2ZR5A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVAHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 44
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr5A02
3LE4A 4U85A 3UQIA 2IF4A 2XP9A 1K9QA 4IQ2A 3WH0A 3O5MA 4NNRA 2PBCA 2YSFA 4MSPA 3M7NA 2L4JA 1R9HA 4QT2A 1KT0A 1TCOC 2KFWA 2KE0A 3UI4A 4DH0A 1JVWA 2XP7A 4REXA 1QPFA 2XP8A 2RUCA 2Y78A 3IKDA 3PRBA 5CQ2A 3ODKA 4ODPA 4QIBA 3UI5A 5HTGA 2RUDA 2DG4A 4LAXA 1J4IA 1FKKA 1P5QA 4G50A 3O5IA 4IPXA 5HT1A 4JYSA 1FKBA 2M08A 4GIVA 4TNSA 1NMWA 2JX8A 4ODLA 1HXVA 3KABA 2ZR6A 1YW5A 4U84A 5GPGA 4DRJA 4J4OA 2RE3A 1FKLA 4N19A 2ZAJA 3IHZA 2PV3A 1QPLA 1FKJA 3O5PA 1WMVA 1K9RA 2DMVA 4LAVA 1F8AB 1J4HA 1Q1CA 1Q6HA 1FKIA 2JV4A 1QZ2A 4IQCA 2OFNA 4FN2A 2ZQTA 2M8JA 4DRQA 4DZ2A 4ODKA 2DK1A 3NTPA 3H9RB 2YSGA 2VN1A 1TK7A 2KR7A 3PA7A 2JMFA 2F4EA 4DRNA 3CNGA 2UZ5A 4JFLA 5DIVA 4JFKA 2LGOA 2KO7A 1A7XA 2RSEA 2YSHA 2EZ5W 1JNTA 3UQBA 2BA1A 4LAYA 2Q5AA 2ZR5A 1C9HA 4TW6A 3B7XA 1M5YA 1W26A 3O5EA 4W9PA 1EQ3A 1F40A 2MNTA 1L1PA 1BL4A 1N1AA 1ZCNA 5HWCA 1B6CA 3O5GA 2ZR4A 3KZ7A 1D7IA 2FKEA 3MDYB 5DITA 4DRIA 4G2PA 3CGMA 5HWBA 3PRDA 3FAPA 2LPVA 2RURA 2DK7A 3KACA 3KAHA 3OOBA 2DG9A 1ROTA 3RGCA 4ODQA 1EG3A 1D7JA 4LAWA 2XP4A 2MLXA 4TX0A 3O5KA 3KAFA 1Q6UA 4QT3A 3O5LA 2VCDA 3O5RA 5DIUA 3RFWA 4DRKA 4TYOA 4DRPA 1PINA 3O5JA 1ROUA 4ITZA 3NI6A 3TC5A 2D9FA 2LKNA 2MPHA 4J4NA 2PV1A 3NRKA 1YATA 1WR7A 5D75A 3KAIA 2XP6A 3TDBA 2M1IA 2PPPA 3CGNA 4O2TA 4R0XA 4C02B 3TCZA 3LUOA 3O5QA 2ZQUA 2YSIA 2DG3A 4JFJA 4MGVA 5HKGA 3O5OA 3I6CA 3KAGA 1FJDA 1JNSA 2DJYA 1FD9A 2XP3A 3UQAA 4DRMA 2XP5A 2DWVA 4GGQA 4BF8A 4DZ3A 2M8IA 3KADA 5HW6A 5I98A 4DRHA 1EYMA 1FAPA 3L4HA 3EY6A 3JYMA 2KXQA 2MF9A 3O5FA 3UI6A 4W9OA 4FAPA 3M85A 1J4RA 3VAWA 1ZK6A 2XPAA 3UF8A 1FKDA 2N87A 4ODNA 1J6YA 2AWGA 1EG4A 2M2AA 1JMQA 3JYJA 2ZQSA 1PBKA 1Y0OA 2M3OW 2JZVA 3JXVA 4ODRA 2ITKA 4JFIA 4JFMA 5HW7A 4W9QA 1O6WA 2F21A 1FKHA 5J6EA 2JXWA 2K8IA 2XPBA 2E45A 4TW7A 2L2SA 2F2DA 4E5RA 2LJ4A 2PPOA 4U86A 2MLZA 2PV2A 4ODOA 2ZQVA 1U79A 2KI3A 1T11A 5AHTA 1FKGA 2LAJA 2MDIA 2RUQA 4ODMA 1FKFA 4DT4A 5BXJA 5HUAA 3KCEA 3IK8A 1D7HA 5B8IC 1FKTA 2RQSA 1BKFA 2FAPA 1NMVA 4DROA 2MLYA 5HW8A 1NSGA 2KGJA 4DIPA 3GPKA 2PPNA 3O5DA 3IKGA 4TW8A 1FKRA 1I5HW 1FKSA 1KT1A 2YSBA 1D6OA 1Q6IA
chains in the Genus database with same CATH superfamily
2ETNA 1GOIA 2IF4A 4PTMA 4NNRA 3RM9A 4A0TA 3M7NA 3WD4A 4P8WA 1GRJA 4REXA 2XP8A 1TFVA 3WD2A 2FDMA 4ODPA 4MNMA 1FKKA 1P5QA 1FKBA 1ITXA 4GIVA 2JX8A 1K9TA 2A3EA 2ZR6A 4IT4A 2RE3A 3AS3A 3IHZA 2G41A 4L3NA 1NWUA 4HBEA 4P8XA 3O5PA 3LKXA 1FFQA 1F8AB 1Q6HA 3WL1A 4DWSD 4FN2A 2DPEA 2M8JA 4DZ2A 1W1YA 2VN1A 4DRNA 2DSWA 3RM8A 2RSEA 1JNTA 2ZR5A 1EQ3A 1W26A 1ZCNA 4Z2LA 1LJYA 3CGMA 3PRDA 3FAPA 1NWSA 3KACA 2DT1A 3OOBA 3PRAA 5E64A 4TX0A 2WADA 3O5RA 4TYOA 4ZPTR 3RMEA 3O5JA 4LGXA 1HJWA 4DWSB 2MPHA 1O6IA 2PPPA 4R0XA 1ZL1A 3FXYA 3O5QA 2YSIA 4JFJA 3O5OA 4ML4A 4HBOA 1FJDA 2DJYA 3UQAA 4S3KA 2O92A 1LG2A 2XPAA 1FKDA 2DSZA 3WD3A 1GUVA 5DF0A 1J6YA 1EIBA 1Y0OA 3CHDA 4L72B 4GLXA 1ZB5A 3WD0A 4JFMA 4W9QA 2Y8NB 3ARXA 4DT4A 2L2SA 2MLZA 1U79A 2KI3A 1W9UA 1FKGA 2DT3A 4MAVA 3BMBA 1FKFA 3KCEA 4AY1A 1FKTA 2WLYA 3G6LA 1BKFA 3AROA 4DROA 3GPKA 2DSVA 3ALGA 3WIJA 2ESCA 1D6OA 1HKMA 3LE4A 3UQIA 2YSFA 4KR0B 5DEZA 1KT0A 2KE0A 1JVWA 1QPFA 4Z2HA 2Y78A 3IKDA 5CQ2A 2A3AA 5HTGA 2DG4A 1LG1A 4JYSA 1HXVA 3ARZA 4IT6A 1WNOA 5GPGA 3ALFA 1FKLA 4QZVB 2ZAJA 4P8VA 1QPLA 1FKJA 3CHCA 4LAVA 1K9RA 2DMVA 3B9DA 1J4HA 2OFNA 2ZQTA 2WAEA 2EULA 1W1TA 3WQVA 2DT2A 2JMFA 2WK2A 3CNGA 4JFLA 5E66A 4JFKA 1SYTA 2LGOA 2KO7A 2BA1A 1FLCA 1JNSA 1M5YA 3O5EA 1BL4A 1B6CA 1TR8A 2B31A 2LPVA 2RURA 2O9OA 1W9VA 3KAHA 3MCBA 1X6LA 1EG3A 1D7JA 1JNEA 4LAWA 5DIUA 3O5KA 3KAFA 3G6MA 1UR9A 4DRKA 1PINA 1ROUA 4ITZA 1XHGA 3TC5A 1NWRA 3NRKA 4A0UA 4C02B 3TDBA 2M1IA 4Q7NA 4DRJA 3CGNA 5HKGA 2P4VA 1FFRA 1ZBCA 2XP3A 2XP5A 2DWVA 4GGQA 3EIPA 4DZ3A 4Z2JA 3KADA 3UQBA 1EYMA 1FAPA 3L4HA 4UDMA 4W5UA 4W9OA 3M85A 1ZK6A 1OGBA 5GPRA 2N87A 1EG4A 2M2AA 4URIA 5E65A 2ZQSA 2M3OW 4ODRA 1JCHB 2ITKA 5J6EA 2K8IA 4DWSA 2XPBA 2LJ4A 2PV2A 4MNLA 4ODOA 3FS8A 1W9PA 3ARVA 5AHTA 2LAJA 2MDIA 3B9AA 5HUAA 4WKHA 3CZ8A 1D7HA 3WL0A 5B8IC 5HW8A 1NSGA 2KGJA 4DIPA 1FKRA 3O5DA 4TW8A 1I5HW 1FKSA 2YSBA 1Q6IA 4U85A 1D2KA 2XP9A 3WH0A 3O5MA 4QT2A 2PBCA 1R9HA 2QF8A 1TCOC 1GPFA 2XP7A 1W1PA 3UI5A 4QIBA 2RUDA 4LAXA 4G50A 4WKAA 4IPXA 2AOSA 1HKKA 2M08A 1NMWA 4MPKA 3KABA 1YW5A 4WIWA 4N19A 2PV3A 4WK9A 1WMVA 4IQCA 4MNKA 1ZU8A 1HJVA 1UR8A 4DRQA 3NTPA 2YSGA 1TK7A 2DSUA 2KR7A 1E6NA 2QRVA 2YSHA 3WQWA 2EZ5W 1C9HA 1F40A 3B7XA 1ZBKA 1L1PA 1XRVA 5HWCA 2F23A 4DWSC 2FKEA 1OGGA 5DITA 4DRIA 3CHFA 4G2PA 3AQUA 2DK7A 5U47A 1ZBVA 1HKIA 2DG9A 1ROTA 3RGCA 2OWOA 5HT1A 1Q6UA 3RFWA 2VCDA 4DRPA 4XAKA 1H0GA 3NI6A 4J4NA 2PV1A 3PQHA 1WR7A 3KAIA 4S3JA 3LUOA 2WM0A 4KQZA 4WKFA 3RM4A 3KAGA 1LL4A 4DRMA 4BF8A 1JNDA 4ZS6A 2DT0A 5HW6A 5I98A 4DRHA 3JYMA 2KXQA 2MF9A 3UI6A 1IX5A 3VAWA 3FSCA 3GU0A 4ODNA 3ARUA 1JMQA 1WAWA 3JYJA 1PBKA 3MQHA 2PI6A 1E6PA 1VF8A 3QOKA 4JFIA 3ARTA 5HW7A 1O6WA 2F21A 5GQBA 2JXWA 1HKJA 4TW7A 2A3CA 1EHNA 1EDQA 4ODMA 3IK8A 2B5UB 3FY1A 1LL6A 2FAPA 5E5WA 3ARPA 1KT1A 5HBFA 2OLHA 1K9QA 4IQ2A 5DIVA 1LL7A 4MSPA 4Z2KA 2L4JA 4DH0A 3UI4A 2KFWA 1E15A 4Z2IA 2RUCA 3PRBA 4TNSA 3ODKA 1J4IA 2YBTA 3O5IA 4ODLA 1OWQA 1KFWA 4U84A 1E6ZA 3W4RA 1CTNA 4J4OA 4WJXA 5E62A 3BXWA 1Q1CA 1FKIA 2JV4A 1QZ2A 1NH6A 3CH9A 2PN0A 1RD6A 4ODKA 2DK1A 3H9RB 2YAJB 4HARA 3PA7A 2F4EA 2UZ5A 2A3BA 1NWTA 1A7XA 4LAYA 2Q5AA 3WD1A 4W9PA 4TW6A 3FSBA 2MNTA 1N1AA 3O5GA 4MTVA 4P8UA 2ZR4A 3KZ7A 1D7IA 3MDYB 2WLZA 5HWBA 4Z2GA 4ZPVR 3PR9A 3ARWA 4ODQA 2XP4A 2MLXA 4NZCA 4QT3A 3O5LA 1X6NA 4MNJA 3ARRA 1H0IA 2D9FA 2LKNA 1W1VA 3ARYA 1YATA 5D75A 2XP6A 4O2TA 1WB0A 3TCZA 2ZQUA 2DG3A 4MGVA 3I6CA 5DO2A 3CHEA 3MCBB 1FD9A 3B9EA 2G8ZA 4R5EA 2M8IA 1LQ0A 3OA5A 3EY6A 4FAPA 3O5FA 3LKXB 1J4RA 1E44A 5JH8A 3UF8A 1SR0A 1E9LA 3GTYX 3AS0A 3WKZA 2AWGA 4ZPWR 2JZVA 2IUZA 3MQGA 3JXVA 1E6RA 3AS1A 4NSBA 3B8SA 1FKHA 2E45A 2F2DA 4E5RA 2PPOA 4U86A 1ZBWA 2ZQVA 1HJXA 1T11A 3ARQA 3AS2A 2RUQA 5BXJA 2RQSA 1RP5A 1NMVA 2MLYA 4Q22A 2PPNA 3ARSA 3IKGA 2YBUA
chains in the Genus database with same CATH topology
1GOIA 2IF4A 4PTMA 4NNRA 3RM9A 4A0TA 3M7NA 3WD4A 4P8WA 4REXA 2XP8A 1TFVA 3WD2A 2FDMA 4ODPA 4MNMA 1FKKA 1P5QA 1FKBA 1ITXA 4GIVA 2JX8A 1K9TA 2A3EA 2ZR6A 4IT4A 2RE3A 3AS3A 3IHZA 2G41A 4L3NA 1NWUA 4HBEA 4P8XA 3O5PA 3LKXA 1FFQA 1F8AB 1Q6HA 3WL1A 4DWSD 4FN2A 2DPEA 2M8JA 4DZ2A 1W1YA 2VN1A 4DRNA 2DSWA 3RM8A 2RSEA 1JNTA 2ZR5A 1EQ3A 1W26A 1ZCNA 4Z2LA 1LJYA 3CGMA 3PRDA 3FAPA 1NWSA 3KACA 2DT1A 3OOBA 3PRAA 5E64A 4TX0A 2WADA 3O5RA 4TYOA 4ZPTR 3RMEA 3O5JA 4LGXA 1HJWA 4DWSB 2MPHA 1O6IA 2PPPA 4R0XA 1ZL1A 3FXYA 3O5QA 2YSIA 4JFJA 3O5OA 4ML4A 4HBOA 1FJDA 2DJYA 3UQAA 4S3KA 2O92A 1LG2A 2XPAA 1FKDA 2DSZA 3WD3A 1GUVA 5DF0A 1J6YA 1EIBA 1Y0OA 3CHDA 4L72B 4GLXA 1ZB5A 3WD0A 4JFMA 4W9QA 2Y8NB 3ARXA 4DT4A 2L2SA 2MLZA 1U79A 2KI3A 1W9UA 1FKGA 2DT3A 4MAVA 1FKFA 3KCEA 4AY1A 1FKTA 2WLYA 3G6LA 1BKFA 3AROA 4DROA 3GPKA 2DSVA 3ALGA 3WIJA 2ESCA 1D6OA 1HKMA 3LE4A 3UQIA 2YSFA 4KR0B 5DEZA 1KT0A 2KE0A 1JVWA 1QPFA 4Z2HA 2Y78A 3IKDA 5CQ2A 2A3AA 5HTGA 2DG4A 1LG1A 4JYSA 1HXVA 3ARZA 4IT6A 1WNOA 5GPGA 3ALFA 1FKLA 4QZVB 2ZAJA 4P8VA 1QPLA 1FKJA 3CHCA 4LAVA 1K9RA 2DMVA 3B9DA 1J4HA 2OFNA 2ZQTA 2WAEA 1W1TA 3WQVA 2DT2A 2JMFA 2WK2A 3CNGA 4JFLA 5E66A 4JFKA 1SYTA 2LGOA 2KO7A 2BA1A 1FLCA 1JNSA 1M5YA 3O5EA 1BL4A 1B6CA 1TR8A 2B31A 2LPVA 2RURA 2O9OA 1W9VA 3KAHA 3MCBA 1X6LA 1EG3A 1D7JA 1JNEA 4LAWA 5DIUA 3O5KA 3KAFA 3G6MA 1UR9A 4DRKA 1PINA 1ROUA 4ITZA 1XHGA 3TC5A 1NWRA 3NRKA 4A0UA 4C02B 3TDBA 2M1IA 4Q7NA 4DRJA 3CGNA 5HKGA 1FFRA 1ZBCA 2XP3A 2XP5A 2DWVA 4GGQA 4DZ3A 4Z2JA 3UQBA 3KADA 1EYMA 1FAPA 3L4HA 4W5UA 4W9OA 3M85A 1ZK6A 1OGBA 5GPRA 2N87A 1EG4A 2M2AA 4URIA 5E65A 2ZQSA 2M3OW 4ODRA 2ITKA 5J6EA 2K8IA 4DWSA 2XPBA 2LJ4A 2PV2A 4MNLA 4ODOA 3FS8A 1W9PA 3ARVA 5AHTA 2LAJA 2MDIA 3B9AA 5HUAA 4WKHA 3CZ8A 1D7HA 3WL0A 5B8IC 5HW8A 1NSGA 2KGJA 4DIPA 1FKRA 3O5DA 4TW8A 1I5HW 1FKSA 2YSBA 1Q6IA 4U85A 1D2KA 2XP9A 3WH0A 3O5MA 4QT2A 2PBCA 1R9HA 2QF8A 1TCOC 1GPFA 2XP7A 1W1PA 3UI5A 4QIBA 2RUDA 4LAXA 4G50A 4WKAA 4IPXA 2AOSA 1HKKA 2M08A 1NMWA 4MPKA 3KABA 1YW5A 4WIWA 4N19A 2PV3A 4WK9A 1WMVA 4IQCA 4MNKA 1ZU8A 1HJVA 1UR8A 4DRQA 3NTPA 2YSGA 1TK7A 2DSUA 2KR7A 1E6NA 2QRVA 2YSHA 3WQWA 2EZ5W 1C9HA 1F40A 3B7XA 1ZBKA 1L1PA 1XRVA 5HWCA 4DWSC 2FKEA 1OGGA 5DITA 4DRIA 3CHFA 4G2PA 3AQUA 2DK7A 5U47A 1ZBVA 1HKIA 2DG9A 1ROTA 3RGCA 2OWOA 5HT1A 1Q6UA 3RFWA 2VCDA 4DRPA 4XAKA 1H0GA 3NI6A 4J4NA 2PV1A 3PQHA 1WR7A 3KAIA 4S3JA 3LUOA 2WM0A 4KQZA 4WKFA 3RM4A 3KAGA 1LL4A 4DRMA 4BF8A 1JNDA 4ZS6A 2DT0A 5HW6A 5I98A 4DRHA 3JYMA 2KXQA 2MF9A 3UI6A 1IX5A 3VAWA 3FSCA 4ODNA 3ARUA 1JMQA 1WAWA 3JYJA 1PBKA 3MQHA 2PI6A 1E6PA 1VF8A 3QOKA 4JFIA 3ARTA 5HW7A 1O6WA 2F21A 5GQBA 2JXWA 1HKJA 4TW7A 2A3CA 1EHNA 1EDQA 4ODMA 3IK8A 3FY1A 1LL6A 2FAPA 5E5WA 3ARPA 1KT1A 5HBFA 2OLHA 1K9QA 4IQ2A 5DIVA 1LL7A 4MSPA 4Z2KA 2L4JA 4DH0A 3UI4A 2KFWA 1E15A 4Z2IA 2RUCA 3PRBA 4TNSA 3ODKA 1J4IA 2YBTA 3O5IA 4ODLA 1OWQA 1KFWA 4U84A 1E6ZA 3W4RA 1CTNA 4J4OA 4WJXA 5E62A 3BXWA 1Q1CA 1FKIA 2JV4A 1QZ2A 1NH6A 3CH9A 1RD6A 4ODKA 2DK1A 3H9RB 2YAJB 4HARA 3PA7A 2F4EA 2UZ5A 2A3BA 1NWTA 1A7XA 4LAYA 2Q5AA 3WD1A 4W9PA 4TW6A 3FSBA 2MNTA 1N1AA 3O5GA 4MTVA 4P8UA 2ZR4A 3KZ7A 1D7IA 3MDYB 2WLZA 5HWBA 4Z2GA 4ZPVR 3PR9A 3ARWA 4ODQA 2XP4A 2MLXA 4NZCA 4QT3A 3O5LA 1X6NA 4MNJA 3ARRA 1H0IA 2D9FA 2LKNA 1W1VA 3ARYA 1YATA 5D75A 2XP6A 4O2TA 1WB0A 3TCZA 2ZQUA 2DG3A 4MGVA 3I6CA 5DO2A 3CHEA 3MCBB 1FD9A 3B9EA 2G8ZA 4R5EA 2M8IA 1LQ0A 3OA5A 3EY6A 4FAPA 3O5FA 3LKXB 1J4RA 5JH8A 3UF8A 1SR0A 1E9LA 3AS0A 3WKZA 2AWGA 4ZPWR 2JZVA 2IUZA 3MQGA 3JXVA 1E6RA 3AS1A 4NSBA 3B8SA 1FKHA 2E45A 2F2DA 4E5RA 2PPOA 4U86A 1ZBWA 2ZQVA 1HJXA 1T11A 3ARQA 3AS2A 2RUQA 5BXJA 2RQSA 1RP5A 1NMVA 2MLYA 4Q22A 2PPNA 3ARSA 3IKGA 2YBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LE4 A;  4U85 A;  3UQI A;  2IF4 A;  2XP9 A;  1K9Q A;  4IQ2 A;  3WH0 A;  3O5M A;  4NNR A;  2PBC A;  2YSF A;  4MSP A;  3M7N A;  2L4J A;  1R9H A;  4QT2 A;  1KT0 A;  1TCO C;  2KFW A;  2KE0 A;  3UI4 A;  4DH0 A;  1JVW A;  2XP7 A;  4REX A;  1QPF A;  2XP8 A;  2RUC A;  2Y78 A;  3IKD A;  3PRB A;  5CQ2 A;  3ODK A;  4ODP A;  4QIB A;  3UI5 A;  5HTG A;  2RUD A;  2DG4 A;  4LAX A;  1J4I A;  1FKK A;  1P5Q A;  4G50 A;  3O5I A;  4IPX A;  5HT1 A;  4JYS A;  1FKB A;  2M08 A;  4GIV A;  4TNS A;  1NMW A;  2JX8 A;  4ODL A;  1HXV A;  3KAB A;  2ZR6 A;  1YW5 A;  4U84 A;  5GPG A;  4DRJ A;  4J4O A;  2RE3 A;  1FKL A;  4N19 A;  2ZAJ A;  3IHZ A;  2PV3 A;  1QPL A;  1FKJ A;  3O5P A;  1WMV A;  1K9R A;  2DMV A;  4LAV A;  1F8A B;  1J4H A;  1Q1C A;  1Q6H A;  1FKI A;  2JV4 A;  1QZ2 A;  4IQC A;  2OFN A;  4FN2 A;  2ZQT A;  2M8J A;  4DRQ A;  4DZ2 A;  4ODK A;  2DK1 A;  3NTP A;  3H9R B;  2YSG A;  2VN1 A;  1TK7 A;  2KR7 A;  3PA7 A;  2JMF A;  2F4E A;  4DRN A;  3CNG A;  2UZ5 A;  4JFL A;  5DIV A;  4JFK A;  2LGO A;  2KO7 A;  1A7X A;  2RSE A;  2YSH A;  2EZ5 W;  1JNT A;  3UQB A;  2BA1 A;  4LAY A;  2Q5A A;  2ZR5 A;  1C9H A;  4TW6 A;  3B7X A;  1M5Y A;  1W26 A;  3O5E A;  4W9P A;  1EQ3 A;  1F40 A;  2MNT A;  1L1P A;  1BL4 A;  1N1A A;  1ZCN A;  5HWC A;  1B6C A;  3O5G A;  2ZR4 A;  3KZ7 A;  1D7I A;  2FKE A;  3MDY B;  5DIT A;  4DRI A;  4G2P A;  3CGM A;  5HWB A;  3PRD A;  3FAP A;  2LPV A;  2RUR A;  2DK7 A;  3KAC A;  3KAH A;  3OOB A;  2DG9 A;  1ROT A;  3RGC A;  4ODQ A;  1EG3 A;  1D7J A;  4LAW A;  2XP4 A;  2MLX A;  4TX0 A;  3O5K A;  3KAF A;  1Q6U A;  4QT3 A;  3O5L A;  2VCD A;  3O5R A;  5DIU A;  3RFW A;  4DRK A;  4TYO A;  4DRP A;  1PIN A;  3O5J A;  1ROU A;  4ITZ A;  3NI6 A;  3TC5 A;  2D9F A;  2LKN A;  2MPH A;  4J4N A;  2PV1 A;  3NRK A;  1YAT A;  1WR7 A;  5D75 A;  3KAI A;  2XP6 A;  3TDB A;  2M1I A;  2PPP A;  3CGN A;  4O2T A;  4R0X A;  4C02 B;  3TCZ A;  3LUO A;  3O5Q A;  2ZQU A;  2YSI A;  2DG3 A;  4JFJ A;  4MGV A;  5HKG A;  3O5O A;  3I6C A;  3KAG A;  1FJD A;  1JNS A;  2DJY A;  1FD9 A;  2XP3 A;  3UQA A;  4DRM A;  2XP5 A;  2DWV A;  4GGQ A;  4BF8 A;  4DZ3 A;  2M8I A;  3KAD A;  5HW6 A;  5I98 A;  4DRH A;  1EYM A;  1FAP A;  3L4H A;  3EY6 A;  3JYM A;  2KXQ A;  2MF9 A;  3O5F A;  3UI6 A;  4W9O A;  4FAP A;  3M85 A;  1J4R A;  3VAW A;  1ZK6 A;  2XPA A;  3UF8 A;  1FKD A;  2N87 A;  4ODN A;  1J6Y A;  2AWG A;  1EG4 A;  2M2A A;  1JMQ A;  3JYJ A;  2ZQS A;  1PBK A;  1Y0O A;  2M3O W;  2JZV A;  3JXV A;  4ODR A;  2ITK A;  4JFI A;  4JFM A;  5HW7 A;  4W9Q A;  1O6W A;  2F21 A;  1FKH A;  5J6E A;  2JXW A;  2K8I A;  2XPB A;  2E45 A;  4TW7 A;  2L2S A;  2F2D A;  4E5R A;  2LJ4 A;  2PPO A;  4U86 A;  2MLZ A;  2PV2 A;  4ODO A;  2ZQV A;  1U79 A;  2KI3 A;  1T11 A;  5AHT A;  1FKG A;  2LAJ A;  2MDI A;  2RUQ A;  4ODM A;  1FKF A;  4DT4 A;  5BXJ A;  5HUA A;  3KCE A;  3IK8 A;  1D7H A;  5B8I C;  1FKT A;  2RQS A;  1BKF A;  2FAP A;  1NMV A;  4DRO A;  2MLY A;  5HW8 A;  1NSG A;  2KGJ A;  4DIP A;  3GPK A;  2PPN A;  3O5D A;  3IKG A;  4TW8 A;  1FKR A;  1I5H W;  1FKS A;  1KT1 A;  2YSB A;  1D6O A;  1Q6I A; 
#chains in the Genus database with same CATH topology
 2ETN A;  1GOI A;  2IF4 A;  4PTM A;  4NNR A;  3RM9 A;  4A0T A;  3M7N A;  3WD4 A;  4P8W A;  1GRJ A;  4REX A;  2XP8 A;  1TFV A;  3WD2 A;  2FDM A;  4ODP A;  4MNM A;  1FKK A;  1P5Q A;  1FKB A;  1ITX A;  4GIV A;  2JX8 A;  1K9T A;  2A3E A;  2ZR6 A;  4IT4 A;  2RE3 A;  3AS3 A;  3IHZ A;  2G41 A;  4L3N A;  1NWU A;  4HBE A;  4P8X A;  3O5P A;  3LKX A;  1FFQ A;  1F8A B;  1Q6H A;  3WL1 A;  4DWS D;  4FN2 A;  2DPE A;  2M8J A;  4DZ2 A;  1W1Y A;  2VN1 A;  4DRN A;  2DSW A;  3RM8 A;  2RSE A;  1JNT A;  2ZR5 A;  1EQ3 A;  1W26 A;  1ZCN A;  4Z2L A;  1LJY A;  3CGM A;  3PRD A;  3FAP A;  1NWS A;  3KAC A;  2DT1 A;  3OOB A;  3PRA A;  5E64 A;  4TX0 A;  2WAD A;  3O5R A;  4TYO A;  4ZPT R;  3RME A;  3O5J A;  4LGX A;  1HJW A;  4DWS B;  2MPH A;  1O6I A;  2PPP A;  4R0X A;  1ZL1 A;  3FXY A;  3O5Q A;  2YSI A;  4JFJ A;  3O5O A;  4ML4 A;  4HBO A;  1FJD A;  2DJY A;  3UQA A;  4S3K A;  2O92 A;  1LG2 A;  2XPA A;  1FKD A;  2DSZ A;  3WD3 A;  1GUV A;  5DF0 A;  1J6Y A;  1EIB A;  1Y0O A;  3CHD A;  4L72 B;  4GLX A;  1ZB5 A;  3WD0 A;  4JFM A;  4W9Q A;  2Y8N B;  3ARX A;  4DT4 A;  2L2S A;  2MLZ A;  1U79 A;  2KI3 A;  1W9U A;  1FKG A;  2DT3 A;  4MAV A;  3BMB A;  1FKF A;  3KCE A;  4AY1 A;  1FKT A;  2WLY A;  3G6L A;  1BKF A;  3ARO A;  4DRO A;  3GPK A;  2DSV A;  3ALG A;  3WIJ A;  2ESC A;  1D6O A;  1HKM A;  3LE4 A;  3UQI A;  2YSF A;  4KR0 B;  5DEZ A;  1KT0 A;  2KE0 A;  1JVW A;  1QPF A;  4Z2H A;  2Y78 A;  3IKD A;  5CQ2 A;  2A3A A;  5HTG A;  2DG4 A;  1LG1 A;  4JYS A;  1HXV A;  3ARZ A;  4IT6 A;  1WNO A;  5GPG A;  3ALF A;  1FKL A;  4QZV B;  2ZAJ A;  4P8V A;  1QPL A;  1FKJ A;  3CHC A;  4LAV A;  1K9R A;  2DMV A;  3B9D A;  1J4H A;  2OFN A;  2ZQT A;  2WAE A;  2EUL A;  1W1T A;  3WQV A;  2DT2 A;  2JMF A;  2WK2 A;  3CNG A;  4JFL A;  5E66 A;  4JFK A;  1SYT A;  2LGO A;  2KO7 A;  2BA1 A;  1FLC A;  1JNS A;  1M5Y A;  3O5E A;  1BL4 A;  1B6C A;  1TR8 A;  2B31 A;  2LPV A;  2RUR A;  2O9O A;  1W9V A;  3KAH A;  3MCB A;  1X6L A;  1EG3 A;  1D7J A;  1JNE A;  4LAW A;  5DIU A;  3O5K A;  3KAF A;  3G6M A;  1UR9 A;  4DRK A;  1PIN A;  1ROU A;  4ITZ A;  1XHG A;  3TC5 A;  1NWR A;  3NRK A;  4A0U A;  4C02 B;  3TDB A;  2M1I A;  4Q7N A;  4DRJ A;  3CGN A;  5HKG A;  2P4V A;  1FFR A;  1ZBC A;  2XP3 A;  2XP5 A;  2DWV A;  4GGQ A;  3EIP A;  4DZ3 A;  4Z2J A;  3KAD A;  3UQB A;  1EYM A;  1FAP A;  3L4H A;  4UDM A;  4W5U A;  4W9O A;  3M85 A;  1ZK6 A;  1OGB A;  5GPR A;  2N87 A;  1EG4 A;  2M2A A;  4URI A;  5E65 A;  2ZQS A;  2M3O W;  4ODR A;  1JCH B;  2ITK A;  5J6E A;  2K8I A;  4DWS A;  2XPB A;  2LJ4 A;  2PV2 A;  4MNL A;  4ODO A;  3FS8 A;  1W9P A;  3ARV A;  5AHT A;  2LAJ A;  2MDI A;  3B9A A;  5HUA A;  4WKH A;  3CZ8 A;  1D7H A;  3WL0 A;  5B8I C;  5HW8 A;  1NSG A;  2KGJ A;  4DIP A;  1FKR A;  3O5D A;  4TW8 A;  1I5H W;  1FKS A;  2YSB A;  1Q6I A;  4U85 A;  1D2K A;  2XP9 A;  3WH0 A;  3O5M A;  4QT2 A;  2PBC A;  1R9H A;  2QF8 A;  1TCO C;  1GPF A;  2XP7 A;  1W1P A;  3UI5 A;  4QIB A;  2RUD A;  4LAX A;  4G50 A;  4WKA A;  4IPX A;  2AOS A;  1HKK A;  2M08 A;  1NMW A;  4MPK A;  3KAB A;  1YW5 A;  4WIW A;  4N19 A;  2PV3 A;  4WK9 A;  1WMV A;  4IQC A;  4MNK A;  1ZU8 A;  1HJV A;  1UR8 A;  4DRQ A;  3NTP A;  2YSG A;  1TK7 A;  2DSU A;  2KR7 A;  1E6N A;  2QRV A;  2YSH A;  3WQW A;  2EZ5 W;  1C9H A;  1F40 A;  3B7X A;  1ZBK A;  1L1P A;  1XRV A;  5HWC A;  2F23 A;  4DWS C;  2FKE A;  1OGG A;  5DIT A;  4DRI A;  3CHF A;  4G2P A;  3AQU A;  2DK7 A;  5U47 A;  1ZBV A;  1HKI A;  2DG9 A;  1ROT A;  3RGC A;  2OWO A;  5HT1 A;  1Q6U A;  3RFW A;  2VCD A;  4DRP A;  4XAK A;  1H0G A;  3NI6 A;  4J4N A;  2PV1 A;  3PQH A;  1WR7 A;  3KAI A;  4S3J A;  3LUO A;  2WM0 A;  4KQZ A;  4WKF A;  3RM4 A;  3KAG A;  1LL4 A;  4DRM A;  4BF8 A;  1JND A;  4ZS6 A;  2DT0 A;  5HW6 A;  5I98 A;  4DRH A;  3JYM A;  2KXQ A;  2MF9 A;  3UI6 A;  1IX5 A;  3VAW A;  3FSC A;  3GU0 A;  4ODN A;  3ARU A;  1JMQ A;  1WAW A;  3JYJ A;  1PBK A;  3MQH A;  2PI6 A;  1E6P A;  1VF8 A;  3QOK A;  4JFI A;  3ART A;  5HW7 A;  1O6W A;  2F21 A;  5GQB A;  2JXW A;  1HKJ A;  4TW7 A;  2A3C A;  1EHN A;  1EDQ A;  4ODM A;  3IK8 A;  2B5U B;  3FY1 A;  1LL6 A;  2FAP A;  5E5W A;  3ARP A;  1KT1 A;  5HBF A;  2OLH A;  1K9Q A;  4IQ2 A;  5DIV A;  1LL7 A;  4MSP A;  4Z2K A;  2L4J A;  4DH0 A;  3UI4 A;  2KFW A;  1E15 A;  4Z2I A;  2RUC A;  3PRB A;  4TNS A;  3ODK A;  1J4I A;  2YBT A;  3O5I A;  4ODL A;  1OWQ A;  1KFW A;  4U84 A;  1E6Z A;  3W4R A;  1CTN A;  4J4O A;  4WJX A;  5E62 A;  3BXW A;  1Q1C A;  1FKI A;  2JV4 A;  1QZ2 A;  1NH6 A;  3CH9 A;  2PN0 A;  1RD6 A;  4ODK A;  2DK1 A;  3H9R B;  2YAJ B;  4HAR A;  3PA7 A;  2F4E A;  2UZ5 A;  2A3B A;  1NWT A;  1A7X A;  4LAY A;  2Q5A A;  3WD1 A;  4W9P A;  4TW6 A;  3FSB A;  2MNT A;  1N1A A;  3O5G A;  4MTV A;  4P8U A;  2ZR4 A;  3KZ7 A;  1D7I A;  3MDY B;  2WLZ A;  5HWB A;  4Z2G A;  4ZPV R;  3PR9 A;  3ARW A;  4ODQ A;  2XP4 A;  2MLX A;  4NZC A;  4QT3 A;  3O5L A;  1X6N A;  4MNJ A;  3ARR A;  1H0I A;  2D9F A;  2LKN A;  1W1V A;  3ARY A;  1YAT A;  5D75 A;  2XP6 A;  4O2T A;  1WB0 A;  3TCZ A;  2ZQU A;  2DG3 A;  4MGV A;  3I6C A;  5DO2 A;  3CHE A;  3MCB B;  1FD9 A;  3B9E A;  2G8Z A;  4R5E A;  2M8I A;  1LQ0 A;  3OA5 A;  3EY6 A;  4FAP A;  3O5F A;  3LKX B;  1J4R A;  1E44 A;  5JH8 A;  3UF8 A;  1SR0 A;  1E9L A;  3GTY X;  3AS0 A;  3WKZ A;  2AWG A;  4ZPW R;  2JZV A;  2IUZ A;  3MQG A;  3JXV A;  1E6R A;  3AS1 A;  4NSB A;  3B8S A;  1FKH A;  2E45 A;  2F2D A;  4E5R A;  2PPO A;  4U86 A;  1ZBW A;  2ZQV A;  1HJX A;  1T11 A;  3ARQ A;  3AS2 A;  2RUQ A;  5BXJ A;  2RQS A;  1RP5 A;  1NMV A;  2MLY A;  4Q22 A;  2PPN A;  3ARS A;  3IKG A;  2YBU A; 
#chains in the Genus database with same CATH homology
 1GOI A;  2IF4 A;  4PTM A;  4NNR A;  3RM9 A;  4A0T A;  3M7N A;  3WD4 A;  4P8W A;  4REX A;  2XP8 A;  1TFV A;  3WD2 A;  2FDM A;  4ODP A;  4MNM A;  1FKK A;  1P5Q A;  1FKB A;  1ITX A;  4GIV A;  2JX8 A;  1K9T A;  2A3E A;  2ZR6 A;  4IT4 A;  2RE3 A;  3AS3 A;  3IHZ A;  2G41 A;  4L3N A;  1NWU A;  4HBE A;  4P8X A;  3O5P A;  3LKX A;  1FFQ A;  1F8A B;  1Q6H A;  3WL1 A;  4DWS D;  4FN2 A;  2DPE A;  2M8J A;  4DZ2 A;  1W1Y A;  2VN1 A;  4DRN A;  2DSW A;  3RM8 A;  2RSE A;  1JNT A;  2ZR5 A;  1EQ3 A;  1W26 A;  1ZCN A;  4Z2L A;  1LJY A;  3CGM A;  3PRD A;  3FAP A;  1NWS A;  3KAC A;  2DT1 A;  3OOB A;  3PRA A;  5E64 A;  4TX0 A;  2WAD A;  3O5R A;  4TYO A;  4ZPT R;  3RME A;  3O5J A;  4LGX A;  1HJW A;  4DWS B;  2MPH A;  1O6I A;  2PPP A;  4R0X A;  1ZL1 A;  3FXY A;  3O5Q A;  2YSI A;  4JFJ A;  3O5O A;  4ML4 A;  4HBO A;  1FJD A;  2DJY A;  3UQA A;  4S3K A;  2O92 A;  1LG2 A;  2XPA A;  1FKD A;  2DSZ A;  3WD3 A;  1GUV A;  5DF0 A;  1J6Y A;  1EIB A;  1Y0O A;  3CHD A;  4L72 B;  4GLX A;  1ZB5 A;  3WD0 A;  4JFM A;  4W9Q A;  2Y8N B;  3ARX A;  4DT4 A;  2L2S A;  2MLZ A;  1U79 A;  2KI3 A;  1W9U A;  1FKG A;  2DT3 A;  4MAV A;  1FKF A;  3KCE A;  4AY1 A;  1FKT A;  2WLY A;  3G6L A;  1BKF A;  3ARO A;  4DRO A;  3GPK A;  2DSV A;  3ALG A;  3WIJ A;  2ESC A;  1D6O A;  1HKM A;  3LE4 A;  3UQI A;  2YSF A;  4KR0 B;  5DEZ A;  1KT0 A;  2KE0 A;  1JVW A;  1QPF A;  4Z2H A;  2Y78 A;  3IKD A;  5CQ2 A;  2A3A A;  5HTG A;  2DG4 A;  1LG1 A;  4JYS A;  1HXV A;  3ARZ A;  4IT6 A;  1WNO A;  5GPG A;  3ALF A;  1FKL A;  4QZV B;  2ZAJ A;  4P8V A;  1QPL A;  1FKJ A;  3CHC A;  4LAV A;  1K9R A;  2DMV A;  3B9D A;  1J4H A;  2OFN A;  2ZQT A;  2WAE A;  1W1T A;  3WQV A;  2DT2 A;  2JMF A;  2WK2 A;  3CNG A;  4JFL A;  5E66 A;  4JFK A;  1SYT A;  2LGO A;  2KO7 A;  2BA1 A;  1FLC A;  1JNS A;  1M5Y A;  3O5E A;  1BL4 A;  1B6C A;  1TR8 A;  2B31 A;  2LPV A;  2RUR A;  2O9O A;  1W9V A;  3KAH A;  3MCB A;  1X6L A;  1EG3 A;  1D7J A;  1JNE A;  4LAW A;  5DIU A;  3O5K A;  3KAF A;  3G6M A;  1UR9 A;  4DRK A;  1PIN A;  1ROU A;  4ITZ A;  1XHG A;  3TC5 A;  1NWR A;  3NRK A;  4A0U A;  4C02 B;  3TDB A;  2M1I A;  4Q7N A;  4DRJ A;  3CGN A;  5HKG A;  1FFR A;  1ZBC A;  2XP3 A;  2XP5 A;  2DWV A;  4GGQ A;  4DZ3 A;  4Z2J A;  3UQB A;  3KAD A;  1EYM A;  1FAP A;  3L4H A;  4W5U A;  4W9O A;  3M85 A;  1ZK6 A;  1OGB A;  5GPR A;  2N87 A;  1EG4 A;  2M2A A;  4URI A;  5E65 A;  2ZQS A;  2M3O W;  4ODR A;  2ITK A;  5J6E A;  2K8I A;  4DWS A;  2XPB A;  2LJ4 A;  2PV2 A;  4MNL A;  4ODO A;  3FS8 A;  1W9P A;  3ARV A;  5AHT A;  2LAJ A;  2MDI A;  3B9A A;  5HUA A;  4WKH A;  3CZ8 A;  1D7H A;  3WL0 A;  5B8I C;  5HW8 A;  1NSG A;  2KGJ A;  4DIP A;  1FKR A;  3O5D A;  4TW8 A;  1I5H W;  1FKS A;  2YSB A;  1Q6I A;  4U85 A;  1D2K A;  2XP9 A;  3WH0 A;  3O5M A;  4QT2 A;  2PBC A;  1R9H A;  2QF8 A;  1TCO C;  1GPF A;  2XP7 A;  1W1P A;  3UI5 A;  4QIB A;  2RUD A;  4LAX A;  4G50 A;  4WKA A;  4IPX A;  2AOS A;  1HKK A;  2M08 A;  1NMW A;  4MPK A;  3KAB A;  1YW5 A;  4WIW A;  4N19 A;  2PV3 A;  4WK9 A;  1WMV A;  4IQC A;  4MNK A;  1ZU8 A;  1HJV A;  1UR8 A;  4DRQ A;  3NTP A;  2YSG A;  1TK7 A;  2DSU A;  2KR7 A;  1E6N A;  2QRV A;  2YSH A;  3WQW A;  2EZ5 W;  1C9H A;  1F40 A;  3B7X A;  1ZBK A;  1L1P A;  1XRV A;  5HWC A;  4DWS C;  2FKE A;  1OGG A;  5DIT A;  4DRI A;  3CHF A;  4G2P A;  3AQU A;  2DK7 A;  5U47 A;  1ZBV A;  1HKI A;  2DG9 A;  1ROT A;  3RGC A;  2OWO A;  5HT1 A;  1Q6U A;  3RFW A;  2VCD A;  4DRP A;  4XAK A;  1H0G A;  3NI6 A;  4J4N A;  2PV1 A;  3PQH A;  1WR7 A;  3KAI A;  4S3J A;  3LUO A;  2WM0 A;  4KQZ A;  4WKF A;  3RM4 A;  3KAG A;  1LL4 A;  4DRM A;  4BF8 A;  1JND A;  4ZS6 A;  2DT0 A;  5HW6 A;  5I98 A;  4DRH A;  3JYM A;  2KXQ A;  2MF9 A;  3UI6 A;  1IX5 A;  3VAW A;  3FSC A;  4ODN A;  3ARU A;  1JMQ A;  1WAW A;  3JYJ A;  1PBK A;  3MQH A;  2PI6 A;  1E6P A;  1VF8 A;  3QOK A;  4JFI A;  3ART A;  5HW7 A;  1O6W A;  2F21 A;  5GQB A;  2JXW A;  1HKJ A;  4TW7 A;  2A3C A;  1EHN A;  1EDQ A;  4ODM A;  3IK8 A;  3FY1 A;  1LL6 A;  2FAP A;  5E5W A;  3ARP A;  1KT1 A;  5HBF A;  2OLH A;  1K9Q A;  4IQ2 A;  5DIV A;  1LL7 A;  4MSP A;  4Z2K A;  2L4J A;  4DH0 A;  3UI4 A;  2KFW A;  1E15 A;  4Z2I A;  2RUC A;  3PRB A;  4TNS A;  3ODK A;  1J4I A;  2YBT A;  3O5I A;  4ODL A;  1OWQ A;  1KFW A;  4U84 A;  1E6Z A;  3W4R A;  1CTN A;  4J4O A;  4WJX A;  5E62 A;  3BXW A;  1Q1C A;  1FKI A;  2JV4 A;  1QZ2 A;  1NH6 A;  3CH9 A;  1RD6 A;  4ODK A;  2DK1 A;  3H9R B;  2YAJ B;  4HAR A;  3PA7 A;  2F4E A;  2UZ5 A;  2A3B A;  1NWT A;  1A7X A;  4LAY A;  2Q5A A;  3WD1 A;  4W9P A;  4TW6 A;  3FSB A;  2MNT A;  1N1A A;  3O5G A;  4MTV A;  4P8U A;  2ZR4 A;  3KZ7 A;  1D7I A;  3MDY B;  2WLZ A;  5HWB A;  4Z2G A;  4ZPV R;  3PR9 A;  3ARW A;  4ODQ A;  2XP4 A;  2MLX A;  4NZC A;  4QT3 A;  3O5L A;  1X6N A;  4MNJ A;  3ARR A;  1H0I A;  2D9F A;  2LKN A;  1W1V A;  3ARY A;  1YAT A;  5D75 A;  2XP6 A;  4O2T A;  1WB0 A;  3TCZ A;  2ZQU A;  2DG3 A;  4MGV A;  3I6C A;  5DO2 A;  3CHE A;  3MCB B;  1FD9 A;  3B9E A;  2G8Z A;  4R5E A;  2M8I A;  1LQ0 A;  3OA5 A;  3EY6 A;  4FAP A;  3O5F A;  3LKX B;  1J4R A;  5JH8 A;  3UF8 A;  1SR0 A;  1E9L A;  3AS0 A;  3WKZ A;  2AWG A;  4ZPW R;  2JZV A;  2IUZ A;  3MQG A;  3JXV A;  1E6R A;  3AS1 A;  4NSB A;  3B8S A;  1FKH A;  2E45 A;  2F2D A;  4E5R A;  2PPO A;  4U86 A;  1ZBW A;  2ZQV A;  1HJX A;  1T11 A;  3ARQ A;  3AS2 A;  2RUQ A;  5BXJ A;  2RQS A;  1RP5 A;  1NMV A;  2MLY A;  4Q22 A;  2PPN A;  3ARS A;  3IKG A;  2YBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...