2ZR5A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVAHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 44
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr5A02
3VAWA 3CGMA 1L1PA 3IHZA 3KACA 2PPOA 2ZR6A 1JNTA 1J4IA 1FJDA 3M85A 3UQAA 2LPVA 4MGVA 2XP5A 3IKDA 1WR7A 3KADA 2F2DA 5DIVA 1PINA 2JMFA 4QT3A 4REXA 2LGOA 2PPPA 2KR7A 1Q1CA 4U84A 2IF4A 3O5MA 4DIPA 4TW8A 1FKRA 2YSIA 5HW6A 4TX0A 3PRDA 1D7JA 1FKFA 5D75A 2DJYA 4ODOA 4J4NA 4O2TA 3UQIA 3UF8A 2JXWA 2PV2A 1N1AA 1W26A 3NI6A 4LAVA 3KAFA 1D7IA 3M7NA 1J4RA 2VN1A 2DG9A 2XP9A 3O5IA 3O5LA 1Q6HA 1JNSA 1D6OA 3KAHA 2MNTA 4DROA 4E5RA 2E45A 2KO7A 1M5YA 1NSGA 2YSFA 2M1IA 5HWCA 4GGQA 3O5FA 1BKFA 4JFLA 4TW7A 2XP3A 2XP8A 1TCOC 3NTPA 1P5QA 4W9OA 2ZQVA 2RUCA 3O5RA 4J4OA 1ZCNA 4ITZA 2DK7A 2ZQSA 4TYOA 3L4HA 1FAPA 4DRKA 3MDYB 4QIBA 2MF9A 2DG4A 3IK8A 3WH0A 5HW8A 2RUDA 3IKGA 4LAXA 4MSPA 4IQ2A 2F21A 2M8IA 4JFIA 1A7XA 2Y78A 2ZQUA 2DK1A 3O5KA 4ODRA 4LAWA 2MLZA 1FKDA 2XP7A 3RFWA 4U85A 2MPHA 3FAPA 3TDBA 1FKKA 4QT2A 2JX8A 1KT0A 4BF8A 1ZK6A 4DZ2A 2XPBA 1K9QA 4DRPA 2D9FA 2K8IA 3O5GA 3LE4A 3PA7A 3H9RB 2DG3A 4ODQA 3B7XA 2DWVA 2RE3A 2XPAA 3KZ7A 4DZ3A 4NNRA 2KFWA 2XP6A 3UI6A 1EQ3A 2MDIA 2KI3A 1JVWA 1YW5A 4FAPA 4ODKA 1QPLA 2KGJA 5DIUA 4DRNA 1YATA 4TNSA 1EG3A 4ODLA 1C9HA 4FN2A 4LAYA 2N87A 2ZAJA 5BXJA 1FKLA 2LAJA 1TK7A 1HXVA 2MLXA 4DRQA 1J4HA 1FKTA 2YSBA 1B6CA 2ZR4A 1NMVA 3TCZA 2L4JA 3I6CA 2VCDA 2F4EA 5GPGA 1FKGA 1U79A 2DMVA 3JXVA 3O5QA 3GPKA 3ODKA 1T11A 3O5OA 4G2PA 5B8IC 5HUAA 1ROTA 5J6EA 1O6WA 5HTGA 2RQSA 2FAPA 3JYMA 2EZ5W 2AWGA 1QPFA 3UI4A 4DRHA 1PBKA 3CGNA 4IQCA 3O5EA 4ODPA 3OOBA 2YSGA 4DT4A 4TW6A 3NRKA 3KABA 1D7HA 1FKSA 3RGCA 1WMVA 1QZ2A 1ROUA 3KAIA 4U86A 4W9QA 1EYMA 4N19A 1F8AB 1FKHA 4DRJA 2LKNA 3O5PA 5DITA 4DRMA 3KAGA 2ZQTA 2PV3A 3O5JA 4JFMA 2BA1A 2RURA 5AHTA 3PRBA 2Q5AA 4W9PA 2UZ5A 4IPXA 4R0XA 4ODMA 4JFKA 4JYSA 1Y0OA 4DH0A 2ZR5A 2MLYA 1FD9A 5HKGA 1EG4A 5CQ2A 3UQBA 3JYJA 4GIVA 4JFJA 1BL4A 1FKBA 2PBCA 1J6YA 1I5HW 2JZVA 1Q6UA 1JMQA 2FKEA 2M08A 4G50A 3CNGA 3KCEA 3UI5A 2PV1A 1F40A 2LJ4A 2JV4A 2YSHA 1KT1A 1K9RA 2M8JA 3TC5A 2KXQA 2L2SA 3LUOA 1R9HA 1FKIA 2RSEA 1Q6IA 2ITKA 4ODNA 2KE0A 5HW7A 1FKJA 4C02B 5HWBA 4DRIA 5I98A 1NMWA 2RUQA 2M3OW 5HT1A 2M2AA 2XP4A 2OFNA 2PPNA 3EY6A 3O5DA
chains in the Genus database with same CATH superfamily
3VAWA 3CGMA 3ARSA 1L1PA 1VF8A 3IHZA 3KACA 2PPOA 1FFRA 2ZR6A 1CTNA 1JNTA 1J4IA 1FJDA 3M85A 3UQAA 3ARVA 5E65A 2G41A 2LPVA 4MGVA 4URIA 2XP5A 1GOIA 2WLZA 3IKDA 3PR9A 1WR7A 3KADA 1ZBKA 1ZBWA 5HBFA 1SYTA 2F2DA 1EIBA 5DIVA 4WKAA 1PINA 2JMFA 4QT3A 4REXA 2LGOA 2A3EA 2PPPA 3CHDA 3AS0A 1O6IA 2KR7A 1Q1CA 4DWSA 4MNKA 4U84A 2IF4A 3O5MA 4DIPA 1LG1A 4TW8A 3ARXA 1FKRA 2YSIA 4L3NA 5HW6A 4TX0A 3PRDA 1EDQA 1D7JA 3ARQA 1RD6A 1FKFA 1HKMA 5D75A 2DJYA 3RM8A 4ODOA 4WIWA 4J4NA 4O2TA 3UQIA 3UF8A 2JXWA 2PV2A 1N1AA 1W26A 3NI6A 4LAVA 1FFQA 3KAFA 1D7IA 3M7NA 1W9VA 1J4RA 1NWTA 3LKXB 1HKJA 2DT3A 4Z2LA 2VN1A 2DG9A 3ALGA 2XP9A 4WJXA 3O5IA 3O5LA 1Q6HA 1JNSA 1OWQA 3WD0A 3PRAA 1D6OA 3KAHA 2MNTA 3GU0A 4DROA 4E5RA 2E45A 2KO7A 1M5YA 1NSGA 2YSFA 1JCHB 2M1IA 5HWCA 4GGQA 3O5FA 1BKFA 4Z2HA 2DSZA 5GPRA 4L72B 4JFLA 4TW7A 2XP3A 1W1VA 2FDMA 2XP8A 1TCOC 1W9PA 3NTPA 1P5QA 4W9OA 1W1YA 1IX5A 1W1TA 2ZQVA 2RUCA 3O5RA 1E6PA 4J4OA 3BMBA 3B9DA 1ZCNA 4ITZA 2DK7A 2ZQSA 4DWSC 2O92A 4TYOA 3L4HA 1FAPA 3WL0A 4S3KA 3FY1A 4DRKA 3ARWA 3MDYB 1W1PA 2QF8A 1HJWA 2WAEA 4QIBA 3ARZA 2MF9A 2DG4A 3IK8A 3WH0A 1OGBA 2ESCA 5E64A 5HW8A 2RUDA 3IKGA 4HBEA 1NH6A 4LAXA 4MSPA 1UR8A 4IQ2A 2F21A 2M8IA 4JFIA 1A7XA 2Y78A 2ZQUA 4KR0B 4LGXA 3ARPA 1E6NA 4WK9A 2DK1A 4KQZA 5DEZA 3O5KA 2B31A 3WD4A 4ODRA 4LAWA 5DF0A 4DWSD 4P8VA 1X6LA 4DWSB 2MLZA 5GQBA 2WADA 1FKDA 3WKZA 4Z2GA 2XP7A 1JNEA 3RFWA 4U85A 2MPHA 2IUZA 4Z2KA 3FAPA 3QOKA 3MQGA 3TDBA 1FKKA 2P4VA 4QT2A 2JX8A 1KT0A 3RMEA 4BF8A 1ZK6A 1NWUA 4DZ2A 1WNOA 2XPBA 4P8UA 1K9QA 3ARTA 4DRPA 2D9FA 2K8IA 1W9UA 2YBTA 3ALFA 3O5GA 3LE4A 4PTMA 4MAVA 3PA7A 3H9RB 4IT6A 2DG3A 2WLYA 4ODQA 2OWOA 3B7XA 1E9LA 2DWVA 1HJXA 3WQVA 2WM0A 2RE3A 2XPAA 3KZ7A 1LJYA 4DZ3A 1NWSA 4ML4A 4HBOA 4NNRA 2KFWA 2XP6A 3UI6A 1EQ3A 2MDIA 2KI3A 1NWRA 1JVWA 1YW5A 1UR9A 4FAPA 1GPFA 4MNMA 1JNDA 4ODKA 1QPLA 2KGJA 5DIUA 3FS8A 1YATA 3ARYA 4DRNA 4TNSA 3FSBA 2DT0A 2F23A 4ZPTR 4Z2JA 4ZPWR 1EG3A 2A3CA 4ODLA 1C9HA 1E15A 4FN2A 4LAYA 2N87A 2ZAJA 1TFVA 4ZS6A 2PN0A 5BXJA 1FKLA 2LAJA 1TK7A 1HXVA 2MLXA 3W4RA 4DRQA 1J4HA 1FKTA 2YSBA 2DT1A 3LKXA 3AS3A 1XHGA 1B6CA 2ZR4A 4Q7NA 1NMVA 3TCZA 2B5UB 4QZVB 3MCBA 3WD3A 2L4JA 3I6CA 1SR0A 3WD2A 2VCDA 2F4EA 3G6LA 5GPGA 1FKGA 2EULA 1U79A 3B9AA 4MNJA 2DMVA 5E66A 3JXVA 3O5QA 2AOSA 3GPKA 3ODKA 1T11A 2DT2A 3O5OA 4G2PA 5B8IC 3B8SA 1HKKA 5HUAA 2DSUA 1E6RA 3BXWA 1ROTA 4NSBA 1O6WA 4UDMA 5J6EA 5HTGA 3AROA 2RQSA 2FAPA 3CHEA 3ARUA 3JYMA 4AY1A 1ITXA 1H0IA 2EZ5W 2AWGA 1QPFA 3RM4A 3UI4A 4DRHA 1PBKA 3CGNA 4IQCA 3O5EA 4ODPA 3OOBA 2YSGA 4DT4A 1OGGA 4TW6A 1HJVA 3NRKA 3KABA 1D7HA 3ARRA 3OA5A 3WL1A 2DSVA 3FSCA 1FKSA 3RGCA 1WMVA 1LL7A 5U47A 1QZ2A 4S3JA 3CZ8A 1LL4A 2QRVA 1ZU8A 1EHNA 1ROUA 3KAIA 4WKFA 1E6ZA 4MPKA 3RM9A 2YAJB 4U86A 3CH9A 2A3BA 4W9QA 1E44A 4P8WA 4Q22A 1EYMA 4N19A 3WQWA 4A0TA 1F8AB 1FKHA 2LKNA 2WK2A 3O5PA 4DRJA 5DITA 4DRMA 4Z2IA 3KAGA 2ZQTA 2PV3A 2ETNA 3O5JA 2O9OA 4JFMA 2BA1A 1WB0A 3AS2A 1KFWA 2RURA 5AHTA 3PRBA 2Q5AA 4P8XA 4W9PA 2UZ5A 4IPXA 4R0XA 4GLXA 3CHFA 4NZCA 4ODMA 1ZBVA 5E5WA 4JFKA 4JYSA 1Y0OA 4DH0A 2ZR5A 2MLYA 1FD9A 5HKGA 4HARA 4A0UA 1LL6A 1EG4A 5CQ2A 3EIPA 3UQBA 3JYJA 1XRVA 3PQHA 4GIVA 2YBUA 4JFJA 3WIJA 1BL4A 3WD1A 1FKBA 2PBCA 1J6YA 1I5HW 1LQ0A 4R5EA 2Y8NB 2JZVA 1Q6UA 3MCBB 2G8ZA 1JMQA 2DSWA 2FKEA 2M08A 1LG2A 1D2KA 4G50A 3CNGA 3KCEA 2PI6A 1ZB5A 3UI5A 2PV1A 1F40A 2LJ4A 3GTYX 5JH8A 5E62A 1HKIA 1RP5A 4ZPVR 2JV4A 2YSHA 1KT1A 2OLHA 1K9RA 2M8JA 4MTVA 3TC5A 2KXQA 5DO2A 2L2SA 3B9EA 3LUOA 1R9HA 1FKIA 1K9TA 1H0GA 3AS1A 2RSEA 1GUVA 1Q6IA 2DPEA 2ITKA 4ODNA 2KE0A 4IT4A 5HW7A 4W5UA 1FKJA 3MQHA 1ZL1A 1GRJA 4C02B 3G6MA 1WAWA 1TR8A 5HWBA 3CHCA 4MNLA 4DRIA 1X6NA 5I98A 1NMWA 2A3AA 2RUQA 1FLCA 3AQUA 2M3OW 4WKHA 5HT1A 2M2AA 2XP4A 2OFNA 4XAKA 3FXYA 2PPNA 1ZBCA 3EY6A 3O5DA
chains in the Genus database with same CATH topology
3VAWA 3CGMA 3ARSA 1L1PA 1VF8A 3IHZA 3KACA 2PPOA 1FFRA 2ZR6A 1CTNA 1JNTA 1J4IA 1FJDA 3M85A 3UQAA 3ARVA 5E65A 2G41A 2LPVA 4MGVA 4URIA 2XP5A 1GOIA 2WLZA 3IKDA 3PR9A 1WR7A 3KADA 1ZBKA 1ZBWA 5HBFA 1SYTA 2F2DA 1EIBA 5DIVA 4WKAA 1PINA 2JMFA 4QT3A 4REXA 2LGOA 2A3EA 2PPPA 3CHDA 3AS0A 1O6IA 2KR7A 1Q1CA 4DWSA 4MNKA 4U84A 2IF4A 3O5MA 4DIPA 1LG1A 4TW8A 3ARXA 1FKRA 2YSIA 4L3NA 5HW6A 4TX0A 3PRDA 1EDQA 1D7JA 3ARQA 1RD6A 1FKFA 1HKMA 5D75A 2DJYA 3RM8A 4ODOA 4WIWA 4J4NA 4O2TA 3UQIA 3UF8A 2JXWA 2PV2A 1N1AA 1W26A 3NI6A 4LAVA 1FFQA 3KAFA 1D7IA 3M7NA 1W9VA 1J4RA 1NWTA 3LKXB 1HKJA 2DT3A 4Z2LA 2VN1A 2DG9A 3ALGA 2XP9A 4WJXA 3O5IA 3O5LA 1Q6HA 1JNSA 1OWQA 3WD0A 3PRAA 1D6OA 3KAHA 2MNTA 4DROA 4E5RA 2E45A 2KO7A 1M5YA 1NSGA 2YSFA 2M1IA 5HWCA 4GGQA 3O5FA 1BKFA 4Z2HA 2DSZA 5GPRA 4L72B 4JFLA 4TW7A 2XP3A 1W1VA 2FDMA 2XP8A 1TCOC 1W9PA 3NTPA 1P5QA 4W9OA 1W1YA 1IX5A 1W1TA 2ZQVA 2RUCA 3O5RA 1E6PA 4J4OA 3B9DA 1ZCNA 4ITZA 2DK7A 2ZQSA 4DWSC 2O92A 4TYOA 3L4HA 1FAPA 3WL0A 4S3KA 3FY1A 4DRKA 3ARWA 3MDYB 1W1PA 2QF8A 1HJWA 2WAEA 4QIBA 3ARZA 2MF9A 2DG4A 3IK8A 3WH0A 1OGBA 2ESCA 5E64A 5HW8A 2RUDA 3IKGA 4HBEA 1NH6A 4LAXA 4MSPA 1UR8A 4IQ2A 2F21A 2M8IA 4JFIA 1A7XA 2Y78A 2ZQUA 4KR0B 4LGXA 3ARPA 1E6NA 4WK9A 2DK1A 4KQZA 5DEZA 3O5KA 2B31A 3WD4A 4ODRA 4LAWA 5DF0A 4DWSD 4P8VA 1X6LA 4DWSB 2MLZA 5GQBA 2WADA 1FKDA 3WKZA 4Z2GA 2XP7A 1JNEA 3RFWA 4U85A 2MPHA 2IUZA 4Z2KA 3FAPA 3QOKA 3MQGA 3TDBA 1FKKA 4QT2A 2JX8A 1KT0A 3RMEA 4BF8A 1ZK6A 1NWUA 4DZ2A 1WNOA 2XPBA 4P8UA 1K9QA 3ARTA 4DRPA 2D9FA 2K8IA 1W9UA 2YBTA 3ALFA 3O5GA 3LE4A 4PTMA 4MAVA 3PA7A 3H9RB 4IT6A 2DG3A 2WLYA 4ODQA 2OWOA 3B7XA 1E9LA 2DWVA 1HJXA 3WQVA 2WM0A 2RE3A 2XPAA 3KZ7A 1LJYA 4DZ3A 1NWSA 4ML4A 4HBOA 4NNRA 2KFWA 2XP6A 3UI6A 1EQ3A 2MDIA 2KI3A 1NWRA 1JVWA 1YW5A 1UR9A 4FAPA 1GPFA 4MNMA 1JNDA 4ODKA 1QPLA 2KGJA 5DIUA 3FS8A 1YATA 3ARYA 4DRNA 4TNSA 3FSBA 2DT0A 4ZPTR 4Z2JA 4ZPWR 1EG3A 2A3CA 4ODLA 1C9HA 1E15A 4FN2A 4LAYA 2N87A 2ZAJA 1TFVA 4ZS6A 5BXJA 1FKLA 2LAJA 1TK7A 1HXVA 2MLXA 3W4RA 4DRQA 1J4HA 1FKTA 2YSBA 2DT1A 3LKXA 3AS3A 1XHGA 1B6CA 2ZR4A 4Q7NA 1NMVA 3TCZA 4QZVB 3MCBA 3WD3A 2L4JA 3I6CA 1SR0A 3WD2A 2VCDA 2F4EA 3G6LA 5GPGA 1FKGA 4MNJA 1U79A 3B9AA 2DMVA 5E66A 3JXVA 3O5QA 2AOSA 3GPKA 3ODKA 1T11A 2DT2A 3O5OA 4G2PA 5B8IC 3B8SA 1HKKA 5HUAA 2DSUA 1E6RA 3BXWA 1ROTA 4NSBA 1O6WA 5J6EA 5HTGA 3AROA 2RQSA 2FAPA 3CHEA 3ARUA 3JYMA 4AY1A 1ITXA 1H0IA 2EZ5W 2AWGA 1QPFA 3RM4A 3UI4A 4DRHA 1PBKA 3CGNA 4IQCA 3O5EA 4ODPA 3OOBA 2YSGA 4DT4A 1OGGA 4TW6A 1HJVA 3NRKA 3KABA 1D7HA 3ARRA 3OA5A 3WL1A 2DSVA 3FSCA 1FKSA 3RGCA 1WMVA 1LL7A 5U47A 1QZ2A 4S3JA 3CZ8A 1LL4A 2QRVA 1ZU8A 1EHNA 1ROUA 3KAIA 4WKFA 1E6ZA 4MPKA 3RM9A 2YAJB 4U86A 3CH9A 2A3BA 4W9QA 4P8WA 4Q22A 1EYMA 4N19A 3WQWA 4A0TA 1F8AB 1FKHA 2LKNA 2WK2A 3O5PA 4DRJA 5DITA 4DRMA 4Z2IA 3KAGA 2ZQTA 2PV3A 3O5JA 2O9OA 4JFMA 2BA1A 1WB0A 3AS2A 1KFWA 2RURA 5AHTA 3PRBA 2Q5AA 4P8XA 4W9PA 2UZ5A 4IPXA 4R0XA 4GLXA 3CHFA 4NZCA 4ODMA 1ZBVA 5E5WA 4JFKA 4JYSA 1Y0OA 4DH0A 2ZR5A 2MLYA 1FD9A 5HKGA 4HARA 4A0UA 1LL6A 1EG4A 5CQ2A 3UQBA 3JYJA 1XRVA 3PQHA 4GIVA 2YBUA 4JFJA 3WIJA 1BL4A 3WD1A 1FKBA 2PBCA 1J6YA 1I5HW 1LQ0A 4R5EA 2Y8NB 2JZVA 1Q6UA 3MCBB 2G8ZA 1JMQA 2DSWA 2FKEA 2M08A 1LG2A 1D2KA 4G50A 3CNGA 3KCEA 2PI6A 1ZB5A 3UI5A 2PV1A 1F40A 2LJ4A 5JH8A 5E62A 1HKIA 1RP5A 4ZPVR 2JV4A 2YSHA 1KT1A 2OLHA 1K9RA 2M8JA 4MTVA 3TC5A 2KXQA 5DO2A 2L2SA 3B9EA 3LUOA 1R9HA 1FKIA 1K9TA 1H0GA 3AS1A 2RSEA 1GUVA 1Q6IA 2DPEA 2ITKA 4ODNA 2KE0A 4IT4A 5HW7A 4W5UA 1FKJA 3MQHA 1ZL1A 4C02B 3G6MA 1WAWA 1TR8A 5HWBA 3CHCA 4MNLA 4DRIA 1X6NA 5I98A 1NMWA 2A3AA 2RUQA 1FLCA 3AQUA 2M3OW 4WKHA 5HT1A 2M2AA 2XP4A 2OFNA 4XAKA 3FXYA 2PPNA 1ZBCA 3EY6A 3O5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VAW A;  3CGM A;  1L1P A;  3IHZ A;  3KAC A;  2PPO A;  2ZR6 A;  1JNT A;  1J4I A;  1FJD A;  3M85 A;  3UQA A;  2LPV A;  4MGV A;  2XP5 A;  3IKD A;  1WR7 A;  3KAD A;  2F2D A;  5DIV A;  1PIN A;  2JMF A;  4QT3 A;  4REX A;  2LGO A;  2PPP A;  2KR7 A;  1Q1C A;  4U84 A;  2IF4 A;  3O5M A;  4DIP A;  4TW8 A;  1FKR A;  2YSI A;  5HW6 A;  4TX0 A;  3PRD A;  1D7J A;  1FKF A;  5D75 A;  2DJY A;  4ODO A;  4J4N A;  4O2T A;  3UQI A;  3UF8 A;  2JXW A;  2PV2 A;  1N1A A;  1W26 A;  3NI6 A;  4LAV A;  3KAF A;  1D7I A;  3M7N A;  1J4R A;  2VN1 A;  2DG9 A;  2XP9 A;  3O5I A;  3O5L A;  1Q6H A;  1JNS A;  1D6O A;  3KAH A;  2MNT A;  4DRO A;  4E5R A;  2E45 A;  2KO7 A;  1M5Y A;  1NSG A;  2YSF A;  2M1I A;  5HWC A;  4GGQ A;  3O5F A;  1BKF A;  4JFL A;  4TW7 A;  2XP3 A;  2XP8 A;  1TCO C;  3NTP A;  1P5Q A;  4W9O A;  2ZQV A;  2RUC A;  3O5R A;  4J4O A;  1ZCN A;  4ITZ A;  2DK7 A;  2ZQS A;  4TYO A;  3L4H A;  1FAP A;  4DRK A;  3MDY B;  4QIB A;  2MF9 A;  2DG4 A;  3IK8 A;  3WH0 A;  5HW8 A;  2RUD A;  3IKG A;  4LAX A;  4MSP A;  4IQ2 A;  2F21 A;  2M8I A;  4JFI A;  1A7X A;  2Y78 A;  2ZQU A;  2DK1 A;  3O5K A;  4ODR A;  4LAW A;  2MLZ A;  1FKD A;  2XP7 A;  3RFW A;  4U85 A;  2MPH A;  3FAP A;  3TDB A;  1FKK A;  4QT2 A;  2JX8 A;  1KT0 A;  4BF8 A;  1ZK6 A;  4DZ2 A;  2XPB A;  1K9Q A;  4DRP A;  2D9F A;  2K8I A;  3O5G A;  3LE4 A;  3PA7 A;  3H9R B;  2DG3 A;  4ODQ A;  3B7X A;  2DWV A;  2RE3 A;  2XPA A;  3KZ7 A;  4DZ3 A;  4NNR A;  2KFW A;  2XP6 A;  3UI6 A;  1EQ3 A;  2MDI A;  2KI3 A;  1JVW A;  1YW5 A;  4FAP A;  4ODK A;  1QPL A;  2KGJ A;  5DIU A;  4DRN A;  1YAT A;  4TNS A;  1EG3 A;  4ODL A;  1C9H A;  4FN2 A;  4LAY A;  2N87 A;  2ZAJ A;  5BXJ A;  1FKL A;  2LAJ A;  1TK7 A;  1HXV A;  2MLX A;  4DRQ A;  1J4H A;  1FKT A;  2YSB A;  1B6C A;  2ZR4 A;  1NMV A;  3TCZ A;  2L4J A;  3I6C A;  2VCD A;  2F4E A;  5GPG A;  1FKG A;  1U79 A;  2DMV A;  3JXV A;  3O5Q A;  3GPK A;  3ODK A;  1T11 A;  3O5O A;  4G2P A;  5B8I C;  5HUA A;  1ROT A;  5J6E A;  1O6W A;  5HTG A;  2RQS A;  2FAP A;  3JYM A;  2EZ5 W;  2AWG A;  1QPF A;  3UI4 A;  4DRH A;  1PBK A;  3CGN A;  4IQC A;  3O5E A;  4ODP A;  3OOB A;  2YSG A;  4DT4 A;  4TW6 A;  3NRK A;  3KAB A;  1D7H A;  1FKS A;  3RGC A;  1WMV A;  1QZ2 A;  1ROU A;  3KAI A;  4U86 A;  4W9Q A;  1EYM A;  4N19 A;  1F8A B;  1FKH A;  4DRJ A;  2LKN A;  3O5P A;  5DIT A;  4DRM A;  3KAG A;  2ZQT A;  2PV3 A;  3O5J A;  4JFM A;  2BA1 A;  2RUR A;  5AHT A;  3PRB A;  2Q5A A;  4W9P A;  2UZ5 A;  4IPX A;  4R0X A;  4ODM A;  4JFK A;  4JYS A;  1Y0O A;  4DH0 A;  2ZR5 A;  2MLY A;  1FD9 A;  5HKG A;  1EG4 A;  5CQ2 A;  3UQB A;  3JYJ A;  4GIV A;  4JFJ A;  1BL4 A;  1FKB A;  2PBC A;  1J6Y A;  1I5H W;  2JZV A;  1Q6U A;  1JMQ A;  2FKE A;  2M08 A;  4G50 A;  3CNG A;  3KCE A;  3UI5 A;  2PV1 A;  1F40 A;  2LJ4 A;  2JV4 A;  2YSH A;  1KT1 A;  1K9R A;  2M8J A;  3TC5 A;  2KXQ A;  2L2S A;  3LUO A;  1R9H A;  1FKI A;  2RSE A;  1Q6I A;  2ITK A;  4ODN A;  2KE0 A;  5HW7 A;  1FKJ A;  4C02 B;  5HWB A;  4DRI A;  5I98 A;  1NMW A;  2RUQ A;  2M3O W;  5HT1 A;  2M2A A;  2XP4 A;  2OFN A;  2PPN A;  3EY6 A;  3O5D A; 
#chains in the Genus database with same CATH topology
 3VAW A;  3CGM A;  3ARS A;  1L1P A;  1VF8 A;  3IHZ A;  3KAC A;  2PPO A;  1FFR A;  2ZR6 A;  1CTN A;  1JNT A;  1J4I A;  1FJD A;  3M85 A;  3UQA A;  3ARV A;  5E65 A;  2G41 A;  2LPV A;  4MGV A;  4URI A;  2XP5 A;  1GOI A;  2WLZ A;  3IKD A;  3PR9 A;  1WR7 A;  3KAD A;  1ZBK A;  1ZBW A;  5HBF A;  1SYT A;  2F2D A;  1EIB A;  5DIV A;  4WKA A;  1PIN A;  2JMF A;  4QT3 A;  4REX A;  2LGO A;  2A3E A;  2PPP A;  3CHD A;  3AS0 A;  1O6I A;  2KR7 A;  1Q1C A;  4DWS A;  4MNK A;  4U84 A;  2IF4 A;  3O5M A;  4DIP A;  1LG1 A;  4TW8 A;  3ARX A;  1FKR A;  2YSI A;  4L3N A;  5HW6 A;  4TX0 A;  3PRD A;  1EDQ A;  1D7J A;  3ARQ A;  1RD6 A;  1FKF A;  1HKM A;  5D75 A;  2DJY A;  3RM8 A;  4ODO A;  4WIW A;  4J4N A;  4O2T A;  3UQI A;  3UF8 A;  2JXW A;  2PV2 A;  1N1A A;  1W26 A;  3NI6 A;  4LAV A;  1FFQ A;  3KAF A;  1D7I A;  3M7N A;  1W9V A;  1J4R A;  1NWT A;  3LKX B;  1HKJ A;  2DT3 A;  4Z2L A;  2VN1 A;  2DG9 A;  3ALG A;  2XP9 A;  4WJX A;  3O5I A;  3O5L A;  1Q6H A;  1JNS A;  1OWQ A;  3WD0 A;  3PRA A;  1D6O A;  3KAH A;  2MNT A;  3GU0 A;  4DRO A;  4E5R A;  2E45 A;  2KO7 A;  1M5Y A;  1NSG A;  2YSF A;  1JCH B;  2M1I A;  5HWC A;  4GGQ A;  3O5F A;  1BKF A;  4Z2H A;  2DSZ A;  5GPR A;  4L72 B;  4JFL A;  4TW7 A;  2XP3 A;  1W1V A;  2FDM A;  2XP8 A;  1TCO C;  1W9P A;  3NTP A;  1P5Q A;  4W9O A;  1W1Y A;  1IX5 A;  1W1T A;  2ZQV A;  2RUC A;  3O5R A;  1E6P A;  4J4O A;  3BMB A;  3B9D A;  1ZCN A;  4ITZ A;  2DK7 A;  2ZQS A;  4DWS C;  2O92 A;  4TYO A;  3L4H A;  1FAP A;  3WL0 A;  4S3K A;  3FY1 A;  4DRK A;  3ARW A;  3MDY B;  1W1P A;  2QF8 A;  1HJW A;  2WAE A;  4QIB A;  3ARZ A;  2MF9 A;  2DG4 A;  3IK8 A;  3WH0 A;  1OGB A;  2ESC A;  5E64 A;  5HW8 A;  2RUD A;  3IKG A;  4HBE A;  1NH6 A;  4LAX A;  4MSP A;  1UR8 A;  4IQ2 A;  2F21 A;  2M8I A;  4JFI A;  1A7X A;  2Y78 A;  2ZQU A;  4KR0 B;  4LGX A;  3ARP A;  1E6N A;  4WK9 A;  2DK1 A;  4KQZ A;  5DEZ A;  3O5K A;  2B31 A;  3WD4 A;  4ODR A;  4LAW A;  5DF0 A;  4DWS D;  4P8V A;  1X6L A;  4DWS B;  2MLZ A;  5GQB A;  2WAD A;  1FKD A;  3WKZ A;  4Z2G A;  2XP7 A;  1JNE A;  3RFW A;  4U85 A;  2MPH A;  2IUZ A;  4Z2K A;  3FAP A;  3QOK A;  3MQG A;  3TDB A;  1FKK A;  2P4V A;  4QT2 A;  2JX8 A;  1KT0 A;  3RME A;  4BF8 A;  1ZK6 A;  1NWU A;  4DZ2 A;  1WNO A;  2XPB A;  4P8U A;  1K9Q A;  3ART A;  4DRP A;  2D9F A;  2K8I A;  1W9U A;  2YBT A;  3ALF A;  3O5G A;  3LE4 A;  4PTM A;  4MAV A;  3PA7 A;  3H9R B;  4IT6 A;  2DG3 A;  2WLY A;  4ODQ A;  2OWO A;  3B7X A;  1E9L A;  2DWV A;  1HJX A;  3WQV A;  2WM0 A;  2RE3 A;  2XPA A;  3KZ7 A;  1LJY A;  4DZ3 A;  1NWS A;  4ML4 A;  4HBO A;  4NNR A;  2KFW A;  2XP6 A;  3UI6 A;  1EQ3 A;  2MDI A;  2KI3 A;  1NWR A;  1JVW A;  1YW5 A;  1UR9 A;  4FAP A;  1GPF A;  4MNM A;  1JND A;  4ODK A;  1QPL A;  2KGJ A;  5DIU A;  3FS8 A;  1YAT A;  3ARY A;  4DRN A;  4TNS A;  3FSB A;  2DT0 A;  2F23 A;  4ZPT R;  4Z2J A;  4ZPW R;  1EG3 A;  2A3C A;  4ODL A;  1C9H A;  1E15 A;  4FN2 A;  4LAY A;  2N87 A;  2ZAJ A;  1TFV A;  4ZS6 A;  2PN0 A;  5BXJ A;  1FKL A;  2LAJ A;  1TK7 A;  1HXV A;  2MLX A;  3W4R A;  4DRQ A;  1J4H A;  1FKT A;  2YSB A;  2DT1 A;  3LKX A;  3AS3 A;  1XHG A;  1B6C A;  2ZR4 A;  4Q7N A;  1NMV A;  3TCZ A;  2B5U B;  4QZV B;  3MCB A;  3WD3 A;  2L4J A;  3I6C A;  1SR0 A;  3WD2 A;  2VCD A;  2F4E A;  3G6L A;  5GPG A;  1FKG A;  2EUL A;  1U79 A;  3B9A A;  4MNJ A;  2DMV A;  5E66 A;  3JXV A;  3O5Q A;  2AOS A;  3GPK A;  3ODK A;  1T11 A;  2DT2 A;  3O5O A;  4G2P A;  5B8I C;  3B8S A;  1HKK A;  5HUA A;  2DSU A;  1E6R A;  3BXW A;  1ROT A;  4NSB A;  1O6W A;  4UDM A;  5J6E A;  5HTG A;  3ARO A;  2RQS A;  2FAP A;  3CHE A;  3ARU A;  3JYM A;  4AY1 A;  1ITX A;  1H0I A;  2EZ5 W;  2AWG A;  1QPF A;  3RM4 A;  3UI4 A;  4DRH A;  1PBK A;  3CGN A;  4IQC A;  3O5E A;  4ODP A;  3OOB A;  2YSG A;  4DT4 A;  1OGG A;  4TW6 A;  1HJV A;  3NRK A;  3KAB A;  1D7H A;  3ARR A;  3OA5 A;  3WL1 A;  2DSV A;  3FSC A;  1FKS A;  3RGC A;  1WMV A;  1LL7 A;  5U47 A;  1QZ2 A;  4S3J A;  3CZ8 A;  1LL4 A;  2QRV A;  1ZU8 A;  1EHN A;  1ROU A;  3KAI A;  4WKF A;  1E6Z A;  4MPK A;  3RM9 A;  2YAJ B;  4U86 A;  3CH9 A;  2A3B A;  4W9Q A;  1E44 A;  4P8W A;  4Q22 A;  1EYM A;  4N19 A;  3WQW A;  4A0T A;  1F8A B;  1FKH A;  2LKN A;  2WK2 A;  3O5P A;  4DRJ A;  5DIT A;  4DRM A;  4Z2I A;  3KAG A;  2ZQT A;  2PV3 A;  2ETN A;  3O5J A;  2O9O A;  4JFM A;  2BA1 A;  1WB0 A;  3AS2 A;  1KFW A;  2RUR A;  5AHT A;  3PRB A;  2Q5A A;  4P8X A;  4W9P A;  2UZ5 A;  4IPX A;  4R0X A;  4GLX A;  3CHF A;  4NZC A;  4ODM A;  1ZBV A;  5E5W A;  4JFK A;  4JYS A;  1Y0O A;  4DH0 A;  2ZR5 A;  2MLY A;  1FD9 A;  5HKG A;  4HAR A;  4A0U A;  1LL6 A;  1EG4 A;  5CQ2 A;  3EIP A;  3UQB A;  3JYJ A;  1XRV A;  3PQH A;  4GIV A;  2YBU A;  4JFJ A;  3WIJ A;  1BL4 A;  3WD1 A;  1FKB A;  2PBC A;  1J6Y A;  1I5H W;  1LQ0 A;  4R5E A;  2Y8N B;  2JZV A;  1Q6U A;  3MCB B;  2G8Z A;  1JMQ A;  2DSW A;  2FKE A;  2M08 A;  1LG2 A;  1D2K A;  4G50 A;  3CNG A;  3KCE A;  2PI6 A;  1ZB5 A;  3UI5 A;  2PV1 A;  1F40 A;  2LJ4 A;  3GTY X;  5JH8 A;  5E62 A;  1HKI A;  1RP5 A;  4ZPV R;  2JV4 A;  2YSH A;  1KT1 A;  2OLH A;  1K9R A;  2M8J A;  4MTV A;  3TC5 A;  2KXQ A;  5DO2 A;  2L2S A;  3B9E A;  3LUO A;  1R9H A;  1FKI A;  1K9T A;  1H0G A;  3AS1 A;  2RSE A;  1GUV A;  1Q6I A;  2DPE A;  2ITK A;  4ODN A;  2KE0 A;  4IT4 A;  5HW7 A;  4W5U A;  1FKJ A;  3MQH A;  1ZL1 A;  1GRJ A;  4C02 B;  3G6M A;  1WAW A;  1TR8 A;  5HWB A;  3CHC A;  4MNL A;  4DRI A;  1X6N A;  5I98 A;  1NMW A;  2A3A A;  2RUQ A;  1FLC A;  3AQU A;  2M3O W;  4WKH A;  5HT1 A;  2M2A A;  2XP4 A;  2OFN A;  4XAK A;  3FXY A;  2PPN A;  1ZBC A;  3EY6 A;  3O5D A; 
#chains in the Genus database with same CATH homology
 3VAW A;  3CGM A;  3ARS A;  1L1P A;  1VF8 A;  3IHZ A;  3KAC A;  2PPO A;  1FFR A;  2ZR6 A;  1CTN A;  1JNT A;  1J4I A;  1FJD A;  3M85 A;  3UQA A;  3ARV A;  5E65 A;  2G41 A;  2LPV A;  4MGV A;  4URI A;  2XP5 A;  1GOI A;  2WLZ A;  3IKD A;  3PR9 A;  1WR7 A;  3KAD A;  1ZBK A;  1ZBW A;  5HBF A;  1SYT A;  2F2D A;  1EIB A;  5DIV A;  4WKA A;  1PIN A;  2JMF A;  4QT3 A;  4REX A;  2LGO A;  2A3E A;  2PPP A;  3CHD A;  3AS0 A;  1O6I A;  2KR7 A;  1Q1C A;  4DWS A;  4MNK A;  4U84 A;  2IF4 A;  3O5M A;  4DIP A;  1LG1 A;  4TW8 A;  3ARX A;  1FKR A;  2YSI A;  4L3N A;  5HW6 A;  4TX0 A;  3PRD A;  1EDQ A;  1D7J A;  3ARQ A;  1RD6 A;  1FKF A;  1HKM A;  5D75 A;  2DJY A;  3RM8 A;  4ODO A;  4WIW A;  4J4N A;  4O2T A;  3UQI A;  3UF8 A;  2JXW A;  2PV2 A;  1N1A A;  1W26 A;  3NI6 A;  4LAV A;  1FFQ A;  3KAF A;  1D7I A;  3M7N A;  1W9V A;  1J4R A;  1NWT A;  3LKX B;  1HKJ A;  2DT3 A;  4Z2L A;  2VN1 A;  2DG9 A;  3ALG A;  2XP9 A;  4WJX A;  3O5I A;  3O5L A;  1Q6H A;  1JNS A;  1OWQ A;  3WD0 A;  3PRA A;  1D6O A;  3KAH A;  2MNT A;  4DRO A;  4E5R A;  2E45 A;  2KO7 A;  1M5Y A;  1NSG A;  2YSF A;  2M1I A;  5HWC A;  4GGQ A;  3O5F A;  1BKF A;  4Z2H A;  2DSZ A;  5GPR A;  4L72 B;  4JFL A;  4TW7 A;  2XP3 A;  1W1V A;  2FDM A;  2XP8 A;  1TCO C;  1W9P A;  3NTP A;  1P5Q A;  4W9O A;  1W1Y A;  1IX5 A;  1W1T A;  2ZQV A;  2RUC A;  3O5R A;  1E6P A;  4J4O A;  3B9D A;  1ZCN A;  4ITZ A;  2DK7 A;  2ZQS A;  4DWS C;  2O92 A;  4TYO A;  3L4H A;  1FAP A;  3WL0 A;  4S3K A;  3FY1 A;  4DRK A;  3ARW A;  3MDY B;  1W1P A;  2QF8 A;  1HJW A;  2WAE A;  4QIB A;  3ARZ A;  2MF9 A;  2DG4 A;  3IK8 A;  3WH0 A;  1OGB A;  2ESC A;  5E64 A;  5HW8 A;  2RUD A;  3IKG A;  4HBE A;  1NH6 A;  4LAX A;  4MSP A;  1UR8 A;  4IQ2 A;  2F21 A;  2M8I A;  4JFI A;  1A7X A;  2Y78 A;  2ZQU A;  4KR0 B;  4LGX A;  3ARP A;  1E6N A;  4WK9 A;  2DK1 A;  4KQZ A;  5DEZ A;  3O5K A;  2B31 A;  3WD4 A;  4ODR A;  4LAW A;  5DF0 A;  4DWS D;  4P8V A;  1X6L A;  4DWS B;  2MLZ A;  5GQB A;  2WAD A;  1FKD A;  3WKZ A;  4Z2G A;  2XP7 A;  1JNE A;  3RFW A;  4U85 A;  2MPH A;  2IUZ A;  4Z2K A;  3FAP A;  3QOK A;  3MQG A;  3TDB A;  1FKK A;  4QT2 A;  2JX8 A;  1KT0 A;  3RME A;  4BF8 A;  1ZK6 A;  1NWU A;  4DZ2 A;  1WNO A;  2XPB A;  4P8U A;  1K9Q A;  3ART A;  4DRP A;  2D9F A;  2K8I A;  1W9U A;  2YBT A;  3ALF A;  3O5G A;  3LE4 A;  4PTM A;  4MAV A;  3PA7 A;  3H9R B;  4IT6 A;  2DG3 A;  2WLY A;  4ODQ A;  2OWO A;  3B7X A;  1E9L A;  2DWV A;  1HJX A;  3WQV A;  2WM0 A;  2RE3 A;  2XPA A;  3KZ7 A;  1LJY A;  4DZ3 A;  1NWS A;  4ML4 A;  4HBO A;  4NNR A;  2KFW A;  2XP6 A;  3UI6 A;  1EQ3 A;  2MDI A;  2KI3 A;  1NWR A;  1JVW A;  1YW5 A;  1UR9 A;  4FAP A;  1GPF A;  4MNM A;  1JND A;  4ODK A;  1QPL A;  2KGJ A;  5DIU A;  3FS8 A;  1YAT A;  3ARY A;  4DRN A;  4TNS A;  3FSB A;  2DT0 A;  4ZPT R;  4Z2J A;  4ZPW R;  1EG3 A;  2A3C A;  4ODL A;  1C9H A;  1E15 A;  4FN2 A;  4LAY A;  2N87 A;  2ZAJ A;  1TFV A;  4ZS6 A;  5BXJ A;  1FKL A;  2LAJ A;  1TK7 A;  1HXV A;  2MLX A;  3W4R A;  4DRQ A;  1J4H A;  1FKT A;  2YSB A;  2DT1 A;  3LKX A;  3AS3 A;  1XHG A;  1B6C A;  2ZR4 A;  4Q7N A;  1NMV A;  3TCZ A;  4QZV B;  3MCB A;  3WD3 A;  2L4J A;  3I6C A;  1SR0 A;  3WD2 A;  2VCD A;  2F4E A;  3G6L A;  5GPG A;  1FKG A;  4MNJ A;  1U79 A;  3B9A A;  2DMV A;  5E66 A;  3JXV A;  3O5Q A;  2AOS A;  3GPK A;  3ODK A;  1T11 A;  2DT2 A;  3O5O A;  4G2P A;  5B8I C;  3B8S A;  1HKK A;  5HUA A;  2DSU A;  1E6R A;  3BXW A;  1ROT A;  4NSB A;  1O6W A;  5J6E A;  5HTG A;  3ARO A;  2RQS A;  2FAP A;  3CHE A;  3ARU A;  3JYM A;  4AY1 A;  1ITX A;  1H0I A;  2EZ5 W;  2AWG A;  1QPF A;  3RM4 A;  3UI4 A;  4DRH A;  1PBK A;  3CGN A;  4IQC A;  3O5E A;  4ODP A;  3OOB A;  2YSG A;  4DT4 A;  1OGG A;  4TW6 A;  1HJV A;  3NRK A;  3KAB A;  1D7H A;  3ARR A;  3OA5 A;  3WL1 A;  2DSV A;  3FSC A;  1FKS A;  3RGC A;  1WMV A;  1LL7 A;  5U47 A;  1QZ2 A;  4S3J A;  3CZ8 A;  1LL4 A;  2QRV A;  1ZU8 A;  1EHN A;  1ROU A;  3KAI A;  4WKF A;  1E6Z A;  4MPK A;  3RM9 A;  2YAJ B;  4U86 A;  3CH9 A;  2A3B A;  4W9Q A;  4P8W A;  4Q22 A;  1EYM A;  4N19 A;  3WQW A;  4A0T A;  1F8A B;  1FKH A;  2LKN A;  2WK2 A;  3O5P A;  4DRJ A;  5DIT A;  4DRM A;  4Z2I A;  3KAG A;  2ZQT A;  2PV3 A;  3O5J A;  2O9O A;  4JFM A;  2BA1 A;  1WB0 A;  3AS2 A;  1KFW A;  2RUR A;  5AHT A;  3PRB A;  2Q5A A;  4P8X A;  4W9P A;  2UZ5 A;  4IPX A;  4R0X A;  4GLX A;  3CHF A;  4NZC A;  4ODM A;  1ZBV A;  5E5W A;  4JFK A;  4JYS A;  1Y0O A;  4DH0 A;  2ZR5 A;  2MLY A;  1FD9 A;  5HKG A;  4HAR A;  4A0U A;  1LL6 A;  1EG4 A;  5CQ2 A;  3UQB A;  3JYJ A;  1XRV A;  3PQH A;  4GIV A;  2YBU A;  4JFJ A;  3WIJ A;  1BL4 A;  3WD1 A;  1FKB A;  2PBC A;  1J6Y A;  1I5H W;  1LQ0 A;  4R5E A;  2Y8N B;  2JZV A;  1Q6U A;  3MCB B;  2G8Z A;  1JMQ A;  2DSW A;  2FKE A;  2M08 A;  1LG2 A;  1D2K A;  4G50 A;  3CNG A;  3KCE A;  2PI6 A;  1ZB5 A;  3UI5 A;  2PV1 A;  1F40 A;  2LJ4 A;  5JH8 A;  5E62 A;  1HKI A;  1RP5 A;  4ZPV R;  2JV4 A;  2YSH A;  1KT1 A;  2OLH A;  1K9R A;  2M8J A;  4MTV A;  3TC5 A;  2KXQ A;  5DO2 A;  2L2S A;  3B9E A;  3LUO A;  1R9H A;  1FKI A;  1K9T A;  1H0G A;  3AS1 A;  2RSE A;  1GUV A;  1Q6I A;  2DPE A;  2ITK A;  4ODN A;  2KE0 A;  4IT4 A;  5HW7 A;  4W5U A;  1FKJ A;  3MQH A;  1ZL1 A;  4C02 B;  3G6M A;  1WAW A;  1TR8 A;  5HWB A;  3CHC A;  4MNL A;  4DRI A;  1X6N A;  5I98 A;  1NMW A;  2A3A A;  2RUQ A;  1FLC A;  3AQU A;  2M3O W;  4WKH A;  5HT1 A;  2M2A A;  2XP4 A;  2OFN A;  4XAK A;  3FXY A;  2PPN A;  1ZBC A;  3EY6 A;  3O5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...