; 
#chains in the Genus database with same CATH homology
 4JFL A;  1NWS A;  1Q6I A;  1F40 A;  2QF8 A;  1H0G A;  1H0I A;  4N19 A;  4IT6 A;  1BL4 A;  1ZBK A;  2RUQ A;  3WL1 A;  4P8W A;  3W4R A;  5HW8 A;  1ZB5 A;  3ARR A;  1FKJ A;  5HUA A;  2DG9 A;  4GLX A;  2DWV A;  3FSB A;  3CNG A;  2WK2 A;  4G50 A;  2M1I A;  3WIJ A;  1HKK A;  2F4E A;  4DZ3 A;  1LL7 A;  4S3J A;  4DRI A;  2DSW A;  4P8X A;  3B9D A;  3B9E A;  3LKX A;  4AY1 A;  4U86 A;  4ODO A;  1GUV A;  4Z2L A;  4TYO A;  2L2S A;  1ZCN A;  1JNE A;  5E64 A;  2ZR5 A;  2DT3 A;  4LGX A;  1W1Y A;  2F21 A;  4HBE A;  3ARQ A;  2PV2 A;  2OLH A;  3CHE A;  1FKG A;  2XP3 A;  2PV3 A;  3RM9 A;  2M2A A;  5CQ2 A;  2KR7 A;  3ALG A;  2JZV A;  2B31 A;  2FDM A;  2ZR6 A;  4Z2K A;  3AS1 A;  2Y8N B;  1RP5 A;  3FAP A;  3UQI A;  4MTV A;  5DO2 A;  3ARP A;  1F8A B;  4P8V A;  3LKX B;  2VCD A;  4QT3 A;  3TC5 A;  4HBO A;  2PPO A;  1SYT A;  4TX0 A;  1W1V A;  3IKD A;  4DRQ A;  4Z2H A;  1LQ0 A;  4A0U A;  3PRA A;  2E45 A;  4TW8 A;  2DJY A;  1EHN A;  2DMV A;  1W1T A;  4LAX A;  4WK9 A;  4DWS C;  1EG3 A;  4IQ2 A;  2RUD A;  3BXW A;  2A3B A;  1EDQ A;  2M08 A;  4LAW A;  2AOS A;  3JYJ A;  2DK1 A;  4ODN A;  3CGN A;  4HAR A;  1E15 A;  5U47 A;  2JX8 A;  3O5E A;  3OOB A;  4Z2G A;  4ZPT R;  1NMV A;  1NWT A;  1SR0 A;  2ESC A;  3KAI A;  1K9T A;  4KR0 B;  4MNK A;  1A7X A;  2A3A A;  2LKN A;  4LAY A;  5GQB A;  1ROU A;  3AQU A;  2FAP A;  4ODK A;  1N1A A;  2KXQ A;  1HKJ A;  2EZ5 W;  1E9L A;  1J4R A;  4TW7 A;  4WKF A;  2BA1 A;  3O5F A;  1GPF A;  4MNM A;  4FN2 A;  2MLX A;  2RUR A;  2MLY A;  1T11 A;  1UR9 A;  2KE0 A;  3ARY A;  3QOK A;  1EG4 A;  3O5G A;  4Q7N A;  2PV1 A;  4TNS A;  1FKT A;  4A0T A;  1YW5 A;  3RME A;  3WD0 A;  3PRB A;  3AS0 A;  1W9U A;  2KGJ A;  4E5R A;  2WLY A;  4JFJ A;  2G41 A;  3WD4 A;  4QIB A;  1WR7 A;  1FLC A;  1K9Q A;  3FY1 A;  3UI4 A;  3OA5 A;  1HKM A;  1ZU8 A;  4DIP A;  2DG3 A;  1JVW A;  2LAJ A;  1Q1C A;  3O5P A;  1ZBC A;  2XP4 A;  1FKF A;  2DK7 A;  5AHT A;  3M85 A;  1FFR A;  3UQA A;  3UF8 A;  4R5E A;  3RM8 A;  2RQS A;  4DWS B;  5BXJ A;  1U79 A;  5HBF A;  2XP8 A;  4MNL A;  4URI A;  2PPP A;  5DIU A;  1ROT A;  3RGC A;  1C9H A;  4Q22 A;  4Z2I A;  5E65 A;  1HXV A;  2PI6 A;  4J4N A;  4ODQ A;  1JMQ A;  3KAD A;  1NSG A;  2DSZ A;  4LAV A;  1JNS A;  1QZ2 A;  5D75 A;  3ALF A;  2XPA A;  4ML4 A;  2DSV A;  3KAG A;  1WMV A;  2OFN A;  4TW6 A;  3UI6 A;  2K8I A;  2F2D A;  3B8S A;  4IQC A;  4S3K A;  1HJV A;  4W5U A;  2JMF A;  1O6I A;  3RM4 A;  4MGV A;  3LUO A;  4GIV A;  1D2K A;  1GOI A;  4L3N A;  2ZQV A;  3PA7 A;  1Y0O A;  2DPE A;  2O9O A;  5HW6 A;  1M5Y A;  1TK7 A;  2M3O W;  4FAP A;  2M8I A;  3FXY A;  3CGM A;  1TFV A;  4DRP A;  2ZQT A;  3O5Q A;  4KQZ A;  2LGO A;  2LPV A;  3ARS A;  2RUC A;  2RSE A;  3ARV A;  2YSH A;  3O5O A;  3NI6 A;  1XRV A;  1YAT A;  2MF9 A;  2IUZ A;  3IHZ A;  3LE4 A;  4JYS A;  2OWO A;  1FAP A;  1ZBW A;  5GPG A;  1WNO A;  2YSG A;  1KFW A;  4MSP A;  1ITX A;  1FKS A;  2A3C A;  1W9V A;  3JYM A;  1PIN A;  3O5K A;  2Q5A A;  2RE3 A;  1FKL A;  1OGB A;  3ARU A;  3TDB A;  2WM0 A;  1LG1 A;  4REX A;  4JFM A;  2MPH A;  3O5D A;  4DWS A;  2YSB A;  2JXW A;  3WQW A;  4G2P A;  4DRK A;  1B6C A;  1D7I A;  2PPN A;  5DIV A;  3WD1 A;  1XHG A;  3NTP A;  5GPR A;  3MCB A;  1OWQ A;  1JND A;  3CH9 A;  3WKZ A;  5DF0 A;  1KT0 A;  2KFW A;  4DRJ A;  4P8U A;  1E6P A;  1NWU A;  1HJX A;  1P5Q A;  2XP5 A;  5B8I C;  1O6W A;  1EYM A;  1X6L A;  5E66 A;  2FKE A;  1R9H A;  2N87 A;  1Q6H A;  4J4O A;  4QZV B;  4ODP A;  1EIB A;  1FKK A;  3O5M A;  2KI3 A;  1LL6 A;  2JV4 A;  4MNJ A;  3MQH A;  2M8J A;  1LJY A;  3MCB B;  3CZ8 A;  3WL0 A;  2WAD A;  1RD6 A;  4DRN A;  4IT4 A;  4O2T A;  2MDI A;  1FD9 A;  2YSF A;  4ITZ A;  4L72 B;  5JH8 A;  1TR8 A;  3KAF A;  1FKD A;  2YBT A;  3WQV A;  3WD2 A;  3PR9 A;  1J6Y A;  5DEZ A;  3TCZ A;  2QRV A;  1J4H A;  1JNT A;  5E5W A;  5J6E A;  2YBU A;  1NWR A;  3KAH A;  4WKA A;  5E62 A;  4U84 A;  4MAV A;  4JFK A;  4WKH A;  1I5H W;  4WIW A;  3FSC A;  1W9P A;  3VAW A;  2ZQS A;  3CHD A;  1UR8 A;  3G6M A;  3PQH A;  4MPK A;  2XP9 A;  2D9F A;  3M7N A;  3O5I A;  1J4I A;  3RFW A;  1X6N A;  3JXV A;  1TCO C;  3NRK A;  3O5L A;  4XAK A;  1OGG A;  3UI5 A;  3ARW A;  3AS2 A;  3WH0 A;  3H9R B;  5HWB A;  1NH6 A;  2XPB A;  4QT2 A;  2L4J A;  2UZ5 A;  2WLZ A;  2A3E A;  3L4H A;  3EY6 A;  3KAC A;  1HKI A;  2WAE A;  1LG2 A;  2LJ4 A;  3PRD A;  1E6N A;  2XP7 A;  2DSU A;  5I98 A;  1K9R A;  4ODR A;  1FJD A;  2MLZ A;  4U85 A;  2O92 A;  4ZS6 A;  1D7H A;  1FKB A;  4WJX A;  2Y78 A;  1WAW A;  4BF8 A;  1FFQ A;  1FKI A;  3O5J A;  5HT1 A;  5HWC A;  4W9Q A;  1W1P A;  3B9A A;  1D6O A;  2ITK A;  3KZ7 A;  1CTN A;  1FKH A;  4C02 B;  4Z2J A;  2ZAJ A;  2KO7 A;  1NMW A;  3IKG A;  3I6C A;  2MNT A;  3CHF A;  1W26 A;  4R0X A;  4IPX A;  4ZPV R;  1E6R A;  4ZPW R;  4W9P A;  2VN1 A;  4NZC A;  2DT1 A;  2IF4 A;  2XP6 A;  3MQG A;  1HJW A;  1Q6U A;  4DH0 A;  3ARX A;  5HKG A;  1PBK A;  4DWS D;  3MDY B;  3G6L A;  2YSI A;  4W9O A;  3KCE A;  1L1P A;  2AWG A;  4NNR A;  1ZL1 A;  4ODM A;  3ARZ A;  4DRM A;  1BKF A;  1D7J A;  5HW7 A;  2DG4 A;  2ZQU A;  1FKR A;  1KT1 A;  2DT0 A;  1LL4 A;  3CHC A;  5HTG A;  3ODK A;  1EQ3 A;  4JFI A;  2YAJ B;  1ZK6 A;  3ARO A;  1E6Z A;  3O5R A;  4DRO A;  4DZ2 A;  4NSB A;  3FS8 A;  4DT4 A;  1IX5 A;  3IK8 A;  4ODL A;  3UQB A;  2G8Z A;  2ZR4 A;  4DRH A;  1QPF A;  3KAB A;  3ART A;  3B7X A;  1VF8 A;  1QPL A;  1WB0 A;  4GGQ A;  3WD3 A;  1ZBV A;  3GPK A;  3AS3 A;  5DIT A;  4PTM A;  2DT2 A;  2PBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...