2ZR5A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVAHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 44
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr5A02
5HW8A 2JMFA 3JXVA 4W9PA 1YATA 3TC5A 2RURA 1FKIA 2M2AA 4JFJA 1B6CA 2KGJA 4DRNA 1ROTA 1ZCNA 4DH0A 2KXQA 2KO7A 1I5HW 2XP3A 1EYMA 2DK1A 4J4OA 3O5IA 2PPPA 2RQSA 4DRKA 4DRQA 4REXA 2E45A 1T11A 2DMVA 1ZK6A 5I98A 2Y78A 2RE3A 3O5OA 4MGVA 2LKNA 1NMWA 5CQ2A 4FAPA 2MPHA 4LAYA 3RFWA 2ZQSA 2D9FA 4DRHA 2RSEA 4TW8A 2PV3A 3UI6A 1JMQA 3NTPA 2PV2A 3IK8A 3LE4A 2KFWA 1W26A 1D7HA 1Q6IA 4ODKA 5HW6A 1FKHA 2LPVA 3NRKA 4ODMA 2F21A 4JFKA 2L4JA 5J6EA 3KAGA 2UZ5A 3MDYB 4U86A 3TDBA 2XP4A 2XP9A 2PPOA 2N87A 1J4IA 2F2DA 2XP5A 2RUCA 2JV4A 1Y0OA 3FAPA 3NI6A 4JFLA 3EY6A 4R0XA 3KAIA 4DRPA 1K9RA 3H9RB 4G50A 3M7NA 2AWGA 4IQCA 4ODOA 2M8JA 1M5YA 1Q1CA 2YSIA 3PRBA 4LAVA 4LAWA 2DG3A 2IF4A 1FKSA 4DIPA 4JFMA 3ODKA 2ZQTA 1FKRA 1JNSA 1YW5A 1NSGA 3JYMA 3JYJA 2ITKA 1FKDA 4FN2A 2OFNA 2Q5AA 4O2TA 2YSGA 1FKLA 5DIUA 1D7JA 1HXVA 2RUQA 5HTGA 2M8IA 1P5QA 2JXWA 3IHZA 3O5MA 3CNGA 3B7XA 4G2PA 5HUAA 1PINA 3UI4A 3GPKA 1NMVA 1Q6UA 2ZQUA 4GGQA 2YSHA 2F4EA 2KR7A 5HWBA 2XP6A 2M1IA 3VAWA 4J4NA 1FKBA 3UF8A 2XPBA 2PV1A 1EG4A 1D7IA 5BXJA 1R9HA 2YSBA 4W9OA 3KAFA 1FKGA 2ZR5A 1FKJA 1EG3A 5GPGA 1KT1A 3PRDA 1D6OA 3CGMA 1F8AB 3KABA 3UI5A 3O5KA 1K9QA 3IKGA 2PPNA 2ZQVA 4QT3A 2EZ5W 2KE0A 1WMVA 4E5RA 1JNTA 1FKKA 2VCDA 3RGCA 4IPXA 3O5QA 5DIVA 1ROUA 1FAPA 4MSPA 4U85A 5D75A 4U84A 2VN1A 4DZ2A 4DRMA 3TCZA 1TCOC 4NNRA 2DK7A 4GIVA 4DT4A 1JVWA 2DJYA 1QPFA 2DWVA 2L2SA 2PBCA 2XP7A 3KCEA 2MLXA 2KI3A 3KADA 2MLZA 2FAPA 4W9QA 2JZVA 4TW6A 4TNSA 2XP8A 2XPAA 1Q6HA 3IKDA 4QIBA 1N1AA 1EQ3A 1F40A 1KT0A 3O5FA 3LUOA 4ODQA 2M3OW 5HWCA 1QZ2A 3CGNA 3M85A 2MDIA 4ODLA 1O6WA 2DG4A 3O5JA 5B8IC 2ZR6A 1BL4A 3PA7A 3O5GA 2LGOA 1J6YA 4N19A 2MLYA 3UQBA 1FJDA 1WR7A 2ZR4A 1J4HA 5AHTA 5DITA 3KACA 1PBKA 1QPLA 2RUDA 1L1PA 3I6CA 4TX0A 1U79A 3WH0A 4BF8A 5HW7A 3OOBA 3O5DA 2BA1A 4JYSA 4ODRA 4DZ3A 4ITZA 4JFIA 4DRIA 1TK7A 1FD9A 3O5LA 4TYOA 3KAHA 4DROA 1BKFA 2MF9A 2DG9A 3KZ7A 1FKTA 5HKGA 4IQ2A 3UQAA 1FKFA 4LAXA 3L4HA 2K8IA 3O5EA 5HT1A 4C02B 3O5RA 2LAJA 2LJ4A 1J4RA 2M08A 1C9HA 4ODNA 2JX8A 3O5PA 2MNTA 4QT2A 4ODPA 4TW7A 1A7XA 4DRJA 3UQIA 2FKEA 2ZAJA 2YSFA
chains in the Genus database with same CATH superfamily
5HW8A 1SYTA 3AS1A 4ZPVR 2JMFA 3JXVA 4W9PA 1YATA 2O92A 3TC5A 4MTVA 3WD2A 3LKXA 3MQHA 2RURA 3B9AA 4L3NA 4MNKA 1FKIA 2M2AA 4JFJA 1ZB5A 1B6CA 1E44A 2KGJA 4DRNA 1ROTA 1E15A 1LG1A 1ZCNA 4DH0A 3WD3A 4GLXA 2KXQA 2KO7A 1W9UA 1I5HW 2XP3A 4DWSB 4A0TA 4DWSD 1EYMA 4DWSC 1CTNA 4A0UA 1LJYA 2DK1A 2FDMA 1E9LA 4J4OA 3O5IA 2PPPA 2RQSA 4W5UA 4DRKA 4DWSA 1HJVA 4DRQA 3WL1A 4REXA 1JNDA 2E45A 1EIBA 2A3CA 4Q7NA 1T11A 1WB0A 2DMVA 3CZ8A 1ZK6A 5I98A 2DSUA 2Y8NB 1TFVA 2Y78A 2RE3A 3O5OA 2A3AA 1ZU8A 4MGVA 2LKNA 1NMWA 1FFQA 1HJWA 5CQ2A 4FAPA 2MPHA 3WQWA 4LAYA 3CHCA 3WQVA 3RFWA 2ZQSA 2D9FA 4DRHA 2RSEA 4TW8A 2PV3A 3UI6A 3CHDA 2QRVA 1JMQA 3NTPA 2PV2A 3IK8A 3LE4A 3ARXA 2KFWA 1W26A 1D7HA 4WKHA 1ZL1A 1Q6IA 4ODKA 5HW6A 4IT6A 1FKHA 1NWRA 4S3KA 4AY1A 2LPVA 1LL4A 2WADA 3NRKA 4ODMA 2F21A 4JFKA 2L4JA 1HJXA 1HKMA 1X6NA 5J6EA 3ARVA 3KAGA 2UZ5A 4WKFA 1ZBCA 3ARZA 1LG2A 2WM0A 3MDYB 2AOSA 4U86A 3WIJA 3TDBA 2XP4A 2XP9A 3G6LA 4P8UA 2WAEA 2PPOA 1HKKA 2N87A 3ALGA 1J4IA 2F2DA 3B8SA 3EIPA 2XP5A 5E65A 2RUCA 2JV4A 1Y0OA 3FAPA 3NI6A 4JFLA 3EY6A 1NWSA 4P8XA 4R0XA 3KAIA 4Z2HA 4DRPA 1H0IA 1K9RA 3H9RB 4G50A 3M7NA 2AWGA 4IQCA 3PRAA 3ARRA 4L72B 4ODOA 3B9EA 4XAKA 2M8JA 1W9PA 1M5YA 1Q1CA 2YSIA 3PRBA 4LAVA 4LAWA 1NH6A 2DG3A 3MQGA 2G8ZA 2IF4A 1FKSA 3BMBA 4DIPA 4JFMA 3ODKA 1GOIA 1W1PA 2ZQTA 4WIWA 1XRVA 1FKRA 1UR9A 4ZPWR 4KR0B 1JNSA 3G6MA 1YW5A 1NSGA 1IX5A 3JYMA 3BXWA 4MAVA 3JYJA 2ITKA 1FKDA 2DT2A 4FN2A 2OFNA 3OA5A 2Q5AA 2YAJB 5E5WA 1W9VA 4O2TA 3ARYA 1EHNA 2YSGA 1FKLA 1WAWA 5DIUA 2YBTA 1D7JA 1HXVA 3ARQA 3ARSA 2RUQA 2QF8A 1GPFA 5HTGA 2M8IA 1P5QA 2JXWA 3IHZA 3O5MA 3CNGA 3B7XA 5DF0A 4G2PA 5HUAA 2B5UB 1KFWA 1VF8A 1PINA 1FLCA 3UI4A 3GPKA 1NMVA 4PTMA 1Q6UA 3W4RA 2ESCA 3WD1A 1OGBA 3ALFA 4ZS6A 4Z2IA 2ZQUA 4GGQA 2YSHA 1LL7A 2F4EA 2DPEA 2KR7A 4WJXA 5DO2A 5HWBA 2XP6A 2M1IA 3VAWA 1X6LA 4J4NA 4WKAA 4ZPTR 1FKBA 2XPBA 2PN0A 4IT4A 3UF8A 2PV1A 1EG4A 1D7IA 1E6ZA 5BXJA 1R9HA 2YSBA 3AS3A 4W9OA 3KAFA 1FKGA 2F23A 2ZR5A 1FKJA 1EG3A 1D2KA 1KT1A 3PRDA 1D6OA 3CGMA 5GPGA 1F8AB 3KABA 3CHEA 3UI5A 2G41A 3O5KA 1K9QA 1GRJA 1NWTA 2PPNA 3IKGA 2ZQVA 4HBEA 1ZBVA 4MNMA 2EZ5W 4QT3A 2KE0A 1E6PA 2A3EA 2EULA 1WMVA 4HARA 4E5RA 1EDQA 1JNTA 1FKKA 2VCDA 3ARTA 3RGCA 1ITXA 4IPXA 1E6RA 2WLZA 3O5QA 5DIVA 2ETNA 4HBOA 3WKZA 1ROUA 1FAPA 4MSPA 4U85A 2DSWA 5D75A 4U84A 5U47A 2DT0A 3RM4A 2VN1A 4Z2KA 4DZ2A 3PR9A 1W1YA 4DRMA 3TCZA 1TCOC 4Q22A 4NNRA 3GTYX 3RM9A 3ARUA 2DK7A 4GIVA 1W1VA 3RMEA 4DT4A 4ML4A 4MPKA 1JVWA 1HKIA 3ARPA 2OLHA 2DJYA 1QPFA 2DWVA 1ZBKA 2WK2A 2L2SA 2PBCA 2XP7A 1FFRA 3KCEA 2MLXA 1RP5A 2KI3A 3KADA 4UDMA 4WK9A 2MLZA 3FS8A 2FAPA 4W9QA 2JZVA 2DT1A 5E64A 4TW6A 4R5EA 4TNSA 4S3JA 3WD4A 2XP8A 2PI6A 2XPAA 4LGXA 4MNLA 4MNJA 5E62A 1Q6HA 2DSVA 3IKDA 1HKJA 3QOKA 5GPRA 4QIBA 1N1AA 1EQ3A 1F40A 1KT0A 1ZBWA 3O5FA 1H0GA 3FXYA 3LUOA 5JH8A 4ODQA 2M3OW 2IUZA 5HWCA 1QZ2A 3M85A 3CGNA 4QZVB 2MDIA 3PQHA 3AS2A 4ODLA 1O6WA 2DG4A 3O5JA 5B8IC 2ZR6A 1BL4A 3PA7A 3O5GA 2LGOA 1J6YA 2A3BA 4N19A 3WD0A 2MLYA 2OWOA 4NSBA 3MCBB 3UQBA 1FJDA 1WR7A 2ZR4A 1RD6A 1J4HA 5AHTA 5DITA 3KACA 2B31A 1PBKA 1QPLA 3WL0A 2DT3A 2RUDA 1L1PA 3I6CA 4TX0A 1U79A 4URIA 5E66A 3CH9A 2WLYA 3WH0A 4BF8A 4KQZA 5HW7A 2P4VA 3MCBA 1OGGA 3OOBA 3O5DA 2BA1A 4JYSA 4ODRA 4DZ3A 4ITZA 3CHFA 4JFIA 4DRIA 1TK7A 1JNEA 3RM8A 2YBUA 2O9OA 1FD9A 3O5LA 4Z2JA 4TYOA 3KAHA 1UR8A 1SR0A 4P8WA 1XHGA 3FSBA 4DROA 1OWQA 1BKFA 2MF9A 2DG9A 3KZ7A 1FKTA 5HKGA 3FSCA 4Z2LA 4IQ2A 3UQAA 1FKFA 2DSZA 1LQ0A 5GQBA 3B9DA 4P8VA 1GUVA 1TR8A 4LAXA 3L4HA 5DEZA 3GU0A 2K8IA 3O5EA 3AS0A 5HT1A 5HBFA 1K9TA 3FY1A 4C02B 3O5RA 2LAJA 2LJ4A 1J4RA 2M08A 1C9HA 1LL6A 4ODNA 2JX8A 3O5PA 1WNOA 1NWUA 1W1TA 1E6NA 2MNTA 1JCHB 4NZCA 4QT2A 4ODPA 3AROA 3LKXB 3AQUA 4TW7A 1A7XA 4DRJA 3UQIA 1O6IA 4Z2GA 2FKEA 2ZAJA 3ARWA 2YSFA
chains in the Genus database with same CATH topology
5HW8A 1SYTA 3AS1A 4ZPVR 2JMFA 3JXVA 4W9PA 1YATA 2O92A 3TC5A 4MTVA 3WD2A 3LKXA 3MQHA 2RURA 3B9AA 4L3NA 4MNKA 1FKIA 2M2AA 4JFJA 1ZB5A 1B6CA 2KGJA 4DRNA 1ROTA 1E15A 1LG1A 1ZCNA 4DH0A 3WD3A 4GLXA 2KXQA 2KO7A 1W9UA 1I5HW 2XP3A 4DWSB 4A0TA 4DWSD 1EYMA 4DWSC 1CTNA 4A0UA 1LJYA 2DK1A 2FDMA 1E9LA 4J4OA 3O5IA 2PPPA 2RQSA 4W5UA 4DRKA 4DWSA 1HJVA 4DRQA 3WL1A 4REXA 1JNDA 2E45A 1EIBA 2A3CA 4Q7NA 1T11A 1WB0A 2DMVA 3CZ8A 1ZK6A 5I98A 2DSUA 2Y8NB 1TFVA 2Y78A 2RE3A 3O5OA 2A3AA 1ZU8A 4MGVA 2LKNA 1NMWA 1FFQA 1HJWA 5CQ2A 4FAPA 2MPHA 3WQWA 4LAYA 3CHCA 3WQVA 3RFWA 2ZQSA 2D9FA 4DRHA 2RSEA 4TW8A 2PV3A 3UI6A 3CHDA 2QRVA 1JMQA 3NTPA 2PV2A 3IK8A 3LE4A 3ARXA 2KFWA 1W26A 1D7HA 4WKHA 1ZL1A 1Q6IA 4ODKA 5HW6A 4IT6A 1FKHA 1NWRA 4S3KA 4AY1A 2LPVA 1LL4A 2WADA 3NRKA 4ODMA 2F21A 4JFKA 2L4JA 1HJXA 1HKMA 1X6NA 5J6EA 3ARVA 3KAGA 2UZ5A 4WKFA 1ZBCA 3ARZA 1LG2A 2WM0A 3MDYB 2AOSA 4U86A 3WIJA 3TDBA 2XP4A 2XP9A 3G6LA 4P8UA 2WAEA 2PPOA 1HKKA 2N87A 3ALGA 1J4IA 2F2DA 3B8SA 2XP5A 5E65A 2RUCA 2JV4A 1Y0OA 3FAPA 3NI6A 4JFLA 3EY6A 1NWSA 4P8XA 4R0XA 3KAIA 4Z2HA 4DRPA 1H0IA 1K9RA 3H9RB 4G50A 3M7NA 2AWGA 4IQCA 3PRAA 3ARRA 4L72B 4ODOA 3B9EA 4XAKA 2M8JA 1W9PA 1M5YA 1Q1CA 2YSIA 3PRBA 4LAVA 4LAWA 1NH6A 2DG3A 3MQGA 2G8ZA 2IF4A 1FKSA 4DIPA 4JFMA 3ODKA 1GOIA 1W1PA 2ZQTA 4WIWA 1XRVA 1FKRA 1UR9A 4ZPWR 4KR0B 1JNSA 3G6MA 1YW5A 1NSGA 1IX5A 3JYMA 3BXWA 4MAVA 3JYJA 2ITKA 1FKDA 2DT2A 4FN2A 2OFNA 3OA5A 2Q5AA 2YAJB 5E5WA 1W9VA 4O2TA 3ARYA 1EHNA 2YSGA 1FKLA 1WAWA 5DIUA 2YBTA 1D7JA 1HXVA 3ARQA 3ARSA 2RUQA 2QF8A 1GPFA 5HTGA 2M8IA 1P5QA 2JXWA 3IHZA 3O5MA 3CNGA 3B7XA 5DF0A 4G2PA 5HUAA 1KFWA 1VF8A 1PINA 1FLCA 3UI4A 3GPKA 1NMVA 4PTMA 1Q6UA 3W4RA 2ESCA 3WD1A 1OGBA 3ALFA 4ZS6A 4Z2IA 2ZQUA 4GGQA 2YSHA 1LL7A 2F4EA 2DPEA 2KR7A 4WJXA 5DO2A 5HWBA 2XP6A 2M1IA 3VAWA 1X6LA 4J4NA 4WKAA 4ZPTR 1FKBA 2XPBA 4IT4A 3UF8A 2PV1A 1EG4A 1D7IA 1E6ZA 5BXJA 1R9HA 2YSBA 3AS3A 4W9OA 3KAFA 1FKGA 2ZR5A 1FKJA 1EG3A 1D2KA 1KT1A 3PRDA 1D6OA 3CGMA 5GPGA 1F8AB 3KABA 3CHEA 3UI5A 2G41A 3O5KA 1K9QA 1NWTA 2PPNA 3IKGA 2ZQVA 4HBEA 1ZBVA 4MNMA 2EZ5W 4QT3A 2KE0A 1E6PA 2A3EA 4HARA 1WMVA 4E5RA 1EDQA 1JNTA 1FKKA 2VCDA 3ARTA 3RGCA 1ITXA 4IPXA 1E6RA 2WLZA 3O5QA 5DIVA 4HBOA 3WKZA 1ROUA 1FAPA 4MSPA 4U85A 2DSWA 5D75A 4U84A 5U47A 2DT0A 3RM4A 2VN1A 4Z2KA 4DZ2A 3PR9A 1W1YA 4DRMA 3TCZA 1TCOC 4Q22A 4NNRA 3RM9A 3ARUA 2DK7A 4GIVA 1W1VA 3RMEA 4DT4A 4ML4A 4MPKA 1JVWA 1HKIA 3ARPA 2OLHA 2DJYA 1QPFA 2DWVA 1ZBKA 2WK2A 2L2SA 2PBCA 2XP7A 1FFRA 3KCEA 2MLXA 1RP5A 2KI3A 3KADA 4WK9A 2MLZA 3FS8A 2FAPA 4W9QA 2JZVA 2DT1A 5E64A 4TW6A 4R5EA 4TNSA 4S3JA 3WD4A 2XP8A 2PI6A 2XPAA 4LGXA 4MNLA 4MNJA 5E62A 1Q6HA 2DSVA 3IKDA 1HKJA 3QOKA 5GPRA 4QIBA 1N1AA 1EQ3A 1F40A 1KT0A 1ZBWA 3O5FA 1H0GA 3FXYA 3LUOA 5JH8A 4ODQA 2M3OW 2IUZA 5HWCA 1QZ2A 3M85A 3CGNA 4QZVB 2MDIA 3PQHA 3AS2A 4ODLA 1O6WA 2DG4A 3O5JA 5B8IC 2ZR6A 1BL4A 3PA7A 3O5GA 2LGOA 1J6YA 2A3BA 4N19A 3WD0A 2MLYA 2OWOA 4NSBA 3MCBB 3UQBA 1FJDA 1WR7A 2ZR4A 1RD6A 1J4HA 5AHTA 5DITA 3KACA 2B31A 1PBKA 1QPLA 3WL0A 2DT3A 2RUDA 1L1PA 3I6CA 4TX0A 1U79A 4URIA 5E66A 3CH9A 2WLYA 3WH0A 4BF8A 4KQZA 5HW7A 3MCBA 1OGGA 3OOBA 3O5DA 2BA1A 4JYSA 4ODRA 4DZ3A 4ITZA 3CHFA 4JFIA 4DRIA 1TK7A 1JNEA 3RM8A 2YBUA 2O9OA 1FD9A 3O5LA 4Z2JA 4TYOA 3KAHA 1UR8A 1SR0A 4P8WA 1XHGA 3FSBA 4DROA 1OWQA 1BKFA 2MF9A 2DG9A 3KZ7A 1FKTA 5HKGA 3FSCA 4Z2LA 4IQ2A 3UQAA 1FKFA 2DSZA 1LQ0A 5GQBA 3B9DA 4P8VA 1GUVA 1TR8A 4LAXA 3L4HA 5DEZA 2K8IA 3O5EA 3AS0A 5HT1A 5HBFA 1K9TA 3FY1A 4C02B 3O5RA 2LAJA 2LJ4A 1J4RA 2M08A 1C9HA 1LL6A 4ODNA 2JX8A 3O5PA 1WNOA 1NWUA 1W1TA 1E6NA 2MNTA 4NZCA 4QT2A 4ODPA 3AROA 3LKXB 3AQUA 4TW7A 1A7XA 4DRJA 3UQIA 1O6IA 4Z2GA 2FKEA 2ZAJA 3ARWA 2YSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HW8 A;  2JMF A;  3JXV A;  4W9P A;  1YAT A;  3TC5 A;  2RUR A;  1FKI A;  2M2A A;  4JFJ A;  1B6C A;  2KGJ A;  4DRN A;  1ROT A;  1ZCN A;  4DH0 A;  2KXQ A;  2KO7 A;  1I5H W;  2XP3 A;  1EYM A;  2DK1 A;  4J4O A;  3O5I A;  2PPP A;  2RQS A;  4DRK A;  4DRQ A;  4REX A;  2E45 A;  1T11 A;  2DMV A;  1ZK6 A;  5I98 A;  2Y78 A;  2RE3 A;  3O5O A;  4MGV A;  2LKN A;  1NMW A;  5CQ2 A;  4FAP A;  2MPH A;  4LAY A;  3RFW A;  2ZQS A;  2D9F A;  4DRH A;  2RSE A;  4TW8 A;  2PV3 A;  3UI6 A;  1JMQ A;  3NTP A;  2PV2 A;  3IK8 A;  3LE4 A;  2KFW A;  1W26 A;  1D7H A;  1Q6I A;  4ODK A;  5HW6 A;  1FKH A;  2LPV A;  3NRK A;  4ODM A;  2F21 A;  4JFK A;  2L4J A;  5J6E A;  3KAG A;  2UZ5 A;  3MDY B;  4U86 A;  3TDB A;  2XP4 A;  2XP9 A;  2PPO A;  2N87 A;  1J4I A;  2F2D A;  2XP5 A;  2RUC A;  2JV4 A;  1Y0O A;  3FAP A;  3NI6 A;  4JFL A;  3EY6 A;  4R0X A;  3KAI A;  4DRP A;  1K9R A;  3H9R B;  4G50 A;  3M7N A;  2AWG A;  4IQC A;  4ODO A;  2M8J A;  1M5Y A;  1Q1C A;  2YSI A;  3PRB A;  4LAV A;  4LAW A;  2DG3 A;  2IF4 A;  1FKS A;  4DIP A;  4JFM A;  3ODK A;  2ZQT A;  1FKR A;  1JNS A;  1YW5 A;  1NSG A;  3JYM A;  3JYJ A;  2ITK A;  1FKD A;  4FN2 A;  2OFN A;  2Q5A A;  4O2T A;  2YSG A;  1FKL A;  5DIU A;  1D7J A;  1HXV A;  2RUQ A;  5HTG A;  2M8I A;  1P5Q A;  2JXW A;  3IHZ A;  3O5M A;  3CNG A;  3B7X A;  4G2P A;  5HUA A;  1PIN A;  3UI4 A;  3GPK A;  1NMV A;  1Q6U A;  2ZQU A;  4GGQ A;  2YSH A;  2F4E A;  2KR7 A;  5HWB A;  2XP6 A;  2M1I A;  3VAW A;  4J4N A;  1FKB A;  3UF8 A;  2XPB A;  2PV1 A;  1EG4 A;  1D7I A;  5BXJ A;  1R9H A;  2YSB A;  4W9O A;  3KAF A;  1FKG A;  2ZR5 A;  1FKJ A;  1EG3 A;  5GPG A;  1KT1 A;  3PRD A;  1D6O A;  3CGM A;  1F8A B;  3KAB A;  3UI5 A;  3O5K A;  1K9Q A;  3IKG A;  2PPN A;  2ZQV A;  4QT3 A;  2EZ5 W;  2KE0 A;  1WMV A;  4E5R A;  1JNT A;  1FKK A;  2VCD A;  3RGC A;  4IPX A;  3O5Q A;  5DIV A;  1ROU A;  1FAP A;  4MSP A;  4U85 A;  5D75 A;  4U84 A;  2VN1 A;  4DZ2 A;  4DRM A;  3TCZ A;  1TCO C;  4NNR A;  2DK7 A;  4GIV A;  4DT4 A;  1JVW A;  2DJY A;  1QPF A;  2DWV A;  2L2S A;  2PBC A;  2XP7 A;  3KCE A;  2MLX A;  2KI3 A;  3KAD A;  2MLZ A;  2FAP A;  4W9Q A;  2JZV A;  4TW6 A;  4TNS A;  2XP8 A;  2XPA A;  1Q6H A;  3IKD A;  4QIB A;  1N1A A;  1EQ3 A;  1F40 A;  1KT0 A;  3O5F A;  3LUO A;  4ODQ A;  2M3O W;  5HWC A;  1QZ2 A;  3CGN A;  3M85 A;  2MDI A;  4ODL A;  1O6W A;  2DG4 A;  3O5J A;  5B8I C;  2ZR6 A;  1BL4 A;  3PA7 A;  3O5G A;  2LGO A;  1J6Y A;  4N19 A;  2MLY A;  3UQB A;  1FJD A;  1WR7 A;  2ZR4 A;  1J4H A;  5AHT A;  5DIT A;  3KAC A;  1PBK A;  1QPL A;  2RUD A;  1L1P A;  3I6C A;  4TX0 A;  1U79 A;  3WH0 A;  4BF8 A;  5HW7 A;  3OOB A;  3O5D A;  2BA1 A;  4JYS A;  4ODR A;  4DZ3 A;  4ITZ A;  4JFI A;  4DRI A;  1TK7 A;  1FD9 A;  3O5L A;  4TYO A;  3KAH A;  4DRO A;  1BKF A;  2MF9 A;  2DG9 A;  3KZ7 A;  1FKT A;  5HKG A;  4IQ2 A;  3UQA A;  1FKF A;  4LAX A;  3L4H A;  2K8I A;  3O5E A;  5HT1 A;  4C02 B;  3O5R A;  2LAJ A;  2LJ4 A;  1J4R A;  2M08 A;  1C9H A;  4ODN A;  2JX8 A;  3O5P A;  2MNT A;  4QT2 A;  4ODP A;  4TW7 A;  1A7X A;  4DRJ A;  3UQI A;  2FKE A;  2ZAJ A;  2YSF A; 
#chains in the Genus database with same CATH topology
 5HW8 A;  1SYT A;  3AS1 A;  4ZPV R;  2JMF A;  3JXV A;  4W9P A;  1YAT A;  2O92 A;  3TC5 A;  4MTV A;  3WD2 A;  3LKX A;  3MQH A;  2RUR A;  3B9A A;  4L3N A;  4MNK A;  1FKI A;  2M2A A;  4JFJ A;  1ZB5 A;  1B6C A;  1E44 A;  2KGJ A;  4DRN A;  1ROT A;  1E15 A;  1LG1 A;  1ZCN A;  4DH0 A;  3WD3 A;  4GLX A;  2KXQ A;  2KO7 A;  1W9U A;  1I5H W;  2XP3 A;  4DWS B;  4A0T A;  4DWS D;  1EYM A;  4DWS C;  1CTN A;  4A0U A;  1LJY A;  2DK1 A;  2FDM A;  1E9L A;  4J4O A;  3O5I A;  2PPP A;  2RQS A;  4W5U A;  4DRK A;  4DWS A;  1HJV A;  4DRQ A;  3WL1 A;  4REX A;  1JND A;  2E45 A;  1EIB A;  2A3C A;  4Q7N A;  1T11 A;  1WB0 A;  2DMV A;  3CZ8 A;  1ZK6 A;  5I98 A;  2DSU A;  2Y8N B;  1TFV A;  2Y78 A;  2RE3 A;  3O5O A;  2A3A A;  1ZU8 A;  4MGV A;  2LKN A;  1NMW A;  1FFQ A;  1HJW A;  5CQ2 A;  4FAP A;  2MPH A;  3WQW A;  4LAY A;  3CHC A;  3WQV A;  3RFW A;  2ZQS A;  2D9F A;  4DRH A;  2RSE A;  4TW8 A;  2PV3 A;  3UI6 A;  3CHD A;  2QRV A;  1JMQ A;  3NTP A;  2PV2 A;  3IK8 A;  3LE4 A;  3ARX A;  2KFW A;  1W26 A;  1D7H A;  4WKH A;  1ZL1 A;  1Q6I A;  4ODK A;  5HW6 A;  4IT6 A;  1FKH A;  1NWR A;  4S3K A;  4AY1 A;  2LPV A;  1LL4 A;  2WAD A;  3NRK A;  4ODM A;  2F21 A;  4JFK A;  2L4J A;  1HJX A;  1HKM A;  1X6N A;  5J6E A;  3ARV A;  3KAG A;  2UZ5 A;  4WKF A;  1ZBC A;  3ARZ A;  1LG2 A;  2WM0 A;  3MDY B;  2AOS A;  4U86 A;  3WIJ A;  3TDB A;  2XP4 A;  2XP9 A;  3G6L A;  4P8U A;  2WAE A;  2PPO A;  1HKK A;  2N87 A;  3ALG A;  1J4I A;  2F2D A;  3B8S A;  3EIP A;  2XP5 A;  5E65 A;  2RUC A;  2JV4 A;  1Y0O A;  3FAP A;  3NI6 A;  4JFL A;  3EY6 A;  1NWS A;  4P8X A;  4R0X A;  3KAI A;  4Z2H A;  4DRP A;  1H0I A;  1K9R A;  3H9R B;  4G50 A;  3M7N A;  2AWG A;  4IQC A;  3PRA A;  3ARR A;  4L72 B;  4ODO A;  3B9E A;  4XAK A;  2M8J A;  1W9P A;  1M5Y A;  1Q1C A;  2YSI A;  3PRB A;  4LAV A;  4LAW A;  1NH6 A;  2DG3 A;  3MQG A;  2G8Z A;  2IF4 A;  1FKS A;  3BMB A;  4DIP A;  4JFM A;  3ODK A;  1GOI A;  1W1P A;  2ZQT A;  4WIW A;  1XRV A;  1FKR A;  1UR9 A;  4ZPW R;  4KR0 B;  1JNS A;  3G6M A;  1YW5 A;  1NSG A;  1IX5 A;  3JYM A;  3BXW A;  4MAV A;  3JYJ A;  2ITK A;  1FKD A;  2DT2 A;  4FN2 A;  2OFN A;  3OA5 A;  2Q5A A;  2YAJ B;  5E5W A;  1W9V A;  4O2T A;  3ARY A;  1EHN A;  2YSG A;  1FKL A;  1WAW A;  5DIU A;  2YBT A;  1D7J A;  1HXV A;  3ARQ A;  3ARS A;  2RUQ A;  2QF8 A;  1GPF A;  5HTG A;  2M8I A;  1P5Q A;  2JXW A;  3IHZ A;  3O5M A;  3CNG A;  3B7X A;  5DF0 A;  4G2P A;  5HUA A;  2B5U B;  1KFW A;  1VF8 A;  1PIN A;  1FLC A;  3UI4 A;  3GPK A;  1NMV A;  4PTM A;  1Q6U A;  3W4R A;  2ESC A;  3WD1 A;  1OGB A;  3ALF A;  4ZS6 A;  4Z2I A;  2ZQU A;  4GGQ A;  2YSH A;  1LL7 A;  2F4E A;  2DPE A;  2KR7 A;  4WJX A;  5DO2 A;  5HWB A;  2XP6 A;  2M1I A;  3VAW A;  1X6L A;  4J4N A;  4WKA A;  4ZPT R;  1FKB A;  2XPB A;  2PN0 A;  4IT4 A;  3UF8 A;  2PV1 A;  1EG4 A;  1D7I A;  1E6Z A;  5BXJ A;  1R9H A;  2YSB A;  3AS3 A;  4W9O A;  3KAF A;  1FKG A;  2F23 A;  2ZR5 A;  1FKJ A;  1EG3 A;  1D2K A;  1KT1 A;  3PRD A;  1D6O A;  3CGM A;  5GPG A;  1F8A B;  3KAB A;  3CHE A;  3UI5 A;  2G41 A;  3O5K A;  1K9Q A;  1GRJ A;  1NWT A;  2PPN A;  3IKG A;  2ZQV A;  4HBE A;  1ZBV A;  4MNM A;  2EZ5 W;  4QT3 A;  2KE0 A;  1E6P A;  2A3E A;  2EUL A;  1WMV A;  4HAR A;  4E5R A;  1EDQ A;  1JNT A;  1FKK A;  2VCD A;  3ART A;  3RGC A;  1ITX A;  4IPX A;  1E6R A;  2WLZ A;  3O5Q A;  5DIV A;  2ETN A;  4HBO A;  3WKZ A;  1ROU A;  1FAP A;  4MSP A;  4U85 A;  2DSW A;  5D75 A;  4U84 A;  5U47 A;  2DT0 A;  3RM4 A;  2VN1 A;  4Z2K A;  4DZ2 A;  3PR9 A;  1W1Y A;  4DRM A;  3TCZ A;  1TCO C;  4Q22 A;  4NNR A;  3GTY X;  3RM9 A;  3ARU A;  2DK7 A;  4GIV A;  1W1V A;  3RME A;  4DT4 A;  4ML4 A;  4MPK A;  1JVW A;  1HKI A;  3ARP A;  2OLH A;  2DJY A;  1QPF A;  2DWV A;  1ZBK A;  2WK2 A;  2L2S A;  2PBC A;  2XP7 A;  1FFR A;  3KCE A;  2MLX A;  1RP5 A;  2KI3 A;  3KAD A;  4UDM A;  4WK9 A;  2MLZ A;  3FS8 A;  2FAP A;  4W9Q A;  2JZV A;  2DT1 A;  5E64 A;  4TW6 A;  4R5E A;  4TNS A;  4S3J A;  3WD4 A;  2XP8 A;  2PI6 A;  2XPA A;  4LGX A;  4MNL A;  4MNJ A;  5E62 A;  1Q6H A;  2DSV A;  3IKD A;  1HKJ A;  3QOK A;  5GPR A;  4QIB A;  1N1A A;  1EQ3 A;  1F40 A;  1KT0 A;  1ZBW A;  3O5F A;  1H0G A;  3FXY A;  3LUO A;  5JH8 A;  4ODQ A;  2M3O W;  2IUZ A;  5HWC A;  1QZ2 A;  3M85 A;  3CGN A;  4QZV B;  2MDI A;  3PQH A;  3AS2 A;  4ODL A;  1O6W A;  2DG4 A;  3O5J A;  5B8I C;  2ZR6 A;  1BL4 A;  3PA7 A;  3O5G A;  2LGO A;  1J6Y A;  2A3B A;  4N19 A;  3WD0 A;  2MLY A;  2OWO A;  4NSB A;  3MCB B;  3UQB A;  1FJD A;  1WR7 A;  2ZR4 A;  1RD6 A;  1J4H A;  5AHT A;  5DIT A;  3KAC A;  2B31 A;  1PBK A;  1QPL A;  3WL0 A;  2DT3 A;  2RUD A;  1L1P A;  3I6C A;  4TX0 A;  1U79 A;  4URI A;  5E66 A;  3CH9 A;  2WLY A;  3WH0 A;  4BF8 A;  4KQZ A;  5HW7 A;  2P4V A;  3MCB A;  1OGG A;  3OOB A;  3O5D A;  2BA1 A;  4JYS A;  4ODR A;  4DZ3 A;  4ITZ A;  3CHF A;  4JFI A;  4DRI A;  1TK7 A;  1JNE A;  3RM8 A;  2YBU A;  2O9O A;  1FD9 A;  3O5L A;  4Z2J A;  4TYO A;  3KAH A;  1UR8 A;  1SR0 A;  4P8W A;  1XHG A;  3FSB A;  4DRO A;  1OWQ A;  1BKF A;  2MF9 A;  2DG9 A;  3KZ7 A;  1FKT A;  5HKG A;  3FSC A;  4Z2L A;  4IQ2 A;  3UQA A;  1FKF A;  2DSZ A;  1LQ0 A;  5GQB A;  3B9D A;  4P8V A;  1GUV A;  1TR8 A;  4LAX A;  3L4H A;  5DEZ A;  3GU0 A;  2K8I A;  3O5E A;  3AS0 A;  5HT1 A;  5HBF A;  1K9T A;  3FY1 A;  4C02 B;  3O5R A;  2LAJ A;  2LJ4 A;  1J4R A;  2M08 A;  1C9H A;  1LL6 A;  4ODN A;  2JX8 A;  3O5P A;  1WNO A;  1NWU A;  1W1T A;  1E6N A;  2MNT A;  1JCH B;  4NZC A;  4QT2 A;  4ODP A;  3ARO A;  3LKX B;  3AQU A;  4TW7 A;  1A7X A;  4DRJ A;  3UQI A;  1O6I A;  4Z2G A;  2FKE A;  2ZAJ A;  3ARW A;  2YSF A; 
#chains in the Genus database with same CATH homology
 5HW8 A;  1SYT A;  3AS1 A;  4ZPV R;  2JMF A;  3JXV A;  4W9P A;  1YAT A;  2O92 A;  3TC5 A;  4MTV A;  3WD2 A;  3LKX A;  3MQH A;  2RUR A;  3B9A A;  4L3N A;  4MNK A;  1FKI A;  2M2A A;  4JFJ A;  1ZB5 A;  1B6C A;  2KGJ A;  4DRN A;  1ROT A;  1E15 A;  1LG1 A;  1ZCN A;  4DH0 A;  3WD3 A;  4GLX A;  2KXQ A;  2KO7 A;  1W9U A;  1I5H W;  2XP3 A;  4DWS B;  4A0T A;  4DWS D;  1EYM A;  4DWS C;  1CTN A;  4A0U A;  1LJY A;  2DK1 A;  2FDM A;  1E9L A;  4J4O A;  3O5I A;  2PPP A;  2RQS A;  4W5U A;  4DRK A;  4DWS A;  1HJV A;  4DRQ A;  3WL1 A;  4REX A;  1JND A;  2E45 A;  1EIB A;  2A3C A;  4Q7N A;  1T11 A;  1WB0 A;  2DMV A;  3CZ8 A;  1ZK6 A;  5I98 A;  2DSU A;  2Y8N B;  1TFV A;  2Y78 A;  2RE3 A;  3O5O A;  2A3A A;  1ZU8 A;  4MGV A;  2LKN A;  1NMW A;  1FFQ A;  1HJW A;  5CQ2 A;  4FAP A;  2MPH A;  3WQW A;  4LAY A;  3CHC A;  3WQV A;  3RFW A;  2ZQS A;  2D9F A;  4DRH A;  2RSE A;  4TW8 A;  2PV3 A;  3UI6 A;  3CHD A;  2QRV A;  1JMQ A;  3NTP A;  2PV2 A;  3IK8 A;  3LE4 A;  3ARX A;  2KFW A;  1W26 A;  1D7H A;  4WKH A;  1ZL1 A;  1Q6I A;  4ODK A;  5HW6 A;  4IT6 A;  1FKH A;  1NWR A;  4S3K A;  4AY1 A;  2LPV A;  1LL4 A;  2WAD A;  3NRK A;  4ODM A;  2F21 A;  4JFK A;  2L4J A;  1HJX A;  1HKM A;  1X6N A;  5J6E A;  3ARV A;  3KAG A;  2UZ5 A;  4WKF A;  1ZBC A;  3ARZ A;  1LG2 A;  2WM0 A;  3MDY B;  2AOS A;  4U86 A;  3WIJ A;  3TDB A;  2XP4 A;  2XP9 A;  3G6L A;  4P8U A;  2WAE A;  2PPO A;  1HKK A;  2N87 A;  3ALG A;  1J4I A;  2F2D A;  3B8S A;  2XP5 A;  5E65 A;  2RUC A;  2JV4 A;  1Y0O A;  3FAP A;  3NI6 A;  4JFL A;  3EY6 A;  1NWS A;  4P8X A;  4R0X A;  3KAI A;  4Z2H A;  4DRP A;  1H0I A;  1K9R A;  3H9R B;  4G50 A;  3M7N A;  2AWG A;  4IQC A;  3PRA A;  3ARR A;  4L72 B;  4ODO A;  3B9E A;  4XAK A;  2M8J A;  1W9P A;  1M5Y A;  1Q1C A;  2YSI A;  3PRB A;  4LAV A;  4LAW A;  1NH6 A;  2DG3 A;  3MQG A;  2G8Z A;  2IF4 A;  1FKS A;  4DIP A;  4JFM A;  3ODK A;  1GOI A;  1W1P A;  2ZQT A;  4WIW A;  1XRV A;  1FKR A;  1UR9 A;  4ZPW R;  4KR0 B;  1JNS A;  3G6M A;  1YW5 A;  1NSG A;  1IX5 A;  3JYM A;  3BXW A;  4MAV A;  3JYJ A;  2ITK A;  1FKD A;  2DT2 A;  4FN2 A;  2OFN A;  3OA5 A;  2Q5A A;  2YAJ B;  5E5W A;  1W9V A;  4O2T A;  3ARY A;  1EHN A;  2YSG A;  1FKL A;  1WAW A;  5DIU A;  2YBT A;  1D7J A;  1HXV A;  3ARQ A;  3ARS A;  2RUQ A;  2QF8 A;  1GPF A;  5HTG A;  2M8I A;  1P5Q A;  2JXW A;  3IHZ A;  3O5M A;  3CNG A;  3B7X A;  5DF0 A;  4G2P A;  5HUA A;  1KFW A;  1VF8 A;  1PIN A;  1FLC A;  3UI4 A;  3GPK A;  1NMV A;  4PTM A;  1Q6U A;  3W4R A;  2ESC A;  3WD1 A;  1OGB A;  3ALF A;  4ZS6 A;  4Z2I A;  2ZQU A;  4GGQ A;  2YSH A;  1LL7 A;  2F4E A;  2DPE A;  2KR7 A;  4WJX A;  5DO2 A;  5HWB A;  2XP6 A;  2M1I A;  3VAW A;  1X6L A;  4J4N A;  4WKA A;  4ZPT R;  1FKB A;  2XPB A;  4IT4 A;  3UF8 A;  2PV1 A;  1EG4 A;  1D7I A;  1E6Z A;  5BXJ A;  1R9H A;  2YSB A;  3AS3 A;  4W9O A;  3KAF A;  1FKG A;  2ZR5 A;  1FKJ A;  1EG3 A;  1D2K A;  1KT1 A;  3PRD A;  1D6O A;  3CGM A;  5GPG A;  1F8A B;  3KAB A;  3CHE A;  3UI5 A;  2G41 A;  3O5K A;  1K9Q A;  1NWT A;  2PPN A;  3IKG A;  2ZQV A;  4HBE A;  1ZBV A;  4MNM A;  2EZ5 W;  4QT3 A;  2KE0 A;  1E6P A;  2A3E A;  4HAR A;  1WMV A;  4E5R A;  1EDQ A;  1JNT A;  1FKK A;  2VCD A;  3ART A;  3RGC A;  1ITX A;  4IPX A;  1E6R A;  2WLZ A;  3O5Q A;  5DIV A;  4HBO A;  3WKZ A;  1ROU A;  1FAP A;  4MSP A;  4U85 A;  2DSW A;  5D75 A;  4U84 A;  5U47 A;  2DT0 A;  3RM4 A;  2VN1 A;  4Z2K A;  4DZ2 A;  3PR9 A;  1W1Y A;  4DRM A;  3TCZ A;  1TCO C;  4Q22 A;  4NNR A;  3RM9 A;  3ARU A;  2DK7 A;  4GIV A;  1W1V A;  3RME A;  4DT4 A;  4ML4 A;  4MPK A;  1JVW A;  1HKI A;  3ARP A;  2OLH A;  2DJY A;  1QPF A;  2DWV A;  1ZBK A;  2WK2 A;  2L2S A;  2PBC A;  2XP7 A;  1FFR A;  3KCE A;  2MLX A;  1RP5 A;  2KI3 A;  3KAD A;  4WK9 A;  2MLZ A;  3FS8 A;  2FAP A;  4W9Q A;  2JZV A;  2DT1 A;  5E64 A;  4TW6 A;  4R5E A;  4TNS A;  4S3J A;  3WD4 A;  2XP8 A;  2PI6 A;  2XPA A;  4LGX A;  4MNL A;  4MNJ A;  5E62 A;  1Q6H A;  2DSV A;  3IKD A;  1HKJ A;  3QOK A;  5GPR A;  4QIB A;  1N1A A;  1EQ3 A;  1F40 A;  1KT0 A;  1ZBW A;  3O5F A;  1H0G A;  3FXY A;  3LUO A;  5JH8 A;  4ODQ A;  2M3O W;  2IUZ A;  5HWC A;  1QZ2 A;  3M85 A;  3CGN A;  4QZV B;  2MDI A;  3PQH A;  3AS2 A;  4ODL A;  1O6W A;  2DG4 A;  3O5J A;  5B8I C;  2ZR6 A;  1BL4 A;  3PA7 A;  3O5G A;  2LGO A;  1J6Y A;  2A3B A;  4N19 A;  3WD0 A;  2MLY A;  2OWO A;  4NSB A;  3MCB B;  3UQB A;  1FJD A;  1WR7 A;  2ZR4 A;  1RD6 A;  1J4H A;  5AHT A;  5DIT A;  3KAC A;  2B31 A;  1PBK A;  1QPL A;  3WL0 A;  2DT3 A;  2RUD A;  1L1P A;  3I6C A;  4TX0 A;  1U79 A;  4URI A;  5E66 A;  3CH9 A;  2WLY A;  3WH0 A;  4BF8 A;  4KQZ A;  5HW7 A;  3MCB A;  1OGG A;  3OOB A;  3O5D A;  2BA1 A;  4JYS A;  4ODR A;  4DZ3 A;  4ITZ A;  3CHF A;  4JFI A;  4DRI A;  1TK7 A;  1JNE A;  3RM8 A;  2YBU A;  2O9O A;  1FD9 A;  3O5L A;  4Z2J A;  4TYO A;  3KAH A;  1UR8 A;  1SR0 A;  4P8W A;  1XHG A;  3FSB A;  4DRO A;  1OWQ A;  1BKF A;  2MF9 A;  2DG9 A;  3KZ7 A;  1FKT A;  5HKG A;  3FSC A;  4Z2L A;  4IQ2 A;  3UQA A;  1FKF A;  2DSZ A;  1LQ0 A;  5GQB A;  3B9D A;  4P8V A;  1GUV A;  1TR8 A;  4LAX A;  3L4H A;  5DEZ A;  2K8I A;  3O5E A;  3AS0 A;  5HT1 A;  5HBF A;  1K9T A;  3FY1 A;  4C02 B;  3O5R A;  2LAJ A;  2LJ4 A;  1J4R A;  2M08 A;  1C9H A;  1LL6 A;  4ODN A;  2JX8 A;  3O5P A;  1WNO A;  1NWU A;  1W1T A;  1E6N A;  2MNT A;  4NZC A;  4QT2 A;  4ODP A;  3ARO A;  3LKX B;  3AQU A;  4TW7 A;  1A7X A;  4DRJ A;  3UQI A;  1O6I A;  4Z2G A;  2FKE A;  2ZAJ A;  3ARW A;  2YSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...