2ZR5A

Crystal structure of a mutant pin1 peptidyl-prolyl cis-trans isomerase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
153
Chain Sequence
KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGKNGQGEPARVRCSHLLVAHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on PIN1 mutants
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 44
structure length 153
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2zr5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2zr5A02
3UQIA 4QIBA 2M8IA 3CGMA 1FKSA 3IKGA 2XPAA 2YSFA 2AWGA 3KAFA 1K9QA 1FAPA 2F4EA 1B6CA 2LJ4A 1FKLA 3PRBA 5HW6A 4W9QA 3I6CA 3UI6A 4FAPA 4E5RA 3CGNA 3JYMA 3O5EA 1FKDA 3UQAA 2DJYA 2JX8A 2Q5AA 4REXA 1TCOC 2RE3A 2RUDA 4TW7A 1FKKA 2DK1A 2ITKA 2YSHA 2K8IA 1U79A 3IHZA 5D75A 1NSGA 4DRPA 4DZ2A 4JFIA 2YSIA 1Y0OA 2MDIA 3EY6A 3TDBA 3O5FA 5HWBA 1EQ3A 2E45A 4O2TA 2ZR5A 3O5QA 2Y78A 3NI6A 2ZQSA 3UF8A 3L4HA 2MPHA 2ZR4A 1KT0A 3O5IA 3B7XA 2LPVA 3ODKA 2UZ5A 3OOBA 4JFMA 4TNSA 4DRQA 1FKIA 2XP6A 4U84A 3O5KA 5HW8A 4QT3A 1EG4A 2KI3A 2JMFA 2M3OW 3KCEA 1K9RA 1W26A 2PBCA 1FKGA 3M85A 2YSBA 1J4IA 1WR7A 1QZ2A 4IQCA 3RGCA 4DROA 4ODMA 5B8IC 2LGOA 3VAWA 4LAVA 2DG3A 1D7JA 2XP7A 4LAYA 2M1IA 2PPPA 4JYSA 1O6WA 1TK7A 4MSPA 4TYOA 4TW6A 3PA7A 1FJDA 2MLZA 1J4HA 4TW8A 4J4OA 1J4RA 1I5HW 1ROTA 4ODKA 5GPGA 4U86A 3NTPA 2D9FA 1Q1CA 2N87A 3KADA 3M7NA 2F2DA 1FKBA 3O5OA 4BF8A 4DRJA 5HW7A 4MGVA 3NRKA 4G2PA 3O5RA 3MDYB 3PRDA 4JFLA 2PV3A 2DWVA 2LAJA 2KE0A 2M08A 1Q6HA 3KZ7A 4GIVA 5HWCA 5I98A 3KAHA 1Q6IA 2KGJA 4ODPA 4ODQA 2XP5A 1P5QA 2M2AA 3KABA 4ODRA 1ROUA 2ZQTA 5AHTA 2RUQA 2PPNA 4DH0A 3KAIA 1D7HA 1NMVA 2F21A 3O5LA 2PV1A 2VCDA 1KT1A 1F8AB 2PPOA 2DG4A 2PV2A 1Q6UA 1ZCNA 2JZVA 2VN1A 3H9RB 2XP3A 1HXVA 4NNRA 3KAGA 4IQ2A 1D6OA 5DIUA 3KACA 5DIVA 1BL4A 3LE4A 1QPLA 1C9HA 2MNTA 2IF4A 3CNGA 4ODLA 1EYMA 1FKTA 2DG9A 2KR7A 1WMVA 1FD9A 3TCZA 2RUCA 3LUOA 3O5PA 3RFWA 2EZ5W 2FKEA 4DRMA 4DT4A 5HKGA 2JV4A 2L2SA 2ZR6A 1T11A 1PINA 2RURA 1EG3A 4ODNA 4R0XA 2RSEA 5HTGA 3IKDA 5DITA 1F40A 1PBKA 1QPFA 4N19A 3FAPA 4FN2A 1N1AA 1FKFA 2XP4A 1FKJA 4W9OA 3O5MA 1YW5A 1J6YA 4ITZA 1M5YA 2MF9A 2MLXA 2XP8A 1FKHA 1YATA 4W9PA 5HT1A 1L1PA 2MLYA 4DRHA 3GPKA 3JYJA 2YSGA 2ZQUA 1NMWA 4J4NA 2M8JA 4JFJA 4LAXA 1JNTA 5HUAA 4JFKA 5J6EA 2FAPA 2DK7A 3O5JA 2XPBA 4QT2A 2BA1A 3O5DA 4LAWA 4DRNA 1R9HA 4DZ3A 1JNSA 1FKRA 2ZQVA 3UI5A 3IK8A 4U85A 2XP9A 1JMQA 2OFNA 4DRKA 1D7IA 3WH0A 2KFWA 3O5GA 2LKNA 4DRIA 2KO7A 1A7XA 3JXVA 4G50A 3TC5A 4TX0A 5CQ2A 1ZK6A 2ZAJA 4IPXA 4DIPA 4C02B 2KXQA 2JXWA 3UI4A 1BKFA 1JVWA 2RQSA 2DMVA 4GGQA 3UQBA 5BXJA 4ODOA 2L4JA
chains in the Genus database with same CATH superfamily
1E6NA 5U47A 2QRVA 2M8IA 3MCBA 2F23A 1FKSA 3ARXA 3CGMA 2XPAA 3GU0A 3IKGA 5HW6A 2LJ4A 3I6CA 4Q7NA 3UQAA 2JX8A 1NWUA 1X6NA 1NSGA 1SR0A 1ZU8A 3O5FA 3EY6A 1EQ3A 4R5EA 2ZR5A 2WLZA 3NI6A 3L4HA 1HJVA 1H0GA 1KT0A 3WQWA 4TNSA 1K9TA 4DWSB 4P8XA 3FY1A 1FKGA 3QOKA 4P8VA 2OWOA 1W9UA 5DF0A 1JCHB 1TK7A 4TYOA 4NSBA 1NWRA 1J4RA 4ODKA 4P8UA 2D9FA 1UR8A 1WB0A 3ARTA 2F2DA 5HW7A 3O5RA 3CHEA 3AS0A 2DWVA 2LAJA 2M08A 3MQGA 1Q6IA 5E66A 1JNEA 4ODPA 2M2AA 3KABA 4DH0A 1W1VA 3KAIA 1NMVA 3O5LA 2VCDA 1XHGA 2Y8NB 1E15A 2DT2A 4IQ2A 4DWSC 1D6OA 5DIVA 3KACA 2DSUA 4L72B 1D2KA 4Z2HA 1EYMA 1FKTA 1WMVA 4L3NA 1HKJA 2RURA 2L2SA 3B9AA 2OLHA 1F40A 1QPFA 3FS8A 3ARRA 1N1AA 1HKMA 1J6YA 1M5YA 2MF9A 1FKHA 3WD2A 3AROA 2YSGA 2ZQUA 4DWSD 4LAXA 4AY1A 3FXYA 2ETNA 4KQZA 4DZ3A 2WLYA 1FKRA 1FFRA 1LL4A 1JMQA 4Z2IA 3PR9A 2A3CA 2LKNA 5GPRA 3JXVA 1ZB5A 4WKHA 3MCBB 2KXQA 2JXWA 1JVWA 2RQSA 1HKIA 3UQIA 5E65A 4QIBA 1FLCA 2YSFA 4Z2GA 1OGBA 4IT6A 2PI6A 4W9QA 3UI6A 3JYMA 1FKDA 2Q5AA 4REXA 1W9PA 2RE3A 4ZS6A 4Z2KA 2MDIA 2E45A 1LL7A 4O2TA 2O92A 2MPHA 4XAKA 1X6LA 3WD4A 4P8WA 3OOBA 1FKIA 5DO2A 5HW8A 1EG4A 2M3OW 1W26A 2PBCA 4DROA 4ODMA 4MNMA 4ZPTR 1LG1A 2M1IA 2PPPA 1O6WA 4MSPA 3ARSA 3FSBA 3W4RA 1E9LA 2DT3A 2DT1A 1I5HW 3O5OA 2B5UB 2N87A 5HWBA 4GLXA 4BF8A 2O9OA 4G2PA 3PRDA 2PV3A 3AS3A 2DSWA 4GIVA 5HWCA 1SYTA 3WD1A 2QF8A 1P5QA 3ARYA 1TR8A 1D7HA 1HJWA 2VN1A 4DRMA 1F8AB 2DG4A 1Q6UA 4IT4A 1HXVA 1ZBWA 5GQBA 4HBEA 3BMBA 3KAGA 1W1YA 4ODLA 2KR7A 1FD9A 2FKEA 4A0UA 2JV4A 1PINA 2A3BA 1RP5A 5DITA 1E6ZA 1W1TA 1PBKA 4N19A 3G6MA 2XP4A 4ZPWR 4HBOA 1YW5A 2WK2A 1GUVA 2WADA 2MLXA 2YBUA 5HT1A 1L1PA 2MLYA 4JFJA 4JFKA 2FAPA 2XPBA 2BA1A 1JNSA 1R9HA 4WKFA 4U85A 2OFNA 5E64A 4WJXA 4G50A 5CQ2A 1EIBA 2ZAJA 1NWSA 1FFQA 4ZPVR 3WD0A 2A3AA 2L4JA 4WKAA 3CHFA 4J4NA 4UDMA 1FKLA 2G41A 1XRVA 4E5RA 1O6IA 4MNKA 3ALFA 3FSCA 4A0TA 2DJYA 3RM4A 3AQUA 2DK1A 2YSHA 4DRPA 3IHZA 2YSIA 1Y0OA 3TDBA 3O5QA 2Y78A 3UF8A 3B9DA 3CH9A 2B31A 2ZR4A 3ARPA 3B9EA 4MNJA 2YBTA 3O5IA 3B7XA 2LPVA 4JFMA 3ALGA 2DPEA 4DRQA 1ITXA 3LKXA 4U84A 2WM0A 4QT3A 2JMFA 3CZ8A 4IQCA 3RGCA 1WR7A 1QZ2A 1IX5A 2LGOA 4LAVA 2DG3A 3ARUA 3WKZA 4JYSA 3RM8A 4TW6A 3PA7A 1E44A 1HKKA 4QZVB 2P4VA 4PTMA 2FDMA 1J4HA 4TW8A 4J4OA 1ROTA 5GPGA 1Q1CA 3M7NA 3WD3A 4DRJA 4Z2LA 4MGVA 2PN0A 3MDYB 1ZBKA 4JFLA 3KZ7A 4ODQA 1KFWA 1LJYA 1OWQA 1ROUA 2ZQTA 1NWTA 2RUQA 2PPNA 1GOIA 2PV2A 2PPOA 3OA5A 5HBFA 3H9RB 2XP3A 1ZBCA 3PRAA 3G6LA 4NNRA 5DIUA 4ML4A 4LGXA 3AS1A 1BL4A 1QPLA 1C9HA 2MNTA 2IF4A 3WL1A 3TCZA 3LUOA 3RFWA 1FJDA 4DT4A 1UR9A 4ODNA 1RD6A 4MPKA 2RSEA 1ZBVA 1TFVA 1FKFA 1FKJA 3ARQA 4S3JA 3O5MA 4W9OA 2XP8A 4WIWA 4DRHA 2DSVA 1LG2A 1NMWA 2M8JA 2AOSA 3GTYX 1JNTA 3ARWA 5HUAA 2DSZA 1WAWA 3MQHA 3O5JA 4QT2A 4LAWA 3UI5A 3IK8A 2XP9A 3O5GA 1W9VA 4TX0A 3TC5A 1ZK6A 3CHCA 1WNOA 2DMVA 3UQBA 5BXJA 5DEZA 5E5WA 2A3EA 2AWGA 2F4EA 3KAFA 1K9QA 1FAPA 1B6CA 3PRBA 4WK9A 4FAPA 4MAVA 3PQHA 3CGNA 3O5EA 1TCOC 2RUDA 1FKKA 4DZ2A 2ITKA 2IUZA 2K8IA 1U79A 5D75A 3ARVA 4JFIA 3RMEA 3WIJA 3EIPA 2ZQSA 1GPFA 4NZCA 3ODKA 1NH6A 2UZ5A 2XP6A 3O5KA 4HARA 4MNLA 2KI3A 1K9RA 3KCEA 3M85A 2YSBA 1J4IA 3LKXB 5B8IC 1CTNA 4W5UA 3VAWA 1D7JA 2XP7A 4LAYA 1HJXA 3CHDA 2MLZA 2G8ZA 3NTPA 4U86A 3KADA 4KR0B 1FKBA 1OGGA 3NRKA 1EHNA 2KE0A 1Q6HA 5E62A 4DWSA 5I98A 3KAHA 2KGJA 2XP5A 4ODRA 5AHTA 2F21A 1JNDA 2PV1A 4TW7A 1KT1A 1LL6A 2JZVA 1ZCNA 1LQ0A 1E6RA 4S3KA 4Q22A 3ARZA 4Z2JA 2EULA 3LE4A 5JH8A 3B8SA 3CNGA 2DG9A 1GRJA 3O5PA 2RUCA 5HTGA 2EZ5W 5HKGA 2ZR6A 1T11A 4R0XA 3WQVA 1EG3A 3RM9A 2YAJB 3IKDA 3AS2A 2ESCA 4URIA 3FAPA 4FN2A 4ITZA 2WAEA 1YATA 3BXWA 4W9PA 1ZL1A 3GPKA 3JYJA 3WL0A 1E6PA 5J6EA 2DK7A 1H0IA 4DRNA 3O5DA 4MTVA 2DT0A 2ZQVA 1VF8A 1W1PA 4DRKA 1D7IA 3WH0A 2KFWA 4DRIA 2KO7A 1A7XA 1EDQA 4IPXA 4DIPA 4C02B 3UI4A 1BKFA 4GGQA 4ODOA
chains in the Genus database with same CATH topology
1E6NA 5U47A 2QRVA 2M8IA 3MCBA 3ARXA 1FKSA 3CGMA 3IKGA 2XPAA 5HW6A 2LJ4A 3I6CA 4Q7NA 3UQAA 2JX8A 1NWUA 1X6NA 1NSGA 1SR0A 1ZU8A 3O5FA 3EY6A 1EQ3A 4R5EA 2ZR5A 2WLZA 3NI6A 3L4HA 1HJVA 1H0GA 1KT0A 3WQWA 4TNSA 1K9TA 4DWSB 4P8XA 3FY1A 1FKGA 3QOKA 4P8VA 2OWOA 1W9UA 5DF0A 1TK7A 4TYOA 4NSBA 1NWRA 1J4RA 4ODKA 4P8UA 2D9FA 1UR8A 1WB0A 3ARTA 2F2DA 5HW7A 3O5RA 3CHEA 3AS0A 2DWVA 2LAJA 2M08A 3MQGA 1Q6IA 5E66A 1JNEA 4ODPA 2M2AA 3KABA 4DH0A 1W1VA 3KAIA 1NMVA 3O5LA 2VCDA 1XHGA 2Y8NB 1E15A 2DT2A 4IQ2A 4DWSC 1D6OA 5DIVA 3KACA 2DSUA 4L72B 1D2KA 4Z2HA 1EYMA 1FKTA 1WMVA 4L3NA 1HKJA 2RURA 2L2SA 3B9AA 2OLHA 1F40A 1QPFA 3FS8A 3ARRA 1N1AA 1HKMA 1J6YA 1M5YA 2MF9A 1FKHA 3WD2A 3AROA 2YSGA 2ZQUA 4DWSD 4LAXA 4AY1A 3FXYA 4KQZA 4DZ3A 2WLYA 1FKRA 1FFRA 1LL4A 1JMQA 4Z2IA 3PR9A 2A3CA 2LKNA 5GPRA 3JXVA 1ZB5A 4WKHA 3MCBB 2KXQA 2JXWA 1JVWA 2RQSA 1HKIA 3UQIA 5E65A 4QIBA 1FLCA 2YSFA 4Z2GA 1OGBA 4IT6A 2PI6A 4W9QA 3UI6A 3JYMA 1FKDA 2Q5AA 4REXA 1W9PA 2RE3A 4ZS6A 4Z2KA 2MDIA 2E45A 1LL7A 4O2TA 2O92A 2MPHA 4XAKA 1X6LA 3WD4A 4P8WA 3OOBA 1FKIA 5DO2A 5HW8A 1EG4A 2M3OW 1W26A 2PBCA 4DROA 4ODMA 4MNMA 4ZPTR 1LG1A 2M1IA 2PPPA 1O6WA 4MSPA 3ARSA 3FSBA 3W4RA 1E9LA 2DT3A 2DT1A 1I5HW 3O5OA 2N87A 5HWBA 4GLXA 4BF8A 2O9OA 4G2PA 3PRDA 2PV3A 3AS3A 2DSWA 4GIVA 5HWCA 1SYTA 3WD1A 2QF8A 1P5QA 3ARYA 1TR8A 1D7HA 1HJWA 2VN1A 4DRMA 1F8AB 2DG4A 1Q6UA 4IT4A 1HXVA 1ZBWA 5GQBA 4HBEA 3KAGA 1W1YA 4ODLA 2KR7A 1FD9A 2FKEA 4A0UA 2JV4A 1PINA 2A3BA 1RP5A 5DITA 1E6ZA 1W1TA 1PBKA 4N19A 3G6MA 2XP4A 4ZPWR 4HBOA 1YW5A 2WK2A 1GUVA 2WADA 2MLXA 2YBUA 5HT1A 1L1PA 2MLYA 4JFJA 4JFKA 2FAPA 2XPBA 2BA1A 1JNSA 1R9HA 4WKFA 4U85A 2OFNA 5E64A 4WJXA 4G50A 5CQ2A 1EIBA 2ZAJA 1NWSA 1FFQA 4ZPVR 3WD0A 2A3AA 2L4JA 4WKAA 3CHFA 4J4NA 1FKLA 2G41A 1XRVA 4E5RA 1O6IA 4MNKA 3ALFA 3FSCA 4A0TA 2DJYA 3RM4A 3AQUA 2DK1A 2YSHA 4DRPA 3IHZA 2YSIA 1Y0OA 3TDBA 3O5QA 2Y78A 3UF8A 3B9DA 3CH9A 2B31A 2ZR4A 3ARPA 3B9EA 4MNJA 2YBTA 3O5IA 3B7XA 2LPVA 4JFMA 3ALGA 2DPEA 4DRQA 1ITXA 3LKXA 4U84A 2WM0A 4QT3A 2JMFA 3CZ8A 4IQCA 3RGCA 1WR7A 1QZ2A 1IX5A 2LGOA 4LAVA 2DG3A 3ARUA 3WKZA 4JYSA 3RM8A 4TW6A 3PA7A 1HKKA 4QZVB 4PTMA 2FDMA 1J4HA 4TW8A 4J4OA 1ROTA 5GPGA 1Q1CA 3M7NA 3WD3A 4DRJA 4Z2LA 4MGVA 3MDYB 1ZBKA 4JFLA 3KZ7A 4ODQA 1KFWA 1LJYA 1OWQA 1ROUA 2ZQTA 1NWTA 2RUQA 2PPNA 1GOIA 2PV2A 2PPOA 3OA5A 5HBFA 3H9RB 2XP3A 1ZBCA 3PRAA 3G6LA 4NNRA 5DIUA 4ML4A 4LGXA 3AS1A 1BL4A 1QPLA 1C9HA 2MNTA 2IF4A 3WL1A 3TCZA 3LUOA 3RFWA 1FJDA 4DT4A 1UR9A 4ODNA 1RD6A 4MPKA 2RSEA 1ZBVA 1TFVA 1FKFA 1FKJA 3ARQA 4S3JA 3O5MA 4W9OA 2XP8A 4WIWA 4DRHA 2DSVA 1LG2A 1NMWA 2M8JA 2AOSA 1JNTA 3ARWA 5HUAA 2DSZA 1WAWA 3MQHA 3O5JA 4QT2A 4LAWA 3UI5A 3IK8A 2XP9A 3O5GA 1W9VA 4TX0A 3TC5A 1ZK6A 3CHCA 1WNOA 2DMVA 3UQBA 5BXJA 5DEZA 5E5WA 2A3EA 2AWGA 2F4EA 3KAFA 1K9QA 1FAPA 1B6CA 3PRBA 4WK9A 4FAPA 4MAVA 3PQHA 3CGNA 3O5EA 1TCOC 2RUDA 1FKKA 4DZ2A 2ITKA 2IUZA 2K8IA 1U79A 5D75A 3ARVA 4JFIA 3RMEA 3WIJA 2ZQSA 1GPFA 4NZCA 3ODKA 1NH6A 2UZ5A 2XP6A 3O5KA 4HARA 4MNLA 2KI3A 1K9RA 3KCEA 3M85A 2YSBA 1J4IA 3LKXB 5B8IC 1CTNA 4W5UA 3VAWA 1D7JA 2XP7A 4LAYA 1HJXA 3CHDA 2MLZA 2G8ZA 3NTPA 4U86A 3KADA 4KR0B 1FKBA 1OGGA 3NRKA 1EHNA 2KE0A 1Q6HA 5E62A 4DWSA 5I98A 3KAHA 2KGJA 2XP5A 4ODRA 5AHTA 2F21A 1JNDA 2PV1A 4TW7A 1KT1A 1LL6A 2JZVA 1ZCNA 1LQ0A 1E6RA 4S3KA 4Q22A 3ARZA 4Z2JA 3LE4A 5JH8A 3B8SA 3CNGA 2DG9A 5HTGA 3O5PA 2RUCA 2EZ5W 5HKGA 2ZR6A 1T11A 4R0XA 3WQVA 1EG3A 3RM9A 2YAJB 3IKDA 3AS2A 2ESCA 4URIA 3FAPA 4FN2A 4ITZA 2WAEA 1YATA 3BXWA 4W9PA 1ZL1A 3GPKA 3JYJA 3WL0A 1E6PA 5J6EA 2DK7A 1H0IA 4DRNA 3O5DA 4MTVA 2DT0A 2ZQVA 1VF8A 1W1PA 4DRKA 1D7IA 3WH0A 2KFWA 4DRIA 2KO7A 1A7XA 1EDQA 4IPXA 4DIPA 4C02B 3UI4A 1BKFA 4GGQA 4ODOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQI A;  4QIB A;  2M8I A;  3CGM A;  1FKS A;  3IKG A;  2XPA A;  2YSF A;  2AWG A;  3KAF A;  1K9Q A;  1FAP A;  2F4E A;  1B6C A;  2LJ4 A;  1FKL A;  3PRB A;  5HW6 A;  4W9Q A;  3I6C A;  3UI6 A;  4FAP A;  4E5R A;  3CGN A;  3JYM A;  3O5E A;  1FKD A;  3UQA A;  2DJY A;  2JX8 A;  2Q5A A;  4REX A;  1TCO C;  2RE3 A;  2RUD A;  4TW7 A;  1FKK A;  2DK1 A;  2ITK A;  2YSH A;  2K8I A;  1U79 A;  3IHZ A;  5D75 A;  1NSG A;  4DRP A;  4DZ2 A;  4JFI A;  2YSI A;  1Y0O A;  2MDI A;  3EY6 A;  3TDB A;  3O5F A;  5HWB A;  1EQ3 A;  2E45 A;  4O2T A;  2ZR5 A;  3O5Q A;  2Y78 A;  3NI6 A;  2ZQS A;  3UF8 A;  3L4H A;  2MPH A;  2ZR4 A;  1KT0 A;  3O5I A;  3B7X A;  2LPV A;  3ODK A;  2UZ5 A;  3OOB A;  4JFM A;  4TNS A;  4DRQ A;  1FKI A;  2XP6 A;  4U84 A;  3O5K A;  5HW8 A;  4QT3 A;  1EG4 A;  2KI3 A;  2JMF A;  2M3O W;  3KCE A;  1K9R A;  1W26 A;  2PBC A;  1FKG A;  3M85 A;  2YSB A;  1J4I A;  1WR7 A;  1QZ2 A;  4IQC A;  3RGC A;  4DRO A;  4ODM A;  5B8I C;  2LGO A;  3VAW A;  4LAV A;  2DG3 A;  1D7J A;  2XP7 A;  4LAY A;  2M1I A;  2PPP A;  4JYS A;  1O6W A;  1TK7 A;  4MSP A;  4TYO A;  4TW6 A;  3PA7 A;  1FJD A;  2MLZ A;  1J4H A;  4TW8 A;  4J4O A;  1J4R A;  1I5H W;  1ROT A;  4ODK A;  5GPG A;  4U86 A;  3NTP A;  2D9F A;  1Q1C A;  2N87 A;  3KAD A;  3M7N A;  2F2D A;  1FKB A;  3O5O A;  4BF8 A;  4DRJ A;  5HW7 A;  4MGV A;  3NRK A;  4G2P A;  3O5R A;  3MDY B;  3PRD A;  4JFL A;  2PV3 A;  2DWV A;  2LAJ A;  2KE0 A;  2M08 A;  1Q6H A;  3KZ7 A;  4GIV A;  5HWC A;  5I98 A;  3KAH A;  1Q6I A;  2KGJ A;  4ODP A;  4ODQ A;  2XP5 A;  1P5Q A;  2M2A A;  3KAB A;  4ODR A;  1ROU A;  2ZQT A;  5AHT A;  2RUQ A;  2PPN A;  4DH0 A;  3KAI A;  1D7H A;  1NMV A;  2F21 A;  3O5L A;  2PV1 A;  2VCD A;  1KT1 A;  1F8A B;  2PPO A;  2DG4 A;  2PV2 A;  1Q6U A;  1ZCN A;  2JZV A;  2VN1 A;  3H9R B;  2XP3 A;  1HXV A;  4NNR A;  3KAG A;  4IQ2 A;  1D6O A;  5DIU A;  3KAC A;  5DIV A;  1BL4 A;  3LE4 A;  1QPL A;  1C9H A;  2MNT A;  2IF4 A;  3CNG A;  4ODL A;  1EYM A;  1FKT A;  2DG9 A;  2KR7 A;  1WMV A;  1FD9 A;  3TCZ A;  2RUC A;  3LUO A;  3O5P A;  3RFW A;  2EZ5 W;  2FKE A;  4DRM A;  4DT4 A;  5HKG A;  2JV4 A;  2L2S A;  2ZR6 A;  1T11 A;  1PIN A;  2RUR A;  1EG3 A;  4ODN A;  4R0X A;  2RSE A;  5HTG A;  3IKD A;  5DIT A;  1F40 A;  1PBK A;  1QPF A;  4N19 A;  3FAP A;  4FN2 A;  1N1A A;  1FKF A;  2XP4 A;  1FKJ A;  4W9O A;  3O5M A;  1YW5 A;  1J6Y A;  4ITZ A;  1M5Y A;  2MF9 A;  2MLX A;  2XP8 A;  1FKH A;  1YAT A;  4W9P A;  5HT1 A;  1L1P A;  2MLY A;  4DRH A;  3GPK A;  3JYJ A;  2YSG A;  2ZQU A;  1NMW A;  4J4N A;  2M8J A;  4JFJ A;  4LAX A;  1JNT A;  5HUA A;  4JFK A;  5J6E A;  2FAP A;  2DK7 A;  3O5J A;  2XPB A;  4QT2 A;  2BA1 A;  3O5D A;  4LAW A;  4DRN A;  1R9H A;  4DZ3 A;  1JNS A;  1FKR A;  2ZQV A;  3UI5 A;  3IK8 A;  4U85 A;  2XP9 A;  1JMQ A;  2OFN A;  4DRK A;  1D7I A;  3WH0 A;  2KFW A;  3O5G A;  2LKN A;  4DRI A;  2KO7 A;  1A7X A;  3JXV A;  4G50 A;  3TC5 A;  4TX0 A;  5CQ2 A;  1ZK6 A;  2ZAJ A;  4IPX A;  4DIP A;  4C02 B;  2KXQ A;  2JXW A;  3UI4 A;  1BKF A;  1JVW A;  2RQS A;  2DMV A;  4GGQ A;  3UQB A;  5BXJ A;  4ODO A;  2L4J A; 
#chains in the Genus database with same CATH topology
 1E6N A;  5U47 A;  2QRV A;  2M8I A;  3MCB A;  2F23 A;  1FKS A;  3ARX A;  3CGM A;  2XPA A;  3GU0 A;  3IKG A;  5HW6 A;  2LJ4 A;  3I6C A;  4Q7N A;  3UQA A;  2JX8 A;  1NWU A;  1X6N A;  1NSG A;  1SR0 A;  1ZU8 A;  3O5F A;  3EY6 A;  1EQ3 A;  4R5E A;  2ZR5 A;  2WLZ A;  3NI6 A;  3L4H A;  1HJV A;  1H0G A;  1KT0 A;  3WQW A;  4TNS A;  1K9T A;  4DWS B;  4P8X A;  3FY1 A;  1FKG A;  3QOK A;  4P8V A;  2OWO A;  1W9U A;  5DF0 A;  1JCH B;  1TK7 A;  4TYO A;  4NSB A;  1NWR A;  1J4R A;  4ODK A;  4P8U A;  2D9F A;  1UR8 A;  1WB0 A;  3ART A;  2F2D A;  5HW7 A;  3O5R A;  3CHE A;  3AS0 A;  2DWV A;  2LAJ A;  2M08 A;  3MQG A;  1Q6I A;  5E66 A;  1JNE A;  4ODP A;  2M2A A;  3KAB A;  4DH0 A;  1W1V A;  3KAI A;  1NMV A;  3O5L A;  2VCD A;  1XHG A;  2Y8N B;  1E15 A;  2DT2 A;  4IQ2 A;  4DWS C;  1D6O A;  5DIV A;  3KAC A;  2DSU A;  4L72 B;  1D2K A;  4Z2H A;  1EYM A;  1FKT A;  1WMV A;  4L3N A;  1HKJ A;  2RUR A;  2L2S A;  3B9A A;  2OLH A;  1F40 A;  1QPF A;  3FS8 A;  3ARR A;  1N1A A;  1HKM A;  1J6Y A;  1M5Y A;  2MF9 A;  1FKH A;  3WD2 A;  3ARO A;  2YSG A;  2ZQU A;  4DWS D;  4LAX A;  4AY1 A;  3FXY A;  2ETN A;  4KQZ A;  4DZ3 A;  2WLY A;  1FKR A;  1FFR A;  1LL4 A;  1JMQ A;  4Z2I A;  3PR9 A;  2A3C A;  2LKN A;  5GPR A;  3JXV A;  1ZB5 A;  4WKH A;  3MCB B;  2KXQ A;  2JXW A;  1JVW A;  2RQS A;  1HKI A;  3UQI A;  5E65 A;  4QIB A;  1FLC A;  2YSF A;  4Z2G A;  1OGB A;  4IT6 A;  2PI6 A;  4W9Q A;  3UI6 A;  3JYM A;  1FKD A;  2Q5A A;  4REX A;  1W9P A;  2RE3 A;  4ZS6 A;  4Z2K A;  2MDI A;  2E45 A;  1LL7 A;  4O2T A;  2O92 A;  2MPH A;  4XAK A;  1X6L A;  3WD4 A;  4P8W A;  3OOB A;  1FKI A;  5DO2 A;  5HW8 A;  1EG4 A;  2M3O W;  1W26 A;  2PBC A;  4DRO A;  4ODM A;  4MNM A;  4ZPT R;  1LG1 A;  2M1I A;  2PPP A;  1O6W A;  4MSP A;  3ARS A;  3FSB A;  3W4R A;  1E9L A;  2DT3 A;  2DT1 A;  1I5H W;  3O5O A;  2B5U B;  2N87 A;  5HWB A;  4GLX A;  4BF8 A;  2O9O A;  4G2P A;  3PRD A;  2PV3 A;  3AS3 A;  2DSW A;  4GIV A;  5HWC A;  1SYT A;  3WD1 A;  2QF8 A;  1P5Q A;  3ARY A;  1TR8 A;  1D7H A;  1HJW A;  2VN1 A;  4DRM A;  1F8A B;  2DG4 A;  1Q6U A;  4IT4 A;  1HXV A;  1ZBW A;  5GQB A;  4HBE A;  3BMB A;  3KAG A;  1W1Y A;  4ODL A;  2KR7 A;  1FD9 A;  2FKE A;  4A0U A;  2JV4 A;  1PIN A;  2A3B A;  1RP5 A;  5DIT A;  1E6Z A;  1W1T A;  1PBK A;  4N19 A;  3G6M A;  2XP4 A;  4ZPW R;  4HBO A;  1YW5 A;  2WK2 A;  1GUV A;  2WAD A;  2MLX A;  2YBU A;  5HT1 A;  1L1P A;  2MLY A;  4JFJ A;  4JFK A;  2FAP A;  2XPB A;  2BA1 A;  1JNS A;  1R9H A;  4WKF A;  4U85 A;  2OFN A;  5E64 A;  4WJX A;  4G50 A;  5CQ2 A;  1EIB A;  2ZAJ A;  1NWS A;  1FFQ A;  4ZPV R;  3WD0 A;  2A3A A;  2L4J A;  4WKA A;  3CHF A;  4J4N A;  4UDM A;  1FKL A;  2G41 A;  1XRV A;  4E5R A;  1O6I A;  4MNK A;  3ALF A;  3FSC A;  4A0T A;  2DJY A;  3RM4 A;  3AQU A;  2DK1 A;  2YSH A;  4DRP A;  3IHZ A;  2YSI A;  1Y0O A;  3TDB A;  3O5Q A;  2Y78 A;  3UF8 A;  3B9D A;  3CH9 A;  2B31 A;  2ZR4 A;  3ARP A;  3B9E A;  4MNJ A;  2YBT A;  3O5I A;  3B7X A;  2LPV A;  4JFM A;  3ALG A;  2DPE A;  4DRQ A;  1ITX A;  3LKX A;  4U84 A;  2WM0 A;  4QT3 A;  2JMF A;  3CZ8 A;  4IQC A;  3RGC A;  1WR7 A;  1QZ2 A;  1IX5 A;  2LGO A;  4LAV A;  2DG3 A;  3ARU A;  3WKZ A;  4JYS A;  3RM8 A;  4TW6 A;  3PA7 A;  1E44 A;  1HKK A;  4QZV B;  2P4V A;  4PTM A;  2FDM A;  1J4H A;  4TW8 A;  4J4O A;  1ROT A;  5GPG A;  1Q1C A;  3M7N A;  3WD3 A;  4DRJ A;  4Z2L A;  4MGV A;  2PN0 A;  3MDY B;  1ZBK A;  4JFL A;  3KZ7 A;  4ODQ A;  1KFW A;  1LJY A;  1OWQ A;  1ROU A;  2ZQT A;  1NWT A;  2RUQ A;  2PPN A;  1GOI A;  2PV2 A;  2PPO A;  3OA5 A;  5HBF A;  3H9R B;  2XP3 A;  1ZBC A;  3PRA A;  3G6L A;  4NNR A;  5DIU A;  4ML4 A;  4LGX A;  3AS1 A;  1BL4 A;  1QPL A;  1C9H A;  2MNT A;  2IF4 A;  3WL1 A;  3TCZ A;  3LUO A;  3RFW A;  1FJD A;  4DT4 A;  1UR9 A;  4ODN A;  1RD6 A;  4MPK A;  2RSE A;  1ZBV A;  1TFV A;  1FKF A;  1FKJ A;  3ARQ A;  4S3J A;  3O5M A;  4W9O A;  2XP8 A;  4WIW A;  4DRH A;  2DSV A;  1LG2 A;  1NMW A;  2M8J A;  2AOS A;  3GTY X;  1JNT A;  3ARW A;  5HUA A;  2DSZ A;  1WAW A;  3MQH A;  3O5J A;  4QT2 A;  4LAW A;  3UI5 A;  3IK8 A;  2XP9 A;  3O5G A;  1W9V A;  4TX0 A;  3TC5 A;  1ZK6 A;  3CHC A;  1WNO A;  2DMV A;  3UQB A;  5BXJ A;  5DEZ A;  5E5W A;  2A3E A;  2AWG A;  2F4E A;  3KAF A;  1K9Q A;  1FAP A;  1B6C A;  3PRB A;  4WK9 A;  4FAP A;  4MAV A;  3PQH A;  3CGN A;  3O5E A;  1TCO C;  2RUD A;  1FKK A;  4DZ2 A;  2ITK A;  2IUZ A;  2K8I A;  1U79 A;  5D75 A;  3ARV A;  4JFI A;  3RME A;  3WIJ A;  3EIP A;  2ZQS A;  1GPF A;  4NZC A;  3ODK A;  1NH6 A;  2UZ5 A;  2XP6 A;  3O5K A;  4HAR A;  4MNL A;  2KI3 A;  1K9R A;  3KCE A;  3M85 A;  2YSB A;  1J4I A;  3LKX B;  5B8I C;  1CTN A;  4W5U A;  3VAW A;  1D7J A;  2XP7 A;  4LAY A;  1HJX A;  3CHD A;  2MLZ A;  2G8Z A;  3NTP A;  4U86 A;  3KAD A;  4KR0 B;  1FKB A;  1OGG A;  3NRK A;  1EHN A;  2KE0 A;  1Q6H A;  5E62 A;  4DWS A;  5I98 A;  3KAH A;  2KGJ A;  2XP5 A;  4ODR A;  5AHT A;  2F21 A;  1JND A;  2PV1 A;  4TW7 A;  1KT1 A;  1LL6 A;  2JZV A;  1ZCN A;  1LQ0 A;  1E6R A;  4S3K A;  4Q22 A;  3ARZ A;  4Z2J A;  2EUL A;  3LE4 A;  5JH8 A;  3B8S A;  3CNG A;  2DG9 A;  1GRJ A;  3O5P A;  2RUC A;  5HTG A;  2EZ5 W;  5HKG A;  2ZR6 A;  1T11 A;  4R0X A;  3WQV A;  1EG3 A;  3RM9 A;  2YAJ B;  3IKD A;  3AS2 A;  2ESC A;  4URI A;  3FAP A;  4FN2 A;  4ITZ A;  2WAE A;  1YAT A;  3BXW A;  4W9P A;  1ZL1 A;  3GPK A;  3JYJ A;  3WL0 A;  1E6P A;  5J6E A;  2DK7 A;  1H0I A;  4DRN A;  3O5D A;  4MTV A;  2DT0 A;  2ZQV A;  1VF8 A;  1W1P A;  4DRK A;  1D7I A;  3WH0 A;  2KFW A;  4DRI A;  2KO7 A;  1A7X A;  1EDQ A;  4IPX A;  4DIP A;  4C02 B;  3UI4 A;  1BKF A;  4GGQ A;  4ODO A; 
#chains in the Genus database with same CATH homology
 1E6N A;  5U47 A;  2QRV A;  2M8I A;  3MCB A;  3ARX A;  1FKS A;  3CGM A;  3IKG A;  2XPA A;  5HW6 A;  2LJ4 A;  3I6C A;  4Q7N A;  3UQA A;  2JX8 A;  1NWU A;  1X6N A;  1NSG A;  1SR0 A;  1ZU8 A;  3O5F A;  3EY6 A;  1EQ3 A;  4R5E A;  2ZR5 A;  2WLZ A;  3NI6 A;  3L4H A;  1HJV A;  1H0G A;  1KT0 A;  3WQW A;  4TNS A;  1K9T A;  4DWS B;  4P8X A;  3FY1 A;  1FKG A;  3QOK A;  4P8V A;  2OWO A;  1W9U A;  5DF0 A;  1TK7 A;  4TYO A;  4NSB A;  1NWR A;  1J4R A;  4ODK A;  4P8U A;  2D9F A;  1UR8 A;  1WB0 A;  3ART A;  2F2D A;  5HW7 A;  3O5R A;  3CHE A;  3AS0 A;  2DWV A;  2LAJ A;  2M08 A;  3MQG A;  1Q6I A;  5E66 A;  1JNE A;  4ODP A;  2M2A A;  3KAB A;  4DH0 A;  1W1V A;  3KAI A;  1NMV A;  3O5L A;  2VCD A;  1XHG A;  2Y8N B;  1E15 A;  2DT2 A;  4IQ2 A;  4DWS C;  1D6O A;  5DIV A;  3KAC A;  2DSU A;  4L72 B;  1D2K A;  4Z2H A;  1EYM A;  1FKT A;  1WMV A;  4L3N A;  1HKJ A;  2RUR A;  2L2S A;  3B9A A;  2OLH A;  1F40 A;  1QPF A;  3FS8 A;  3ARR A;  1N1A A;  1HKM A;  1J6Y A;  1M5Y A;  2MF9 A;  1FKH A;  3WD2 A;  3ARO A;  2YSG A;  2ZQU A;  4DWS D;  4LAX A;  4AY1 A;  3FXY A;  4KQZ A;  4DZ3 A;  2WLY A;  1FKR A;  1FFR A;  1LL4 A;  1JMQ A;  4Z2I A;  3PR9 A;  2A3C A;  2LKN A;  5GPR A;  3JXV A;  1ZB5 A;  4WKH A;  3MCB B;  2KXQ A;  2JXW A;  1JVW A;  2RQS A;  1HKI A;  3UQI A;  5E65 A;  4QIB A;  1FLC A;  2YSF A;  4Z2G A;  1OGB A;  4IT6 A;  2PI6 A;  4W9Q A;  3UI6 A;  3JYM A;  1FKD A;  2Q5A A;  4REX A;  1W9P A;  2RE3 A;  4ZS6 A;  4Z2K A;  2MDI A;  2E45 A;  1LL7 A;  4O2T A;  2O92 A;  2MPH A;  4XAK A;  1X6L A;  3WD4 A;  4P8W A;  3OOB A;  1FKI A;  5DO2 A;  5HW8 A;  1EG4 A;  2M3O W;  1W26 A;  2PBC A;  4DRO A;  4ODM A;  4MNM A;  4ZPT R;  1LG1 A;  2M1I A;  2PPP A;  1O6W A;  4MSP A;  3ARS A;  3FSB A;  3W4R A;  1E9L A;  2DT3 A;  2DT1 A;  1I5H W;  3O5O A;  2N87 A;  5HWB A;  4GLX A;  4BF8 A;  2O9O A;  4G2P A;  3PRD A;  2PV3 A;  3AS3 A;  2DSW A;  4GIV A;  5HWC A;  1SYT A;  3WD1 A;  2QF8 A;  1P5Q A;  3ARY A;  1TR8 A;  1D7H A;  1HJW A;  2VN1 A;  4DRM A;  1F8A B;  2DG4 A;  1Q6U A;  4IT4 A;  1HXV A;  1ZBW A;  5GQB A;  4HBE A;  3KAG A;  1W1Y A;  4ODL A;  2KR7 A;  1FD9 A;  2FKE A;  4A0U A;  2JV4 A;  1PIN A;  2A3B A;  1RP5 A;  5DIT A;  1E6Z A;  1W1T A;  1PBK A;  4N19 A;  3G6M A;  2XP4 A;  4ZPW R;  4HBO A;  1YW5 A;  2WK2 A;  1GUV A;  2WAD A;  2MLX A;  2YBU A;  5HT1 A;  1L1P A;  2MLY A;  4JFJ A;  4JFK A;  2FAP A;  2XPB A;  2BA1 A;  1JNS A;  1R9H A;  4WKF A;  4U85 A;  2OFN A;  5E64 A;  4WJX A;  4G50 A;  5CQ2 A;  1EIB A;  2ZAJ A;  1NWS A;  1FFQ A;  4ZPV R;  3WD0 A;  2A3A A;  2L4J A;  4WKA A;  3CHF A;  4J4N A;  1FKL A;  2G41 A;  1XRV A;  4E5R A;  1O6I A;  4MNK A;  3ALF A;  3FSC A;  4A0T A;  2DJY A;  3RM4 A;  3AQU A;  2DK1 A;  2YSH A;  4DRP A;  3IHZ A;  2YSI A;  1Y0O A;  3TDB A;  3O5Q A;  2Y78 A;  3UF8 A;  3B9D A;  3CH9 A;  2B31 A;  2ZR4 A;  3ARP A;  3B9E A;  4MNJ A;  2YBT A;  3O5I A;  3B7X A;  2LPV A;  4JFM A;  3ALG A;  2DPE A;  4DRQ A;  1ITX A;  3LKX A;  4U84 A;  2WM0 A;  4QT3 A;  2JMF A;  3CZ8 A;  4IQC A;  3RGC A;  1WR7 A;  1QZ2 A;  1IX5 A;  2LGO A;  4LAV A;  2DG3 A;  3ARU A;  3WKZ A;  4JYS A;  3RM8 A;  4TW6 A;  3PA7 A;  1HKK A;  4QZV B;  4PTM A;  2FDM A;  1J4H A;  4TW8 A;  4J4O A;  1ROT A;  5GPG A;  1Q1C A;  3M7N A;  3WD3 A;  4DRJ A;  4Z2L A;  4MGV A;  3MDY B;  1ZBK A;  4JFL A;  3KZ7 A;  4ODQ A;  1KFW A;  1LJY A;  1OWQ A;  1ROU A;  2ZQT A;  1NWT A;  2RUQ A;  2PPN A;  1GOI A;  2PV2 A;  2PPO A;  3OA5 A;  5HBF A;  3H9R B;  2XP3 A;  1ZBC A;  3PRA A;  3G6L A;  4NNR A;  5DIU A;  4ML4 A;  4LGX A;  3AS1 A;  1BL4 A;  1QPL A;  1C9H A;  2MNT A;  2IF4 A;  3WL1 A;  3TCZ A;  3LUO A;  3RFW A;  1FJD A;  4DT4 A;  1UR9 A;  4ODN A;  1RD6 A;  4MPK A;  2RSE A;  1ZBV A;  1TFV A;  1FKF A;  1FKJ A;  3ARQ A;  4S3J A;  3O5M A;  4W9O A;  2XP8 A;  4WIW A;  4DRH A;  2DSV A;  1LG2 A;  1NMW A;  2M8J A;  2AOS A;  1JNT A;  3ARW A;  5HUA A;  2DSZ A;  1WAW A;  3MQH A;  3O5J A;  4QT2 A;  4LAW A;  3UI5 A;  3IK8 A;  2XP9 A;  3O5G A;  1W9V A;  4TX0 A;  3TC5 A;  1ZK6 A;  3CHC A;  1WNO A;  2DMV A;  3UQB A;  5BXJ A;  5DEZ A;  5E5W A;  2A3E A;  2AWG A;  2F4E A;  3KAF A;  1K9Q A;  1FAP A;  1B6C A;  3PRB A;  4WK9 A;  4FAP A;  4MAV A;  3PQH A;  3CGN A;  3O5E A;  1TCO C;  2RUD A;  1FKK A;  4DZ2 A;  2ITK A;  2IUZ A;  2K8I A;  1U79 A;  5D75 A;  3ARV A;  4JFI A;  3RME A;  3WIJ A;  2ZQS A;  1GPF A;  4NZC A;  3ODK A;  1NH6 A;  2UZ5 A;  2XP6 A;  3O5K A;  4HAR A;  4MNL A;  2KI3 A;  1K9R A;  3KCE A;  3M85 A;  2YSB A;  1J4I A;  3LKX B;  5B8I C;  1CTN A;  4W5U A;  3VAW A;  1D7J A;  2XP7 A;  4LAY A;  1HJX A;  3CHD A;  2MLZ A;  2G8Z A;  3NTP A;  4U86 A;  3KAD A;  4KR0 B;  1FKB A;  1OGG A;  3NRK A;  1EHN A;  2KE0 A;  1Q6H A;  5E62 A;  4DWS A;  5I98 A;  3KAH A;  2KGJ A;  2XP5 A;  4ODR A;  5AHT A;  2F21 A;  1JND A;  2PV1 A;  4TW7 A;  1KT1 A;  1LL6 A;  2JZV A;  1ZCN A;  1LQ0 A;  1E6R A;  4S3K A;  4Q22 A;  3ARZ A;  4Z2J A;  3LE4 A;  5JH8 A;  3B8S A;  3CNG A;  2DG9 A;  5HTG A;  3O5P A;  2RUC A;  2EZ5 W;  5HKG A;  2ZR6 A;  1T11 A;  4R0X A;  3WQV A;  1EG3 A;  3RM9 A;  2YAJ B;  3IKD A;  3AS2 A;  2ESC A;  4URI A;  3FAP A;  4FN2 A;  4ITZ A;  2WAE A;  1YAT A;  3BXW A;  4W9P A;  1ZL1 A;  3GPK A;  3JYJ A;  3WL0 A;  1E6P A;  5J6E A;  2DK7 A;  1H0I A;  4DRN A;  3O5D A;  4MTV A;  2DT0 A;  2ZQV A;  1VF8 A;  1W1P A;  4DRK A;  1D7I A;  3WH0 A;  2KFW A;  4DRI A;  2KO7 A;  1A7X A;  1EDQ A;  4IPX A;  4DIP A;  4C02 B;  3UI4 A;  1BKF A;  4GGQ A;  4ODO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...