2ZR9A

Msreca q196e datp form iv
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
327
structure length
312
Chain Sequence
b'APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINELRTTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 100
structure length 312
sequence length 327
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr9A01
4PTLA 1HE1C 2VP5A 3LVQE 1RKBA 4RFSB 4CVNA 1OXUA 1W4CA 3GLIB 4ZKDA 1YZNA 2NOAA 2YWGA 3AVOA 4OJQA 5TB5A 2WHXA 3K09C 4Q7MB 3H1TA 2VHUA 4JLPA 4XWAA 3WNDA 4TQAA 4DEXA 3NWJA 2HT1A 3RSOA 3WRXC 3QF7A 4LX0A 1DAGA 2F1JA 2O8DA 2ZSAA 3BAFA 5L3RA 2FF7A 4BPBA 1OIVA 2C5LA 2IYZA 2IHYA 3QKUA 1C4OA 4PO1A 2IYVA 2JJ1A 3LW7A 4DSNA 2ZS7A 2XNDA 3MWYW 2L0XA 2QP3A 3NC1C 4KODA 4QGHA 5DI3B 5FUVA 3SJBA 3W5IA 4M1YA 3FGNA 4QJ3A 3I62A 3B60A 5KPJA 1W49A 4B3FX 2B7BA 821PA 3HR7A 2JEOA 3KFVA 2ZRJA 2BJWA 3CF6R 4LYHA 4IVPA 2ZAMA 3UMFA 1W47A 3GLFA 1GL6A 1RJ9B 1E9CA 1NSFA 1KHTA 2PZFA 3SHWA 2YKGA 2J7KA 5KSZA 1SVMA 3KXKA 3LBNA 1J99A 1CKEA 1G3QA 2BMFA 2QA5A 3EWSA 1Q3HA 2GXQA 5FI0B 3KXLA 2D2EA 5GVRA 4BE7B 3ICEA 4C7OB 1K6MA 3R8FA 4OKSA 4WXPA 4IRUB 2IBMA 3SOPA 2BOVA 1Z0DA 2ZREA 2O52A 1YR9A 4LV5B 4K8OA 2H16A 4AYTA 5HKKA 2CHGA 4RD4A 1R5OA 2ERXA 3NEJA 3B5JA 3GLHE 5FPHA 3UWOA 2ZE6A 4BQSA 2JLSA 4LJYA 2EFHB 5TVKA 4FIDA 3UWKA 2QTFA 3CNLA 1IXSB 3OEED 2ZSFA 1PLLA 1G9XA 1KJYA 1MT0A 1O3YA 1TQ2A 2A7QA 2QNRA 3EA5A 3LXRA 3FKQA 3IPYA 3MSXA 3IIKA 1PZNA 4WBSA 4LJ5A 1G20E 1XD8A 5JCPA 2Z0MA 2JDIA 1MOZA 4ASUD 2ZI9A 1E9AA 1Q22A 2GXUA 2V55B 3EC1A 2V54A 4D0NA 5JCZA 1E1QD 2OV2A 1RRPA 3OZXA 2BWJA 2GXSA 4BFTA 2ZJBA 4DCVA 4NE2A 5DN6D 4M2LA 4B48A 1E9DA 721PA 3AVWA 2C96A 3DOEA 2RMKA 2ZEJA 1YZUA 3K9GA 5JRJA 2Q6TA 2WJVA 1Q44A 4JLMA 4D0GA 3QI2A 4XWKA 1JR6A 2KBEA 1XEXA 4ON9A 5KNDA 2B92A 1Z6AA 2XAUA 1NLYA 1DADA 1GZSA 2ZI5A 2LKCA 2VA8A 5P21A 1P72A 4TL8A 1YKSA 4HUQA 3FMIA 2UVQA 4M1TA 3LQQA 2WBLC 5C2JB 2MSDB 3IEVA 4US1R 4MGZR 1N5JA 1MRSA 1VCIA 4B2PA 2EYQA 1MO6A 2REBA 2EWVA 4WAUA 3VMFA 1NVWQ 3QPVA 3K70D 3EZ6A 5CIQA 2IF0A 1KDTA 2RH5A 2GESA 2W0SA 1FQKA 2ANBA 3B82A 3OIVA 3Q3JB 4B3DA 2FDCA 4FINA 3E1SA 4UNSA 3RSLA 1AA3A 3NG1A 3THXB 1XMVA 3RRMA 4EDHA 1GNQA 2CBZA 5DO9A 5FI1B 1E99A 2FFBA 3HWSA 4JKYA 5JWHA 2BMDA 4W5HA 4G5OA 1FX0B 4I4LA 2D06A 4KXFB 1LS6A 1CR2A 1EFUA 3KB2A 4GNKA 2NGRA 2H17A 3FKSA 3JZAA 1NI3A 4O0MA 3MWLA 5J4LA 1JR3E 3X1WA 2NMVA 1EFRA 1W1WA 4NCNA 2RGGA 4B47A 4UNPA 2GEUA 1N25A 3KQNA 1E0JA 5FUWA 2FA9A 2RGNA 4TN1A 4DLUA 4XVQA 1AGPA 2QQ0A 5EE3A 4DDUA 1AIPA 2ZRBA 1KMHB 1DO0A 1WP9A 4MGIR 3N5CA 3T1QA 4FMDF 2IT1A 1U8YA 3GD7A 1TEXA 3GLHB 1CJVC 2FPKA 4ESHA 2QMOA 1S9HA 1NF3A 3GFOA 1P4SA 3AKDA 2ONJA 2J46A 4A0HA 2YYZA 4MKFA 2IYUA 2RB4A 1JALA 2DCUA 3KQHA 3A1SA 1KZ7B 4QBFA 1TU3A 1NY6A 2OILA 4M9SA 1E9SA 1N6HA 4TYYA 3NBYC 4JVNA 4A9AA 1HA3A 1R0WA 4U5XA 3T1OA 2A3RA 3P1JA 4TT3A 1E0SA 2A30A 1VKJA 1UM8A 1E98A 4Q48A 1TTTA 3G5UA 4TLBA 1KO4A 1WBBA 5JSZB 2JASA 2P67A 2NQ2C 3W6PA 4QG7A 3QG1A 3U6BA 4RZXA 4TL7A 3LNCA 5FL3A 4Q47A 3Q9LA 2VP2A 5G53C 3O8RA 1TL7C 2ODWA 1HT1E 3BS4A 1OJLA 4G01B 3U7EB 4BRUA 5EXTA 4EPTA 3Q85A 3GEHA 3SC3A 2ECKA 3F5FA 2DPXA 2FFAA 2C98A 1H8HA 2QT0A 3UMSA 1GITA 1JAHA 1HH4A 2O8DB 3X1YA 2WWXA 4C4PA 1B23P 3B85A 3NDBB 3I92A 3F3YA 3K53A 4JLKA 4R71A 1XMJA 2IXFA 2OBMA 4NCHA 3GLGE 1P75A 3U44A 4P31A 1WMSA 3OEEA 5BN4A 3S1AB 1QDEA 4G5RA 5LD2C 1SVWA 4Q4AB 1GNRA 2G1KA 1W48A 3O8DA 2K5UA 3I72A 1KI7A 1SKYE 2F6RA 3AP1A 4LZZA 1IY0A 4EQ6B 2W83A 3BOSA 3DKPA 4I1UA 1E1QA 2VHJA 3GLFB 1S1MA 1FNNA 1T3LA 2HXSA 5LPNA 4YMSA 1Z0KA 4WW0A 1SXJC 5DSZA 2IYLD 2JCSA 3IHWA 4BLTA 2GEDA 5DN6A 1HQYE 4HZUB 3A36A 2H1LA 4L5BA 3QXCA 4W7SA 5G40A 4PSKA 3B13B 3E70C 3FMPB 1R6BX 3Q7QA 4LUCA 3TE6A 2XOKA 4CEIA 1TADA 1RIFA 1XDBA 2GWHA 3IBGA 1GTVA 1Z28A 3VR3A 3M0EA 4I1VA 1FP7A 3UIEA 4NONA 3RNLA 2GCPA 2G88A 3UMRA 5EZ6B 5CJPA 3BE4A 2CL0X 1NJGA 1Z3IX 1XXHA 3WP1B 2NG1A 2PJZA 3BERA 4D6PA 1X8JA 3EZ2A 1G8HA 2G0TA 4UJ3A 5JZVA 2ZRPA 4KCGA 2BVNA 3NBXX 3CPHA 3T1VA 2VRWA 3PUXA 1AKYA 4CEJA 4JMPA 5FUYA 1DARA 1W5SA 4TTQA 2X1VA 4LBVA 2NZ8A 4RD1A 4DB4A 4AC9A 2ZR9A 2C78A 4B43A 3EPHA 2EFEB 4Q1DA 4JBYA 4B33A 4AI6A 2QPOA 3DPUA 3TUJC 4QRHA 2ZR7A 3PENA 1GRRA 1EFCA 5AJXA 3C15C 5JS8A 2CHVA 3AKYA 3E5HA 4Z8YA 3B2EA 2GRJA 3HU3A 4PZLA 4LHXA 2CJWB 2DHRA 4DLWA 3X1DA 3R7WB 3T5DA 5G3ZA 3HPRA 3GFPA 2IHBA 2YWFA 3RS3A 3SNHA 3THOA 1M7GA 4O3MA 4NCKA 1LV7A 3K70C 3SBDA 2G77B 2YVUA 2MMGA 3W8NA 1KYIA 3QEJA 1D5CA 3LLMA 4TTPA 3I73A 4A2WA 4A8JC 1CLUA 3PEYA 1XMIA 1OE0A 3BH6A 1A4RA 4IEIA 3ONWA 3QXXA 2XB4A 3EPKA 2BM0A 2HCJB 1OHHD 4DLSA 3JVUA 1PUIA 5DIFA 3A4MA 5HZKA 2KBFA 3REFA 2QENA 4MQBA 2O8CA 1SXJE 5EJEA 4LK2A 4Q1EA 4B44A 4MKHA 2YV5A 2AFHE 5A0FA 1AQUA 3GLGB 4HAWA 1IJFA 4ZCIA 2FPMA 3TJZA 1XWIA 5DE3A 4B35A 3WYGA 2ZXUA 1S3SA 2GDJA 4V0NA 4Q9KA 5EXSA 1UF9A 4KSBA 4JLJA 4R7ZA 5CJ2A 1P3JA 1QHGA 1R10A 2N46A 4TLCA 3DMDA 3SFVA 4TYNA 1U8AA 1ZUHA 2YC2C 2N1BA 4KV9A 2Q3HA 4F92B 1RPZA 1NMXA 1TU4A 1JI0A 3AGPA 2BCGY 4LV8B 4DWJA 2W6ID 4XSHA 1CRPA 2V7QD 2XX3A 3KZ1E 3DEFA 4ZCLA 4P4SA 3ZIAD 1PUJA 1ZMXA 2ZYWX 3ZLJA 4M1SA 2O0HA 2X2EA 2GBLC 1ZD8A 2YWHA 3TAUA 1VMAA 3U6KA 2EU8A 4X8OA 1HUQA 2JIZD 2VSFA 4G0NA 1WXQA 4ZKEA 3KKNA 4PC7A 4A1FA 1E2IA 3T06B 4ZV4A 3TR5A 2QPTA 1RRCA 4CDGA 1ZW6A 1L8QA 4KVAA 3PFIA 4XD7D 4UNQA 3K0FA 1ZU5A 2XJ4A 1P60A 4YDHB 1A2KC 1TAGA 3CR8A 3MCAA 4LHWA 4EFLA 4OBEA 4TSFA 1Q21A 1US8B 5FBVB 3Q72A 1YE8A 1WDTA 4JS0A 1OW3B 1XCPA 3BB4A 4IEEA 4RY2A 3AUYA 1LFDB 2QP9X 2O0KA 4NCJA 4PXAA 3CRRA 2Q9AA 1LW7A 4GPTA 4KLNA 4DDTA 1GRQA 5JJKA 1PVOA 1OFTA 4YXWA 1FL9A 4CGZA 1ETUA 4KITB 4O2RA 4Q9IA 1Q1QA 5LB2A 2W6JA 1VHLA 5FBLB 3K0SA 2WICA 1UJ2A 3GEIA 4C0KA 4G1UC 4ZDWA 3RRYA 4D4KA 1EFHA 4MRRA 1AS3A 3SJAA 3QY0A 4Q4LA 1ZBDA 2ZQ5A 4IOMA 5AUOB 4QNRA 4XJXA 2FFQA 4ZO4A 2WMOB 4RJLA 5FL7A 2AD1A 3OFND 4UQOA 1FW6A 4W5JA 1R4AA 3IO5A 3ZQJA 3AVTA 1EESA 1FNMA 2RHDA 2ATVA 3P4XA 2ODEA 2YHSA 2W2VA 3BJIC 2HJVA 3JZMA 1IM2A 1ZM4A 5H1YA 3NBFA 1ZD9A 5LD2B 2QRZA 2R62A 1QHYA 4L16A 4BRWA 1EGAA 2YZ2A 3QXHA 2CEAA 2OFWA 4S35A 4MRSA 2VIIA 1G1MA 5AJWA 5EXPA 2ZANA 4MA4A 2H5EA 1EX6A 3MWKA 1LB1B 2P65A 121PA 1KI9A 2JJ1D 3SEAA 3K1JA 4K46A 2BHRA 1XJCA 3AF0A 2ZJ8A 3K8YA 2XNDD 2PL3A 1DAFA 4HATA 2CE7A 3CZQA 1LF5A 1G7TA 3P20A 1HY3A 4QGFA 3W3ZB 1T3SA 3U44B 1VIAA 1G17A 1ZM7A 3CWQA 4GMXA 3KJIA 4AYWA 2P6NA 2BMEA 4UNNA 1ODFA 2PX3A 3AB3A 4HDQB 3I5XA 4E09A 1Q1BA 2FSIA 2H7VA 2OM2A 4OQMA 3K9HA 1OKKA 4FCWA 2C9OA 4RCZA 1P2SA 5FBRB 2NZJA 4PHTA 4MGYR 3KKMA 4A4DA 3TQFA 2DFTA 2DY1A 4OQLA 4G5QA 3B1ZA 4Q1CA 1HE8B 4OI2A 2XZOA 2VP9A 2CLSA 1NLFA 1KDPA 2CLDX 5FPTA 4F91B 5JRZA 3WNCA 3DHWC 1KO1A 2ZUCA 3IQXA 2FPLA 4R98A 2IYRA 4QJ4A 1FTSA 4TMKA 1BYIA 1Z6XA 1NL3A 3H0KA 3PITA 4M4SA 4BFSA 3I5YA 2GVDC 3BIFA 1AM4D 4IOLA 1OB2A 1XXHB 2OESA 4DRZA 2IX3A 4H1VA 3PIRA 4EUNA 1JJVA 3CB4A 4WIAA 1AKEA 1JEDA 4KJZA 2CMKA 3NKVA 2AK3A 4O2LA 5EP1A 5AUPB 5FOSA 3O8CA 4LY6A 2WWIA 1KK0A 1Z2CA 3P4YA 4TMTA 3NEYA 4TWZA 3H86A 1XCMA 1DAMA 3RS5A 3TSZA 4MITA 1ZU4A 2O0JA 1EX7A 5L3SA 3K70B 3SFZA 2VP0A 4Y0VA 1R2QA 3ZDQA 1U9IA 5EZ5A 3ZD6A 1G6OA 4WZAE 4OI0A 2VHQA 4NYIR 4NDZA 3TH5A 1KI1A 1PLJA 1YHNA 3EW9A 2WOOA 2Z43A 4BLPA 2PLRA 3I32A 2R6FA 1G5TA 2MSCB 5A4JA 4MRPA 2G1JA 1NBMA 3NBZC 3AVQA 4N0DA 4LBWA 3U7FB 4Q9LA 2ZYUX 3UK6A 4PC6A 1YQTA 1KGDA 5AJVB 4LHVA 1T9HA 1W44A 1YR8A 2NO9A 3CRMA 4M9XA 1NN5A 5HPYB 3GJ3A 3MG9A 2W6IA 3QENA 3I8XA 1G5RA 1YVDA 3GMTA 3NTUA 4MYHA 4URWR 1SKQA 2AHOA 2QN6A 2ORVA 1E2FA 1P5ZB 2J0UB 4QGGA 1R8SA 1G8YA 1HURA 1IQPA 1R7RA 2FSHA 4LC1A 1UPTA 2CL7X 2CNWA 3FMOB 4DUGA 1IN5A 3LXXA 3V4RA 4HLDA 2F1IA 3EIQA 3V9PA 4LHYA 5EQTA 2O8CB 1A5TA 4RSGA 1AK2A 4MYUA 1KJWA 2FEMA 3A58B 4XD7A 3TVTA 4H1UA 1NMZA 4PQFA 2J41A 3M1IA 2GCNA 3UG7A 3IDQA 2BIFA 3N2IA 5AUQA 3BXZA 2EFCB 4RD3A 3IGFA 2NPFA 1HT2E 2FE4A 4PX9A 2IUUA 5SZIA 1CJTC 4R9UC 4GP6A 4LCBA 3CH4B 2OE2A 2F9LA 4CRWB 3ICQB 4KSCA 1FUUA 1E2NA 3A4NA 1U8ZA 2QEQA 4LC0A 2Q3MA 4OI4A 2J87A 4A2PA 3QVVA 4A0RA 1IN7A 4MGKR 3WY9A 4Q01A 2GVZC 4M1OA 2KI5A 3HYRA 3AH8A 1XTIA 1E96A 2J0SA 4B75A 2C04A 3TSWA 1UBEA 1KDOA 1II9A 1GUAA 4PSAA 1DOAA 2HLDA 3OF5A 1ZC4A 4RFVA 4LRWA 3VU9A 4GFDA 1MR3F 1G3IA 4G5SA 3QSYA 3OFNA 2CL6X 1G8GA 3CF2A 4LHZA 3FHTA 5AK0A 4M9QA 4TMWA 4URYR 4B3CA 4C0HA 2ZRLA 3W5JA 3L8ZA 3B8HA 2CVFA 3FFBA 1Z0JA 1NIJA 4ILEA 2IWHA 3K0FB 3AGQA 1Q20A 1TEVA 1NMYA 5CDFE 1J8MF 2OFXA 2Z5FA 1OYWA 1SHKA 2P3SA 5AUNB 3U5ZB 3EWAA 1TQDA 3THWB 2IK8A 3AP2A 2ZYTX 3KFXA 1F2UA 4IFBA 4KYIB 4N1AA 3WMFA 4DCNA 2ZROA 3H4MA 5KUTA 3ZGXA 4XVUA 2O8BB 421PA 4IVQA 4KFSA 2HV8A 2WJIA 4TT3D 3K9LA 3VR1A 3X1ZA 1XPRA 1KK3A 3U61B 3QE0A 3A6PC 1EWRA 4HLUA 3QOFA 1W0JD 4DIDA 3CR7A 4QL3A 4FCTA 3NHBA 2AFIE 2R6DA 4JL6A 4BLSA 2O5VA 1DAHA 3HU1A 4MDEA 4OHXA 5KSPA 2ZJ2A 4EIWA 4UXIA 5IRCD 1W2HA 2I1QA 1OXVA 4IHQA 2JJ2A 3DMNA 3T1TA 1BOFA 1XPUA 4PPQA 3MMPA 3UG6A 1CJMA 3IILA 1MO3A 4TZ0A 3ZYCA 5KU1A 2PJRA 1VCOA 1GWNA 1N6NA 3Q7PA 1H8HD 3V00A 4UXJA 3RC3A 4DEYA 6Q21A 2WWYA 3B7GA 3TUIC 2LKDA 4U7DA 1G3RA 1P62B 2REXB 1I4DD 2MSEB 1MO5A 1J2JA 3I1FA 4NYIQ 4V03A 1KIMA 4DCTA 1S0UA 2HEIA 4ERNA 2VBCA 4LI0A 3QQ5A 5FR2A 3QEOA 1OH5A 1JEEA 1U94A 4PR0A 3K0AA 4CYMA 1GM5A 2BCJQ 3KL4A 4OI1A 4GBMA 1NVVR 1Z8FA 2RHMA 1E2EA 2GAOA 3W8RA 4X8HA 1VPLA 2GILA 2ZRIA 4DVGA 4PC2A 4YMUA 5C46F 5D3QA 5JHHB 5J40A 5KSOA 4BFZA 2DFLA 1NSTA 1XZQA 2WPDD 1C1YA 2GZAA 3AV0B 4IVRA 4C3ZA 4HLQB 3BC1A 2OEPA 3WHKA 1D2NA 2UKDA 3K0CA 2D7CA 3Q8XB 4YLGA 4CEHA 3R20A 2XTMA 4LGMA 3PEWA 3C4JA 2VO1A 4I1SA 1ONBA 4A82A 2XOKD 3P32A 2ZVPX 4B73A 2IW3A 1KNXA 2C03A 4GOKA 1U0LA 1YZQA 1JB1A 4D0LB 1UADA 4YC7A 5BN5A 3SR0A 2QORA 4LV6A 5FOTA 4GL2A 3E2IA 4JLBA 2QROA 3W9YA 3ND8A 4JVLA 2GNOA 3ZZUA 2R8RA 5EP4A 3ZVNA 1Z22A 2HCBA 3VKGA 1OFHA 1KSFX 2ZI6A 2A9KA 3HP1A 4M1WA 3M6AA 2E87A 2V6JA 4Q21A 1NLZA 1D2MA 2ASEA 3KQUA 1G64A 3BFXA 2R6GA 2QMUA 1FQJA 5J4VA 5L3SB 2JLYA 1T6NA 2O8EA 1IY2A 3GLFE 2WTUA 1UEJA 5DISB 4KFUA 1T5LA 3VR2A 1F6BA 3GP8A 1K5GA 1IXRC 4RZUA 5IHPA 1W4RA 1ZIPA 4PZZA 1SVLA 5FTKA 4B2IA 4Q9JA 4DT1B 2BC9A 3LAWA 4OQXA 3MFYA 3A37A 4JL5A 1JPNA 3IPXA 3OIYA 2D62A 3CPEA 1E4VA 2D2FA 1HQCA 3EIEA 2VP6A 3M4YA 2AXNA 4Q02A 1WE2A 5BYJA 3IKJA 3WYFA 4V02A 5DI9A 4AD8A 3I8SA 3KKOA 3GJ6A 2BMJA 4FWIB 3CRQA 4WZBE 3AVYA 1ZD1A 3CUEF 4Q4JB 1NN0A 4ITRC 3TRFA 1ESNA 4YMTA 3FMFA 5TMPA 1UDWA 3TVDA 1M1YE 4L9WA 5UKDA 3DM9B 4C2TA 3QG5A 2VF8A 5GJWC 4DCUA 4PQRA 1XF9A 2RGNC 2RKOA 2V6IA 3BFVA 5C18A 4EPXA 4Q5IA 1OFUX 2AKAB 5CLLA 1X1RA 2DWQA 4D26A 2GA8A 2H8KA 4AKIA 3B9QA 3MJHA 1KI2A 2DFKB 4HZIA 5KOYA 3EZFA 3TLXA 2IYQA 2QAGA 2QM7A 1BIFA 1Z0FA 1ZIOA 2DBYA 2VTKA 4GSYA 2FWRA 4ZDJA 1W0JA 2AD5A 4KHZA 4DLVA 1M7HA 4W9MC 3PG5A 1V43A 4NKRA 4B32A 4DB2A 3CO5A 3ADKA 3F0TA 2FGKA 4TTRA 4AKEA 1LVGA 4P4UA 4QBGB 4US0R 4UXHA 5J4HA 1NVVQ 1KY2A 4E22A 4PHFA 3QJYA 4GI7A 5TDHA 2NO1A 2FEOA 2WWGA 2ODNA 2B6HA 2ZJ5A 1CULC 4JLVA 4TMXA 1R0XA 2DWOA 2NO7A 1XMSA 5LBIA 3SE0A 2QP4A 4EAQA 2JLQA 1OB5A 4CF7A 2CDNA 4TSFD 4DLXA 4NYMR 1WA5A 1ZRHA 2FSGA 1F2UB 4PHHA 1V5WA 5K8IA 3IEUA 1DPFA 4YXWD 2R6CA 4A2QA 4YQFA 4BUJA 5FTLA 4IJMA 2W6JD 1RYHA 4XWOA 1SGWA 3GJ8A 4CIDA 5TXGA 3WYAA 1ZUNB 2WPDA 2CK3A 2XJ9A 3CM0A 1E2MA 4A36A 2ATXA 3C14C 1N6RA 3HU2A 3AF4A 3ASYA 5C4GB 2UZIR 1T3HA 3DL0A 3NH9A 2A5FA 3QKSA 3LV8A 4QBIA 3RAPR 4D80A 2RGCA 5FL7D 4LJ7A 3O47A 1G19A 1TMKA 1W5TA 4PC3A 3TNFA 1VYVA 3MD0A 4C2UA 4A92A 4B6FA 4TLAA 5K8LA 4DHEA 1HV8A 5KPDA 5E7JA 1KI8A 5H70A 3L82B 2QMHA 2ZU6A 1OFIA 1FZQA 1P2VA 2OXRA 4XTRA 5DGXA 2LCFA 1XJQA 4DZZA 5B2ZA 2F43A 4LPSA 2OBNA 3HDTA 1M8PA 4G3XA 1II8A 3K0AB 2JA1A 3LFUA 5BN3A 2IS2A 2ZSDA 1XJ0A 1K5DA 3H2YA 4HUTA 2ORIA 4A6PA 4BFYA 4FXPA 4ZDIA 3AKCA 1E0KA 3C5CA 3MGCA 4Q7KA 1C9KA 5EE1A 1KI4A 3D7MA 3FB4A 4XSGA 1OKKD 3VHXA 3CW2A 2A78A 2QT1A 1YJ5A 3PCRB 2QAJA 3CZPA 3FWYA 1QRAA 2AL7A 2B7CA 4URZR 4C0BA 1GAJA 5J4YA 2B21A 2SHKA 1KI6A 3PUZA 1Z47A 1G6HA 2KE5A 1SVSA 4BZXA 2YOHA 2ZI4A 4ZI3A 4CEHB 4FMCB 4OK5A 1NRJB 1UAAA 2V3CC 1Z06A 5F9HA 4EPWA 4P4TA 1Q57A 4UKDA 4B6EA 4YMVA 5F2EA 1VG0B 3NH6A 4B2LA 1XEXB 4PANA 2YJTD 3W6NA 1FOEB 1X1SA 2FV8A 1ZNXA 2D3WA 4QGAA 4PPFA 2FFHA 2F55A 2BBSA 4TQ9A 4BZQA 5KO2A 4HUQB 1T0HB 2W2XA 4IFEA 4R2IA 1JECA 1P7CA 2ZR0A 5L8VA 2QPAA 1R0ZA 5CITA 1P9NA 2WJYA 3BH0A 3THYA 1TQ6A 5KDDA 1EG7A 1GOTA 4LWZA 1LTQA 1Z0IA 3PQCA 1N6PA 1T8UA 2ZPTX 5GVSA 4Q4HA 3TUZC 3CF0A 3VR4A 4HSEA 2O8FA 3VFDA 2VPPA 3G82C 4GOJA 5TARA 2FSFA 4D2IA 1QBKC 1G5PA 3DVLA 2B8TA 3KXIA 1KKMA 1Z6GA 1NBMD 4GZLA 1AJEA 4BEJA 3CX7A 2IYTA 2OHFA 2PEZA 2VYFA 5EE9A 3JVVA 2FOLA 2C95A 2UZ3A 4HAYA 1QZXA 1OH7A 1D9ZA 1X8KA 3TBKA 1HEIA 1JXMA 4KVGA 621PA 2RCNA 3EASA 1OPXA 2RGBA 3AF1A 4NYMQ 4BASA 5FUXA 1VDZA 5F3WB 1Y63A 1J7KA 1E0AA 4PAMA 4WA7A 3VNVA 1M74A 2CNWD 4PSVA 1XXHE 5TV2A 2QTHA 4DUGD 3DKVA 1GRNA 1XTKA 3QF4A 2RGXA 1N0UA 3PV0A 2JJ8A 2I3BA 5M04A 2J9RA 1BS1A 2AWOA 4DXAA 2QMEA 3PXGA 3WHLA 4RCYA 1E79A 4PQYA 1N5KA 1XRJA 4G5GA 4RFSA 4URXR 3GLIA 1S3GA 2ZS9A 2BBWA 2Q21A 4KAXA 3LD9A 4TYWA 1IN4A 4RZ2A 3WRYC 1Z6TA 3U3MA 2DWPA 4QHTA 4EJSA 4L15A 1KOFA 2BDTA 3A8TA 2Z83A 3CNOA 4WZ6A 5EE0A 2JGNA 4MKGA 1FPMA 2FGJA 2R65A 5KDLA 2QAGB 1UBFA 4C30A 3AKEA 2PT7A 4GP7A 3QVUA 4I99A 1IHUA 2HLDD 5AJZA 3C16C 3IQWA 1YRAA 4HB4A 3DZ8A 4KBGA 2KWIA 3GEEA 1S4QA 2KJQA 3BFKA 3K9NA 3UATA 4C0LA 3CIOA 4HAVA 3MWJA 1IY1A 4URVR 3C7KA 4JLNA 2LWIA 1KY3A 1XEFA 5SZHB 4HYYA 2ONKA 2QZ4A 1RJ9A 4PFSA 2C2HA 5FOWA 3EIHA 4Q7LA 2V1XA 1DEKA 3RABA 2GCOA 3OIWA 3HYTA 2XGJA 2CCKA 2QE7A 2WMNB 4OHWA 3U3JA 4DDVA 1FMLA 3V4FA 2F1HA 3AQ4A 1M34E 2WWFA 1U99A 1XTRA 1DELA 4YMWA 2CVHA 3D8BA 2ZM5A 3N70A 4BLOA 3EG5A 3U7GA 1AS2A 2ODBA 4BFWA 4JSTA 3UANA 2JATA 1UBCA 1RRFA 2GTPA 5HTKA 2WZQA 4MRVA 5BXQC 4ARZA 1P61B 5JFGA 1D6JA 1F3OA 3OEHD 2BKUA 4IOJA 3DOFA 2XZLA 1EWQA 3PUWA 4N3NA 4H9GA 1CJKC 3QKSB 2RGAA 5HE8A 2OCBA 4MKIA 2JJ2D 5SZKB 2F3RA 1IONA 3U7HB 2GK6A 1N3BA 3OHMA 5C1BA 5H68A 4JVMA 4QFMA 3GJ4A 2HXYA 4CEIB 2GEVA 1F5NA 1XCGB 4AURA 4JBXA 1AN0A 2NPIA 3IBYA 4HAZA 4QHSA 2ZRHA 4DLRA 1NJFA 3CRW1 4PAQA 1U81A 1ZP6A 5JI2E 2EWWA 2ZUDA 5JWOA 5KYKA 1QHHA 2F43B 4JIMA 3L0SA 4JT4A 4V0MA 4DBLC 1NVUQ 5G41A 1M6NA 4BFXA 4Q19A 4B3GA 3A4LA 2IEZA 2J3EA 3G0HA 1II8B 4FN5A 4CEJB 1VG1A 1L7VC 3FPAA 1GKYA 1DAIA 1Q1ZA 1U90A 1NNEA 1XU4A 1WF3A 1JR3D 5AR1A 2QGZA 3I3SR 3VTKA 3B1XA 4Q1FA 4Q7JB 1ZM2A 4Z54A 3VX3A 1G8PA 3KJHA 1TQ4A 3BH7A 1UKVY 1LY1A 1QHXA 2FH5B 2VHTA 2C8VA 3OE7D 4P0TA 4RKFA 4RVCA 4A0GA 1KMQA 2PMDA 2R2AA 2J7PA 4AIIA 1EFTA 4JJZA 2BEJA 2HF9A 1VG8A 4UNRA 5FBWB 4DIEA 3OESA 5D3MA 2JLUA 2HYDA 1M2OB 2QM8A 1SZPA 2C77A 1LF0A 2HYIC 1U9IC 2FN4A 1PJRA 5EUMA 1GP2A 3R8CA 1W0KA 2FZLA 4TL6A 4CT4B 1CR1A 3UKDA 4IXNA 2D4HA 4MYCA 5EUQB 3THXA 5JMTA 2AR7A 2EFGA 2GZHA 2OCYC 4LJ4A 4AG6A 1AS0A 1QVRA 4F4JA 3T34A 2WVJA 2VEDA 3EPJA 4AKGA 1RZ3A 1FX0A 1S9DA 1Q0UA 3B78A 4QKQA 4M1KA 1TF7A 1G3UA 3WP0A 2QGNA 4WVFA 3THYB 2FMXA 2OG2A 3KB1A 2PCJA 4JZKA 2ZSBA 4Q4HB 4WOPA 1G8FA 3T61A 4P33A 1GKIA 3A1VA 5FR1A 1WBDA 2XNSA 2JLWA 5EXXA 4PO9A 3PVSA 1N0WA 1OIXA 1XEWY 5K8TA 1Z63A 1ESMA 1N5IA 3AVPA 4DKXA 1OH6A 221PA 3EAQA 4M1MA 3A1TA 3RWOA 1Z29A 2XSZA 4S2EA 3SYKA 1KZGB 3PUYA 5F9FA 4EPVA 2BBTA 2OAQ1 3GLHA 1A7JA 2VH5R 2IYXA 4XVRA 2F9MA 2OFOA 4EFNA 1IN6A 2Z4RA 1UEIA 1CRQA 3BGWA 4M0LA 3REGA 3LX8A 1GSIA 3OIUA 1HTWA 1GG2A 4P4SB 5JBQA 5KDOA 3GCGA 3EZ7A 3GJ0A 3ZJYA 1JAIA 2YOGA 4JBWA 2X2FA 4JKIA 5G3YA 5CB6A 1A2BA 1N6LA 5GADl 3FOZA 4HB3A 4TL9A 2YWEA 5FTJA 2P6RA 3RS4A 3GJXC 4Z1MA 1COWA 4IDOA 1NVXQ 2AN9A 3K09A 3QF4B 1G4UR 2IXGA 5HCIA 1E2HA 1ZJ6A 2G83A 3RS2A 1IJEA 3CBQA 1ZC3A 3ZZTA 3PJRA 2C99A 2IEYA 2ZJOA 1N2CE 2Q3FA 2OLKA 2OBLA 4QNMA 5ELXA 4AY2A 1GL7A 2WJJA 3IIMA 1KSGA 1SVKA 5JS7A 1I2DA 3HR8A 4U02A 4Z51A 2GETA 2ZRGA 3AF3A 4HAXA 1U2RA 5B57C 1S8FA 3AVVA 4EJSB 1E2QA 5CLQA 5LDDC 2QI9C 3WNBA 1I2MA 1NBME 1KDRA 3T12A 3VKWA 3CRVA 1L4YA 5FTNA 1N5LA 5FOXA 3SU8A 3BB1A 3OEHA 3PUVA 1G7SA 1IN8A 4KLZA 3TK1A 3X2SA 4QM6A 3KKQA 4OK3A 2OO7A 3S1AA 2XZPA 1FTNA 4QM7A 521PA 1T91A 4Q4AA 1HYQA 2NO6A 4Y0AA 1VIYA 4OJKA 2HDNB 3CX6A 2XB2A 2GJKA 1DAEA 3ECCA 4HLUC 4JT2A 4EQ6A 2IL1A 1D8TA 1NN1A 4I1OA 1U98A 5CK4A 3ZVRA 3LX5A 1NIPA 2WJGA 2X77A 2WWHA 1N6OA 1Y3AA 4QBHA 2V8OA 4GOXA 3SS8A 3TR0A 3ZS9A 2GCOB 4HZUA 3SYNA 5HR5A 1S1CA 1UKYA 5H8WA 4FMDB 1E2GA 5AJYA 2ZRFA 5B58C 3VNUA 4IDQA 3BBPA 5BW8A 1JR3A 3R9WA 1FP6A 3O8BA 3AEZA 4OQNA 5HCNA 3VX4A 1A82A 1OXXK 3I4LA 4BZPA 2CK3D 4M9ZA 2ZRNA 1VG9B 4ARZB 5KTYA 4PPNA 1NG9A 1AGRA 2GJAA 3FTQA 2FJUA 3J81k 2RAPA 3ND9A 5JI3E 3T15A 5ANRB 3HPQA 3U3RA 2N42A 2TMKA 4HDCA 1SXJD 2HJGA 3OE7A 2DR3A 4OL0A 2XEXA 2VLIA 3B1VA 1ZAKA 1XEWX 4TQUS 1XTSA 2GXAA 2EW1A 3IUYA 1DG1G 1QHIA 4Q00A 4URUR 5CYPA 3AF2A 1XTQA 3C5HA 1DS6A 4FD2A 1W36B 4TMVA 4XIGS 3VHLB 4OQFA 3T5GA 1G18A 1W2GA 1CIPA 2IF2A 3GJ5A 1BMFD 3QPWA 4C0AC 1YZGA 2P5SA 3QXSA 4AWXA 3SYLA 5L3VA 3K0CC 1CXZA 1KKLA 4HI0E 5CK5A 2CJWA 5HE9A 5KNBA 2QSZA 1QHHB 2ZRCA 3R7WA 4F38A 4FW9A 5JJIA 1VECA 2MMCA 3W90A 2GKSA 1X86B 2GF9A 1MRNA 5GJCA 5J4KA 4W5WA 3KX2A 2WKPA 2KB0A 3KQKA 4BLQA 4DLYA 1Z83A 1ZYUA 3U3OA 3SDZA 1MABA 2ZETA 4NP6A 5FOUA 3ZS8A 2V4ZA 3FYHA 1E2LA 2OUKA 1DVRA 1DAKA 2DFNA 2H57A 2Y8EA 2D74A 3L43A 1NKSA 1QG2A 2WOJA 2X8AA 5J5CA 5KNCA 3FHOA 4M8NE 3ZVLA 1G291 3BD9A 1JXOA 2ZTSA 3PEVA 4XOIA 5AWFC 1TF5A 5FFMA 3VR5A 1E3MA 5TY0A 3DZDA 4ZIRA 4F93B 5D3MB 4BFVA 1DBSA 4LYJA 1Z6YA 2R6AA 3GLGA 4M22A 2JLRA 2XXAA 4BWYA 4R2HA 4BEBA 1E1RA 1PLKA 1BKDR 5E7MA 4D81A 1I4TD 1E9RA 3PEUA 3W6OA 4DSUA 3EPLA 4D25A 4GMDA 3UPUA 3FE2A 2CCJA 3CWZA 1D9XA 5HZHA 2YOFA 3IHLA 5IDVA 2FNAA 1G7RA 1P73A 4DC9A 1Z07A 3LLUA 3MAAC 2EVWX 4P3YA 3R9IA 8OHMA 4OHYA 3EC2A 4O25A 3IO3A 2PLFA 1YZKA 1Z2AA 4FCVA 1AZSC 1E9BA 3Q5EA 4RD0A 2H18A 3QIAA 2BM1A 4IDPA 4LPKA 4PC1A 1CP2A 4EPRA 5C4MA 2IS6A 3RC8A 1RE0A 1IOZA 1YR7A 4UJ5A 3ZH9B 5JHGB 2YC4C 4C0SA 2PZGA 2V9PA 1LS1A 3BRWD 3BWDD 4TLDA 2WM9B 2VHCA 2NIPA 2J59A 2GHIA 4AK9A 2I1VB 2QBYA 3VQTA 2IS1A 2ORWA 4GZMA 1GKUB 1JJ7A 4LJ9A 1O87A 3KUDA 1GFIA 3SZRA 4N0EA 2A5GA 4NYJR 2IYWA 3KTAA 1UDXA 1UBGA 2QY9A 1J90A 1W46A 2A2ZA 2ANCA 3CONA 1JQLB 1KTVA 4Q9HA 1KJZA 3NC0C 3RS0A 1XPOA 3QKRA 1US8A 3ADDA 3WXMA 3KUCA 4LJ8A 3KDSE 4GRAA 3SJCA 3L0OA 1P2TA 5E3HA 1TUIA 4RZ3A 2ZE7A 2G6BA 3VU9B 1KO7A 4ACAA 5FPKA 1E69A 3LBIA 1WB9A 1NG1A 1UKZA 2QAGC 1OF1A 1E2PA 2ZE8A 3SI7A 3RWMB 1MH1A 5DYIA 1S96A 3UXMA 4JJKA 1CEEA 2J5XA 4L8GA 1SVIA 3WBJA 1CBUA 5JJLA 1Z0AA 3P26A 4LJAA 3EZ9A 2J0VA 1E79D 4AYXA 1NY5A 3ZZ0A 3R9XA 3QUSA 1EK0A 4E07A 1KK1A 2REOA 3QBVA 1GDDA 2BKEA 4DLZA 2D7DA 1P9WA 5BQ5A 2BBOA 4KI0A 2GAAA 3RRNA 3WMEA 2AX4A 4LBZA 4TZ6A 1G4AE 4AKHA 1P2UA 3SBEA 5DH9A 4F4IA 2WIAA 3EARA 2ZIAA 1E32A 1F2TA 4A6XA 1F48A 4GT1A 2WSSD 2VF7A 1SQ5A 1WRBA 1I4LD 4II7A 4OHZA 3N2EA 4D82A 4MUAA 2XTNA 1T0JB 3TGPA 2F7SA 1SXJA 2I4IA 2QU8A 4IOKA 2H92A 4ACBA 1D2EA 3X1XA 3MRSA 1X3SA 4V0LA 2IC5A 3W34A 1W4AA 3L2OB 2HT6A 4CW7A 1ZM3A 2OT3B 1P6XA 1G7CA 4NH0A 2AK2A 4ASUA 2YNMA 4Q03A 4L4UA 2NO0A 3B9PA 1KNQA 1BMFA 5JWRA 3L8YA 5CM9C 4MRNA 2P6UA 3EX7C 5SZJA 2QE7D 1TNDA 2ZYVX 5FOVA 1DG3A 4IKEA 1E4YA 1S2MA 4YONB 4IW3B 2IUTA 3GQBA 3RANA 1Q12A 2XITA 1E6CA 3LW8A 4J0QA 4OYHA 4QOSA 2ZJYA 2W00A 4JVSB 5KHOC 4I81A 1E94E 2ZS8A 3U60B 3IIJA 3TW8B 4E5UA 4ZPXA 2F3TA 3NIBA 3LDAA 2P0EA 2VL7A 3GFTA 4Q1AA 1TX4B 4MH0R 1F60A 2ZE5A 2E1RA 4U00A 5BWMA 1IBRA 4TYPA 2Z6VA 1R5BA 4V0OA 1FFHA 3RDPA 2G0NA 2HF8A 1IXZA 4XH9B 2GJ8A 3Q5DA 4V0KA 2ZRAA 1E2JA 1XB2A 1WQ1R 1DE0A 3CLVA 3VKHA 1W36D 2QQEA 4C0JA 1G41A 1JNYA 5GJVC 4B3BA 3ASZA 4Q66C 3VAAA 5JLJA 4XTCS 4LJ6A 4PPGA 4BECA 1H65A 1AQYA 1BH2A 3RRZA 3QPUA 2A5DA 2ZRMA 4ESVA 1E9EA 4PHGA 1LNZA 4A8JA 3LVRE 2NTYC 4JLDA 2PZEA 3U4QA 1RYFA 1UFQA 1ZNZA 4NYJQ 2QRNA 1RRGA 1XX6A 2OCPA 1A1VA 4PO8A 5DYGA 4US2R 1XTJA 1OH8A 4GDFA 2E9SA 3PR1A 3LWNA 4E03A 3DDCA 4D4JA 4LBYA 3SJZA 3OAAD 4EFMA 4JYCA 1MABB 2GZDA 1N6KA 1KSJA 2O8EB 2J0UA 3NXSA 3GPLA 1JBKA 1OLOA 4NHOA 5L3QA 1TPZA 5EP2A 2OXCA 1N6IA 2J7PD 4RKEA 3DO6A 4TLEA 3NHAA 5FPSA 1CR0A 1VYTA 3SHFA 2WJHA 4RD6A 5LB4A 4K81B 2VP4A 1UKEA 4C9BA 4JLAA 1AZTA 4LYAA 1RW4A 5B64A 4ZIRB 1OT3A 4LSGA 3QXJA 1XD2A 3RHFA 2Q9CA 1KI3A 1YR6A 1J70A 2HUPA 1W0KD 3D31A 4M21A 2XXAB 1CTQA 1X6VA 1ELOA 3MJRA 3C41J 2PT5A 4JYBA 5DLQC 1QHNA 3K0EA 4AG5A 2GBLA 4NU0A 1G21E 1SKYB 4F4CA 1NN3A 1R0YA 3CNNA 3MUFA 2GJSA 1PV4A 1ZM9A 3EXAA 1GILA 2GJ9A 1U0JA 3ETLA 3SQXA 4D4LA 3BK7A 2JLVA 1FMJA 1SHZA 5CM8B 1KAOA 1RVDA 4A15A 2KSQA 1XNJA 3C8UA 4QJ5A 5FBQB 1VTKA 3CH5A 4X8LA 2QSYA 5FPYA 1QG4A 4WXRA 1SULA 4POAA 2ZITA 1CJUC 4PAOA 4MDFA 3U3KA 2XSZD 2QBYB 2PBRA 1ZUIA 2JLZA 3RLFA 1FUKA 2ZRDA 1Z08A 1H8ED 2J45A 4FWTA 2AXPA 5JECA 2QL6A 3TKLA 2WSSA 3FHCB 3KTAB 4KBFA 1M7BA 2W58A 2RGDA 2CLCX 3EA0A 2C9YA 2EQBA 3QNUA 4OK6A 1B0UA 3THWA 5IK2D 3QKRB 4Z8XA 5DI3A 1NP6A 2A5JA 1E9FA 2YINC 4EJSC 1R8QA 2O8BA 3B1WA 3LRPA 2EYUA 4Z1MD 2B8WA 1COWD 3SN6A 1U0HC 1YZTA 4F7WA 4ZDKA 1OV4A 1ZCAA 2VSOA 5FH9A 3RS7A 3ADBA 3T35A 3BORA 3LY5A 4FMCF 4JLOA 1KSHA 4MUBA 3AUXA 4RD2A 4QXAA 4BLRA 2FU5C 1XBTA 3KJGA 4JSYA 2ZI7A 5IT5A 1ZINA 4KO8A 3A1WA 1AA9A 1DTSA 1YZLA 2OCAA 3KJEA 5IF9A 2OZEA 2PEYA 4DCSA 5E7IA 4C7OA 4NTZA 1IAQA 3GJ7A 2R44A 1Z5ZA 3DM5A 1KK2A 2QG6A 4EKDA 1G3MA 4NL4H 1XFAA 4Q1BA 5JEDA 1F2TB 2Q0HA 1YU9A 1RC8A 3F8TA 3TMKA 3TSOA 4HB0A 5E4FA 4P32A 4LYFA 2QUZA 3RYTC 1E2DA 5JEEA 1RFLA 3L0PA 4B74A 1CS4C 2AKYA 5EP3A 1KAGA 3ZD7A 5FTMA 5B30A 1CR4A 1BO6A 1P9RA 3ZVMA 3ADCA 1T8TA 3BB3A 3MLEA 5DHFA 2WSMA 4ZI2A 4HB2A 3TW4A 5CB8A 1SXJB 3A1UA 1Q1EA 3TQCA 3KKPA 2ZRKA 2X19A 1XP8A 4JL8A 1OSNA 1X8LA 1MV5A 2J0QA 4X8MA 2ZAOA 2JLXA 3AVXA 5J47A 1GIAA 1ZNYA 2CXXA 4KFRA 4NBSA 4DLTA 4NPHA 3LQRA 4EPYA 2V1UA 2W2TA 3TAHA 1JQJC 3RVBA 2ZI3A 1N0VC 2BJVA 3NVAA 5DHAA 3LO5A 2PMKA 2IS4A 2R9VA 1ZVQA 1EXMA 2DYKA 3GLIE 4QHYA 1BYUA 2BEKA 2ZVQX 3U2QA 4Q18A 1YRBA 1DO2A 4LOAA 1W36C 1JPJA 1XD9A 2JAQA 5GJBA 2P5TB 1GNPA 2WAXA 4CZ2A 4C0QC 1OYYA 5HKKD 4KU4A 3D6TB 1R5NA 4NCIA 3FDIA 1NKTA 3HJNA 4B71A 1ZCBA 3OAAA 4HEJA 1J8YF 3NDPA 3LA6A 4LDJA 3FFAA 2C9CA 1W4BA 2BV3A 1MO4A 4B76A 1KO5A 2FX3A 2WKQA 2ZSEA 2DB3A 1KI6B 1OHHA 3AP3A 2WKRA 4L9SA 3CKLA 2WWWA 4NMMA 4ZCMA 4D4MA 1II0A 2W0MA 2JDID 1VCNA 3H84A 2PCLA 3LH5A 4QC2A 5CDFA 2PH1A 2IA5A 1K8RA 2QTVB 5EE5B 1T5IA 1ZNWA 4M53A 1G16A 4CT5A 5DNYB 1W7AA 3D3QA 4FI3C 2WIBA 2F1RA 4BFUA 1L2TA 5F98A 1MKYA 4PZYA 4DSTA 2OSBA 4IXMA 4A8JB 3B6EA 4KYUA 1CF4A 1VHTA 3U4QB 3L0IB 5BYKA 2FG5A 2OLJA 4DT1A 4DDWA 3SQWA 1VYUA 2ZU0C 2Z4SA 2GF0A 1OIWA 1E2KA 1QVAA 2AWNA 2G3YA 2V7QA 2WAYA 4NZYA 2G9NA 4ABYA 3ZIAA 3AM1A 3W3AA 1CU1A 2O8FB 5KSYA 1SVOA 2P2LA 2VQSA 1VCMA 3FVQA 4TYQA 4IDNA 3WMGA 3P27A 2IXEA 5L3QB 3AVUA 5CIWA 4B3XA 2CCGA 2IYSA 2Q9BA 1T4GA 2JIZA 2ZUBA 1KMHA 2CE2X 4Q4JA 5K8UA 4B34A 1TUEA 4YDSA 2PX0A 2GK7A 4FMBB 5E95A 1H8EA 1KO8A 1XZPA 2CHQA 3KQLA 1GVNB 3CX8A 4MYTA 3QKTA 2WV9A 4TMZA 1ANKA 3B1YA 2J1LA 4HLCA 4DJTA 2ZJAA 1GL9B 5CYOA 1E1RD 1XD2B 2IWRA 2A5YB 2VSXA 1OXSC 2RGEA 2ERYA 5IK2A 3TIFA 2IYYA 1OXTA 4KFTA 3VR6A 2EFDB 4DSOA 1TF2A 2ZJZA 3LBHA 2XTZA 4HDOB 4V0ME 4HAUA 3CPJB 3WBKA 1QHSA 5A5GA 3I61A 4A0FA 2OAP1 5JSZA 2IUSA 3FKSD 1QF9A 1WCV1 3ZQ6A 4BGDA 3QBTA 2FZ4A 4IDHA 1Q3TA 4OHVA 1L4UA 1EFRD
chains in the Genus database with same CATH superfamily
4PTLA 5DK6A 5LXTB 1R0LA 3AM3A 4RFSB 3HUEA 3P5BA 2IOFA 4Y1FA 4R54A 3V34A 1RC1A 3LL7A 1YZNA 3WK8A 5TB5A 5KB3A 1NVGA 3A6LA 5DHSA 4IG9A 1TZJA 5K0SA 4DEXA 1XPJA 4TQAA 5I7SA 3V48A 3L5KA 3S5JA 4MHSA 4U1RA 1FUIA 2A33A 2EJWA 2PKQP 4KX3A 1DAGA 2F1JA 5FNVF 4FYYA 8ADHA 5F9MA 5ES4B 5L3RA 4Z9AA 3P9QA 3AHJA 2GHTA 4BPBA 1OIVA 4H7DA 3RM3A 5DVZA 2IYZA 4AUMA 4MUYA 1XAHA 3QKUA 2IYVA 3O3NB 4GXNA 3ZWVA 1FLDA 1VJ5A 2ZS7A 1L7AA 1QV6A 2XNDA 3FNQA 5MGBA 5DI3B 1SQ6A 2VJNA 1USKA 3MBOA 4INOA 3H1FA 1GKLA 4KR2A 1PCXA 1JB9A 1UPAA 4ZJYA 4UAGA 1W49A 2FUKA 3R2JA 4NJOA 2HPAA 4WMLA 2V0GA 3KFVA 1GGMA 4LG1A 3KP1A 2FEXA 2CV1A 1M0TA 1AHNA 4I4TB 1W47A 1I7PA 4MSUA 4C4XA 4EZIA 3H3FA 3GLFA 1KDYA 3C3YA 1N9GB 3S7ZA 2PZFA 3DDWA 3WDLA 1AV7A 2WB2A 1SVMA 1P45A 3M49A 3LBNA 1D4ZA 1J99A 4KNWA 3GMDA 1YAHA 2BMFA 2K87A 4O8CA 4QXRA 4C4SA 2WVAA 3ZI7A 3UM9A 4DRXA 4DFDA 3VOAA 3Q8WA 2LW7A 2X5XA 5KSWB 1ZNQO 4YRNA 4C7OB 3SS9X 1L1QA 2PR2A 3IXLA 4XGQA 1LC0A 3K32A 5IKMA 1J2YA 1SBIA 5DBOA 2X40A 3SOPA 2BOVA 4LV5B 5CDGA 1JSCA 3E23A 2H16A 4AYTA 5IKXA 2AG5A 2CHGA 5FOQA 3MJTA 4RYLA 1R5OA 1WUIS 1XMPA 2ERXA 3LF2A 1XA4A 4UAVA 1T5DX 1W35A 3N9IA 1RKVA 2ADMA 2P8JA 4R16A 1NJ1A 5ALJA 1XTBA 2HA2A 1ST3A 2DSNA 3M6IA 3O3OB 3PE6A 4L50A 4RY8A 4Y18A 3FMVA 2IZOA 1TYEB 2JH9A 3K30A 3PGJA 3F78A 3FAZA 3U7QB 3ZLVA 1J2UA 1EJ0A 4BN0A 3IESA 3OEED 4DUPA 5JQGF 3VYSB 2A7QA 1RADA 3EA5A 4LZPA 3FKQA 3GEMA 4UM9B 1QS0B 1QFSA 4LMRA 3IIKA 1PZNA 4HGYA 4LJ5A 4IAOA 4TVKA 4TS4A 3UA4A 3BMQB 2Z0MA 4WGGA 4JUDX 2CVOA 1X80A 2JDIA 4PCAA 2ZI9A 2IX9A 4ASUD 4D0NA 4D9JA 3EC1A 1JEQA 3OZAA 4DR3B 2AZMA 2NTJA 3IT1A 3Q40A 1AE1A 4TN5A 5FA5A 3QEAZ 4UU7A 1OR8A 5CCBA 3WL3A 3AR4A 1XR3A 1C3OB 2OHIA 3QA3E 4FZVA 1BE1A 2ETXA 1YDWA 4E12A 3D2BA 3EDCA 3SZLA 3DOEA 5CITA 5BMVB 2ZEJA 1U7ZA 5JU6A 1NRWA 2WJVA 5H80A 4D0GA 2LPMA 4IF4A 1P4GA 3IUJA 2HSWA 2NV0A 2Z2IA 5T3UA 2PMBA 4FYIA 5DM2A 3PGMA 1GZSA 1POXA 3O26A 3HLKA 4FFNA 3SHTA 3F46A 2HQRA 2Q5HA 4HUQA 5K0TA 3L84A 1U3CA 5EKUA 2HC9A 2PV7A 4M1TA 1QTIA 3QLUC 4MEJA 4JXZA 2QW0X 4LQDA 1PJTA 1USWA 3HXOA 4HXFB 4TUYB 1GPMA 1U7HA 1BE6A 3DJFA 2JI7A 5FUBA 4B2PA 1DJNA 4LQ4A 1RBQA 3G02A 1T29A 4BP1A 2REBA 1FIUA 2EWVA 5GONA 4WAUA 3JAWB 3RF7A 3C1TA 4DCGA 1LLDA 1NVWQ 1WCWA 2AN1A 3NDJA 4GE3A 4RPIA 5FWXB 3K70D 3ODGA 4RF5A 2WU8A 2PD3A 2C4VA 1KDTA 5BNWA 3P45A 5ED0A 2C92A 2VUSA 1SU7A 3HJAA 2FDCA 4FINA 3ZR4B 2P90A 4BBAA 1O89A 1FXWF 3JARB 3THXB 1IL0A 2VH2A 1Y98A 3GVCA 1CE8B 4S3MA 4BGIA 2CBZA 3OZFA 2ENUA 2I76A 3H1PA 1LV8A 3R4CA 3O4GA 3SF8B 3DBVO 3L92A 4BQRA 4I4LA 3Q0EA 3U56A 3DDHA 1VL0A 4KXFB 1CR2A 5LP6C 5K45A 1I5EA 2D0IA 1C9JA 4O0MA 1IRXA 1GFSA 2WJZB 2GPBA 1O5OA 1YZVA 3GF4A 1OD6A 1JR3E 1ARZA 1T0PA 4L9RA 4RKQA 4R2JA 5FBHA 4BO8A 5J4LA 4NCNA 1G6Q1 1BHJA 3KUUA 2RGGA 4R05A 4KIWA 4R0NA 4UNPA 1CR6A 1E1CA 2AX3A 2D1FA 2GEUA 3O2JA 1W30A 4M9RA 2F1KA 4NY1A 3COVA 2RGNA 2NZWA 4QUGA 3INYA 4IZ6A 3LA8A 5A6SB 5SY6A 2FWBA 2QQ0A 4WNYA 4MPRA 2FLKA 1XA3A 2JLCA 3DZIA 1IB0A 3L8CA 5M2QA 1GQSA 2IT1A 1QKKA 2YRFA 4E6PA 5JAPA 5DBEX 3DP9A 1N75A 1BRMA 3C6QA 4L2IB 4HD8A 1OX4B 4XCVA 1XU7A 1MB0A 3NEAA 5C80A 2ZTMA 3LLSA 1P4SA 1KL7A 2J46A 4YJ2A 1XEAA 3KZOA 3TD6A 2DCUA 1E4EB 3GT3A 2O2JA 3K16A 3QH4A 4LYDA 1P0QA 2PN1A 5CM2Z 2OILA 4TYYA 1N6HA 5D7BA 3LCRA 4MA0A 3CEJA 1ZRSA 1E3QA 1R0WA 3T1OA 4CPDA 5L53A 2A3RA 5CDHA 4B79A 2A30A 1HKHA 2J0EA 1AY0A 2OKGA 3MERA 5IUJC 2DF8A 4GF5A 4YO8A 1RXVA 1XP5A 1PJQA 2OMEA 2NQ2C 2QRVA 1O8BA 5IJZA 4W1SA 2G36A 1U5AA 2KW5A 3B51X 4H3HB 4BYMA 2SKEA 4RZXA 2LNDA 4TL7A 1ECFA 3NFRA 1C0IA 4MVJH 5L7WA 3WLKX 2HTEA 3Q9LA 1EGHA 3GJTA 2VCHA 2ODWA 1HT1E 2JGEA 3QHAA 3U7EB 5EXTA 3Q85A 2ECKA 2JGDA 4QGBA 4ZEWA 2DPXA 2H2GA 3PQ5A 5HKOA 2XUZA 4U7HA 1H8HA 4X3CA 3JRXA 2O6LA 3OQVA 1J33A 3UMSA 5LLDA 5ED4A 4P83A 1HH4A 2WE7A 4LYEA 4MUXA 4PE5B 3O3CA 1A5ZA 2R5WA 1B23P 1T26A 1CFJA 3B85A 3CLSD 4GOLD 3F3YA 3K53A 4RKWA 4RETA 4XPIA 4CM7A 5AW6A 3NDBB 1EZ4A 1NW5A 2IXFA 3OEYA 1SBNE 4XUEA 1GYRA 1P75A 3CUWA 4PG5A 1EQUA 3B7PA 4XVHA 4DQDA 2OOKA 1I7DA 1RHUA 2YJ3A 5LD2C 3IVGA 1L8LA 4Q4AB 1V8PA 5EIXA 3OLQA 2K5UA 4U2DA 3TZQA 3IEKA 4D9CA 1FUEA 4RQAA 1KEKA 4KWHA 2H48A 5EKTA 3WGZA 4WBNB 1B8PA 3C3KA 4BGEA 4DIFA 4JY7A 5TSDA 5JVDF 3F97A 4YCBA 2XUHA 1Z0KA 5AVJA 3FOFC 5LM3A 3CKKA 1JL3A 2BFWA 4KIUA 2IYLD 3IHWA 4MW1A 5FWDA 4CKCA 3HJUA 4I9GA 5DN6A 1HQYE 3TLYA 3A36A 4L5BA 2DE0X 4PTYA 3MWEB 2BUBA 1GNVA 5G40A 4K6GA 4PSDA 2OO5A 2QOEA 4Z0HO 3O75A 5JR3A 3G23A 3TE6A 3PUHA 4H7HA 2A1IA 1QHFA 4X3OA 4BVKA 5JUWA 4CEIA 1RIFA 1XDBA 4K0KB 2WWTA 1Z28A 2B99A 1JIIA 5GOZA 1QG0A 1SPXA 3QW4B 3UIEA 4AJNA 1GZVA 3FR8A 3ZYZA 4DAOA 3IMEA 2GEKA 1X9GA 3GH1A 2P8SA 5CJPA 4M83A 4AKTA 4K9SA 1IC6A 5JZVA 1SR8A 2G0TA 5EZYB 2BVNA 3CPHA 4V1CB 5C35A 2G5PA 3CLRC 4WLNA 2QUKA 1YL5A 1XZJA 2FW7A 2FWJA 4QUAA 5J58A 1DARA 1W5SA 3KUXA 3OD1A 3HDQA 1T2DA 2I2XB 4CCAA 2I1WA 1BWPA 4REOA 3T3MB 4W5NA 4DB4A 3N28A 2ZR9A 1MNAA 2C78A 2CT8A 1OROA 5REQB 4GLBA 3EPHA 3OSZA 4FHZA 4FHCA 3I6QA 4KDRA 4CKWA 2E89A 3U19A 4K6OA 4LRSB 3B2EA 5A05A 2V65A 3HU3A 1EDBA 3Q12A 2CJWB 4LHXA 2QTMA 3HWRA 3V4ZA 1D1TA 3IOCA 4TQGA 2HADA 1AKMA 1ZQ9A 1ZZGA 2AE1A 2IHBA 3T5TA 1JTEA 3RS3A 4MUEA 5K05A 1Q0TA 4LXIA 3THOA 3A6HA 3O4VA 3M3PA 2I2WA 3WV5A 4FC7A 3D0QA 4CL0A 1JQAA 2WF7A 4DANA 1W29A 3QKWA 1OQAA 2GF2A 4XJTA 3W2EA 3N05A 5LOVB 1UIMA 1IN1A 1UXKA 4OAOA 4YP9A 1IDN1 3DDZX 4ZI7A 1C1DB 2GH1A 3DXYA 3I73A 4A8JC 4A2WA 5LQKA 1XMIA 1OE0A 1XZ8A 4WK2B 3EJWA 2J9FB 5G0VA 3IL2A 1EJ2A 4RMGA 2HCJB 1OHHD 4N3BA 3JVUA 5DIFA 3A4MA 4PONA 2DR0A 4OYYA 5EHXA 1YNOA 1VRVA 2VPXA 3QV1A 2R87A 5JFTA 4LK2A 4CKXA 1IHOA 4ZWNA 1F2VA 4G0WA 4ZPJA 2V59A 4A2CA 5LYJA 1QV9A 1XKTA 2V7WA 4OQPA 4ECEA 2QX7A 1Y7PA 4UATA 1Q7BA 4FYWA 1RMQA 1IJFA 1CQXA 4OP3A 3NX4A 1UR5A 1YJ8A 3GDHA 1Y42X 1S01A 4N9WA 5DE3A 2E4VA 3ZKWB 4B35A 5LL6P 4ARIA 1S3SA 2GDJA 5AW2A 5JAOA 3P2MA 1U7PA 4G25A 4JLJA 4OFWA 2N46A 1R10A 3U48A 1QVWA 4LY3A 3R5JA 3AR8A 4JU8A 1NNLA 2YY7A 1AF4A 3EC7A 4KV9A 3ZHSA 3JR3A 4Y2QA 1RPZA 3D8NA 2NU7A 3ZCUA 1JA0A 4PEVA 4V38A 1QZZA 3BBLA 1XRQA 2VNIA 5ALWA 3ZIAD 5HS4A 1NPYA 2PGJA 4AN0A 2FN7A 1XA0A 2DH5A 4BB9A 2YZNA 5DHTA 3JQ7A 1D0SA 2VDWA 2GBLC 1ZD8A 2OHVA 3K9BA 3RE1A 3AHCA 1PQWA 3TAUA 4BU0A 5BYAA 3U6KA 2JIZD 1BDHA 1PK9A 3KKNA 4FZ5A 2BFOA 5KEIA 4DC1A 3BE8A 3ETJA 3IQGX 3K0BA 5HSGA 4ZV4A 1J0AA 2ZQZA 4RLFA 4HVLA 1TFUA 4KO3S 2QPTA 2MDTA 5I7WA 3COYA 1QP7A 2Z8YA 1GLVA 1L8QA 3PFIA 3ZHUA 3G2MA 3K0FA 4DV2B 1KFKB 2OHXA 3BMOB 4RDCA 5J2UA 4I7EA 5FF9A 3MT7A 4LHWA 5IJ9A 1MC4A 1QG6A 3UJDA 4Y6RA 5JSHA 2QTWB 3DLCA 2I29A 1PS8A 1US8B 4D56A 5JNTA 1NXSA 1V3VA 4S04A 1XCPA 1LPSA 2VK2A 2DCMA 3EDYA 1PEDA 4NCJA 4PXAA 4DGSA 1OI4A 2NQTA 1ESCA 4GPTA 1L9KA 4IZIA 5BNZA 1OFTA 1HLFA 1J0DA 1KMMA 1EDOA 1G2QA 1R0KA 1HMPA 1SIWA 2C9DA 1F8XA 1FDSA 1FL9A 2GZRA 3PSAA 3PVCA 4KEAA 4U7GA 2YWRA 4XR4A 5EJFA 1Q1QA 3UH0A 4EW2A 2W6OA 3GPBA 1UK6A 5ITZB 4BLWA 4C0KA 1X2EA 1W76A 2GNAA 2X7XA 3LSYA 4O6VA 4D4KA 4R68A 2CXSA 1FSPA 1KY4A 2HB6A 3VTAA 3H5RA 4XJXA 3VDXA 4ZO4A 3DSRA 1FTGA 2WMOB 2H1HA 3H9BA 3QVJA 5FI3A 3OFND 3UBTA 4C7KA 3MJCA 1FW6A 4UZFA 1R4AA 3IO5A 1EESA 3AVTA 4DV3B 5JTUA 4KACA 2PUGA 2CBXA 3CLKA 4YBRA 3S5UA 3BJIC 2YHSA 2W2VA 1MH9A 3PKJA 1IM2A 5H1YA 3HVKA 1ZD9A 2DQSA 2QRZA 3DBRA 4L16A 4DJFC 2HF7A 4E5KA 3ADOA 3JZFA 1EIWA 4RSHA 3KQPA 5AJWA 4ZO6A 2H5EA 4LX8A 3F4BA 1O8CA 1VLVA 1LB1B 2LV8A 1JF8A 2P65A 2PRIA 3CZ4A 3SEAA 4DJDC 1CYEA 2P4EA 2BHRA 3MJFA 2ZJ8A 3R7DA 1LF5A 4MB2A 2Q8QA 4QGFA 5ALOA 4B6GA 1F3LA 2QN9A 3FVRA 3G6KA 1G17A 3A3PA 5ICMA 3CLUD 4AYWA 2X3FA 4FE3A 3JCZA 5BN4B 1YS9A 3Q8KA 3P0JA 3RSSA 1ODFA 2E0IA 2PX3A 2Q1TA 2O3RA 3AB3A 5EJ2A 2ZSIA 4I3GA 3IAFA 5BV1A 5AKIA 3R4VA 2FSIA 3F90A 4INAA 5BYBA 2E2WA 1RQ2A 1YAJA 1JQEA 2OM2A 4NXMB 4FCWA 4MZXA 1O0BA 1V5IA 2XUFA 3ZWPA 2HO4A 3FDZB 5LJLA 1DRVA 3SVTA 4AX8A 1VLQA 2PYDA 3S2ZA 3ZGLA 1XYGA 3TQFA 1HE5A 4A4DA 4I2NA 1S2NA 4G5QA 2F59A 5JH7F 3B1ZA 5KTNA 1QAQA 4D0SA 1JI3A 4NV1A 1BHO1 3H13A 2D1YA 2H1IA 2QQFA 2UZAA 3ILHA 3VYRB 1NLFA 5JRZA 3OOHA 3DHWC 5JDCC 2PKQO 1KO1A 2ZUCA 1F6DA 2FPLA 4PO3X 1MBZA 2ZBRA 1W8DA 1ZJZA 1FTSA 3HA5A 3T9CA 1ORDA 2EX1A 3LDUA 4HH3C 1Z6XA 4B8WA 3D54D 2YW2A 1XRSB 5IEJA 4BFSA 1YUMA 2Q2WA 3RJMA 3TKAA 3BIFA 4HDRA 4G6ZA 2XKAA 4YCMA 4I1PA 1XXHB 4NC9A 2AVNA 1RYBA 1J1IA 4DRZA 3GLRA 4ZGBA 1RAAA 1CUWA 1FXUA 2OFPA 2ECPA 3I6YA 1HNZB 4EUNA 3N8NA 5KDOA 4WIAA 4KJZA 2CMKA 2VHWA 2AK3A 4II2A 2NU6A 3OZRA 3Q7EA 4FQ8A 4CG3A 2NVOA 2WWIA 1Z2CA 4LY6A 3FWZA 4XIFA 4IV5A 1LSOA 4RJJA 3H86A 1WUKS 5C52B 1XCMA 3UFXB 3WK7A 3VVLA 1R00A 3YASA 3H42B 3I2IA 4MS3A 1ZU4A 1M0SA 3FTCA 5BNFA 4O4JF 2FJ0A 1WABA 1BXRA 4WWHA 4A23A 4CKYA 1E3WB 5JO0A 1DKUA 5KWSA 3K70B 1Y80A 4QJIA 3ZDQA 4CM9D 5E1BA 1U9IA 3ZD6A 5AVKA 1L4EA 4WZAE 2VHQA 1EFPA 4LWQA 1TCUA 4NENB 1G59A 3TH5A 4AJ4A 1DEXA 2DBVO 2XLCA 3EW9A 3KLBA 4BLPA 2AJTA 4DARA 4HDMA 2V03A 2PWZA 2WYHA 2QTRA 2MR6A 3MB5A 3PF8A 4MR9A 4XQEA 3DDOA 3WG9A 2C4WA 2ZJ3A 3KLNA 4PN3A 2E4UA 5AVWA 3OUUA 4ARBA 4KXMA 1KGDA 1R6VA 3WLNA 5KNDD 2OD9A 1W44A 3CRMA 3DNFA 2NO9A 3JD3A 2XGSA 4M9XA 4YUYA 4PZAA 3TJMA 5HPYB 2W6IA 4CV1A 2WUVA 2ZVDA 4YRRA 2Q4RA 2QUBA 2ID9A 4S2UA 1CC1S 2AHOA 2QN6A 1YHYA 4GMKA 4R5MA 3NTVA 4AWAA 1Q19A 2J0UB 3ND5A 2CV2A 1TOAA 3KPUA 4R1TA 5K7SA 1IQPA 2HKIA 2SCUA 1E5QA 2WY2D 3PZRA 1DRWA 2PU7A 3LZ6A 3PJFA 4HNHA 1AUOA 3KWMA 4HLDA 1FZTA 5CMLA 4QOEA 5EQTA 2PKYX 1RYZA 2ZTLA 3ESRA 2YVLA 1WCIA 2PNFA 3TLMA 3VU8A 1J39A 4RSGA 5LYYA 3ET4A 3NVMB 2XVAA 4XD7A 3A58B 3TVTA 5JD4A 1NMZA 4PQFA 1SCBA 2GCNA 3M1IA 4I08A 3PEEA 3QW2A 4ZU3A 1U8TA 4E4YA 4AXBA 2EFCB 1ESDA 1HT2E 2FE4A 3KSZO 3U26A 2NX2A 1BS9A 4LCBA 2I3ZA 5JSKA 4RF2A 3SSMA 4ERXA 5KQLA 2QEQA 1RWKA 2G71A 2RC6A 1TM5E 1FVFA 1P1RA 5DF1A 5BP7A 3AUFA 4A2PA 4A0RA 2QTLA 3RTGA 1IN7A 1F20A 2V7BA 4C22A 1N0HA 3O74A 4M1OA 3HYRA 4QYTA 1KYTA 4YRZA 4KLRA 3CVVA 3AETB 1D5WA 2C04A 1K2WA 1S8AA 3UUFA 4MS1A 4C21A 2ZW9A 3AUKA 2VSYA 3GRPA 5ERYA 1JLSA 1II9A 1PTJC 1RKUA 5B1YA 1BFKA 1E20A 2HLDA 4YXFA 3RT1A 1CPYA 4QPJC 3TOSA 4WTOA 4ZHQA 4GFDA 1BN6A 3C3MA 4N5DA 3QPAA 2V7GA 2YHIB 1G8GA 3CF2A 2WT4A 1RHKA 3KT6A 3UO8B 3W6ZA 4CJXA 1YSCA 1FF9A 2OCIA 3TDNA 1JLHA 4CM6A 3CNQS 3MW8A 4C0HA 2Y0EA 4R1MA 2VAWA 3SR3A 5DLDA 3MRXA 1RABA 1KQ3A 1ML3A 2RGYA 1Z0JA 3CC8A 4LVNA 4ILEA 4IPTA 3E53A 2P68A 2XODA 2ZB3A 2XB6A 4BGUA 4FWBA 4AAYA 4WECA 4PS0A 2IEBA 3N8KA 1TJNA 1WV0A 3G0CA 1KYXA 3KJQA 4F2WA 3EWAA 1D4OA 1TQDA 1CFZA 2IK8A 3M5WA 2ZYTX 3DLTA 4DCNA 3WMFA 4N1AA 4E33A 4EMTA 2ZROA 4V1CI 1ZITA 3H4MA 3EEIA 1L7EA 4I9NA 2Q29A 1KFEB 1E92A 1RJWA 4KFSA 5FWNA 2JFGA 3VR1A 1P33A 1ISPA 3FYTA 1MF7A 4GBGA 4R6XA 5DXFA 3K92A 5SYNA 2VLBA 3I2KA 4FMPA 2G07A 4B5LA 4PYJA 5KTRA 3ICCA 4JI2B 3LPNA 4J6EA 3QE0A 4G41A 4LJLA 3UK1A 2XWBF 5JJ5A 3QOFA 4DIDA 1DC8A 2XRFA 3K73O 3PDHA 4LECA 3NHBA 1SA0B 2G76A 4QU9A 4BLSA 3HU1A 4FT2A 2PJUA 4IJUA 5KSPA 1XHEA 3HEBA 4ER3A 4UXIA 1KORA 2NVWA 1Y1LA 1OXVA 3RBZA 3DMNA 3JD2A 3L7LA 4IIYA 1XPUA 1C1XB 3UG6A 1CJMA 3WGTA 3DKRA 1XU9A 2OZLB 2PJRA 3AERA 4O2AB 3TLCA 1GCGA 4D8XA 3OZVA 1NWHA 4O4LB 5AK4A 1T2NA 1B43A 5DRTA 2PYIA 3E48A 3I1FA 3R44A 4R41A 2OCDA 1A9PA 4IVNA 4XKJA 4DHWA 4LF6B 2AI3A 3ZE9A 2HEIA 4WXEA 3BXOA 4LI0A 1CJSA 2XD9A 5AI0A 4HQFA 3QEOA 5KC9A 4Q4DA 2AN3A 3UT5B 3EYAA 1SK8A 3DCNA 5T64A 3K0AA 4DQVA 5J1SB 2C0PA 3IQIX 4L57A 1IQRA 3LWDA 2BCJQ 2G06A 1WXGA 1GM5A 2RKWA 2R1TA 2B9VA 3LBYA 4RJKA 2X0FA 4X8HA 1C0KA 1OVMA 3TW8A 1KQNA 4EVSA 4JQYA 7ABPA 4N47A 3GBPA 1V1RA 3EFOA 1VHDA 3PEFA 2DBZA 1XZQA 2PFGA 1E63A 5DYYA 4F2GA 1OLUB 1C1YA 2GZAA 3T9EA 2OGUA 2P4QA 3GRUA 5H16A 4LC1A 1V9SA 2VPYA 2V5AA 3PHHA 4FEEA 3PDIB 4KVFA 3A3NA 3JYHA 3Q8XB 4XUCA 4OQQA 3RYFB 2XTMA 3KWFA 2VO1A 3TMAA 2OORC 4KQXA 3QE3A 4RWZA 3N2ZB 3FCCA 5HJ7A 2C83A 1YF3A 1Z4QA 2XRMA 1NR5A 4LMBA 2XOKD 4EG6A 1SU4A 2ZVPX 3PXEA 3QFCA 4EO7A 4IHJF 4JP5A 4ESOA 2XUPA 3OCYA 4N0MA 3V4LA 3MSCA 4B73A 4Z49A 2XUIA 2IW3A 2C03A 5EUCA 2XDQA 4YJHB 4EW6A 1YZQA 4UAUA 2PUWA 4PQEA 4V0QA 3H5AA 2VH1A 5BN5A 2XYVA 3MCZA 3OZUA 2QROA 2F8SA 2C4NA 2UYQA 3V7FA 2ZBEA 1NQUA 1E64A 1L4FA 2GNOA 4NJMB 5HIJA 2NU8A 4ETMA 1QIMA 3O3MB 1Q83A 5JZBA 5HQ3B 2HCBA 1OI3A 4ANFA 4F4UA 4UOEA 4AL4A 2ZI6A 3HP1A 1XLVA 2A9KA 4NCXA 4OQZA 3LY9A 1MB2A 4RHUA 5KYWA 4JXXA 2F48A 2FPOA 3TLAA 5DYWA 4BAGA 4C5BA 4D9GA 1X14A 3TRHA 1BG6A 4CQMD 1KFBB 1VBMA 1K3TA 2XKBA 3AFNA 3JQRA 3VH1A 1LQ2A 1SXPA 2QMUA 1FQJA 3P2JA 3C6XA 5F5NA 5L3SB 4BTLA 1Q0QA 3FM9A 1OBVA 2AUTA 3HP4A 4RKRA 2FQWA 5IULC 3LQ2A 2PZAA 1PHRA 5CVCA 1T5LA 5EJ4A 1ZXLA 4IKOA 4IO1A 1UBSB 1QQTA 2RK6A 3INNA 4L74A 1RQXA 1M33A 2G4VA 3F49S 4D92A 4EHBA 5LIPA 1YULA 3LRTA 1M10A 2O5CA 5TS3A 1W4RA 3MCUA 1TXGA 1SVLA 5COBA 3NOQA 5FTKA 4BP9A 3STHA 4A6EA 4J6FA 1SUCA 2DLNA 3W8FA 4GG1A 1LPPA 3FBTA 2OV1A 1REQA 3K1ZA 3CPEA 3OIYA 1OLSA 3X43A 4N65A 1GFZA 3AINA 3B20A 1XO1A 3LDHA 4U0JA 3WJAA 1K06A 1CJBA 3WYFA 5JADA 1TQHA 3I05A 1G5IA 3KKOA 1KRXA 3DYBA 3FPKA 4JR1A 4XEUA 5CUQA 2K7FA 1N7IA 2DUUA 3LCJA 1E7RA 3SMQA 3EAFA 3EG9A 3HJRA 3RS9A 2VRBA 4G5YA 4Q4JB 1NN0A 4HS4A 4DCPA 3J80A 1B8UA 3HXLA 2I66A 3JALA 4EOGA 2GARA 1EQAA 3DUWA 3RCBA 3VR4D 4C2TA 1ODIA 3QG5A 3H8VA 4MVJG 4CXMA 3CQ9A 3I01M 2ZB4A 3PWSA 2MINB 1R9GA 4DCUA 1XF9A 1V6AA 2OBXA 2B7LA 3G3EA 5EWJB 5LQJA 3ELWA 5IBQA 3IIIA 5AHRA 1GXSA 2V6IA 2C9ZA 2HSEA 3MGAA 3BFVA 1PDVA 3N2NA 4EPXA 5CFZA 4GH5A 2BDUA 2G1AA 3FOWA 3EHEA 2DWQA 3NGLA 5K3CA 3V1KA 2X4GA 4WCFB 4ZICA 3B9QA 3AIIA 4HZIA 4X64B 2I6QA 4O29A 1W4ZA 4G23A 4YMLA 2RHCA 3DCJA 4GSYA 1Q7EA 3M2TA 4BO3A 4GM0A 3HXKA 4ZDJA 4GSLA 3B12A 4KHZA 1M7HA 4M55A 4TKMA 1ZD3A 3PG5A 4GOOD 4DLVA 4FN4A 1RC0A 2QTTA 3F0TA 2IP2A 4TTRA 3UAXA 1LVGA 4P4UA 4ALJA 1Q0PA 4DG8A 2UVPA 2XE7A 4PHFA 3QJYA 1PR0A 3T38A 5TDHA 4TSRA 4E11A 2ZJ5A 2NXNA 1D8AA 4PBSA 1CULC 4BQQA 4JLVA 4C7XA 4PCUA 4JC5A 2VJBA 4WCVA 3OHPA 2NO7A 3FNEA 5J2TA 3KBBA 1Z26A 3SE0A 2QP4A 3CMCO 4M9UA 5DTMA 5TLSA 1PL0A 3IP3A 3EUEA 4GIBA 4MMZB 4RADA 3CPSA 3HSKA 4CF7A 5M7EA 2LVBA 1WPGA 1UMBA 3I76A 4REMA 3IKMB 4AO6A 3DJYA 3BZWA 2B94A 3ORYA 1MUUA 3ACCA 3E9QA 5LFAA 1Y1QA 1DPFA 4YPOA 2F8TA 1GCUA 5FTLA 4Y9SA 3KELA 4IJMA 5EWLA 1ZUNB 3B8EA 2NT3A 3DTVD 4A36A 2GD2A 3ASYA 1XQYA 2Q4EA 4LDQA 1CUHA 3TRDA 3VZPA 4ESEA 1T3HA 2I6UA 5BUSA 1N5MA 3LV8A 1JYEA 4XQ9A 3TIGA 2P41A 3GBVA 4B9AA 1NVAA 2AZXA 1CUZA 2X23A 2J9GA 4EF6A 4CF4A 1G19A 1YK0A 4QXOA 1FJHA 2QT9A 1E3TA 5JXHA 1VYVA 2VYND 3MD0A 4A92A 4HH0A 4TLAA 4BVFA 5KPDA 3RYCB 2AZDA 2Z6AA 2XHZA 5T8KA 4CV3A 3L82B 4YT5A 5HVNA 1MA0A 1FP2A 4NLLA 1FZQA 1GQRA 1P2VA 5C81A 1Z3CA 3MC1A 3HABA 3CG0A 2EQAA 3P97A 4JZYA 1GTMA 1XJQA 4RJIA 4QSHA 3KR1A 3EZLA 3R76A 5EVJA 5I4IA 3RC9A 1BDBA 1KVUA 1OAAA 3GUUA 3D2CA 2GN4A 3D0KA 3PQEA 4HRAA 5FNVA 3LFUA 1CZNA 4OFBA 3CVUA 3NAZA 3ZY4A 1RYDA 5JZOA 1KAMA 5AW9A 4EG3A 4R2LA 3L7CA 1JUDA 5BSEA 3WGMA 1KI4A 3TO5A 1NHWA 2O57A 2B4YA 3TVYA 1P0PA 2A78A 2RGRA 4NBVA 3LFHA 1UXHA 3BA1A 3BGOS 3FWYA 4PLZA 3W5SA 3OZSA 4MWCA 5L40A 2QL5A 2P3OA 1KJIA 3FWNA 1KI6A 4KO1S 2QM0A 5FBZA 5IXJA 1V6SA 4ZZ3A 5AW8A 4YMIA 1JN0A 3D4PA 2JL1A 2X14A 5I8PA 2WSLA 3EXEB 4EPWA 1RAEA 1Q57A 1ZEJA 4HNAA 4UKDA 5TT1A 4G37A 4JK3A 4YMVA 5KKNB 1T9GS 1GR0A 1Y8QA 1QH1A 1U9JA 4B2LA 4AW9A 2C97A 3HZOA 1EWVA 4PANA 4BX2A 3KSAC 3QM1A 2ZIGA 4ZVPA 2QPLA 1X1SA 5FT9A 2ILTA 4OB7A 3O91A 1Y8ZA 4Y2VA 1NYQA 1SD1A 1ZNXA 2ARKA 3BIXA 4QGAA 4PXSA 4PPFA 3REOA 2FFHA 3ZD8A 2FQYA 4TQ9A 4BZQA 1TAUA 2BP7B 2TYSB 3HRHA 3HU5A 1YD7A 4QLBA 3BJZA 1PDOA 4NBUA 1IEVA 1P7CA 3LDFA 1NDQA 4BNLA 4F4DA 3P9KA 2VT7A 2CWDA 4LTDA 1JDBC 1AZWA 3D2AA 2QPAA 1R0ZA 4LXQA 3K31A 4GPBA 4ZT2A 4MPJA 5BSGA 3RYIB 1TQ6A 1MOPA 2C31A 2IHUA 2L42A 2QRGA 2Y6VA 5EJMA 4YCNA 4QOGA 3KHKA 1N6PA 2X58A 4Q37A 3IR5A 2VF2A 3Q1LA 4DR7B 5L4NA 3ZXUB 2Z1MA 3OKAA 4GOJA 1FBNA 4PPYA 2J5BA 1QANA 2ZCVA 3Q11A 4UUOA 2BEWB 2FK7A 5TARA 2LCQA 4BO2A 4MDHA 5ILQA 2W2NA 1JRLA 1MAUA 5LBUA 8LDHA 2XUQA 3LGXA 3UF0A 3EDMA 3WJ7A 4F45A 1EK2A 3CO0S 2GSDA 4UE2A 2GVNA 1JDTA 1EUDB 1AJEA 3NV9A 3UXHA 4RSRA 1NBWB 5LA6F 4U3JA 3B52X 1CS0A 2VYFA 5HDBB 2H1FA 3LP8A 4PGAA 5BW5A 1E8NA 1PQ4A 1RXCA 2FOLA 2NNWB 5BOSA 1IZ9A 2JJQA 2V7EA 5BVHA 1X8KA 3P9PA 5DRYA 3TBKA 4Z2AA 1NZFA 2FMHA 1QCDA 1JXMA 3LUPA 5CH8A 1BW9B 3K2EA 3HRKA 3EASA 4NYMQ 3JPYA 3VDQA 1QU2A 4TLLB 2CXRA 3TLGA 3PUKA 3W2TA 4C43A 3FTFA 2XNKA 4D1YA 3WQBA 2VDNB 1HDGO 2FPIB 3VNVA 3CCCA 4YLYA 4PSVA 3GK3A 1AH2A 4Y0NA 4MOWA 4Z4GA 2HFKA 1N8SA 3DKVA 3HL0A 1E58A 4P7FA 4YRQA 1PYDA 3P8ZA 1L5HA 2NZVG 2V6FA 4TTTS 1YZHA 3CXUA 2X0RA 3MRVA 1R27A 4BNJA 2J9RA 4AQ7A 3GI1A 1KEZA 2I78A 2QNBA 4DXAA 4P2GA 3WHLA 2MYPA 2GYYA 2WFZA 1LH0A 1N5KA 1TJPB 4IDDA 1M6VA 4RFSA 1WUHS 4YRGA 4URXR 5HQTA 3KZKA 3M9LA 4NARA 5T4EA 1CG6A 3SEQA 1Y89A 4BNUA 2I33A 3F7TA 4KAXA 3LD9A 1AK9A 1Z8HA 4BJ5A 4RTPA 1QPZA 3GA7A 4LY0A 4RZ2A 3RU3A 3WSTA 3LPDA 2DWPA 1DIRA 3MUEA 2EHDA 4L15A 1V4NA 4GI3A 1NHGA 3RPEA 3UMCA 3USES 3ZBTA 5ICEA 2Z83A 3R6TA 1JFFA 1NATA 1TLTA 2PIDA 3GGJA 3OJCA 2YWCA 4PG6A 2R65A 2Q2VA 3EA4A 2GBIA 2QAGB 1FXWA 1L5RA 1Q2UA 3BL8A 4M38A 1ECCA 4GP7A 4U2GA 1TYDE 4K9QA 2I5PO 1IHUA 1V16A 2H2DA 3JD4A 5AHWA 2VDPB 3IQWA 3USCS 1YRAA 3ROZA 2C0CA 2W5UA 3K9FC 4KBGA 1YI0A 2KWIA 3LQ4A 1FRZA 2WFMA 1JW9B 4FUTA 1U8CB 4UREA 5JTTA 3E0QA 1J00A 3CIOA 3PDJA 2WQZA 3TDKA 2W6NA 2EJBA 2ZB8A 4N41A 2CYBA 2BL4A 4QZVA 4RXUA 5ALKA 4Z0PA 3OZCA 4RLSA 3BMCB 3RTEA 1KY3A 3B3AA 1N1DA 3PL5A 1S89A 2QZ4A 3RW9A 3MELA 5FOWA 4H08A 1C8BA 2NO4A 4Q7LA 5ESWA 3RGGA 1DEKA 3S44A 2UXDB 3HBAA 1C9YA 1T8RA 1A97A 2GCOA 2HLPA 4DLNA 1TGYA 4JWTA 5GIPE 2WMNB 1FMLA 4NEGA 3V4FA 2I1LA 3ORSA 2RGWA 1U99A 2AFVA 3C87A 4YMWA 4RTQA 1QRSA 4KE7A 1A3CA 1P4JA 2AGVA 3QMVA 5I4BA 3EG5A 2ADFA 2FN9A 3WL4A 4JSTA 4IIEA 1I4EB 1VSTA 1T8YA 2VOEA 4C4YA 1MB4A 3KQWA 1DJQA 2JATA 5ALHA 1LX7A 5F3DA 1KEEB 2W98A 1UBCA 1OTXA 3T3NA 5CCEA 2WUFA 4C2BA 1T3TA 1O94C 4NZ9A 3U37A 5MN6A 5CYFA 4JC0A 4F8JA 3OH8A 2BKUA 3DOFA 3PUWA 4IS2A 3HUDA 2WYVA 3MBKA 2IH5A 1CJKC 2NNLD 4ER0A 2IDKA 5AOAA 3SM3A 4LRQA 5AM3A 2PGAA 1U2PA 2GK6A 1Z18A 1QS0A 4IDGA 5CCXA 1SUAA 5H68A 4JVMA 3ZUPA 1RQGA 3HVRA 2UUBB 4MRMB 1T2CA 3V2GA 5IT0A 1MORA 4G0UA 4LCJA 2HXYA 1LJUA 1V71A 3CJTA 4IMJB 3GELA 1YS4A 5LQUA 2HD4A 1XCGB 2ZYSA