2ZR9A

Msreca q196e datp form iv
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
327
structure length
312
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINELRTTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 100
structure length 312
sequence length 327
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr9A01
4PXAA 2ZE7A 4FW9A 4Q00A 1GFIA 1KI1A 2ZI5A 2ORVA 4QFMA 4EJSA 821PA 1E3MA 2OXRA 1RFLA 2FE4A 4IVRA 4PSAA 4NZYA 3B9QA 5EXTA 4B76A 4MGYR 4L9SA 3CM0A 5HCIA 2IYLD 2WJVA 2FV8A 5B58C 5HR5A 1KO7A 5JCZA 1HQCA 4Q7LA 3I3SR 2HEIA 4A15A 3EZFA 1HEIA 4ARZA 2F9MA 4B33A 3LXXA 3UMRA 5DHAA 4P32A 5EP2A 3CONA 3SNHA 1DO2A 3BFXA 1BYUA 2HXSA 4RJLA 1J8MF 4QM7A 1GKUB 4XTCS 1XZQA 3KXLA 2XAUA 3RS5A 1ZYUA 4L4UA 1S9HA 3MSXA 2F6RA 3KDSE 3OHMA 3U60B 1X86B 1HYQA 3Q7PA 2IYSA 2YINC 4QM6A 3SYKA 1HQYE 2J87A 5FOTA 3H84A 1WA5A 3LWNA 1Q1EA 3IKJA 5FBRB 5SZKB 3LAWA 2CLCX 1GL9B 4CT5A 3AP2A 1NSTA 4PSVA 3N2IA 1Z83A 2GF9A 1GITA 3TK1A 4ITRC 1NBME 1IOZA 1DAMA 5HCNA 1IY1A 3TR0A 2IS2A 3OEEA 5HPYB 1I4LD 4E03A 4IW3B 4URUR 4DB4A 4OKSA 3PG5A 4NPHA 1EWRA 4V0ME 1YZUA 2C2HA 2F43A 4A0HA 1Z6GA 2G77B 2PJRA 3IIJA 3BB3A 1Z0IA 1P61B 2X2FA 1WRBA 3CF6R 1XEFA 4A6XA 4TZ0A 1W0JD 2VRWA 5HKKD 2WWGA 2G88A 2ZVPX 3KXIA 2MSCB 4ZV4A 2QMHA 1ZNZA 3T12A 2PCLA 4OI0A 1MR3F 4NTZA 3CRMA 1G18A 1P2VA 4HLCA 3RS7A 1F2TA 3NXSA 4GPTA 5JEDA 4KO8A 4JBWA 1VG0B 4LJ8A 2GETA 4Y0AA 4DIEA 1E2FA 2B8WA 4I1VA 2FG5A 2AN9A 3HP1A 4A8JB 5B64A 3U3KA 1YE8A 4DEXA 2QT0A 1S3GA 4B3DA 2RGNC 3EX7C 5GJBA 1WP9A 5DNYB 5GVRA 1CS4C 2BBSA 3RC8A 3A1TA 3KQLA 2OFOA 4Q02A 1L8QA 2IS4A 4M9XA 1FTSA 1LFDB 4ZI2A 1WBDA 1Z47A 2D2EA 3T1VA 3TSZA 2LWIA 1CXZA 3F3YA 3BH0A 3QBTA 5KNCA 4M1KA 3AVTA 1T0JB 5BW8A 2XTMA 4GZLA 1KDRA 4NCJA 4P4SB 4QC2A 3TR5A 4F4IA 1Z2CA 4G1UC 2IYUA 2DBYA 2WMNB 1Q57A 4ZDKA 4TLDA 2VSFA 4NYJQ 2ZU6A 1T8TA 3LV8A 1GAJA 2IT1A 2UZ3A 3CNLA 3IGFA 3K0FA 3FHOA 3LVRE 1B0UA 2HJVA 3U3RA 4PQYA 2CNWA 4R98A 2HV8A 2OHFA 2ZETA 4DLZA 2JLSA 4Q1BA 2WKPA 5DI3B 2H7VA 2J0SA 4A0RA 4B43A 1NY5A 2A3RA 4RKEA 1JR6A 4US1R 4Q03A 5HE9A 4DUGA 1FP7A 1P2TA 1E2IA 2D7CA 1COWA 1US8A 4KSBA 4GFDA 5EE5B 2OBLA 5FPSA 5G3YA 1EXMA 3HDTA 5CM9C 4B6EA 2QRZA 1VCNA 3K9GA 3Q9LA 2V7QA 1G7TA 2GCNA 3TJZA 3ZZUA 2F1IA 4M8NE 1R7RA 2QN6A 4WVFA 2BMEA 1T91A 4QGFA 1ZU4A 1LW7A 3U44B 4MYUA 2P5SA 4YMWA 1S4QA 1R0WA 5IK2A 4LCBA 5EJEA 4BZXA 3FOZA 1NJFA 5GVSA 2G9NA 2OEPA 3A4NA 1T4GA 3TAUA 2IF0A 4LBVA 4JYBA 4MKGA 1G21E 4WIAA 2EFHB 2QY9A 4QHSA 4I81A 2YWEA 3CX6A 1RJ9A 1W1WA 1E96A 4W5JA 4LJ6A 4JVNA 1GTVA 1EFRA 1E2DA 2JAQA 4QHYA 4F4CA 2WWIA 4G5SA 2R6DA 1XB2A 2ZROA 2WSSA 1KDPA 1EX6A 3MUFA 2AKYA 4MRSA 5LB2A 3ZQJA 2QGZA 4LYJA 4RD4A 1VMAA 3KB2A 1DOAA 3C15C 3VR2A 2FPKA 4F93B 4UNNA 3LLMA 5H8WA 4URYR 3I5XA 4URWR 4AURA 1WDTA 2A5JA 4IOLA 3K0SA 1COWD 5AJYA 1FMLA 3B60A 2W83A 3S1AA 1ONBA 4OHWA 1G5RA 2V7QD 4ESVA 4LJ5A 4V03A 5DE3A 2ZI9A 1M7HA 4BRWA 5HTKA 3RS0A 2FN4A 1KHTA 3EZ6A 2GZAA 1H8EA 1ZCAA 3SBEA 4CVNA 1YVDA 1MO5A 1OJLA 1EFCA 2QSYA 5DYGA 5FOWA 5IK2D 2J3EA 1N6OA 3AVUA 2IC5A 2W6JA 2ODWA 3JVVA 3W6OA 1Q1QA 3EG5A 5KO2A 2EWVA 5L3QA 5BYJA 1IN6A 3GLHB 2QTFA 5FBWB 4IXNA 4JJZA 3WHLA 1IN8A 2O8DB 2RGDA 4AYTA 1EFRD 5FI1B 3VR4A 4L16A 4BFSA 1II9A 2KWIA 1IN5A 2QAGB 3B1VA 3K09C 1NN1A 4QGGA 4R7ZA 2WSSD 3VR6A 5F98A 3FYHA 1AS3A 4C2TA 4RZ2A 2IYTA 2MMGA 1XJCA 3B78A 1KI9A 3KJIA 4Q1CA 3DKPA 4MQBA 2A30A 2W00A 2GZHA 1WCV1 1P2SA 2XOKA 1BMFA 2YVUA 1W0KA 5BWMA 4LK2A 4NBSA 1PLKA 4Q4AA 4G01B 4KVAA 1G9XA 1JXMA 3QY0A 4FMBB 4B3BA 2UZIR 3A1UA 2IWHA 2EYQA 4RZXA 1YZKA 1X3SA 2N1BA 2XJ9A 1SHZA 2JIZA 4CGZA 4RD3A 1X1RA 1U99A 2QL6A 3IIMA 2JLXA 4PAQA 1AS0A 1NBMD 4KFSA 1GZSA 1KAOA 3BB4A 1H8ED 2ZTSA 4Q9HA 2QA5A 2ZI6A 2QPAA 3UK6A 1KMQA 1E2NA 5FTLA 1P9WA 2NZJA 4LJAA 1FZQA 1D2EA 2P3SA 1Q1ZA 1SKYB 1VHLA 3H4MA 2VLIA 5FOXA 4LDJA 3WNBA 4IFBA 5L3SA 2VHCA 1P7CA 3CLVA 3UIEA 1Q1BA 2CBZA 3P27A 4NL4H 4QBIA 1E4VA 3I1FA 1LY1A 1YRAA 1P3JA 4QL3A 2OFXA 1OH7A 3Q7QA 2QBYA 4MDFA 2OCAA 3EIEA 2J5XA 4A2QA 3FHTA 4GBMA 4A1FA 3NWJA 4V02A 2C96A 4B75A 1BMFD 2ZPTX 3MJHA 4TTQA 1YQTA 1VCIA 1W0KD 4BLSA 1Z0AA 4Q5IA 4NCNA 5EE9A 1NN3A 3AGPA 2EW1A 1KK3A 2IYZA 3VNUA 3ECCA 4Q48A 3ZVRA 4PHHA 1A5TA 3ADBA 2VTKA 3G5UA 2ATXA 1KSHA 4PSKA 1RZ3A 1SVSA 2FZ4A 4Q1FA 3SHWA 3KQUA 2GXUA 3U2QA 4POAA 3MLEA 4LHVA 3F5FA 5FPTA 2WTUA 2ZRCA 1E9DA 3NEJA 2J41A 4XIGS 2J0UA 2R44A 3RWMB 4KFUA 3K0CC 5J4HA 4IEEA 4QBHA 5JJIA 2G0NA 1NVVR 3LLUA 3UATA 1ZD9A 3WMGA 5EE0A 2GF0A 4JLMA 5KUTA 2XB2A 1BO6A 3CRVA 4YMSA 2ATVA 4LWZA 4DJTA 2OESA 2O8FA 3C4JA 5TY0A 1VG9B 4TYWA 2IXFA 1SVKA 1W2GA 3I72A 1XXHE 2KSQA 3QJYA 2FGKA 2WBLC 1SVOA 3QXSA 2XITA 2PH1A 2V4ZA 3C5HA 4NCIA 4Q1EA 3GP8A 2GJKA 1E1RD 1Z8FA 1OYWA 2GCOB 2V55B 1E4YA 3PIRA 1UBCA 3K9LA 2D2FA 4TLBA 2OLJA 1AA9A 3L2OB 2BCJQ 4KAXA 1I4TD 1U98A 2FFQA 2WWYA 3B7GA 3HR7A 4Q4JA 1OFUX 4AY2A 3AKEA 2QZ4A 2ZRLA 5GADl 1IHUA 5JRJA 2CHQA 1S9DA 2FH5B 2QM7A 4O25A 3VU9B 1W44A 2CK3A 2P0EA 1JR3E 5JWHA 1N6RA 4RZUA 2GJSA 3RWOA 3QKSB 1OXVA 1O3YA 2VP6A 2QG6A 3BGWA 2BBWA 3CPEA 4C9BA 2IYRA 2RCNA 2ZS7A 4JBXA 2RHDA 2IXGA 3GCGA 4U7DA 3CX7A 1SXJE 2Q3MA 4GT1A 4BPBA 1OKKA 2Q21A 1TQDA 3TNFA 1G4AE 4CEHB 1TTTA 3ICEA 1DAFA 3TVDA 4C0JA 4AYXA 4MRRA 4UXIA 4KBFA 1XD2A 1DARA 4EFNA 2O52A 4C7OB 1KK2A 5A4JA 2YKGA 1G8HA 4J0QA 5AUNB 4S2EA 1OXXK 2NIPA 4CEIB 1UM8A 3GJ5A 1X8LA 3NBXX 2VP2A 3NDPA 4ZPXA 1KI6B 5TVKA 4AWXA 4D4MA 1GWNA 1WMSA 1F2UA 2Z0MA 3UWOA 4C2UA 3VKGA 3EA0A 2V54A 4JKYA 2CHVA 4FINA 1TEVA 3IUYA 3RYTC 3L0OA 1DAEA 4C0KA 1KI8A 1K8RA 3K8YA 2VEDA 3B1YA 4FWIB 3QXCA 3IBGA 2BDTA 1JQJC 5L3RA 5JSZB 4Q4HA 3OEHA 1YJ5A 2FZLA 2H17A 4HUTA 2WIBA 2WV9A 1J2JA 2CE2X 1KJWA 2XTNA 2ZRKA 1M7GA 4HLUC 1G5TA 3NC1C 4IOMA 1E0AA 1E6CA 1GUAA 4JT4A 3UG6A 1AKEA 2JATA 3X1ZA 4DIDA 1JB1A 1S1CA 1T5IA 3A1SA 2ANCA 4ZO4A 1FQJA 2QRNA 3CZQA 3GLGB 2VHUA 1TUEA 1ANKA 2A7QA 2WSMA 3LDAA 5FR2A 1OFTA 3V4RA 1DVRA 1OKKD 2IYQA 4OQFA 2P67A 3EARA 4YMVA 3BFVA 2AXPA 3KKQA 3WYAA 1DBSA 2G3YA 2PZGA 2XNDD 1CU1A 1YRBA 2BEJA 2IA5A 2RMKA 2ZJ8A 3QVUA 2YOHA 4IKEA 4IDPA 5FTKA 1H8HA 1RVDA 2J46A 4PPNA 2C9YA 3BH6A 3CH5A 4M2LA 3MWYW 2G6BA 4KFRA 4JLPA 1XU4A 2BC9A 1NF3A 1LV7A 4PFSA 4P33A 2ZM5A 1E2JA 2JLQA 5AJXA 1G20E 2GJ8A 1GP2A 1FP6A 4A8JC 3TUJC 1R4AA 3ZIAA 1YR8A 3THYA 5AJZA 4EPTA 1KDTA 4WW0A 3SFVA 1VCOA 1N3BA 5SZHB 4US2R 6Q21A 1RE0A 1XPOA 1A1VA 2XTZA 3MJRA 5CIQA 3P4YA 4BECA 4RZ3A 1ZNWA 4MITA 2O0JA 2H16A 1Y3AA 1FMJA 2ZJ5A 4G5QA 3DDCA 3RAPR 2FWRA 3BAFA 5JECA 1DO0A 2HT1A 4HAXA 4PTLA 3L0IB 1NKTA 1SVIA 1E2PA 2DYKA 3IQXA 3OIVA 3QUSA 3DMDA 2WJHA 2LCFA 3HYRA 1LS1A 3QF7A 221PA 1J8YF 2W58A 2ZI7A 2B92A 3EA5A 1X8KA 3PR1A 1NP6A 1D6JA 2ZRJA 2FMXA 4C4PA 3IDQA 3QF4B 3T15A 4OQNA 4CW7A 1XCPA 2FEOA 1XMVA 2W2TA 3M6AA 5D3MB 1OIXA 5KSOA 4W9MC 3EWSA 1W4CA 1GNPA 1ZU5A 1NLFA 3GLFE 1MO6A 1YR6A 2R6AA 4DLTA 2KE5A 2YC4C 1XJ0A 3OE7A 4UNSA 2CCGA 2HDNB 1OFHA 4TLAA 1RPZA 2OFWA 3B13B 3CWZA 3NKVA 2IUUA 2W2XA 4DEYA 4M0LA 3ICQB 4PHTA 3R8CA 1HT2E 3ZIAD 2YNMA 3PENA 3ND8A 5BN5A 4TQ9A 4M1OA 2WOJA 4CRWB 2J0UB 1NLZA 5AK0A 5KHOC 1E2KA 1V5WA 2BEKA 2QMOA 1W49A 4WBSA 1SXJA 3K70B 1SKYE 2J0QA 3B82A 2Q6TA 4M1TA 1J99A 1KTVA 3Q5DA 3RSOA 2HLDA 1N5IA 3CRW1 4NH0A 3SFZA 721PA 4EQ6B 4G0NA 4K81B 5JS8A 3K0AA 5CYPA 1SVWA 2RGBA 2WVJA 3U3MA 2MSDB 2XZLA 1QVRA 2PCJA 4PC6A 4CIDA 3LH5A 5JMTA 3ADCA 1OH8A 3AM1A 3NVAA 2G83A 3GMTA 4TQUS 1DADA 1KI7A 1U8AA 3GJ0A 1OF1A 1VTKA 2FFAA 3GLIB 3OIUA 5K8UA 4R71A 1D2MA 3DOFA 4F92B 2O8EB 2GWHA 4K8OA 3RDPA 3A6PC 3LA6A 4V0KA 1FUUA 2WJYA 3VR5A 3OE7D 3KKNA 4ON9A 4C3ZA 4MA4A 4DCNA 4V0OA 3C14C 1U8YA 2CLDX 4MGIR 2UVQA 1JR3D 1E0SA 1DAGA 1TF2A 1T8UA 2ECKA 3CNOA 3U7FB 1ZM3A 2O8CB 4MYHA 4QRHA 1G7CA 5TDHA 2QQEA 2OG2A 4A2PA 1D2NA 2RGCA 2VPPA 3PXGA 4OI1A 4DLYA 2W6ID 3OESA 1SXJD 2OCYC 4B6FA 3DZDA 1W4RA 5CK4A 2FOLA 3L82B 3ASZA 2J59A 4RD0A 5ANRB 3FB4A 4O2RA 3HWSA 2FGJA 2CDNA 2QAGC 3AKCA 2W0SA 2NPFA 1KOFA 3CF0A 2DFTA 3SQXA 4BFUA 2DCUA 2VYFA 5P21A 4JKIA 3SJBA 3KKPA 3QPUA 4HLDA 4URVR 5J47A 2VH5R 2QMEA 4DXAA 2AK3A 1N6HA 4DLUA 4DLSA 1OXUA 1ZM7A 2GK7A 3CR7A 1W48A 3HU2A 1QZXA 2GAOA 1X6VA 4D80A 1HY3A 1YZGA 4XVUA 1RRCA 1JI0A 2GVDC 1E79A 1GKYA 2KBEA 2QNRA 2RKOA 2V6IA 4IXMA 2WM9B 3SHFA 2RGXA 2R62A 2IYVA 1U2RA 1QHYA 1Z0DA 4I4LA 3ZD7A 4PO8A 1HE8B 5AJVB 1LNZA 4N3NA 1UEJA 1XF9A 1YHNA 3TUIC 3B6EA 1Z06A 2GJAA 1ESNA 3AF0A 1W0JA 1N6NA 1KZ7B 2XJ4A 5HKKA 1N0UA 4CEJB 3NHBA 4HUQA 4M4SA 4EDHA 3UWKA 1UADA 2XSZA 4HDOB 2OUKA 4C0LA 2D7DA 4AKGA 2F9LA 4QKQA 4I1UA 1ODFA 3LW8A 4NDZA 4DDWA 1E99A 1Z6TA 5FUWA 3U4QB 3RS3A 4XJXA 2IUSA 3KKMA 1TEXA 1ZINA 1E32A 4JL6A 1CKEA 2AWNA 4DT1B 1AA3A 1S0UA 1GRNA 4FMDF 5K8TA 5CM8B 4A0GA 1NG9A 3AVXA 3THXB 4GMDA 1SHKA 4ZDIA 1RW4A 2DB3A 1XCGB 3H0KA 3GLFA 2ERXA 1P2UA 2WJIA 1NI3A 5CK5A 1R5BA 5KDOA 2R6CA 3IIKA 5J40A 3X1YA 4D2IA 5TXGA 3OZXA 4D4JA 1C4OA 1KO1A 5FUVA 3AV0B 1E79D 2CVHA 2ODNA 2FEMA 1MABA 2WIAA 3E5HA 4P4TA 3AVPA 1G16A 1D5CA 3LVQE 3QPWA 3F8TA 1KI4A 1NIJA 4W7SA 1G7SA 1C1YA 1MKYA 1R0ZA 2AFIE 4OK6A 1G5PA 1OH5A 2ZRFA 3DHWC 3JVUA 2XSZD 2KBFA 4RD2A 3SR0A 2HXYA 4Z8YA 1SGWA 1CJVC 1MRNA 3VQTA 3C41J 1HTWA 1U0HC 4N0EA 3PITA 3B2EA 4E22A 4PQRA 5KYKA 2VP4A 5FUYA 3UG7A 3ZQ6A 3CUEF 2QP4A 5A5GA 2JA1A 1XMSA 3PCRB 5BN3A 1T0HB 1ZUIA 2ZUBA 3GJ3A 1QBKC 2X8AA 1QHHA 2JJ8A 1QHNA 3IBYA 2CEAA 2ZRPA 2ZJAA 3KXKA 2WAYA 2ZREA 4PZYA 2ORWA 3HR8A 3DL0A 4P31A 1WXQA 4Q21A 1Z6XA 2HF9A 4IEIA 1AJEA 3WXMA 2JASA 4JLDA 3LX5A 4QNMA 5LDDC 2VIIA 1JAHA 2GXSA 4E07A 4U02A 1LF0A 1TL7C 2XGJA 1VCMA 5BXQC 5KTYA 1BKDR 1KKMA 3AVVA 2J1LA 3P20A 4U00A 4Q9IA 1OE0A 4A92A 4B3FX 3QBVA 1ELOA 1UF9A 3OFND 3ZVLA 4MRVA 2GBLC 3C16C 1XTQA 4M22A 2G1KA 4PZLA 5DN6D 2QENA 1SQ5A 5DISB 2ZI4A 3C5CA 3M0EA 4ACAA 4KODA 3FFBA 3I61A 2OT3B 5E7IA 1DAIA 3RRZA 3UPUA 2JJ2A 4KLNA 4RD6A 5CDFA 4MDEA 1Q12A 1E94E 2ZYUX 1GDDA 2RGNA 3I92A 4PAOA 2Y8EA 3B9PA 1KMHA 3UKDA 4A9AA 2EFGA 1J7KA 1J90A 1II8B 2WZQA 5JFGA 3I8XA 4JLBA 2HYIC 1NMYA 1GILA 4M9QA 1HE1C 4AD8A 1NKSA 2Z4SA 3R7WB 3M4YA 3AF1A 2FA9A 4HZUB 2D06A 3A4LA 1XNJA 4K46A 2IEZA 2X19A 4Q9LA 1SVMA 2ZXUA 3CB4A 3V00A 5AJWA 1ZRHA 1NMXA 5DGXA 1MH1A 2CJWA 3JZAA 2ZRBA 1CULC 3THWB 4B44A 1BYIA 2C9CA 1G291 2PLRA 3NDBB 5FL3A 3HPQA 3SJCA 2ZE8A 1F60A 2G1JA 2ONKA 2ORIA 4XSHA 1E9AA 1MOZA 2O0KA 2HUPA 3VX4A 5IHPA 4LHWA 4AKIA 4LRWA 4DB2A 2VP0A 4NYMR 1G64A 3EIQA 1GG2A 4QOSA 2NG1A 2OO7A 1Q0UA 4TMVA 1U90A 5EQTA 1XD9A 1N2CE 4IOJA 3ZS9A 4LPKA 2XXAA 1XEXB 3TKLA 3E1SA 2H5EA 2ZSDA 2Z5FA 1QF9A 1ZNYA 4LJ9A 2JJ2D 3B5JA 3Q8XB 2O8BB 3B1XA 4FCVA 4IDOA 1Z0FA 1NVVQ 2X77A 1NBMA 1NMZA 4L8GA 2PMKA 2R9VA 3VHXA 4TYQA 2R8RA 3Q85A 4PPGA 5IDVA 1IXZA 1KAGA 2I1VB 2ZJOA 4EJSB 2HYDA 4BLRA 621PA 5LB4A 2YZ2A 3D31A 3QOFA 2IYYA 3R20A 3KJGA 2DY1A 4RFSA 4V0MA 4B71A 3AP3A 4UJ3A 1HURA 4L9WA 2BBTA 4DHEA 4ARZB 1IN7A 1D9ZA 2P6RA 3T5GA 3BORA 2VBCA 2VQSA 2BJVA 2VHTA 2V8OA 3BBPA 3BK7A 3QKTA 4G5OA 3ZLJA 2Z83A 4EPVA 3I62A 2ZSEA 5CJ2A 1Q21A 1KK1A 4PC2A 5CB8A 4HUQB 1FX0A 2IW3A 3SQWA 4NONA 5DO9A 1E98A 5FTJA 1TF7A 1W46A 3KJEA 4KSCA 2CHGA 2JDIA 3MD0A 4JYCA 2PX3A 3OIYA 1CR1A 3TSWA 4M1YA 3SZRA 4OI2A 4LUCA 3GEEA 5GJCA 2FFHA 1T3LA 2Q9AA 3U5ZB 1TQ2A 4LJ4A 4BGDA 4OQMA 5J4LA 3M1IA 1R0YA 2IYWA 4Q9JA 1XZPA 4BFXA 4NYJR 3BWDD 3H86A 2PJZA 5FPKA 1DAKA 3MWJA 4QJ5A 3WNDA 4ZIRA 1KSJA 1CF4A 2C77A 5EP4A 4MYTA 2ZJ2A 3HYTA 2QUZA 1CP2A 2HF8A 3EZ7A 4AYWA 1CLUA 3CPHA 3VR3A 4W5HA 3I8SA 3K09A 3AKYA 3L8YA 1CBUA 4P3YA 4WZBE 3I5YA 1N5KA 3EZ9A 2F43B 5JS7A 1JQLB 2GEVA 3GEIA 4M9ZA 1N6LA 3P1JA 2GRJA 1E9BA 1N25A 4EAQA 1G3IA 3GJXC 1OXTA 3SEAA 4TMXA 3SJAA 4JL8A 4GNKA 1E1RA 1E1QD 2WKQA 4XOIA 3EPLA 4LSGA 1CR2A 3KQHA 2IEYA 1J70A 4DCVA 2HCJB 1OXSC 2IWRA 1F2TB 4LV6A 4PAMA 3MMPA 3K70C 1OW3B 2AWOA 3LFUA 1EG7A 5CITA 2IBMA 4JLJA 3GJ4A 3FVQA 3HPRA 2BM1A 4LV8B 2IL1A 4ASUA 2JDID 5AWFC 1N6PA 5FOUA 1KKLA 3KUCA 1NLYA 3T06B 2QI9C 5KSYA 3RRYA 1WB9A 3IPXA 3GPLA 1IM2A 4AKHA 3GD7A 1NIPA 1UBFA 1XJQA 2EU8A 4DLXA 4FN5A 3TW8B 3CPJB 2OCBA 3W6NA 1VYTA 2P5TB 1DG3A 2OAP1 4BE7B 1KO5A 2WWFA 3A1WA 3NH6A 4H9GA 1A4RA 1RRPA 2J7KA 3BIFA 4QHTA 2QE7A 3W6PA 1L7VC 3EWAA 3DZ8A 3K0FB 5JI3E 1OSNA 1E2GA 3KFXA 1DTSA 3I32A 1QHIA 1M34E 2R2AA 1DS6A 5EZ6B 1ZUNB 1MO3A 5J5CA 3VMFA 2QQ0A 5TMPA 2DR3A 1UBGA 5E3HA 2VP9A 3N5CA 4II7A 5JWOA 1P62B 3CBQA 4YC7A 1YZQA 1E0KA 1JECA 3EAQA 3ADDA 1ESMA 1US8B 1EGAA 2CMKA 3KTAA 1R8QA 2C03A 1K5DA 2C98A 1U9IC 2YC2C 5LD2C 4ASUD 4Q01A 3A8TA 4B74A 1P5ZB 2YWGA 2CL7X 2QP3A 2GZDA 4HEJA 4UJ5A 3B8HA 3K9HA 5B57C 2AD5A 2BWJA 2REOA 4CT4B 4CZ2A 4DSOA 3TRFA 4C0SA 2GEDA 5K8LA 3EPHA 1F3OA 3K0CA 1W5SA 3PQCA 4X8MA 1WE2A 2IS1A 4KCGA 4QJ4A 3CRRA 4HB4A 2R6FA 1T6NA 3U7GA 1ZIOA 3DOEA 4UXHA 3OF5A 1P4SA 1RJ9B 3QKRA 1GOTA 3RRMA 3MGCA 1BS1A 4G3XA 3VKWA 1HV8A 4EFLA 3W3ZB 4NU0A 1IBRA 2R65A 4JSYA 2YWFA 2QE7D 3TIFA 4BFYA 3IO5A 4UXJA 4AIIA 4BFZA 5C18A 2XNDA 5HZKA 1XMIA 2ZAMA 2H57A 2RHMA 2WPDA 3T61A 4FMCB 3IQWA 3P26A 4BEBA 2DWOA 1IQPA 2AFHE 4H1UA 2VO1A 2J45A 2IYXA 3LO5A 4QG7A 2JLUA 4TYPA 4DLVA 2WOOA 121PA 1M6NA 1GL6A 1IJEA 2Z43A 4NHOA 2IF2A 3K70D 1P60A 2YHSA 3O8DA 3Q72A 3S1AB 3ETLA 4KU4A 3T5DA 3L0PA 1U8ZA 4ZDWA 4PO1A 4DDTA 1CJTC 3IHLA 2XNSA 4OK3A 3AVWA 3LBIA 5JLJA 2JLZA 3SU8A 3TMKA 1KIMA 4RVCA 5FL7D 3KUDA 3T1TA 5TV2A 2XEXA 2ANBA 2WWHA 4WA7A 4E5UA 2NQ2C 1GVNB 1UBEA 1AQUA 3BERA 3FKSA 1KJYA 5B2ZA 5L3QB 4JT2A 4LBZA 5AR1A 5EXSA 4Q1DA 1E2EA 3FMPB 4RFSB 1RKBA 2OV2A 5FTNA 3H2YA 4A82A 4KHZA 1UAAA 3TQFA 1Z08A 2D62A 4RY2A 4YDSA 2QEQA 4M9SA 4BZQA 2A78A 1FNNA 4Q47A 1JXOA 2WPDD 1NVXQ 4TL8A 3X1WA 2YOFA 4YLGA 2V1XA 4BLTA 5KPDA 4JLVA 1OH6A 4GI7A 1KO8A 2B6HA 1R10A 4TQAA 1VYUA 2AD1A 2NO7A 2ZE6A 3AGQA 3NBFA 1G8PA 1S1MA 2VHQA 4URZR 3TUZC 4Q4AB 1IXRC 1N5JA 3BB1A 1QG2A 1D8TA 4F38A 3NBYC 2QSZA 3AH8A 1MO4A 4RCZA 2DWPA 4IDNA 1T3SA 1XRJA 2F3RA 1W47A 1Z0JA 4LJYA 3QNUA 1XD8A 4JLOA 1G19A 2OXCA 3D3QA 2Q9CA 3N2EA 1KNQA 5EE3A 3VFDA 5LPNA 2FX3A 2EFDB 1E9FA 1ETUA 2B7CA 2GJ9A 1RYHA 5G3ZA 1XDBA 1GNQA 3FKSD 2FDCA 2IS6A 4BLQA 4BQSA 4F7WA 4NMMA 1UKVY 3PUXA 1IN4A 3SYLA 4Z51A 1XTJA 5L3SB 1E2HA 3GLHE 3CF2A 1RC8A 3IHWA 2ZJZA 4XTRA 4BLPA 2H18A 3T35A 4DCUA 1XXHA 5AUOB 2AK2A 2WICA 3WNCA 1ZJ6A 4EPYA 2C5LA 1I4DD 3CH4B 3PUZA 4TL7A 4AKEA 3EPKA 1JJ7A 1OIWA 2QBYB 1ZIPA 3QKUA 4ZI3A 1PZNA 1OFIA 1NG1A 3NHAA 1HT1E 1W7AA 1A2BA 2A2ZA 3FMFA 1I2MA 1CRPA 2OAQ1 4FCWA 4Z1MA 5H1YA 1KY3A 2XZOA 2PEYA 3EIHA 1SKQA 1KO4A 1S3SA 4LBYA 4IDHA 3WBJA 3TW4A 4A8JA 2NO0A 4C0BA 3OIWA 2I4IA 1ZAKA 1Z6AA 5E7MA 4LHYA 2H1LA 1JR3A 4H1VA 2FSIA 2JGNA 2YOGA 5KSZA 1XP8A 1TUIA 2VSXA 1YZLA 3AF3A 3DM9B 4GOXA 4ZKDA 3U7HB 2NO1A 4LY6A 1Z5ZA 1L2TA 1AM4D 4PANA 1QDEA 1TAGA 1KK0A 4KYIB 1BOFA 4FD2A 4P4SA 2YWHA 2W6IA 5C46F 4DLRA 1KGDA 5EE1A 2C99A 2REBA 1R0XA 5FR1A 4XH9B 1OB2A 1U81A 2XB4A 3SE0A 2A5GA 1ZM9A 2JJ1D 3UANA 4MYCA 3PEYA 2J7PD 2O8FB 1KZGB 1VIYA 1XCMA 4BLOA 1JPJA 2BKUA 1T9HA 2ZRMA 2R6GA 5EXPA 4PC1A 2B7BA 3CWQA 2PX0A 1KJZA 8OHMA 4DRZA 2ODBA 5DI3A 2MMCA 3T1QA 2PZEA 4LHXA 3WMEA 2GESA 2IXEA 4BZPA 4P4UA 4I99A 3CRQA 2PZFA 4AG6A 4Z1MD 1G1MA 3MAAC 3B1WA 4QXAA 1G6OA 3RHFA 1OV4A 4Z54A 2EWWA 4Q4JB 4UKDA 1M7BA 3SC3A 1PUIA 2OBNA 1ZMXA 1SULA 3PEVA 4KBGA 3NEYA 2ZRIA 2B21A 4ESHA 4D25A 3T1OA 3U44A 4KI0A 4AC9A 2I3BA 4KXFB 4DCSA 2EFEB 1E9RA 4HAWA 5B30A 3KFVA 1KI2A 2L0XA 1G4UR 4D0GA 2ZSBA 4EJSC 1OB5A 1DE0A 2OM2A 5J4KA 1YU9A 3CZPA 3BC1A 2DFNA 3CKLA 3BD9A 3PUVA 4LYHA 2HT6A 5LD2B 1RIFA 1XMJA 3LY5A 1XFAA 2D74A 1XD2B 4JJKA 3U3JA 1GNRA 1W4BA 2V9PA 4DZZA 4X8OA 3U3OA 2IUTA 4OI4A 4LPSA 4BFTA 1EESA 4GP7A 1W4AA 2ZRGA 1NN0A 4O0MA 1NNEA 3IPYA 2HCBA 3ZVMA 4B2LA 3DO6A 4MKHA 1F2UB 4DSUA 1CR0A 3QIAA 3SN6A 4B35A 3ASYA 3ZH9B 4PPFA 3KQKA 2RB4A 4EPRA 2ZUDA 3PV0A 4YDHB 1AGPA 3FMIA 4GRAA 4JVMA 1ZC4A 4Q19A 1AGRA 1H65A 4YQFA 1Y63A 3QPVA 1ZP6A 3NG1A 4LI0A 2ZRAA 5FOSA 4BASA 4Q4HB 3P32A 4RCYA 1FL9A 1N5LA 5BYKA 2JEOA 2PT5A 5FPHA 3KJHA 1G8FA 2O0HA 3ADKA 2ZJBA 4MGKR 3HU1A 2ZJYA 3J81k 5AUQA 3MWKA 1GRRA 3QG5A 4JZKA 4QGHA 2QORA 5IT5A 4PC3A 3V9PA 1T5LA 3AB3A 4FWTA 3GLHA 4RSGA 4HB3A 3PUWA 2F1RA 2UKDA 4LYAA 4U5XA 4MRNA 1XEWX 1P75A 4NCHA 2O8DA 1ZVQA 1I2DA 3AF4A 2E1RA 4PR0A 4WXPA 5TB5A 2ZR9A 4LJ7A 2QAGA 2ZR7A 1QG4A 2AXNA 4QBFA 3FFAA 3GJ6A 3TE6A 1CRQA 3QG1A 5TARA 421PA 4BWYA 1W36B 4C0AC 4B3XA 4DCTA 2NTYC 3W8NA 2PEZA 4WOPA 1G3MA 2C04A 1Q20A 4PPQA 4DVGA 2B8TA 4LGMA 1AQYA 1QHSA 1FTNA 3BE4A 4GP6A 2GXQA 1GL7A 2PT7A 4HLQB 1CTQA 4DBLC 1NY6A 4B48A 4HAYA 3FMOB 4NYMQ 5C2JB 3LXRA 3R9WA 4MGZR 2P2LA 1UDXA 4UQOA 4KITB 3THYB 2C9OA 1A2KC 4GZMA 4MRPA 4M1MA 4QNRA 3OFNA 2QT1A 4OK5A 5FUXA 4TL6A 2QM8A 3WY9A 2F7SA 1ZW6A 3N70A 3PJRA 5DN6A 3QXXA 4XVQA 3PUYA 4C30A 2FPMA 1BH2A 1Z0KA 4O3MA 2PL3A 1EFTA 3U6KA 5C1BA 1DELA 2OLKA 3NTUA 2HJGA 1EK0A 4DC9A 3MFYA 5FH9A 3WP0A 1QRAA 2ZITA 3QSYA 5JZVA 1XXHB 3EC1A 3GLGE 4NE2A 3FHCB 4B3GA 3EW9A 3BRWD 1KSGA 2GHIA 1N0VC 3FDIA 3AVYA 2BM0A 2NOAA 4TL9A 4DLWA 1EWQA 4NYIR 1YR9A 3MCAA 4TZ6A 1ZD1A 4Q7MB 4LOAA 3W8RA 1PUJA 5AUPB 1S8FA 2AX4A 3ZZTA 5M04A 3DM5A 1P72A 1T3HA 2J9RA 4MUAA 2EFCB 3VHLB 4TT3A 1AKYA 5KPJA 2IK8A 2F55A 2ZSAA 1Z29A 5L8VA 4JL5A 3KL4A 3EZ2A 1TMKA 2BKEA 3VAAA 4D6PA 3REGA 1P6XA 1PLLA 1PLJA 1E69A 1OPXA 4JLNA 2VF8A 2GXAA 4URXR 5J4YA 3BJIC 1AS2A 4OYHA 4Q7KA 2BMJA 3OEED 3SI7A 4FMDB 2CL6X 4HAZA 3V4FA 4A2WA 4L5BA 1SXJB 2YYZA 3NIBA 5JEEA 4QGAA 4TWZA 3BXZA 3E70C 5K8IA 2REXB 4RKFA 3EASA 3FTQA 4KFTA 1AZTA 4DSTA 1G3QA 3K0AB 2NGRA 2Q9BA 2JLYA 4C0QC 4WZ6A 4A36A 4ABYA 3OAAA 1Z07A 4WAUA 2GCOA 5JCPA 2ZUCA 2F1JA 3W90A 5FBVB 4UNQA 1AK2A 4ZCMA 1RRGA 3A36A 1AZSC 1X1SA 2AR7A 1NN5A 2C78A 2QTHA 3CR8A 3RC3A 3UXMA 1E0JA 2CCKA 5JHHB 4TT3D 4B2PA 3QXHA 3P4XA 1P9NA 1HA3A 2I1QA 1R2QA 1EFHA 1FOEB 4W5WA 5EP1A 3UMSA 1OT3A 4KYUA 3VU9A 1KDOA 1UJ2A 1G8YA 1DG1G 3CX8A 3AP1A 4JIMA 2GBLA 2JCSA 3A4MA 2BVNA 2CL0X 2X1VA 3QKSA 2ZR0A 4HATA 3ZDQA 2WWXA 3K9NA 3QEJA 2OBMA 2AL7A 3G0HA 1YR7A 1ZCBA 4FIDA 1U94A 1OHHA 3QI2A 1VIAA 4EFMA 5F9HA 2KJQA 4PQFA 4WXRA 4M53A 3WYFA 4CEHA 3WBKA 2VHJA 5D3QA 3QEOA 4Q7JB 1KSFX 3AF2A 4HDCA 5H70A 2CNWD 4C7OA 2Q3FA 1Z3IX 1JBKA 4Q9KA 4TLCA 3LW7A 2ZQ5A 3TBKA 3OAAD 4CEIA 1NL3A 1XPUA 4IJMA 1KI6A 4YMUA 3VTKA 3GJ7A 4JVLA 5E95A 3ZGXA 1UPTA 5F3WB 1G41A 3TLXA 1X8JA 3R9IA 4B34A 4DUGD 5F2EA 2BHRA 4CDGA 1FW6A 5KSPA 3GLIE 4IRUB 1CJKC 2IHYA 2QPTA 5HE8A 4A6PA 3WRYC 3LQRA 4RD1A 3BOSA 1G17A 1LTQA 3T34A 1PV4A 4ILEA 3G82C 1JAIA 5JSZA 3Q5EA 3TH5A 2ASEA 2RAPA 1TU4A 4UNPA 1E1QA 3AVQA 1XWIA 1A7JA 3DPUA 5GJWC 3KQNA 1UKYA 4JLKA 1DEKA 3AQ4A 4MH0R 1GRQA 4FXPA 1TQ4A 1YZNA 5KNBA 5G40A 4ZDJA 1CJMA 3R8FA 2OSBA 1OHHD 4D81A 3BS4A 1S96A 3GLGA 2WJGA 1JALA 3AVOA 3F0TA 3TSOA 5CYOA 2JLWA 4D0NA 521PA 4LBWA 3THOA 5EUMA 4B73A 5KOYA 3CNNA 1KY2A 4LC0A 3RNLA 4BEJA 3W9YA 2QAJA 4DDVA 1NRJB 3GJ8A 1Z2AA 1CEEA 1WBBA 1L4YA 3TVTA 4JS0A 1XPRA 1RRFA 1WQ1R 1Z28A 2BOVA 1VDZA 4Q18A 2QGNA 3GLFB 4O2LA 4NCKA 4HI0E 3ONWA 2OILA 5CLLA 1Z6YA 3W34A 4HB2A 1CR4A 2Q3HA 3SDZA 4C0HA 1RYFA 2E87A 2RGGA 2W2VA 3PFIA 2EYUA 4YXWA 4OQXA 1EX7A 3RLFA 5KNDA 1VPLA 4V0NA 3PEWA 1KYIA 1MABB 4PHFA 2ZYTX 4R2HA 4RFVA 4A4DA 2NZ8A 2MSEB 2BIFA 4OHVA 5KDLA 3FGNA 3O47A 4US0R 4Q4LA 1XTKA 3AUXA 3D8BA 5KDDA 4HAUA 3MWLA 2JLRA 4ZKEA 2W6JD 4HAVA 3X1DA 4PZZA 5KU1A 4R9UC 2NMVA 2CCJA 4BRUA 4KJZA 5CB6A 4Z8XA 4LHZA 2ZRHA 4ZCLA 1FPMA 1V43A 5SZJA 1OIVA 3LNCA 1G3RA 4X8HA 1G8GA 5JHGB 4IVPA 2SHKA 4GOJA 3HJNA 1W2HA 1HH4A 4FI3C 3H1TA 2GA8A 4MKFA 4UNRA 4X8LA 1QHHB 4XWKA 1NVWQ 2FNAA 5EUQB 4D26A 3QF4A 1XEWY 2GAAA 1NVUQ 4N0DA 1GSIA 5D3MA 2XOKD 5JWRA 3KX2A 1GKIA 2VA8A 4PC7A 4KV9A 3EPJA 2BBOA 2XX3A 4HDQB 3RVBA 4CF7A 4FMCF 4JLAA 2N42A 4YXWD 1IXSB 4E09A 2P6NA 4IOKA 4LX0A 4OHZA 2JIZD 3WP1B 5IF9A 3DKVA 2W0MA 1IAQA 1WF3A 2OE2A 1VHTA 4OHXA 3QENA 1UKZA 2GEUA 4TTPA 3D6TB 2AKAB 1GIAA 1QVAA 4D0LB 1Q3HA 1F6BA 1NJGA 5JJLA 5CJPA 2IX3A 1E2LA 2OZEA 2ZAOA 4D82A 1W5TA 3C7KA 2BCGY 5DI9A 2VF7A 1TPZA 2RGAA 4ACBA 1PVOA 1R8SA 1L4UA 1ZBDA 4TTRA 5EZ5A 3DMNA 1G6HA 2QROA 5C4GB 1K6MA 3KB1A 4JMPA 2C8VA 2GDJA 3X2SA 4OHYA 2YJTD 3C8UA 4EQ6A 1AIPA 1G7RA 1XBTA 4EIWA 5FBLB 2QPOA 1KMHB 3D7MA 3O8RA 1R6BX 1ZM2A 4GL2A 5FL7A 1M8PA 4F4JA 1IONA 3HU3A 1E9EA 3IEUA 3VR1A 5DLQC 2ZSFA 1LVGA 2WKRA 3L8ZA 3Q3JB 3KKOA 3L43A 5DSZA 4TYNA 2KI5A 3GLIA 2E9SA 2ZRNA 3WRXC 4IHQA 2O8EA 2ZIAA 1Q44A 2CVFA 4TMTA 2VP5A 1IY2A 4JBYA 3K0EA 4PX9A 4Q66C 2F1HA 1Q22A 2V6JA 2CJWB 2QU8A 2D3WA 4NKRA 3RRNA 4GDFA 5FI0B 4G5GA 2WWWA 3IO3A 2O8CA 4GMXA 2LKDA 1OYYA 2A9KA 4OJKA 4TN1A 5GJVC 1XX6A 2NO6A 1IY0A 2ZYWX 2TMKA 3TQCA 3A58B 4BFVA 2GTPA 3FPAA 3LRPA 2ZS8A 5JBQA 5DIFA 4YONB 4M1SA 3AKDA 1N0WA 2XXAB 1ZM4A 3CO5A 1N6KA 3B1ZA 2DHRA 3RS4A 4DKXA 1U9IA 4B47A 4DSNA 2PBRA 5JI2E 1JEEA 2C95A 1O87A 5CIWA 2A5DA 2G0TA 3SBDA 2DFKB 4B3CA 2O5VA 2VL7A 1LB1B 4XD7A 4ZCIA 1CIPA 5EXXA 3CIOA 4MUBA 3ZVNA 4QJ3A 2N46A 2EQBA 3I73A 3LD9A 1W36C 1IJFA 1G3UA 2FU5C 3PEUA 3ND9A 5FOVA 1U0JA 4MKIA 1FNMA 1TF5A 3LX8A 1D9XA 3ZZ0A 2GKSA 4AK9A 3X1XA 4LYFA 2FF7A 4LC1A 3K1JA 2RGEA 1TX4B 3PVSA 4TSFA 2ZANA 1Z22A 2QP9X 3VNVA 2CK3D 4JVSB 1HUQA 2FSHA 2GCPA 2GK6A 1OLOA 1R5OA 3NH9A 4CEJA 1R5NA 5F9FA 1E9CA 1ZC3A 1E9SA 4IVQA 3QXJA 1FX0B 3EC2A 3EXAA 2AHOA 3B85A 1TU3A 1VECA 3MG9A 4F91B 1UFQA 1M74A 3RS2A 3REFA 3U4QA 4OJQA 5BQ5A 4D4LA 2PLFA 3SYNA 3W5IA 1MV5A 2GILA 3LBNA 3WYGA 5HZHA 5E7JA 1FQKA 4QBGB 3ZS8A 2BMDA 4DT1A 1CJUC 2V1UA 3A1VA 4EPXA 2ZYVX 3FE2A 4JSTA 4HZIA 3GFPA 4XD7D 3THXA 1E2QA 5DH9A 3ZD6A 5SZIA 3LBHA 3NBZC 3R9XA 1LS6A 2FSFA 2QMUA 1UEIA 1S2MA 4LV5B 3FWYA 3QE0A 4HLUA 2D4HA 5E4FA 3RSLA 3SJZA 4ZIRB 2P6UA 1Z63A 1M1YE 4GSYA 4L15A 1KNXA 2RH5A 2VSOA 4TMKA 5ELXA 2ZRDA 2QTVB 1ZD8A 1II0A 2JJ1A 2XZPA 4IDQA 4TYYA 2J7PA 1P9RA 2BV3A 5CLQA 5H68A 3K53A 4TSFD 1VKJA 4B2IA 5BN4A 1SVLA 1B23P 2CLSA 3OEHD 4IFEA 2CE7A 2GNOA 1E2MA 2YV5A 1TADA 3KZ1E 1Q3TA 1VG8A 3U7EB 3IEVA 1UKEA 4TMWA 4OL0A 4Y0VA 3SS8A 3GFTA 4BFWA 2DFLA 1NSFA 1DAHA 4M21A 4BUJA 4PHGA 5J4VA 1SXJC 2Q0HA 5EP3A 1K5GA 2J0VA 1XTIA 4EUNA 4G5RA 3DEFA 2DWQA 3VKHA 1F48A 2BMFA 4FCTA 5JJKA 1UDWA 3JZMA 4HYYA 3W5JA 3DVLA 1H8HD 3L0SA 3ZJYA 3QVVA 1W36D 3O8CA 3BH7A 1FFHA 1GM5A 2BJWA 4XWOA 1F5NA 2FJUA 5C4MA 4Q1AA 1LF5A 1DPFA 2GVZC 2H8KA 4LZZA 3GFOA 4B32A 1MRSA 2ZS9A 4AG5A 2CXXA 2WHXA 2LKCA 3BFKA 2F3TA 2ZVQX 3MRSA 4ERNA 1AN0A 4HB0A 1SZPA 1A82A 4OBEA 1BIFA 5FBQB 4EKDA 3CW2A 3TGPA 2JLVA 2FPLA 2Z6VA 2WAXA 4KVGA 5JRZA 2A5FA 4OQLA 2A5YB 2P65A 1N6IA 2FSGA 4WZAE 5L3VA 2OCPA 3LQQA 4DDUA 4CYMA 4PO9A 1ZNXA 1FUKA 3VX3A 1TNDA 3KTAB 2ZEJA 2K5UA 5DHFA 2EVWX 4P0TA 2ODEA 4EPWA 1TQ6A 5FFMA 4KLZA 4D4KA 4S35A 1XTSA 4GOKA 4I1SA 3NC0C 1II8A 1ZUHA 2ZU0C 2Z4RA 2NPIA 3O8BA 1VYVA 5FTMA 3R7WA 2PMDA 4DWJA 4R2IA 3FKQA 5FPYA 2ZE5A 4HZUA 3AUYA 2ZI3A 4V0LA 3TAHA 3QKRB 3IILA 4N1AA 1VG1A 3QQ5A 3U6BA 2WJJA 4NYIQ 4A0FA 1U0LA 5A0FA 3GQBA 2WMOB 4TLEA 4XVRA 5IRCD 2KB0A 3RANA 1XTRA 5DYIA 3THWA 1JNYA 2IHBA 1JEDA 2DPXA 1M2OB 3SOPA 5LBIA 2X2EA 3WHKA 1C9KA 4AI6A 1KI3A 2ERYA 5G41A 3A37A 5G53C 1PJRA 3AEZA 4I1OA 1QHXA 1MT0A 1YKSA 3UMFA 4YMTA 3I4LA 4NP6A 2FFBA 1XEXA 4TMZA 2ONJA 2H92A 4HSEA 3E2IA 5UKDA 1QHGA 1P73A 3U61B 4M1WA 3RABA 4XWAA 1EFUA 2O8BA 3WMFA 2HLDD 1JJVA 3ZYCA 5CDFE 3GEHA 1YZTA 2V3CC 4XSGA 3W3AA 2NO9A 1JPNA
chains in the Genus database with same CATH superfamily
4PXAA 3LLVA 1WABA 2Y0EA 2ZE7A 4FW9A 2PKEA 4BTLA 1KI1A 2H7YA 3NEPX 1EA5A 3WFIA 5K9ZA 4ZZ3A 3MF4A 4NZYA 3KPVA 5EXTA 3P9CA 2HK7A 4JP5A 1IVSA 5TMDA 4B76A 1EGHA 2FHPA 5TQ2B 2HLNA 3FX2A 2MR6A 3CM0A 3WWOA 5HR5A 2FV8A 4YRAA 1W8DA 1WVMA 1KAEA 2HEIA 1H5QA 2J3MA 3EAFA 3EZFA 3MPUA 5ADUS 3LXXA 1NWCA 2PMWB 2DY0A 1C7QA 5DSXA 3SC2A 5EP2A 3RYCB 1DO2A 1VSUA 3K1YA 1J39A 2WF6A 3BRWA 4MMXB 2NXJA 6YASA 2CXTA 1CT9A 1JRLA 2IZ5A 2ZAYA 2GVNA 2BMWA 5EOVA 3S1SA 4XTCS 3PTZA 3KXLA 3PL5A 2YVAA 4C6SA 1PNTA 3BGIA 4IDDA 5EZYF 1Y7LA 3WMRA 4B17A 5LQCA 1U80A 1J5XA 1BEZA 1C3JA 3KDSE 3OHMA 4ICIA 1ZXBA 3Q7PA 4Y7DA 4QM6A 1RLIA 1VKNA 4E5VA 2J87A 4L08A 1Q1EA 5SZKB 2WW8A 3HKBA 4J16C 1VJGA 3ZW9A 3ZZMA 4MPPA 3AP2A 9LDBA 2WAMA 3LVFO 3QELA 4GOOD 3MWEA 1E1CA 2C4WA 1F2DA 3QM1A 3BSFA 3TK1A 4EMSA 2NSHA 3BXOA 1MB0A 5J43A 3GLQA 1IOZA 5HCNA 2Y93A 1CY4A 4QTXA 4Q3EA 1Q0SA 1QRSA 1OX5A 3RU2A 4MV1A 1J1IA 1Z7GA 3UJAA 3NTQA 5ALLA 4YRFA 1DIRA 1E8NA 2O4CA 4N8EA 5T6BA 2YFYA 5KO2A 4OGLA 3NTRA 4B46A 2WYHA 1ZWLA 4URUR 1S2DA 4J1QA 3U39A 1HTTA 5LYJA 5F3DA 4YX9A 5AYVA 3L7JA 3JQAA 1MFPA 4WNAB 4A0QA 6PFKA 2BELA 2C2HA 1F6DA 3SZ3A 1HNWB 2Q8QA 1L4FA 2EKBA 1EUDA 2XE6A 3CF6R 2PGAA 3IAXA 1R15A 3L8EA 4RYDA 3GT0A 3B53X 3OX1A 4N65A 4A6XA 1W0JD 3LUJA 3SZGA 4U0KA 2IOYA 3I09A 5LP6B 4PYJA 4O4LB 5AP9A 1E7WA 2ZVPX 3KXIA 3O73A 3Q3EA 3LQ4A 1QC5A 2Z5LA 4ZV4A 1ZNZA 3N8IA 1DCMA 3QKIA 5SV2A 4C14A 5J23A 1MR3F 3CRMA 3O4FA 1G18A 1P2VA 3OUUA 1FU4A 4KIGA 4GPTA 5JEDA 2E7ZA 2H31A 1JHAA 1SOUA 2H2HA 3ZGNA 4Y0AA 2O2XA 3ELDA 1CCWA 2HDHA 3B89A 4OYYA 1NBAA 1KJJA 1G8SA 4FNGA 1S3GA 1IOLA 1UMDB 3L7DA 1VCHA 3IMEA 3ITEA 3L7CA 3MBIA 3N75A 2IEGA 5EINA 1RJGA 1CB0A 1EFVB 3FLEA 3DO8A 2IH5A 2IEDA 4EVQA 1NQXA 3RUEA 1LFDB 4ZI2A 5KOJB 3BEOA 5M04A 1W5AA 1OWLA 1CXZA 2WJWA 3BH0A 1RM0A 4BB9A 4HQRA 3W2GA 5KNCA 2O19A 3E0QA 1T0JB 1CRZA 1E20A 4B6RA 1NU8A 2IE8A 2ZSHA 1U1FA 2YMPA 3B5EA 4NCJA 4QC2A 3DAYA 1RI1A 4KOAA 4EA6A 4G1UC 4F4IA 1GSOA 2XAAA 4IP0A 4O8CA 4DV1B 4ZVUA 3QQPA 2XDQA 4YRQA 1D1SA 4Q7EA 3EDCA 5ECYA 1YBFA 2IT1A 3FNGA 3LVRE 2Q3CA 3FHOA 1QTQA 1DFGA 1U7TA 1K08A 4MUYA 3DUFA 3IFSA 1KYQA 4RY8A 3SLRA 2B5VA 3J7TA 3NVKI 4B79A 4PGAA 3ZBTA 3MOGA 3BDIA 1PJBA 1YC2A 2C4MA 2WKPA 1RAGA 3E5RA 4Q4CA 3A28A 1NY5A 1TIKA 4I7EA 1BGXT 1ZQ1A 4DA8A 4ZEOA 5ICSA 3RIYA 1LA2A 3O8OB 3JD4A 2C07A 4MW9A 1COWA 1US8A 1DWPA 3IBFA 4KSBA 5EE5B 5G3YA 3T95A 1EXMA 3HDTA 4ZEVA 4DC1A 4EX7A 1S2NA 2P6MA 3FFXA 2V4MA 1G7TA 4FOPA 4MWCA 4YWJA 4M8NE 1VLLA 2GYWA 5DOZA 1N7GA 1EB8A 2QN6A 4WVFA 2ZT8A 4F46A 5KQPA 1A9YA 1UXKA 3BULA 4IHAA 1LW7A 1VMDA 1TYEB 2Q1SA 2HQSA 4Y9RA 2P5SA 3GGCA 1RWVA 3IB6A 3BGVA 2VWPA 1Q1AA 4KO3S 1OAOC 3A7EA 3PE6A 4OXYA 4N41A 4BZXA 3D7NA 3SSMA 4G24A 1EK2A 3FOZA 4CV0A 1DMSA 4WUTA 2IF0A 1VPTA 4RSRA 2Z8YM 4ND7A 3URMA 2EL7A 4XI9A 4W5JA 5IS2A 2ZJ0A 2FPSA 3I42A 2EEZA 4MV7A 4CN9A 5KOHB 2VAXA 3DJYA 1ADJA 1NVTA 2G7MC 2SCUB 2Q4DA 3WDSA 1KDPA 1EX6A 3N39C 4UVEA 2IXDA 2AKYA 1WW8A 1YA6A 3ZQJA 1P0IA 1YQGA 3FTPA 4KQEA 4RD4A 4K9PA 5K99A 5JH7B 4HWGA 4KQ9A 2ZJFA 4JEUA 5E8JA 4MS1A 2O1XA 4DREA 4UNNA 5A5VA 3LLMA 1I94B 3NHRA 2IEAA 4WCFB 1MA0A 1U2GC 4P53A 2A5JA 2JGDA 1P6UA 5AJYA 3SF0A 4YDQA 1K0UA 2C83A 3SZLA 4ESVA 4LJ5A 4V03A 3HMQA 5DE3A 3E9RA 1RXSA 4BRWA 2QRVB 3RS0A 2FN4A 3EZ6A 4KO2S 5C4IA 4AZ0B 4WTOA 4E1VA 3FBWA 1LTHR 4Z4EA 1EFCA 2C82A 1XRPA 1T6BY 2WJZB 3H18A 3H9BA 4HNHA 4N9WA 5KAMA 2I67A 2ODWA 1EFPB 4M6WA 1BE8A 3JVVA 3B7PA 4O4IF 5DTQA 3T41A 4A26A 5FWNA 5GIOE 1K6IA 2XRZA 1AX9A 2NZUG 4BO2A 3Q8MA 2MTBA 3JVIA 4PNHA 1XXLA 2P1RA 1EFRD 3VR4A 3AIIA 1II9A 4KBYA 2C5BA 3B1VA 4NV3A 1WX1A 2PRJA 1JHDA 5IJAA 5KWEA 1DKQA 4JWTA 1TU0A 1AS3A 4DARA 2P4UA 3DVAB 3CUUA 3II6X 4U8HA 1KI9A 1PRYA 2QB5A 2VF2A 2WD7A 4JXJA 4PYNA 4TUYB 3I04A 4WEQA 3ZWNA 4L6IA 4YUWA 2V7WA 2W00A 2GZHA 2X23A 2MIIA 4BCCA 5CFZA 5JARA 4Q9NA 2PKCA 4Y9UA 4KXVA 1VRVA 4MJ7A 3U19A 2PR7A 3ZWWA 5HKAA 3K6SA 2CYBA 3FR7A 1SXPA 1HDEA 4AJNA 3ZZ1A 3BXEA 2ORED 3OPYI 2G0AA 4NBSA 5DNEA 4C6RA 1VKHA 3KLMX 4P92A 4P7KA 1JXMA 2DHEA 3QY0A 5HIJA 2P7HA 3B1FA 3WRYA 3AOEC 1NDUA 2AQKA 5ELLA 1RTKA 2XJ9A 3W5SA 3NIFB 2FX2A 1OI2A 1JYEA 1SURA 4RD3A 5GM2A 4E1BA 1BQ4A 3ADPA 2JLXA 2JGAA 1AS0A 5H4GA 5ETJA 4LF7B 3CUYA 4KFSA 2A58A 4Z4FA 1H8ED 2ZI6A 3LUDA 5EJIA 5FFNA 1KMQA 1WLSA 5DM0A 2UUBB 3TLMA 3V80A 5FTLA 5FI3A 4EUFA 1FZQA 5LQAA 2P3QA 4G5YA 5FJIA 5IG2A 4RE6A 1RPTA 3NTOA 4LDJA 4WACA 5L3SA 1P7CA 3CLVA 5E6RB 4C04A 5I7SA 4AY6A 1BCRB 1EU1A 2IYEA 4QYWA 1SD1A 1P0CA 1NGSA 2X3YA 3ESRA 3K5PA 2VK2A 5TR9A 4C0XA 1G2QA 1YRAA 2I55A 4B4KA 3R5SA 4FOLA 4G0OA 4HF7A 2ET6A 1T6YA 3EH2A 5IJXA 1QGAA 1CVIA 3L7MA 1HETA 4A2QA 4V02A 3RJ9A 4D3SA 4TVSA 1H2WA 4B75A 1YHYA 2O6HA 3I9FA 4TTQA 1YQTA 1VCIA 2UZ0A 4I55B 4PSUA 5DP2A 4BLSA 2J5KA 5BRJA 1KFBB 4Q5IA 3PHGA 1TZJA 1K6EA 2IZOA 2QGFA 2XWPA 4FDUA 1L3BA 2DG2A 2EW1A 3MINB 1EVEA 2G4LA 4FKZA 2IYZA 4G37A 5EKXA 4D45A 3K30A 2Y77A 2VTKA 3Q7EA 2JCBA 5A4IS 2X0NA 1USKA 2ODPA 1Y7PA 4PSKA 1SVSA 1O97C 4HZGA 1LSJA 4Q1FA 4YJFB 3SX4A 3V8MA 4DJFC 5CB4F 2IIBA 1NJ2A 1OWMA 3ZTWA 2IZ7A 4WDRA 5EIHA 5L7TA 5FPTA 1N36B 3NEJA 3BE5A 3DJFA 1SWVA 4N7RA 3RQSA 4KFUA 4BEBA 1S4MA 5IC4A 2FF5A 5JANA 4GBGA 2PKWA 5HVNA 1P19A 2N0SA 1O5TA 5IKEA 5TQ0A 2XW6A 2ZCVA 5JJIA 1GKLA 2G0NA 1VP9A 2ZJ3A 2PRSA 2GSDA 3P19A 3UATA 1ZD9A 3KOMA 5EIFA 2I4RA 3EB9A 2PTHA 3EOBI 1L7RA 4R8LA 4YGXB 2BUBA 4JLMA 4XIYA 5H9WA 2GBIA 4RTRA 3RWBA 5SICE 3STVA 2H1OA 4EP1A 1N5MA 1NDHA 4O1MA 2OESA 3OM0A 4H1WA 1E3IA 1P2FA 1SC1A 2D5IA 4QTUB 1MQ9A 1Q1NA 4BRZA 4YCAA 3HCOA 5DTJA 1XXHE 2YFQA 3VVCA 3QJYA 2POCA 3G8BA 3H2SA 4W1QA 4BXOB 1BHO1 4AX4A 1Y5RA 2PH1A 2PX4A 1CE8A 2E55A 1QNLA 2GJKA 2V4ZA 4W63A 5LQMA 2XCTB 3S8EA 3D5EA 1PBTA 1OYWA 1VKZA 2I03A 1E4YA 3L0ZA 3OIGA 3K9LA 2D2FA 1HC7A 1BCSB 2WHPA 4IHJF 5J1TB 5KKAA 3QNWA 1N0IA 1NX9A 1E1MA 3KOUA 1I4TD 4EHKA 1ZK1A 3R77A 1ZR4A 4O08A 3EMKA 3GFFA 3O75A 5DN9A 2ID8A 1Y1TA 3L8CA 4AZ3A 4ZT4A 2QZ4A 1QTRA 2P6OA 3W0LB 1EKXA 3LT4A 5JRJA 4R69A 1QV9A 1V4NA 4ZO7A 4ZI7A 2FH5B 3QFRA 5DZSA 4LRXA 1UZAA 4INJA 4MUKA 4EQZA 3IXMA 3EIWA 1JR3E 1UM9B 3IKVA 5ALSA 3RUCA 2R5NA 2YWJA 2GJSA 2OOKA 4YH1A 4XM2A 3RWOA 3QKSB 4DMFA 2H0RA 3JWGA 5LCXA 1E3EA 3BGWA 1DEAA 5C35A 1B26A 2BBWA 1P0FA 3NBMA 4ESEA 3DE4X 1FMFA 3TDMA 1JGTA 4C9BA 3T94A 1RAFA 2VYNA 2P35A 3TYXA 4R2KA 5ERGB 4WN9B 1BW9B 3RUDA 4BV3A 4GT1A 1JZTA 3ORSA 1OKKA 4QREA 3SOZA 4X3OA 2Q21A 3TNFA 4DBZA 3ETEA 3NALA 1PIWA 3ICEA 4WBNA 1DAFA 3NT5A 3PHJA 2B4YA 4R84A 4MRRA 4KBFA 1DARA 2HMYB 2O52A 3D64A 3WWCA 4C7OB 4X44A 1BJRE 2PGJA 2FXIA 2QV0A 2WFLA 4II3A 4O4JF 1NV9A 1OXXK 1ZJZA 2NIPA 3DB1A 3UT0A 2XT6A 1X8LA 2NUPA 4ZPXA 1KI6B 2WHEA 1VKOA 5CT9A 4Y8VA 1XLTA 2Z0MA 3UWOA 2IH2A 3WLNA 1TDJA 4MIOA 3M6FA 5CNKA 1Q7EA 3IUYA 5DV9A 3WLFA 1EDZA 3D8HA 1WOYA 1FNDA 4RAQA 2VUUA 2V0CA 1NVFA 4YDRA 2OFFA 1UIMA 4BZWA 3A6FA 2GPJA 2WNIA 3UHPA 1GR0A 4FWIB 2VJPA 4KN9S 3IBGA 1L5HA 4X64B 4TXLA 4CTNA 3WYCA 2E37A 3W4KA 1CDZA 1J23A 5FOQA 4OBXA 4LVCA 3OEHA 3G2NA 4LXIA 2WIBA 3ZEIA 1ZGZA 2WV9A 4IUDS 1H05A 3H7IA 4NJMB 3RVKA 3VI3B 3SIRA 5ES3A 3ZE1B 3RAGA 3M4XA 3D1JA 2AUMA 3Q7TA 1WXIA 2ZRKA 5ALOA 2PD6A 1J07A 2YRXA 1N2GA 3OLXA 1PR0A 1QGED 2VDPB 3GGPA 3D2LA 2OMEA 5B36A 1ZN2A 1V5GA 2DZDA 4JT4A 2W2MA 3UG6A 2ECQA 4A2CA 1ND5A 4KYVA 4TTAA 3A1SA 5A6VA 1J5PA 1T9GR 4ZO4A 4DR2B 1FQJA 3CZQA 1S6YA 1KQNA 3VXKA 4J0FA 1J97A 2VDWA 1P0PA 2HV9A 3EYAA 3OZGA 1DVRA 4KE6A 5DHTA 4YMVA 1XAGA 3ITKA 3KKQA 1PGPA 2XNDD 1CU1A 1ZOPA 3VPHA 3PPWA 2YYAA 3EFOB 3VNBA 4B4UA 2J4CA 3MC1A 2O2GA 1H8HA 1I2ZA 4FVTA 4X62B 1RVDA 4YJGB 1TLLA 4PPNA 4M2LA 4H7FA 2XIQA 4HQ0A 2GYUA 4KFRA 4JLPA 1XU4A 2BC9A 2IPOA 3IMFA 5I7WA 3VNRA 5JNUA 4AZSA 1QGDA 2VP3A 4WK4B 2X6RA 4PFSA 1CRLA 2G67A 1E2JA 4ROTA 1Z9BA 2DHQA 3GR6A 5IVDA 1G20E 2GJ8A 5CD1A 2EG5A 2X42A 3N3BC 1AHIA 3RJ5A 3W2TA 1X0XA 1YR8A 3THYA 2G40A 1B4DA 1E3SA 4WW0A 1LU9A 4JK3A 4X1IA 3HXQA 1H4SA 4I50A 1OLXA 3KDPA 5AFSA 1RPJA 2O3UA 3O2SB 1GO2A 5SZHB 1XPOA 1YMUA 1XRLA 5BQ3A 5LN1A 4GR5A 3MJRA 3BK1A 4BECA 4M49A 1IHDA 3HCEA 3ME5A 1IDN1 1V4BA 4G5QA 2ZJ5A 4JUDX 1WXXA 1YJBA 1EBBA 1VKRA 2I33A 4BO9A 1GRCA 3DULA 3F5DA 3ZDZB 4QZVA 1PJ8A 4JODA 4N82A 4RGVA 3DE5X 3ZGYA 1XLUA 3K2IA 4B8YA 3L0IB 2HT1A 5J9FA 2DFVA 4UDNA 3IBSA 4PLPA 2R0QC 1Q2UA 1E2PA 1O58A 2DYKA 2Y1OA 3FPBA 3LCMA 1Q0HA 4GI1A 1YQDA 4HK4A 4G1MB 5FA8A 4BNWA 5L53A 4YAEA 221PA 1J8YF 1OA1A 5I6DA 1YFKA 2IOFA 3PR1A 4HJRA 1D6JA 2JW5A 2QVLA 3IALA 2C5FA 4G56A 4O2BB 5FD8A 4IQ0A 3FSJX 1MJNA 2FEOA 2WT8A 3JQRA 3M6AA 1OIXA 5D3MB 5JSYA 3TTSA 5KSOA 4XYGA 4W9MC 4QJBA 2WZCA 3QXGA 4GMFA 3AR6A 5A3SA 1GNPA 2DUWA 3PXBA 4D3XA 4AFNA 2VCYA 4DLTA 1DZ3A 4BLWA 4TRJA 2WP8J 1XJ0A 2IY9A 3BAZA 3D0QA 2ZAGA 2ZBUA 2J5RA 2HDNB 1OFHA 1RR6A 2Z9DA 4TLAA 1TEZA 3NKVA 3CMCO 3WLSA 2W2XA 3HBMA 1ICIA 4M0LA 4TLMB 3UWMA 3ICQB 3ORHA 1EZZA 2I87A 4L1KA 4BMXA 4EGCB 2JI4A 3KSAC 4W6QA 4WERA 5E1DA 5BN5A 3MWDB 3IOMA 3Q8WA 1B76A 4P3OA 2IV3A 1E2BA 4CRWB 2J0UB 2RI1A 1LRLA 1X77A 5B6IA 1BRTA 2W90A 3LTEA 3O9MA 1E2KA 3EDRA 3BRSA 4I08A 4WBSA 4X3CA 1GV0A 3RIMA 1SKYE 2IBTA 1K1EA 1PGQA 5B37A 3N6RA 1F2VA 2VHXA 2HI0A 3FTEA 1SCUB 3DZBA 4B8WA 2X1MA 5AHWA 1DIBA 1DBIA 4N5DA 1E3WA 4B3IA 3IDAA 4MRAA 4D9BA 4OLBA 3RSOA 4F1JA 2D0IA 4NH0A 3SFZA 1MRZA 4K81B 1JKXA 5JS8A 3HJFA 3CZ9A 3C0KA 3TG8A 2OKGA 4RA9B 2JIOA 4B8ZA 1JDZA 2BLNA 2XOEA 4PE5B 5LFAA 1QVRA 4YP0A 2D1YA 4EG6A 4PC6A 4CIDA 3LH5A 4FIZA 3LT2A 1H69A 2FPPB 3C97A 1XN1A 3GNQA 4YJ2B 3GJ0A 3KYDA 2QVYX 4CNBA 1V8FA 4PLVA 1V8ZA 3F74A 4U7TB 4EFKA 1D2MA 4FZRA 3HBLA 1GPYA 3SLGA 2WZBA 3IBCA 3P97A 3RDPA 1R0KA 5F1KA 3A6PC 4Z2AA 1RXIA 4BNKA 5JZMA 3A25A 5AKKA 2WJYA 1EUCA 3SHQA 3OE7D 4FBLA 2ISSD 1YR3A 3ANLA 3NU1A 1Z37A 3LHDA 3E7DA 3P2EA 4JBHA 1U8YA 4WGFA 5D8DA 5JYEA 2UVQA 1JR3D 5BWNA 1B93A 1E0SA 2BONA 4YP1A 3WL7A 1TF2A 5I5EA 4DPKA 2DWCA 5ED0A 4MYHA 4EDFA 3OE5A 3AFGA 3GZJA 4X1YA 4ZXFA 5IWCA 3NNNA 1IULA 1D2NA 1UBRS 2FSSA 2X76A 5IJ9A 4GOMD 3KZNA 3PXGA 5EAIA 1HNZB 2VOJA 3WGQA 4Q4DA 3U0VA 3MUEA 4DIOA 4DLYA 5ITSA 5EIXA 2ZWVA 3ZDRA 2UUOA 3U4CA 4B6FA 3E6AA 1JU9A 3DZDA 1GA1A 2BR4A 2FOLA 3DEJA 3QX9A 1JQEA 3VVMA 2HBQA 1NXTA 4ZVOA 4RXMA 4MW4A 3HWSA 3IUNA 3WLLA 1SK8A 2W0SA 5IU6A 3CF0A 3HDHA 5K05A 1UOQA 2DFTA 3VPDA 1IG3A 4GMHA 3LECA 4LYYA 1FP1D 4KH0A 1ZQ9A 4JQZA 2E6KA 2JIQA 1QZTA 2DM6A 2AK3A 3DEHA 3PKZA 4KQKA 5CG1A 2NU6B 3A4IA 3CX3A 4DLSA 4P36A 2BFEB 1TFUA 1Z36A 2C2MA 1CUJA 3HM2A 3HU2A 4JD5A 4D8WA 3IDZA 1E60A 5C3UA 8ABPA 4DMUB 4U7PB 2GVDC 1HQDA 1GKYA 2QNRA 1TAUA 2C4KA 2VYQA 3FW1A 1D2GA 1D2AA 2V6IA 2Q6VA 2G5PA 3I9KA 2V7BA 3NHFA 2JLCA 4WY8A 3SHFA 2H3EA 1XNQB 1Z0DA 3ILXA 4TKUB 1C1HA 2MT9A 3B6KA 3U7QB 4N3NA 3ZIUA 1YHNA 1SQFA 3BGSA 4Q0MA 4BO1A 4RIEA 1W0JA 1N6NA 5SYNA 1KZ7B 1N0UA 4CEJB 4HXEB 1O0BA 1JKIA 4Y2RA 1P5FA 2GJ4A 3AL3A 4GX5A 1JEYB 5IXSA 2A14A 2ILVA 3SXJA 3UJDA 4HDOB 4AKGA 3RRFA 2F9LA 4M83A 3LW8A 4FFSA 4UBIA 2Q2OA 1FRVA 1K63A 3IQIX 3KSUA 4RHCA 1BWSA 1Z6TA 1FTGA 3PCXA 3U4QB 3A32A 2BEVA 3FOWA 3OCCA 1NYRA 4XJXA 1RHJA 1ZINA 1BVYF 5DM60 5J2TA 4F3YA 3TXAA 2R3SA 4K40A 2PY6A 1R6AA 2Y9MB 1ADFA 4L3VA 1AA3A 2VKTA 1ADBA 4GM1A 4HXFB 3UK0A 1NG9A 4MWDA 4DV0B 2FAXA 2VCEA 2EKQA 1D4ZA 1UDBA 1RQGA 2EKDA 1XHFA 3DMPA 4H7DA 3THXB 2NP7A 3R74A 2XA9A 1RW4A 3EY9A 1R9JA 3LT5A 4OLJA 3H0KA 2PZLA 4W8OA 3GLFA 1R74A 2HBYA 2QS9A 5CK5A 5KDOA 1P0MA 1OUMA 2R6CA 3CE9A 1WM1A 3JYQA 3FYUC 3TZLA 3X1YA 2A0KA 4CIBA 1F7UA 3WA6A 5BYAA 2GPWA 5LMUB 4D4JA 3LPMA 3BMNB 2ADFA 5JSHA 1HFEL 1AZLA 2FEMA 1MABA 1DBQA 3JZDA 4UCWA 5CRIA 1S8OA 2VJYA 5L3ZA 2C3UA 3DDSA 4G0ZA 4CM4A 5BN4B 1AF7A 3C3DA 4WMLA 4GKKB 1EWTA 1M34B 1ULBA 4RKWA 3LRTA 5U1PA 1HYGA 2DPMA 4UTVA 1R0ZA 5JSFA 1HZZC 1XQYA 2J9ZB 1OH5A 4ZALA 1N7JA 4H77A 2YXNA 3H3XA 4YUYA 4WZAA 2ZRFA 4FQ7A 3AF5A 1JHYA 3TBFA 1X7YA 1FVXA 2BDUA 3KB8A 1SGWA 1IZ8A 3WK4A 3RVNA 3RFCA 3C41J 3HB7A 3P2KA 4N0EA 2O2IA 1EX1A 2ZIZA 4A5OA 2H08A 3GPIA 2XMBA 4EMUA 5A0VA 2PPLA 2PIAA 3ZQ6A 1WUHS 2QP4A 3OKAA 3T0IA 3S8YA 2TS1A 5AJTA 4RIFA 1LV8A 2FW7A 2VWQA 2ZUBA 3F6EX 5FHQA 2VNJA 5BN3A 3T7AA 2VK4A 2YXBA 4NNPA 4IYJA 1QHNA 4RTJA 2CEAA 2ZRPA 3KXKA 4PZYA 2WAYA 1FRZA 3TZKA 4EMBA 5LZ5A 2H7CA 1GXSA 4Y1RB 5CDTA 4YFYA 3RASA 2VJKA 3IEIA 2P8SA 3ON5A 2JASA 3DFUA 1XZDA 4JASB 5DLPA 1GRVA 2PL1A 4Y2VA 4ENWA 1UFRA 1H5NA 1HQKA 2ATCA 2D1TA 1JAHA 2GXSA 4GKVA 5FQOA 9ABPA 1CS0A 3R6DA 4QYIB 3FTNA 5KTYA 1DBPA 1YXMA 2JGFA 3ZGOA 3WKCA 1KKMA 2NT4A 2YWDA 5CUQA 3AVVA 4O1IA 2B69A 3OTQA 2LCQA 3RVJA 3IAEA 1VHWA 2DBVO 4Q9IA 3R24A 4ETIA 3ZHVA 2VUSA 3S0JA 1ELOA 5KIAA 3LOQA 3U37A 1QKKA 3RCBA 3CX4A 2NZWA 2G1KA 1OLUA 7MHTA 1VJRA 1U3FA 2UYQA 2CFSA 3ZV7A 3AF6A 3HKCB 3NATA 4CR6A 4MLDA 3I2KA 3UGTA 4TV9A 1KH3A 3JR7A 1DJQA 3C5CA 3M0EA 3VYSB 1VSTA 2PUCA 3EULA 4X9XA 4MR8A 2XYHA 2A0UA 1T2VA 2CHEA 3TNYA 4I3HA 3VBEA 4X7PA 3VDXA 3UPUA 3I9MA 3GEBA 1TFRA 1FRNA 1OJ7A 2UVPA 2RGNA 2CMGA 1WVGA 2XMDA 4RVOA 2Y8EA 5JNSA 3SYTA 4OYLA 4DGQA 3BD7A 2JD2A 4IQFA 2Y3IA 3UJCA 2WC1A 2V8BA 5D6OA 1UZMA 2RC5A 2CJPA 2Z4SA 2GEKA 3R7WB 3DR5A 2AEJA 2FA9A 2IODA 1Y80A 2D06A 2Q4BA 4IZIA 5CGQB 5IJ0B 4X66B 1XNJA 3GPDG 2JH3A 3IURA 4MIYA 5TC4A 2ZXUA 2BTQA 1RXYA 4BN4A 4JLSA 2CF5A 5EQDA 3CB4A 3V00A 3GXBA 1FE8A 2I80A 5DGXA 1MH1A 1FXSA 1SUAA 1Y98A 2GZ2A 3GHYA 4QDZA 3S40A 3ZU4A 4E31A 2CJWA 2XT9A 3ROXA 4YT8A 1CULC 1UWCA 3WIUA 4Z4HA 3WJ1A 3L4KA 4LRUA 4MQ4A 4DY6A 3BE8A 4MSUA 5FL3A 3SJCA 4RTMA 3N8KA 1TJ5A 1F60A 3IXLA 1JF8A 1TGVA 2BFDB 4XQEA 3SDBA 2H1CA 3C5WP 2HUPA 1JQ5A 4L4RA 3VZBA 1VJTA 1GSHA 3NANA 4GUDA 4AKIA 4L9AA 4LMAA 4LRWA 4NYMR 1FDSA 4JDUA 3EIQA 1L7PA 4TMVA 4FDAA 3T7SA 3HWWA 1XD9A 2Y1CA 1XEXB 2P4QA 3INYA 3X2FA 2OYSA 4KXNA 2Q9UA 4GD3Q 2QNIA 3TRDA 1K86A 1K4MA 1ZNYA 3A9RA 4KQ1A 4QXMA 2CYCA 3V4SA 3KQOA 1RHRA 1W96A 1YAHA 2JJ2D 3B5JA 4ZI5A 4CIAA 3ZDAA 4FCVA 1Z0FA 4JI0B 1GGEA 2CF6A 4L8GA 3GX1A 1OREA 4DCJA 3RIGA 2FVYA 2JRLA 1OYVA 2R9VA 1L1QA 4U4AA 1WTAA 4TYQA 5TJHA 1RYZA 1GPH1 1JR4A 3Q85A 4PPGA 1LJUA 1IXZA 1U1DA 2BH9A 2V7GA 3X1JA 3INRA 3VKUA 1UKAA 3MCUA 1D2RA 4Q24A 2CV2A 2I6GA 1N5RA 1ODCA 2R84A 1LW6E 2YZ2A 3KOZA 2JIBA 2CFOA 3R6LA 3R20A 4R8RA 3P45A 3TRHA 4XM0A 3Q11A 2Y1EA 2I71A 4RFSA 4NOLA 5I7OA 4Y2SA 2Y1KA 3LYLA 3IJPA 3S1LA 2JH9A 3IEXA 1JFTA 2G08A 4L9WA 2FKAA 4PCUA 2H11A 4EOGA 5NLLA 1GG5A 3WDMA 1N32B 2J3IA 3T5GA 4NWIA 1NFFA 2ID7A 2VBCA 2VQSA 3BBPA 3C39A 2V8OA 3MJEA 2CDBA 2Z83A 4YAUA 3P9XA 3A70A 3H4VA 4NCBA 1C4WA 2H06A 3Q6NA 2X40A 3OBBA 1KY5A 3FPHA 3BYZA 5PNTA 1NBIA 2R7KA 3UENA 4PWZA 3W9SA 2RHJA 8AT1A 1GA4A 1U2EA 4IWXA 4DA7A 3AFOA 2FW8A 1P7WA 3KHUA 1SUWA 2BTOA 2H9AA 1SRRA 1AHNA 3UYKA 3CN9A 2V4UA 1TF7A 1W46A 3IUJA 2HADA 3KJEA 3MJTA 4KSCA 3GFGA 2CHGA 2UXBB 1NQ5A 2DX7A 4BJHB 4W1SA 2FN8A 4J0DA 2H48A 2BGTA 4XM1A 2X0EA 4LUCA 3BJMA 1QGUB 1KDVA 2Z08A 3MMSA 5GJCA 1RZRA 5BOSA 4OX9Y 2FW1A 3I64A 1BVUA 1T29A 3BQMB 1PJAA 1U2DA 3OE1A 4OQMA 4P22A 4EATA 4BGDA 2IYWA 3QFFA 1J9ZA 3JQ9A 5DYYA 4A10A 2PJZA 2QN8A 5FPKA 3MWJA 4QJ5A 3FWZA 1O95C 3U9SA 1G5IA 5JVDF 1FNCA 3ZWXA 1Y6RA 4ENQA 5BMOA 2W2LA 3G2JA 2YJ3A 3LQ2A 5EP4A 1SIOA 3HYTA 1UJBA 4LMPA 2FP4B 4UBOA 2ZTUA 2I4LA 4YRZA 2QTAA 4WZBE 4YMLA 1ZRSA 3EZ9A 3TIXB 2HKIA 3ZWBA 2GEVA 4M9ZA 3C1OA 4U2FA 3RFVA 2DQYA 1N25A 4PX5A 3WLJA 4TMXA 3UV7A 3FNIA 5K8JB 3BHJA 2WMDA 3FRJA 4BNLA 3QEBZ 1E1QD 2WKQA 4XOIA 1FTWA 4Q39A 5DYWA 1BROA 4LSGA 4I5GA 4M1ZA 3KQHA 2DR0A 2BMAA 1ZGCA 2IEYA 1FSSA 1PVVA 2CHUA 2HNKA 4L3OA 4QFBA 2HCJB 2A94A 4TZKA 5BVGB 2F1KA 1RMTA 3ZQUA 3K70C 2AWOA 5CITA 1DI0A 2IBMA 3HPRA 1MENA 1C9YA 2IL1A 3NTXA 4RZSA 1EJ0A 4NI5A 4XJSA 1KKLA 1T4MA 3ZUPA 3I6MA 3KJXA 1XRMA 1NLYA 3T06B 5F3RA 4ER5A 1OWNA 4GBED 3CF4G 4TV8B 1OV6A 4EW2A 4EY7A 1OI4A 2ZJ1A 3V97A 2YCBA 3H0EA 1GGHA 5AVJA 3V4ZA 3R0XA 4E4RA 5C7YA 1PR9A 1SG6A 1IM2A 3PHIA 4XJTA 1JEAA 3ZBUA 3E3OA 3GD7A 3LUBA 4ND8B 1UBFA 1RRKA 1UMCA 3A2NA 4PS0A 3EMBA 2SNIE 1QFYA 5JMWA 3IRUA 3LOPA 1UPXA 4DLXA 2EOAA 2JFPA 2MSLA 4FN5A 3CPJB 3DZJA 4RIGA 3QU7A 3FF4A 1JJIA 4GLOA 4LK3A 1ULHA 2XZLA 1DG3A 2OAP1 4D56A 3HXKA 2AJDA 4I6GA 1JR2A 4DJAA 4YMGA 4EZIA 1UJMA 2D59A 2D6FA 3ZDBA 3WSWA 2WG1A 3AZQA 3IVRA 4F3KA 1RRPA 4IH9A 3OIDA 3EWAA 3DZ8A 3K0FB 4RHYA 1DQSA 1OASA 1OWOA 1TI7A 1DTSA 1EVLA 1A9XB 3I30X 4Y2JA 3V1UA 1SD5A 2A3NA 2QQ0A 3VJKA 5DT9A 1IQ0A 3I12A 4U3JB 2FEXA 2VWHA 4HH3C 4EITA 4DMRA 1HEUA 1A8IA 1UMKA 2DCMA 3FCSB 2PL5A 5FAKA 1B0AA 5TMBA 4YV1A 2Y0PA 1YDMA 1M76A 2CMKA 2H54A 1K5DA 2C98A 1Z7YA 2EL9A 4JX8A 4R0NA 4ZICA 2Q1XA 4ASUD 1QP0A 5K4HA 1C3LA 4J91A 4B74A 3A7DA 4OXIA 1G2OA 4AAYA 2VF5X 2GZDA 4BX3A 4UJ5A 4BAZA 4HVTA 3NAGA 2O0LA 2REOA 4CZ2A 3H75A 3EEFA 1MC8A 2GEDA 4YAWA 1GZUA 4C0SA 2AC2A 2JFQA 2NQTA 2X5XA 2GBPA 3K0CA 1DPGA 4ZQIA 3RC7A 3TB6A 3VPSA 1Z2DA 2G06A 3CRRA 4QO8A 2R6FA 1T6NA 3S2YA 1GCIA 2XMRA 4UXHA 1FIUA 2YFKA 3O95A 6GPBA 5MGBA 3G5MA 3L6UA 5BSVA 1GR1A 1QOQB 3IQEA 1BS1A 3MGCA 3G1TA 1UP4A 4L02A 4F4HA 5IVKA 1IBRA 2IHVA 4UARA 4F56A 1BWRA 3DHEA 2YWFA 3O4VA 4P0PB 3BT7A 2XNDA 1V5FA 1XMIA 4FC7A 2RHMA 2WPDA 3EOAI 3IAUA 5PGMA 4IY1A 4FMCB 3P26A 4U7GA 1DRWA 2EGUA 2GPNA 3NORA 4UU0A 3FUUA 4POOA 1P91A 2IYXA 2XADA 2QTBA 4OB8A 3REQA 2WOOA 4AW9A 1M6NA 4BNDB 1GL6A 1WSBA 4ZZIA 2W42A 2IF2A 2FWAA 5ARCA 3VYTB 2YHSA 3O8DA 1S8NA 2GASA 1G59A 1GUYA 5SYMA 4B45A 3QLVC 4OYRA 4KXWA 2X3FA 4ZDWA 4PO1A 4ZZ0A 1J8QA 5IYZB 2QRUA 3IHLA 4XB1A 3TSYA 4XPIA 3UVEA 1QE0A 4ZO9A 3X44A 1B14A 3SKXA 5E8RA 2YHBA 4UE2A 3SU8A 1KIMA 4HVLA 1R8JA 3KUDA 4X91A 3JQFA 5D2CA 1U28C 5FL7D 4ENUA 1UQRA 2XEXA 1ABEA 4OHFA 4QBKA 2HBZA 5TV2A 3S29A 2QT9A 3PYXA 4ZMBA 4QT0A 3KEMA 2IVZA 3FSRA 4E5SA 4ZFNA 2WD8A 1YRYE 4NE7A 5I4CA 4KV7A 2F17A 4LBZA 3KEQA 1QUEA 4UPDA 3G2IA 5EXSA 1DCFA 1QBGA 1F8YA 5CA0A 1RKBA 4INAA 3U1VA 4KE8A 1ADGA 2C4TA 3K15A 1UAAA 1MPXA 1QYWA 1RQXA 4Y2UA 3A4TA 4UM9B 4KUGA 2BI7A 1J2TA 2XT0A 2B1RA 2GTHA 3NYQA 2R11A 4NPCA 3CH6A 4G1VA 4HXYA 2A78A 10MHA 1G9TA 3A4YA 3AJ9A 1PG2A 2PX6A 3SZOA 4IO1A 4F2WA 3UQZA 4B87A 3NX4A 3SVZA 2KYRA 5FV4A 3OT4A 3EZLA 3OFVA 4TL8A 4RHFA 2C9BA 4S3MA 1GGVA 1OH6A 1U4SA 5KPDA 3HMKA 3NWEA 3C43A 1PD1A 4GI7A 4KR0A 3JRWA 4TQAA 2YN0A 3PZBA 4AF6A 2FXVA 2HMWA 2NO7A 2P40A 4NOKA 4RNDB 1S1MA 2VHQA 1Z4QA 2WEKA 4ZYLA 4Q4AB 1EJ2A 4Y6SA 4IIFA