2ZR9A

Msreca q196e datp form iv
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
327
structure length
312
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINELRTTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 100
structure length 312
sequence length 327
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr9A01
3ADKA 3U6KA 2NPFA 4RD4A 1FPMA 4BGDA 2ZSBA 3QPVA 4OYHA 1X86B 2VHQA 4Z54A 1Z2AA 1E79A 5FUYA 3GJ6A 3VMFA 5LB2A 1MKYA 1GRRA 1OIVA 2I3BA 1NVVQ 4TYNA 2CHVA 3SU8A 1SVOA 1FNNA 3LWNA 3P4YA 1ANKA 1FW6A 4Q1DA 4TYYA 1ZM9A 1HYQA 2HUPA 2ONJA 4AKEA 2E87A 3KL4A 1CTQA 1GOTA 5EP4A 1JNYA 4M4SA 1UAAA 1E9AA 1X8LA 3AVWA 1XPRA 1G3IA 4HLDA 4Q01A 5CLLA 1OH6A 3FB4A 5FPHA 4A2QA 3GJ8A 2BBTA 2V4ZA 3L0SA 2GHIA 4LYHA 3AUYA 3D6TB 5AJVB 1A1VA 4XIGS 1I4TD 4L9SA 4OBEA 2HJGA 3VNUA 1RPZA 2WSMA 2WJGA 1YZKA 4KITB 5J40A 4RZUA 5JLJA 2IL1A 3O8RA 4OI1A 4Q9LA 3EW9A 4B34A 1HUQA 3RC8A 2BCGY 2V1XA 3PUXA 4EUNA 2JATA 2FFAA 2P6UA 4I81A 3SFVA 5JJIA 1P73A 3GCGA 5CIQA 1A7JA 3B1WA 1D2MA 1G5RA 2XTNA 4AIIA 1QG2A 2RGDA 3IDQA 4BEJA 2RKOA 3IQWA 2PLRA 3HU2A 2YYZA 4RD6A 4GNKA 1KSFX 2OILA 5K8TA 3PUWA 2D7DA 1GP2A 1E2FA 3SEAA 4E03A 1KDTA 2BMFA 1AQYA 5A5GA 1JQLB 5D3MB 3TJZA 4B3FX 5FOWA 4F38A 2YINC 1PLLA 4Q1FA 1K8RA 4HAVA 2F6RA 1UDXA 3ADCA 2FPLA 4OK5A 3EX7C 1FQKA 4QRHA 4HAYA 2BWJA 2O5VA 2O52A 4KLZA 2V7QD 3K0CA 4AD8A 4CEHA 1NMYA 1E79D 3OHMA 1KHTA 4YC7A 2V8OA 5KU1A 3TH5A 1SULA 2ZSFA 3QEOA 1KI4A 3U3JA 2QA5A 4KVAA 4CDGA 3QF7A 4AG6A 3HR8A 1X3SA 2Q9BA 3HWSA 3KB2A 5C4MA 4BASA 2ZR7A 3ETLA 1YZLA 1CIPA 2BEKA 1VCIA 2CLDX 1KO5A 5CJ2A 1R10A 4LJ8A 2GEDA 1ESMA 2HCBA 2P6RA 2CXXA 2ODBA 3AF1A 2NTYC 3NHBA 3D3QA 4JYCA 3NVAA 3GJ4A 3J81k 2GDJA 2X2FA 2IWHA 1XCMA 4IRUB 4PQFA 2XEXA 3QY0A 1VG1A 3HPQA 2JJ2D 3CWZA 1A5TA 1FNMA 1T0HB 1KAOA 2GVZC 2WJYA 4FINA 4HDCA 1XTIA 4OI2A 4X8MA 5AUNB 2PX3A 1E96A 1E9BA 2HF9A 1Z6GA 2GBLA 2P2LA 5HZKA 2ZAMA 4H9GA 1KI2A 1Z6TA 4JL8A 4RSGA 4DZZA 4PFSA 4DUGD 1IN6A 3E70C 4JJZA 1SXJA 4Q4JA 3BERA 1J8YF 1G4UR 4KXFB 3C8UA 1ZM2A 1EFTA 2D62A 1FP6A 4S35A 1NN5A 5FUVA 2GNOA 4MGIR 2IHBA 5CK5A 2WVJA 2GETA 1AM4D 4M9QA 5JECA 2VYFA 5M04A 3K0AA 2H57A 1WP9A 3LRPA 3NHAA 4OQNA 1L2TA 1IN8A 3BGWA 3NIBA 3NWJA 3ZD7A 2N1BA 1F3OA 4LHXA 4QBHA 5DN6D 1LVGA 4D4MA 4YMUA 2V54A 3K70B 2OE2A 4ZO4A 1QHNA 4B44A 4HAXA 2X8AA 5BW8A 3VHLB 3THWA 2QM7A 3THWB 2H7VA 1RFLA 2ASEA 2YNMA 4DLVA 4JLKA 1E9EA 2BM1A 4Q4AA 4IKEA 4RD3A 4MYCA 4E07A 4EPXA 3QXXA 1DG3A 1E4VA 2CDNA 4AKHA 4YXWD 3SS8A 2R2AA 2ATXA 1KJWA 6Q21A 1NLYA 5EE0A 3U7HB 2NQ2C 1VIAA 1OV4A 5FPYA 2ZE6A 2PX0A 2IA5A 3QI2A 4GPTA 1DPFA 3REGA 1P9WA 1BKDR 3EPKA 2CLCX 2P5TB 2WM9B 2IYZA 4KCGA 4AY2A 2J59A 4DCSA 4GMXA 4JBYA 3OIYA 2J0UA 3LX5A 4R71A 1DELA 1S3GA 3CF6R 3PEYA 5FOTA 2VP6A 3HJNA 5GADl 2ORIA 4NYMR 1ZM3A 2LKCA 4S2EA 1GNRA 1X6VA 1KMHB 2X77A 2ZRLA 3HU3A 1W48A 2ZR9A 4Q7LA 4V0OA 2FGKA 1XZPA 2Q3HA 1C9KA 5KUTA 1NLZA 2EU8A 1OSNA 3BRWD 4IDNA 1XFAA 2CE7A 4Q7JB 2I1VB 4UNQA 2MSEB 2QROA 3THYA 3GLHE 1N0VC 2VSFA 1E2QA 1GL9B 1L4YA 3IEVA 3UATA 2HXSA 4EPRA 4FXPA 3GLFB 3CONA 2OXRA 4HI0E 3RRNA 3ZJYA 2IXEA 4U5XA 4MQBA 1N5JA 1XBTA 4NU0A 2BBWA 4GT1A 4PAOA 1RRPA 3IBYA 4LWZA 5FBQB 2GEUA 4I1VA 4E22A 1M1YE 4Q21A 2R62A 5FPKA 4JMPA 1HA3A 1T3LA 5HR5A 2Z0MA 1WXQA 3ADBA 4Q4HB 1CJVC 1A4RA 3HPRA 2NIPA 5B57C 3BFXA 3CRQA 1LS1A 4KODA 5B30A 2E9SA 2VSOA 4MKIA 5ELXA 5F9FA 2NZ8A 1NJFA 5DISB 1D9XA 5D3MA 1F2UA 2P5SA 2CL0X 3CRRA 3UPUA 2J7PD 1A2BA 3UG6A 2ZANA 1N0WA 2ZRPA 1W49A 4D82A 2EVWX 1ZU4A 2WWWA 2KB0A 4FMDB 3TUIC 2D74A 2QMHA 1NSFA 2IXFA 3L8ZA 2XSZD 4ASUA 4HZIA 2A30A 1P4SA 1H8HD 1SHZA 3X1YA 2ZE7A 4Z8YA 2D7CA 1ETUA 2AKAB 4C0QC 1Y3AA 2WIAA 1XDBA 2Q9AA 3P1JA 3AGPA 3PFIA 4G3XA 4BZXA 4DB2A 1KI9A 3SJZA 4K8OA 2H8KA 4HLUA 1A2KC 4M0LA 2BEJA 3VR6A 5CDFA 4OJKA 4JL6A 1G21E 1OYWA 4H1UA 5DYIA 3GP8A 4C2TA 1G1MA 4ARZB 3TMKA 5KPJA 1EX7A 1TQDA 2EFEB 4MYUA 3QPWA 2ZI9A 2O8BB 5JEDA 5H8WA 4RZ3A 3BBPA 2O8BA 2IUSA 3ZS8A 3C4JA 3SYKA 4PC1A 4CF7A 5JCPA 2X19A 2EWWA 1Z47A 1IY0A 3NTUA 4B2LA 4A0GA 3B8HA 1LTQA 3IO5A 3QF4B 3VR3A 2RGXA 3I61A 4PC3A 5TARA 1G3MA 2Z4RA 3GEEA 3OE7D 2ORWA 2CCGA 2KBEA 4DB4A 4ZCMA 2QTHA 4FWIB 1XMIA 4HUTA 3A36A 4Q7MB 4M22A 4DEXA 1TQ4A 3I5YA 1WQ1R 4RD0A 3B1VA 3QPUA 4GZMA 4Y0VA 1SKYB 3QXHA 4BQSA 1OKKA 4A36A 4PPGA 4UNSA 2JEOA 3GD7A 4MKHA 4NBSA 4C3ZA 5F2EA 4BFUA 1N6IA 1VCNA 3RAPR 3AGQA 1S0UA 3SHFA 3B9PA 1R0YA 1W4AA 2C96A 2DFNA 4P4UA 4PHFA 1W4CA 1WRBA 1E2GA 4U02A 2QM8A 3KB1A 4G5QA 2J9RA 1XD8A 2WWIA 4D6PA 2CHGA 5FOVA 4JJKA 2H1LA 1W0KA 1XEWX 3L0IB 2EFDB 4UNPA 1KO7A 2G0NA 3VKGA 1H8HA 3LVQE 3ZIAA 2HEIA 5K8UA 1YVDA 1JJ7A 2N42A 3CX6A 2OV2A 2OAQ1 4X8LA 3X1ZA 3I4LA 1E1QD 1HT1E 3EIHA 2G9NA 4TQUS 2MMGA 4TYQA 2GCPA 3QKSB 3BFKA 4BRUA 1KNXA 2G1JA 3CW2A 3QKSA 5FBRB 4NL4H 4WZBE 2HV8A 1TF5A 4YLGA 3U6BA 4MRVA 3SNHA 5F3WB 1PV4A 2V6JA 2AK2A 4UXHA 2DFTA 3DKVA 2O8FA 4XOIA 2R6CA 2XTMA 4G0NA 1E2JA 3PG5A 3LX8A 4OHXA 3ADDA 2H92A 2J3EA 4HB3A 2C2HA 2QN6A 3B1YA 4BLOA 4DCTA 2BVNA 4URUR 3SI7A 3HP1A 5KSYA 1NY6A 3PUZA 4LHYA 2IF0A 2ZSAA 4C9BA 1YQTA 3NBXX 3W90A 2IYQA 3VX3A 1ZP6A 2IYLD 1VG0B 3SE0A 2PMDA 1TL7C 3ZZUA 1Z0AA 4BLPA 3WNBA 1P72A 4XWOA 3UMRA 1MO6A 4OL0A 3R9IA 4PQRA 2GXAA 1SVSA 1T3HA 1OJLA 4IXMA 4IXNA 1J8MF 2XZOA 3TR5A 4NTZA 3A8TA 1II0A 4A1FA 4B6EA 1DAIA 3CNLA 1ZUHA 5G53C 4IOKA 3OEHD 2J87A 5L3RA 4DSUA 3UMSA 2B8WA 4HYYA 3ZZ0A 4BFXA 3QF4A 1P62B 3Q7PA 5H68A 4P4TA 3OAAA 5TB5A 1CR1A 5E4FA 1IHUA 3AVOA 1GUAA 4FI3C 1G3UA 4LBYA 4LJ5A 1IN5A 2OFWA 4P3YA 4B32A 1L7VC 1SKQA 4Q5IA 3OE7A 3VAAA 1XEXA 1FUKA 1M2OB 3CX8A 3I1FA 4ITRC 1P2VA 4IVQA 4XSHA 3ZYCA 2VLIA 1M7GA 3AKCA 2IBMA 1HH4A 2WWGA 1JPJA 2ZETA 5FBLB 1ZRHA 2D06A 2WIBA 4YDSA 2FA9A 2BOVA 1E0SA 4ZDWA 1SXJC 2FSGA 1PLKA 2B6HA 1SXJE 1I2DA 1F5NA 2FF7A 2Q3MA 1N0UA 2V6IA 1YR9A 3DL0A 3TAUA 3U44A 4CGZA 4R2IA 4QOSA 4M1WA 1OE0A 2AD5A 4JT2A 1S3SA 3D31A 3LW8A 1EX6A 3BK7A 3ZIAD 1VYTA 3TIFA 1KI1A 1WE2A 2ZS7A 1IBRA 3AP2A 2ZJAA 3GFTA 3OIVA 3Q3JB 2Q9CA 3VNVA 2QPAA 4PQYA 2F43B 3EA0A 4EPWA 1LB1B 3MWLA 1RJ9B 4TTPA 1KYIA 1C4OA 1ZMXA 4LJ4A 2WMOB 2FE4A 4XVRA 2REBA 5TV2A 1XMSA 1WB9A 4TYWA 1WCV1 1YZUA 2XITA 1NMZA 1IONA 3T5GA 3LFUA 1MABB 1SVLA 2XNDD 1X8JA 4TMKA 1OB2A 1D2EA 1JQJC 1RIFA 3OFNA 1P3JA 3KJGA 1KMHA 2ZU6A 3K0CC 2JLUA 2ZI7A 1XTSA 4PHTA 4UXIA 5L3VA 4O2RA 3SBDA 4OHWA 2WJIA 1XPUA 2HLDD 4LBZA 1PUIA 4Q47A 1VCMA 4QM6A 2RB4A 3VTKA 1G20E 2Z4SA 4EIWA 4LPKA 1KSJA 2C78A 2NO1A 4NONA 1ZU5A 4BWYA 1G17A 2DFKB 3AEZA 4CZ2A 5KSOA 3AVYA 4TMXA 4LZZA 4KSCA 3OIWA 3RRYA 1NJGA 1PJRA 3AVUA 1KY2A 1UEJA 2FU5C 2QI9C 3W9YA 1FTNA 4HEJA 3L82B 3LD9A 3EIEA 2C03A 1WA5A 2VP5A 2R6AA 3UWKA 3SBEA 1W5TA 1FZQA 2IW3A 2VHCA 5DSZA 2C9YA 1W36C 2YC4C 3A4MA 2QT0A 5BWMA 221PA 4URZR 3GJXC 3C5HA 1XEXB 4TLDA 1QF9A 3NKVA 3B1XA 3M4YA 4Q4LA 3ASYA 1GIAA 3A37A 1G6HA 1HY3A 4LJAA 1N3BA 4LCBA 4AYWA 2OFXA 2WPDA 1OH5A 3OIUA 4RCZA 1GKUB 3WBKA 3BAFA 1W46A 1XB2A 2G6BA 2HT6A 3QG5A 3AVPA 3GJ7A 1X1RA 2VF8A 2ZRCA 4DLWA 4FCVA 2YJTD 1E9FA 3FKQA 2WV9A 2PZFA 3AH8A 3AF2A 2J45A 2GILA 4N0EA 4UXJA 2VEDA 1NN3A 3HYTA 4GOXA 4Y0AA 3EC2A 4AURA 3GFPA 2W2XA 1CULC 1XF9A 2IXGA 4JYBA 4US2R 5L3SB 2REOA 3FKSA 3MWKA 3WXMA 1X1SA 4YMWA 3QVUA 3ASZA 4KYUA 2DCUA 3F3YA 2UKDA 2OXCA 3KUCA 2O8EB 4D26A 3EZ7A 2UVQA 3B7GA 4TL8A 1SQ5A 2ZS8A 4PANA 1ZCAA 3PEWA 2EYUA 1TF7A 1ZIOA 3N70A 1RJ9A 5JWOA 3LXRA 1CJKC 1DAKA 1PZNA 3B1ZA 1PLJA 4YMTA 2B7CA 1JAIA 1UDWA 3EZFA 1DOAA 3QVVA 1Z5ZA 2V9PA 4CVNA 1CP2A 2WWYA 2Q0HA 5HKKA 1I4LD 2EW1A 4M8NE 5J47A 2GCNA 2Y8EA 4MRRA 1E2LA 4QFMA 4HZUA 3B13B 1AK2A 2P67A 1JXMA 5H1YA 4M1MA 2PMKA 1E2IA 3FDIA 4PTLA 2ZIAA 1IM2A 4LYAA 3BS4A 1KK3A 1IJEA 1OF1A 4FD2A 2YOFA 3OF5A 3EPJA 4QGFA 1Z0IA 1OHHD 2F3RA 2RGAA 5J4HA 3TKLA 1K5DA 4GOKA 1XCGB 3WP0A 3QEJA 4NPHA 2ZRMA 1G64A 4IDHA 3QG1A 1VG8A 2C5LA 3T1VA 4FCTA 4RFSA 1D6JA 1OFHA 3VKWA 5JI3E 3U44B 4C7OB 3PQCA 2D2FA 1W0JA 3H0KA 4DLRA 4TL7A 5FBWB 4D81A 3NH6A 1UJ2A 1ZCBA 4F91B 2OFOA 1AZTA 2GEVA 1DAHA 1N6NA 4Q18A 5SZJA 2I1QA 4DLTA 3T1TA 2QSYA 3BORA 2ZI4A 1ESNA 1KJZA 2HLDA 4GRAA 3UMFA 5FOSA 1NN0A 1BYUA 5IF9A 1I4DD 5FUXA 1IY2A 3BXZA 1KDRA 1GZSA 4CW7A 5KNBA 5KOYA 4WIAA 3EASA 4LJYA 4ACBA 1JR3E 2BKEA 1R5OA 2KE5A 1NLFA 5CYPA 2HYDA 3RS7A 4B35A 1MABA 3U7EB 1DBSA 4Q48A 2OBNA 2R6FA 5DH9A 3EWSA 2ATVA 4FMCF 1R4AA 1Q1QA 4C0HA 2MMCA 3RDPA 4HLQB 1E94E 1UBCA 4W5WA 3I62A 1JECA 2GF9A 3EC1A 1N2CE 3R9WA 4A0FA 4KO8A 3RS2A 2WKRA 3L0OA 2FGJA 5LB4A 2XZLA 1CRPA 3K0FA 3WMGA 2ZAOA 2P65A 3T15A 2W2VA 4Q9KA 4NH0A 3AB3A 1AS0A 2XTZA 3UXMA 1OB5A 4V0NA 5A0FA 2ZE8A 4TLCA 3TGPA 2WPDD 3KKOA 3P26A 2J46A 4EJSC 3LVRE 2O8EA 2QTFA 1OXVA 3MG9A 1P2SA 4B3BA 3VU9B 2A78A 2F1IA 3B85A 4XTRA 3NBZC 2O0KA 1SZPA 1LS6A 5AJZA 1IXSB 2D4HA 1JEDA 4Q4HA 4TMTA 1NL3A 5FOUA 5FUWA 1AN0A 1Z07A 1GL7A 4JL5A 3DOEA 4DSNA 3GLIB 1NG9A 2B8TA 1F48A 2PJRA 5CYOA 5JJLA 3KX2A 1NSTA 3ZD6A 1CJTC 1XRJA 2PEZA 2W6IA 1SXJB 4D4JA 1E9CA 2DWPA 1AKEA 1WMSA 4JLNA 5SZIA 5G40A 4F93B 1D8TA 2GJ8A 3AP3A 3UG7A 2OCBA 4QGGA 4CT5A 1YU9A 4YQFA 4A0RA 4YDHB 5B64A 3LBHA 5CDFE 2JLWA 3KXIA 4R98A 2ZVQX 4WXRA 1CJUC 2PCLA 2VHJA 3KQHA 4CEHB 5LDDC 2QAGC 1IN7A 1G4AE 3B60A 4JIMA 4DIDA 3W5IA 4UNNA 3PENA 1T6NA 2WMNB 1Q3HA 1Z22A 4RZ2A 4UQOA 5DHFA 4MUBA 3N2IA 2CLSA 3QQ5A 1CRQA 3G82C 1TQ2A 1YZNA 2GBLC 3JZAA 3K70C 1KI6B 3C41J 1VHTA 4JSTA 5KPDA 2QT1A 4OHYA 4QNRA 3BIFA 4JBWA 1U81A 4V03A 3REFA 2IS2A 2JLZA 4DHEA 4ESVA 2CL7X 1NBMD 2AX4A 2NO6A 4OI4A 4B33A 4ARZA 4QC2A 3T34A 3GLFE 5CK4A 1Q1EA 4L8GA 4LJ9A 2JJ1A 721PA 2AXPA 2OZEA 2ZJYA 3IIKA 1M34E 1RRCA 2PT7A 4IDQA 1C1YA 1RC8A 3W5JA 4OQXA 3DPUA 1EFCA 3CF2A 4M21A 3K09A 4JZKA 3GLIA 2F55A 2GESA 5JS7A 1XTRA 3DM9B 4AG5A 5CB8A 3W6NA 1S1CA 3Q72A 2GZDA 5EUQB 4WW0A 4D4LA 2IYTA 3FMPB 3SYLA 1W36D 1HE1C 4B3DA 3EPHA 4HZUB 3MJHA 4D0GA 1E4YA 2GK6A 1ZW6A 4O0MA 3CBQA 4HDOB 4LI0A 3K0AB 3H84A 2GTPA 2WWXA 4A8JC 3WYAA 2ANCA 3A1WA 1VYVA 1PUJA 1R7RA 3SFZA 1W5SA 3RSLA 4YMVA 2DHRA 1MOZA 2BC9A 4NYJQ 3TW8B 1Q22A 5FTLA 1SHKA 1QZXA 1OXSC 4QJ5A 5HZHA 1GKYA 5FOXA 3H1TA 1MH1A 1ELOA 1AA9A 1YE8A 2FV8A 4C0SA 4WZAE 3VU9A 2A5GA 4BLQA 2IS4A 1IJFA 4PO8A 4MYHA 3PEVA 4NDZA 1W47A 4NCJA 5BN5A 4UNRA 2IYWA 2A5YB 2ZRAA 3O8DA 1U0JA 1DO2A 1G16A 2ODEA 4JBXA 3QNUA 4KJZA 1ZJ6A 2VBCA 3CO5A 1GM5A 4OI0A 4ILEA 3SC3A 1UKEA 1GG2A 5EXXA 2GJKA 3BE4A 1SVKA 5F98A 4D25A 3SQXA 3M1IA 1VTKA 3PITA 3BJIC 3WBJA 4EDHA 1HQCA 1B0UA 1OLOA 3K53A 1CXZA 2QPTA 2FN4A 1O3YA 4IFEA 3RWOA 2PCJA 3AVXA 3TQCA 3U3KA 3KQNA 2XXAA 2NO0A 1ZC3A 2RMKA 4DC9A 4GP6A 2XXAB 2HJVA 4Q02A 5C2JB 3L43A 2QP4A 3IHWA 3AVTA 5IHPA 1NF3A 1ZM7A 2QP9X 2BHRA 2MSCB 3JZMA 2QRZA 4FMCB 3NC1C 1GTVA 3BH6A 3CM0A 1P5ZB 1FL9A 4PR0A 1EXMA 4XSGA 3PUYA 1X8KA 4EPTA 5LD2C 4A15A 4CIDA 1ODFA 1W4RA 1TU4A 1NVXQ 2QENA 3MGCA 2CBZA 5SZKB 1EWRA 2ERYA 2QGZA 1U0HC 2B7BA 2VP4A 1ZD1A 2A2ZA 2WKPA 4LYJA 4JVSB 4LC0A 3MAAC 4BFSA 4NP6A 2BBOA 1R5BA 3W3AA 3M6AA 5E7MA 2JLVA 1I2MA 4OHZA 3DEFA 2ZYTX 4KFRA 3RS4A 4QKQA 1Q57A 3WHLA 4JLPA 4MRPA 4ZKEA 4F4JA 1M7BA 4NCIA 1XTKA 2XNDA 1N5IA 5EJEA 2ZRGA 1S2MA 1ZC4A 3OFND 5DHAA 2YOHA 2W58A 5AUQA 1P9NA 4M1YA 1ONBA 4B76A 5JEEA 4C2UA 5P21A 2DY1A 1S9HA 4NCNA 4AC9A 2ODWA 4JVNA 2CJWB 4Q1BA 4NMMA 3IUYA 4TSFD 1Z63A 1NN1A 4NKRA 2ZSEA 5EE5B 4D0NA 4QJ3A 1DE0A 1BMFA 2DBYA 2IS1A 2J1LA 5TDHA 1JAHA 1VHLA 3KQKA 2J0SA 1XJ0A 1E1RD 5JWHA 5LD2B 1II8A 2NO7A 4OQFA 4PSKA 2OHFA 4OHVA 5C18A 2ZM5A 2QTVB 4OKSA 4RVCA 1JR3A 2JLQA 4IVRA 1V5WA 2VHTA 4ESHA 3KTAA 2F1HA 3FYHA 2OEPA 4UJ5A 3ZH9B 4W5HA 1NKSA 4B47A 4C0JA 4ZDIA 3QBVA 4Q9IA 1NNEA 5B2ZA 2BV3A 1W4BA 3VQTA 1OH7A 4B71A 4XWKA 1ZIPA 4QBIA 4PSVA 4UKDA 4A9AA 1Q44A 4QHSA 3BWDD 3RSOA 1E2NA 5IRCD 2WKQA 3NEJA 2KBFA 5F9HA 3T1OA 1Q21A 3VR2A 3KKMA 2HYIC 4GL2A 2JCSA 2GZAA 2OLKA 3AKYA 3DZ8A 3IEUA 1D5CA 1UKZA 1DO0A 2AFHE 3K9NA 1JALA 2OCAA 4PC7A 3TSOA 1P75A 2WSSA 2O8FB 2CHQA 1JBKA 2ZITA 5JHGB 2VHUA 2NPIA 5AWFC 3QKUA 4Q1CA 2OO7A 1UBEA 4A6XA 4ZI2A 3LH5A 4FIDA 4LOAA 2BJWA 2IEZA 2PL3A 2F1JA 2YC2C 2DB3A 1TF2A 4PZLA 4PHHA 1CKEA 2LKDA 3FKSD 3A4LA 3FPAA 4QHTA 1QHGA 1S9DA 5GJVC 2AKYA 3WNDA 5BYJA 1G8FA 5JSZA 1E0AA 1OPXA 4MDEA 2GJSA 2RGEA 3W8RA 3K9LA 3AF4A 2EFGA 1N25A 2ZYWX 1F60A 3DM5A 3RNLA 1BMFD 1KZGB 2L0XA 1QHIA 2WOOA 2A3RA 2CVHA 2ZI3A 1RYFA 2A5JA 4FMDF 4IEEA 3ECCA 4X8HA 4QJ4A 3ICEA 2FG5A 3GLGA 4M1SA 5HPYB 2C9CA 1NI3A 2EYQA 4WOPA 1RW4A 1MO5A 1TUEA 1Q3TA 4B73A 3K70D 2FSHA 3HR7A 2GF0A 1HTWA 3C7KA 1QHHB 2IHYA 1S96A 4BFWA 3EIQA 1H8ED 2NGRA 2YHSA 3KJHA 2JAQA 3K09C 1G7TA 4MKFA 3A1UA 4KFTA 4QBGB 4W7SA 3BB4A 1S1MA 4A2WA 4GP7A 5FL3A 2ZRFA 2FSIA 3NG1A 3RABA 4ON9A 4URYR 2B21A 2ZUCA 3Q5EA 1ZYUA 5GJWC 3OESA 5DI3A 1EFHA 1XMVA 4OQMA 1VMAA 1Z0DA 5AK0A 5LPNA 2JASA 4NYJR 4US1R 3IPYA 3MFYA 4BZQA 1EFUA 4MRNA 4LV6A 4X8OA 3C16C 4KHZA 4JKIA 3WNCA 1KKLA 3KXKA 2GCOA 2YWFA 3UIEA 4BRWA 4DDUA 2BIFA 4NYIQ 2YV5A 1GDDA 4KVGA 2EFHB 3Q85A 3SJBA 1JJVA 2ZUBA 5FI0B 2BJVA 3TSWA 4PC6A 2ZRHA 4DLXA 1WF3A 2QBYB 4F7WA 4K46A 4CEJB 3U4QA 4Q7KA 2XGJA 1G9XA 5JMTA 3GLHB 4M9XA 2AR7A 3QSYA 3U4QB 3RLFA 3AKEA 4G01B 1TQ6A 3THXA 1RRGA 2O0JA 3SYNA 1F6BA 3FHTA 4HAZA 5K8IA 3G5UA 4TQAA 3Q8XB 3VKHA 4V0ME 3IGFA 4AK9A 1S8FA 1ZAKA 1BS1A 3B9QA 1DG1G 1EK0A 5KYKA 3TNFA 2G88A 1KO4A 1N6PA 3I8XA 5HE8A 3VR5A 5GJCA 2QMOA 3PCRB 1Z29A 3P4XA 4RCYA 1QHHA 1CS4C 4FN5A 3T1QA 4DEYA 2Q21A 1XTQA 3MMPA 3A6PC 5KNDA 5C1BA 1BO6A 1II9A 3EWAA 2IYRA 4B3GA 2GAAA 4MRSA 2XJ4A 4L16A 2F9LA 4XTCS 2A9KA 4G1UC 3A1TA 4HAUA 1KI8A 4LRWA 3UK6A 1M8PA 5EXPA 2VL7A 1H8EA 2NMVA 1T5LA 1UF9A 1DTSA 4JS0A 4BEBA 2BMJA 3KJEA 4RD1A 2ZYVX 2QAGB 1FP7A 4Q03A 3FWYA 3KQUA 1FTSA 1FFHA 2VP0A 2VF7A 1OXUA 2HF8A 2W0MA 4IOLA 1DVRA 3CIOA 5DN6A 3WMFA 1T8TA 4WAUA 2BDTA 1KSGA 3AVQA 1KK2A 4JT4A 4PC2A 1Z6XA 4MGZR 4JLMA 1OFIA 4ZKDA 2IS6A 2J41A 3FHCB 1P2UA 2VH5R 3PVSA 4M9ZA 1G6OA 4DCVA 2O8DB 3HU1A 4Q19A 1SVWA 5G41A 2AHOA 3GLHA 1UEIA 2QQ0A 4JLOA 4YXWA 1DADA 3R9XA 4AYTA 3L0PA 4BZPA 4J0QA 1QDEA 3RHFA 4W9MC 1E32A 1XU4A 2W83A 4IOJA 4ZCLA 2QNRA 3BD9A 4URWR 2AFIE 5EE3A 3UANA 4M2LA 3QOFA 3U60B 1YRBA 5KDLA 2LCFA 1TEXA 1TUIA 1MO4A 3TVTA 4Z1MA 2PH1A 2V7QA 2ANBA 1JXOA 2IF2A 2QE7A 3A1VA 1MRSA 1TMKA 2QORA 3VR4A 2Z43A 3KZ1E 3X2SA 2QQEA 1P60A 4QGHA 4BFVA 2WWFA 4G5RA 4BLTA 2GJAA 3WYGA 3LLMA 2FEOA 3KFXA 1Z06A 1E9DA 2GCOB 2XJ9A 1T4GA 1CEEA 4FCWA 4A4DA 3AV0B 3EZ2A 4RKFA 1CR2A 1E0KA 1XEFA 2KWIA 4MGKR 3RRZA 3D7MA 4FW9A 4OQLA 2JDIA 2PZEA 2VP9A 2D2EA 3L2OB 1BOFA 4IEIA 3MWJA 2AXNA 2W6JA 3SHWA 3E1SA 1N5LA 3PIRA 2FZLA 3THXB 3DKPA 1TAGA 4MGYR 2IT1A 1GL6A 1KO8A 4MH0R 3RVBA 2ZROA 2X1VA 4B2PA 1NMXA 2CK3D 4JLAA 3WP1B 3ZS9A 3TSZA 2F9MA 1IY1A 4A82A 1G41A 3SDZA 4M53A 4CT4B 1O87A 3TR0A 4C0LA 5HE9A 2QL6A 3K8YA 3TW4A 4B6FA 1U8YA 2E1RA 2WZQA 2OSBA 3Q7QA 1JR6A 5BYKA 3CR8A 3FE2A 4QBFA 1UKVY 4PAMA 3ICQB 4LHWA 4DLYA 2CJWA 3HDTA 1US8B 2J7PA 3CB4A 5DE3A 5EE9A 1GVNB 5EP1A 4TTQA 4BECA 5FH9A 2IWRA 1XXHE 3LQRA 4ZDJA 1GNQA 1MT0A 3IIMA 3P27A 5BQ5A 3KUDA 3ZVLA 1G5PA 1U0LA 5FPSA 1II8B 1TTTA 2XSZA 4ASUD 4ZV4A 2RAPA 1U94A 3R20A 4MA4A 3B78A 5JI2E 4CRWB 3SQWA 1R0WA 3E2IA 3MUFA 5L3SA 2EFCB 4NZYA 1GILA 2VP2A 4HUQB 2FDCA 4P0TA 4RKEA 3RYTC 1NKTA 1QRAA 1U9IA 3FMOB 1U98A 2C95A 2W2TA 2O8DA 1YZGA 1NVUQ 5J5CA 1TU3A 3QBTA 4TL6A 4YONB 5TY0A 5FR2A 4ZIRA 1OIXA 3LA6A 1G7CA 2R6DA 3P32A 4I1UA 3GFOA 1RKBA 4N1AA 3T12A 5TXGA 2R9VA 4TLEA 2KJQA 4QHYA 3TQFA 4ACAA 5HCIA 3LNCA 4M1TA 5CIWA 3TUJC 4A92A 1KK0A 2WHXA 4A2PA 3IO3A 2C98A 4C4PA 2OCYC 4TWZA 2QZ4A 1CJMA 3KFVA 3OEHA 4P33A 1Z6AA 1U8ZA 1QBKC 2IYSA 5EZ6B 2J7KA 3OEED 1E2PA 3LDAA 2LWIA 1OYYA 4KU4A 5EP3A 5J4KA 5E95A 2YOGA 5IT5A 4GFDA 2AWOA 4WXPA 3PXGA 3VHXA 2ZJBA 2FFQA 3MJRA 4ZDKA 4NCHA 3CH4B 4DIEA 1KMQA 2R8RA 2JDID 4PZYA 3W6PA 2FEMA 4LV8B 2YWHA 1AKYA 2ZRBA 4E09A 4PPNA 3A58B 2FNAA 2NO9A 4DJTA 3RWMB 1N6RA 2RGBA 1OFTA 1Z83A 1YR7A 1G5TA 1E1RA 1ZINA 4HATA 3V00A 2JA1A 1J70A 2JLSA 4DLSA 1AJEA 2CK3A 2AD1A 3UKDA 1PVOA 1KTVA 4LC1A 1OW3B 4LHVA 4IJMA 3SZRA 3OEEA 3THYB 4TSFA 1NRJB 1SXJD 4MKGA 1E9RA 4N0DA 1AS3A 1DEKA 2CCKA 1KAGA 2QMEA 1N5KA 1N6OA 5CITA 1JI0A 3ZGXA 1ZM4A 1WBBA 2ZJOA 5EQTA 3Q5DA 4DVGA 1VDZA 1GRQA 3R7WB 2C04A 1IN4A 5E7IA 1TADA 5DGXA 4KFUA 1JR3D 1OXTA 3G0HA 2C99A 1IAQA 4LGMA 1SKYE 2ZQ5A 5BXQC 1YHNA 1CU1A 4AKGA 2V55B 4QL3A 3K0SA 1E3MA 2RGNA 3DZDA 2XOKD 1TPZA 5FFMA 4DSOA 1KOFA 1LW7A 1Z2CA 2ZE5A 4BE7B 3F5FA 4CEIA 1G18A 4NE2A 4XWAA 1UBFA 2BMEA 1XD2B 3ZVMA 1OH8A 1YZTA 3PUVA 1G8PA 1IQPA 4LK2A 5KSPA 3ONWA 4BFZA 5C46F 2AL7A 5DIFA 4LBVA 5L3QB 4XVUA 4RFVA 4AI6A 4HB4A 1F2TA 4EJSA 1ZUNB 4TL9A 4GZLA 4C0BA 5IK2D 2RCNA 3CLVA 4U7DA 1EG7A 3PEUA 1XTJA 3GLFA 4LJ6A 4IW3B 4DLZA 3AKDA 2V1UA 3EG5A 2Z6VA 2C9OA 3QXCA 3MLEA 3QXJA 4GOJA 5EUMA 3NBYC 4B75A 5GVSA 1MR3F 1IOZA 5JCZA 2ZRKA 2ONKA 1OFUX 4F4IA 4D4KA 3AF0A 4PPQA 8OHMA 1CR4A 1G8GA 2CMKA 2WAXA 2OBLA 2MSDB 2PLFA 4V0MA 5SZHB 3I3SR 5GVRA 1Z28A 2YZ2A 4LUCA 5AJYA 5JHHB 3K0EA 2CEAA 3DO6A 5FTMA 2HT1A 3GJ0A 5DI3B 1YJ5A 2WOJA 4HSEA 1LFDB 1XCPA 1XEWY 1EWQA 4HLUC 4R9UC 3X1DA 4EQ6A 1XJQA 2ZI6A 2K5UA 2QAJA 4JLBA 3AUXA 3CZQA 2ZJ5A 1KI6A 4HUQA 3TK1A 2OLJA 1KDPA 3OZXA 3BC1A 2F3TA 1LF0A 2O0HA 4XVQA 4DDTA 1HT2E 2ZSDA 3KDSE 1XD2A 1G7SA 1Z0JA 4N3NA 1XXHB 5DO9A 2YWEA 1EGAA 1KZ7B 4FMBB 4Z51A 4ZIRB 1ZUIA 1ZNYA 1HURA 821PA 2RGGA 1RZ3A 1H65A 5HTKA 1SVMA 4ZI3A 4QGAA 4TT3A 1ZD9A 2REXB 3DMDA 3CR7A 3N5CA 2JJ2A 1U9IC 2TMKA 4BLRA 4EFLA 1MO3A 2P6NA 3B2EA 1XMJA 4L9WA 1QHYA 3O8BA 5C4GB 4ERNA 1UM8A 2VSXA 1GITA 3WRYC 5DNYB 2IUUA 3LBNA 3N2EA 4Q9JA 1JPNA 1GWNA 2QY9A 4LYFA 3T06B 2IK8A 3B6EA 5LBIA 3GLGE 1G7RA 2WBLC 4I1OA 3U2QA 4TYPA 2ZEJA 3K0FB 2ZJ8A 1J99A 1Q0UA 1UKYA 4PHGA 2OESA 1E69A 1T91A 1TNDA 2YVUA 4EFNA 2ZTSA 3LQQA 1A82A 4LPSA 3WHKA 4RD2A 3KKNA 1ZD8A 3WY9A 3ZZTA 2HCJB 2XX3A 2YWGA 4K81B 4Z8XA 5BN3A 2FPMA 1E2KA 3V9PA 1NBMA 3ZDQA 2CE2X 4BPBA 4LX0A 4EJSB 3X1XA 1AS2A 3W3ZB 5FI1B 2Z5FA 3A4NA 1E2EA 1D2NA 1UPTA 4BUJA 1ZNWA 1G291 4QG7A 4WBSA 1M74A 2AN9A 3TE6A 2F7SA 1FOEB 1HEIA 1MRNA 2IYYA 2IYVA 1T3SA 5B58C 5J4YA 4G5SA 2ERXA 4LBWA 4EPVA 3C5CA 3T35A 4IDOA 2H5EA 4ZCIA 3JVUA 2DWOA 2PBRA 3PR1A 2XNSA 3K9HA 4LV5B 4EPYA 5TMPA 1NG1A 2FH5B 2QUZA 2GA8A 3TUZC 3TAHA 1GKIA 4LY6A 1COWA 1DAGA 2FZ4A 1P7CA 3IHLA 1E99A 1Y63A 5JBQA 3WYFA 1P9RA 4TZ0A 4PXAA 2ZVPX 2VTKA 3R7WA 1M7HA 4TT3D 3IILA 4L15A 5JZVA 2FFBA 4EQ6B 1W1WA 3AP1A 4JLVA 4O25A 3UWOA 4EAQA 2SHKA 5KDDA 3CNNA 4L4UA 1GSIA 2ZRIA 5EXSA 3RS0A 4GSYA 4HB2A 4KBGA 1E2MA 1M6NA 5JS8A 3AF3A 2QBYA 1TEVA 1RYHA 2ZUDA 4KBFA 4OK6A 4HAWA 1KJYA 2O8CA 4H1VA 3CX7A 2JLYA 2WTUA 2H18A 4JVMA 2WJHA 1JB1A 1XXHA 4TZ6A 2XZPA 3X1WA 1LV7A 4QNMA 4C30A 1QHXA 1VECA 3LBIA 1E1QA 2G83A 3P20A 3RS3A 4I99A 3SN6A 1KI3A 1ZNZA 3THOA 1T0JB 3CWQA 1F2TB 3MRSA 4EFMA 4V0LA 1Z6YA 3NDBB 1U99A 1XD9A 2HXYA 1R2QA 1BIFA 2P3SA 2QE7D 1HE8B 2GRJA 5ANRB 5JRJA 3KKPA 1W0KD 5FTNA 4V02A 2GXSA 1FQJA 2IYXA 3W6OA 2H17A 5H70A 2DFLA 2BM0A 2ODNA 3IIJA 1L8QA 2BMDA 2CL6X 1Q1BA 2Q6TA 1XP8A 3LAWA 1S4QA 2RHDA 4WA7A 1GAJA 4AKIA 1G8YA 1DS6A 1XWIA 521PA 4WZ6A 1Q1ZA 1E2DA 3QKRA 4OJQA 4Q00A 3TLXA 1KY3A 4DT1A 2IUTA 4DLUA 5AJWA 3QKRB 3DVLA 4JLDA 4DT1B 2R44A 1T5IA 3FMIA 3TBKA 1P2TA 2BBSA 4KI0A 4O2LA 3O8CA 2J0VA 4JVLA 3EA5A 3FFAA 3RC3A 5J4VA 3KQLA 5DLQC 3V4FA 3NC0C 1KKMA 3U7GA 3EAQA 4P4SA 2DPXA 3DHWC 1Z8FA 2EQBA 5FTJA 3QKTA 3MSXA 4DWJA 2B92A 3GQBA 2W00A 1E6CA 4R7ZA 1W2GA 2VPPA 4KV9A 4R2HA 4F92B 5HKKD 3I5XA 5EP2A 4IOMA 1YRAA 3B5JA 2NOAA 1HQYE 1T9HA 1AGRA 1NY5A 2F1RA 1Q20A 1Z3IX 3AQ4A 4NYMQ 4MITA 4RFSB 4C7OA 2GZHA 3FGNA 5IDVA 1N6HA 3B82A 3H86A 4MYTA 4DUGA 2WJJA 5EE1A 4YMSA 2A5DA 4KSBA 3EZ9A 1E2HA 2G77B 2ZS9A 1OHHA 2KI5A 1EFRD 2ORVA 5G3ZA 3F8TA 3ZQJA 4PO9A 5CLQA 1UBGA 4EKDA 1T8UA 5KHOC 4PX9A 4POAA 1G3RA 2C77A 2N46A 3BH7A 3I92A 4DXAA 3CPHA 4TLAA 1ZBDA 1ZVQA 4TN1A 2ZRDA 2CNWA 1N6LA 3VFDA 4B3CA 2J0UB 3FFBA 1YR8A 2QSZA 1R0ZA 3SJAA 2OBMA 2G0TA 4G5GA 3Q9LA 5JSZB 5FPTA 2VA8A 3DMNA 5FL7A 4TQ9A 2O8CB 2W0SA 5BN4A 2XB2A 2IX3A 5JFGA 4CEJA 4KAXA 2WJVA 4B48A 3MCAA 3WMEA 121PA 1Z0FA 3CUEF 4QXAA 5L3QA 2J0QA 4XD7A 4AYXA 4F4CA 4FWTA 5E7JA 4B43A 1G3QA 1FX0B 2UZ3A 4Z1MD 4C0AC 5UKDA 3AVVA 5AUPB 1R5NA 1EFRA 1FX0A 3NH9A 5TVKA 3ZVRA 5KTYA 1D9ZA 4JLJA 2JLXA 2FFHA 4Q1EA 1TX4B 2OT3B 2XAUA 3WRXC 3GLGB 3BB3A 2QGNA 4L5BA 2X2EA 4KLNA 2OG2A 5CB6A 3CPEA 1R8SA 4C0KA 1E9SA 3LLUA 3IKJA 2NG1A 4GI7A 2VO1A 1AZSC 1RRFA 3NBFA 2IC5A 3PJRA 1YR6A 3W8NA 1DAMA 1U8AA 4DBLC 3GPLA 4B3XA 4GMDA 3T5DA 3C15C 4HLCA 2ZREA 3C14C 4I4LA 4M1OA 3ZQ6A 2GJ9A 4BFTA 3ND8A 1QVAA 2VIIA 4P31A 2QU8A 2W6ID 1J7KA 5FL7D 3QE0A 3FOZA 2KSQA 3R8FA 1SVIA 2OUKA 1DAFA 3CPJB 2C8VA 3QXSA 4XH9B 1W44A 2ZI5A 1EESA 1G8HA 1U2RA 1QG4A 3LW7A 2WSSD 4ABYA 2NZJA 1F2UB 2IYUA 1QVRA 1K6MA 3FVQA 1J90A 3S1AA 3VX4A 1W0JD 2PEYA 4P4SB 1WBDA 2RH5A 4DDVA 1Q12A 4Q9HA 2A5FA 4CEIB 421PA 2GXUA 4TTRA 1CBUA 4QM7A 4XJXA 5JWRA 5EZ5A 1W2HA 5DI9A 3KKQA 3H4MA 3BOSA 2GVDC 3U3RA 1YKSA 2GAOA 621PA 5FBVB 3K1JA 3KJIA 2QRNA 2OCPA 2VRWA 3DDCA 2GWHA 3U3MA 2ZU0C 1GNPA 3IQXA 2J5XA 2GK7A 1VYUA 1GFIA 1OKKD 1BYIA 3QIAA 3QUSA 4M9SA 1E0JA 3I32A 2JJ1D 2Q3FA 4IVPA 3SR0A 1FMJA 3AM1A 1UFQA 5IK2A 1DARA 2CCJA 1B23P 3OAAD 2R6GA 3D8BA 4LDJA 3NDPA 1VKJA 4HDQB 1VPLA 4Q1AA 2IEYA 4GDFA 4PZZA 2FX3A 3QENA 4W5JA 2QG6A 1VG9B 2QMUA 3V4RA 4PAQA 4HB0A 2YKGA 1SGWA 1OIWA 3I72A 1V43A 2GXQA 2HDNB 2A7QA 2P0EA 1Z0KA 4Q66C 2DWQA 1QHSA 3U7FB 1KIMA 1LY1A 3LY5A 2ZPTX 1W7AA 4PO1A 3I73A 2EWVA 2H16A 2D3WA 4XD7D 1XPOA 5D3QA 3RANA 2OM2A 2BKUA 4E5UA 5KNCA 4DCNA 5CM8B 3R8CA 2QEQA 2ZJZA 4MUAA 2OAP1 4IHQA 5L8VA 2AK3A 4G5OA 3IPXA 4DSTA 2BCJQ 1DAEA 3MWYW 1LF5A 5EXTA 2CNWD 3SJCA 3TRFA 4M1KA 5FR1A 4UJ3A 3O47A 1RE0A 4URVR 4OK3A 3T61A 4Q4AB 4NYIR 3GLIE 3ZLJA 5AR1A 1R0XA 4KYIB 3A1SA 1KNQA 2JJ8A 4II7A 4O3MA 3CNOA 1US8A 1NIJA 2F43A 3DOFA 2PJZA 3H2YA 1CR0A 2JLRA 1KI7A 2Z83A 3SOPA 4B74A 2QP3A 4NCKA 1KK1A 1K5GA 1XJCA 3BH0A 3RRMA 2W6JD 4IFBA 3GEHA 1OXXK 3CF0A 3FMFA 1RVDA 2ZJ2A 4NHOA 3CKLA 4LSGA 2XB4A 1KSHA 2V3CC 4B2IA 2RHMA 2ZRJA 1MV5A 5HCNA 4RY2A 4AWXA 2ZR0A 4A8JA 3QJYA 4ZPXA 4A8JB 3L8YA 2WICA 2XOKA 2QPOA 1R8QA 3EXAA 4GBMA 5CM9C 3FTQA 2DYKA 2FPKA 3CRVA 3EZ6A 3NXSA 2JIZA 1VIYA 1IXZA 1P6XA 4TMVA 1BH2A 1IXRC 3VR1A 1KGDA 1R6BX 4TMWA 1N6KA 4D2IA 1KDOA 2GKSA 4URXR 2PZGA 4D80A 1FMLA 2FMXA 3TVDA 2ZXUA 1L4UA 1YZQA 4TMZA 4CYMA 5KDOA 1LNZA 1AIPA 1KO1A 3FHOA 1P61B 1NVVR 1UADA 1XNJA 5FTKA 4DRZA 5JRZA 3ND9A 1CLUA 1VCOA 2WAYA 2WWHA 2ZRNA 5K8LA 1CF4A 3W34A 1ZNXA 4RZXA 4A0HA 2AWNA 2I4IA 3IBGA 4MDFA 2UZIR 3I8SA 3BFVA 1Z08A 3U3OA 5DYGA 4P32A 3CH5A 3U5ZB 3GJ5A 3JVVA 1W36B 3GEIA 1FUUA 1U90A 1E98A 3EPLA 1G19A 1OT3A 2PT5A 3GJ3A 4BLSA 4IDPA 4Q4JB 4LJ7A 3ZVNA 2R65A 1NVWQ 1NIPA 2FSFA 4DCUA 3RS5A 1AQUA 4JKYA 2ZYUX 5AJXA 4BFYA 2QAGA 4JSYA 4RJLA 1GRNA 2FWRA 2G1KA 1COWD 3S1AB 2CVFA 4LHZA 1WDTA 1AA3A 2G3YA 3EARA 3LV8A 2RGCA 3KTAB 3E5HA 4US0R 4WVFA 2RGNC 4PSAA 4DDWA 3K9GA 3MD0A 3GMTA 3NEYA 1NBME 1NP6A 3M0EA 2ECKA 4TLBA 3LO5A 5G3YA 4KFSA 1HV8A 3F0TA 3KXLA 5CJPA 2JIZD 3U61B 2JGNA 4V0KA 4PPFA 1JEEA 2DR3A 4U00A 4DKXA 5J4LA 2FOLA 2FJUA 5JJKA 5A4JA 5KO2A 4A6PA 2VQSA 3CZPA 4D0LB 5GJBA 3HYRA 1XX6A 1J2JA 4I1SA 1XZQA 3BB1A 3LXXA 3CRW1 5E3HA 5AUOB 3CRMA 3PV0A 5KSZA 1AGPA
chains in the Genus database with same CATH superfamily
3BAZA 3U6KA 2FW7A 4CV2A 4BGDA 1L8OA 2Z98A 4AT1A 5JFTA 1QM5A 4DIOA 1GLVA 2YMMA 2PO7A 3WADA 4YRFA 1OIVA 1IZYA 2I3BA 1VGVA 2GA9A 5KNBH 1JVBA 3UWDA 1IHYA 2YZNA 4JFAA 5H9WA 1ML4A 5B1EA 1JEOA 2CYBA 3IIEA 2W43A 1YS1X 1FNNA 3MUEA 3LWNA 3N7TA 3P4YA 4N7JA 1YVPA 4D98A 4Q1DA 4TYYA 4U6NA 1M8JA 3RBXA 1ITZA 3A4TA 2MTBA 1WY5A 4JI7B 2QVGA 4WRRA 1DKUA 1NZFA 4BIMA 4ZT4A 2E4WA 3C6YA 1SXQA 1UAAA 2RG7A 4YAKA 1OXKB 1G3IA 2WZDA 3CUSA 4HFJA 4HLDA 5LOVB 4DG9A 1XPRA 2PK3A 4CETA 3A1NA 3GRFA 3FB4A 4YK7A 2FN3A 2HNBA 1EIZA 2BBTA 1DBVO 2P9JA 1OWPA 2V4ZA 3GJ8A 4I36A 3R5KA 4H0NA 4JU9A 2B5VA 3AUYA 3A4YA 3D6TB 3S5UA 4ED9A 3SNKA 1M6YA 4AMYA 3OF3A 4QVGA 1A1VA 4OBEA 5FA5A 2HJGA 1X0VA 3FPHA 1RPZA 1X80B 3PPIA 1UBUS 4D9IA 1QNFA 1UMBA 3EQ7A 5ALTA 1TCUA 2X6TA 3T38A 5CBPB 4ZYXA 5BPHA 3O8RA 2RK6A 1KJ8A 1N2CB 4B34A 3UAYA 3CUUA 3OQOA 4KGDA 2J67A 2JIOA 2N3ZA 1A97A 2V1XA 3PUXA 4FNAA 1B0ZA 2JATA 5BMVF 3SX0A 3F3MA 1M2VA 5EIFA 5L6LB 1A7JA 4NJEB 1ZA1A 1E7MA 3F97A 2PUFA 1QLHA 2YY5A 1AKRA 3IAM6 1QG2A 1J09A 2RGDA 3NAZA 4AIIA 4BEJA 1T0PA 2GZSA 4KUEA 3A04A 3AERB 5H3CA 3U0VA 2YYZA 1ZMTA 3FVVA 2PRSA 1KSFX 4I6EA 1C9JA 3PUWA 2DG2A 2OHVA 1GP2A 2PWAA 3M2PA 1ILWA 1GZ4A 1Q0RA 4B3FX 1Z7GA 4XAQA 1Q17A 2AZ4A 2YINC 4NFHA 4Q1FA 1K8RA 5AMXA 4F38A 1IEVA 3EVFA 4D42A 1R50A 4OK5A 5KYTA 2XA1A 3EX7C 1FQKA 4QRHA 1F8UA 3ZI0A 4WOCA 2BWJA 1SD1A 3AEKB 2E48A 3EGOA 3IT2A 3K0CA 3H75A 1E79D 1KP2A 1P5HA 2Q2QA 4MIEA 2P3OA 5I5EA 3GG9A 3OP1A 3LCMA 4R8KA 1FLDA 5CNIA 2V8OA 4F4FA 1GTMA 5JO0A 1I36A 5JXGA 1AMUA 3CZMA 1KI4A 4DUZB 1Q0LA 2QA5A 4OHCA 2F4VB 1TYEB 1X3SA 1IOVA 4BO4A 1QQ5A 3HACA 3UYKA 1ZJWA 3AM3A 2A7XA 3AUJB 4QDKA 3P0JA 1YZLA 3ZXUB 3AXTA 3M9WA 1JG6A 2Z2ZA 1NKVA 2BEKA 4MTLA 4CHTA 1UCFA 4MWSA 1QPZA 2JRLA 5KYWB 1R10A 1R4MB 1TVKA 2VPZA 4NBNA 2HCBA 2C3MA 4WUVA 2CXXA 2ODBA 3NHBA 1NRIA 1T5BA 2A3NA 3A31A 4FFDA 4RPKA 1JSZA 3WLKX 3DCJA 5AICA 4AZSA 2XEXA 4CCYB 2OHOA 4GIBA 3D4LA 2P2ZA 2JJ2D 3L7LA 3PQ5A 1H2HA 3RAJA 1T0HB 3WLAA 4ZARA 2GVZC 3KEFA 4GR5A 1XRMA 4RNCA 4X8MA 2Z8XA 5EZQA 3MJDA 3V7UA 3NXKA 4DDKA 3M2TA 4IV0A 2PT6A 4D96A 4O2BA 2GBLA 3SFTA 4ZZIA 2C97A 4WERA 4H9GA 2H0AA 3LY8A 1Z6TA 4CMJA 1QK4A 2CSUA 4PFSA 3IULA 5J5AA 2BUBA 1IN6A 3B89A 3E70C 1SXJA 3EY9A 5HG0A 1XDWA 3OX3A 5JD3A 2O6LA 1A9TA 1K6JA 4CUKA 4F5EA 5K5EA 2IODA 1EFTA 4RTKA 2B2XA 2OR3A 1FP6A 2FRXA 3AYXB 2GNOA 1QYDA 2AJ8A 4Q9NA 3V33A 5K0GA 3OLZA 2PBZA 4O6VA 4MVJA 2VYFA 4J7UA 2AZXA 1ZGJA 4P38A 1EHCA 1WP9A 5DRTA 3SOOA 5GAJA 2GD6A 2WTNA 4KWTA 5JNUA 3A1DA 3SMVA 4YRBA 2TSYB 4JOCA 1KFJB 3NWJA 2ORED 1Y3CE 2DPLA 2FUNB 2N1BA 1F3OA 4LHXA 3RIYA 1JIVA 4D57A 3K70B 2OE2A 2FMKA 4RWZA 2AUTA 2AJTA 4Z9FA 3THWA 3VHLB 5GV8A 4TM7A 3DEAA 1U9YA 1RFLA 5DM0A 2O5EA 3RWBA 4HXYA 3U1TA 3R3WA 4DLVA 1F0PA 2FAXA 1UZNA 3ECSA 5AFSA 1UWKA 4QRIA 4MYCA 3ZXXA 5LMZA 4MUNA 3JALA 2VATA 4LFCB 2C4TA 2O2XA 3CE9A 1TAQA 5ALLA 2FHPA 2O8NA 2PUTA 3BMXA 2R2AA 4X60A 9ABPA 1GTL1 1HYEA 1X38A 1YUNA 4AFNA 3PHIA 6Q21A 3U7HB 5BSMA 3O4HA 1RP1A 1O9BA 4QUIA 4Z3KA 2ZE6A 4H08A 4BV3A 3R7DA 1EFLA 3LUDA 2PYZA 3KQPA 5CNMA 1DPFA 3ML1A 4IIJA 1H93A 2D54A 3KSMA 3DUWA 3ZCRA 4QDTA 1BKDR 4BNWA 2CLCX 4R6XA 4HTAA 2UVPB 4P86A 4AY2A 1I9CA 4PNHA 3E9CA 4GMXA 4DCSA 5K09A 1ZDMA 2JCGA 1BHQ1 4JBYA 2F1OA 2VT7A 3MRXA 3VI4B 3LX5A 3QBDA 4R71A 1S3GA 1U9ZA 1YL6A 3OJEA 4R1QA 5H4GA 5FOTA 1AOXA 1XCBA 1E5TA 2JANA 1YI0A 3GT7A 3HJNA 3COZA 2GYVA 4D3YA 3GL9A 1H3NA 4FZRA 1ZM3A 4HXGA 4QQFA 4FPXA 4KPYA 2GO7A 1GNRA 1X6VA 3BKXA 1T9GS 2F62A 2ZRLA 3CVYA 1T43A 1W48A 2FEAA 2QZJA 2AMJA 1ADYA 1FDVA 4K2AA 2A1TR 3H65A 4P7GA 2WYOA 5F21A 3KLPX 2DP4E 1HDCA 4ZP1A 5G0WA 3TOCA 1NW6A 3PC8A 5J43A 5CNKA 1L6IA 1QR6A 1VFPA 3A4VA 3I6MA 2I1VB 6REQA 4JQZA 3SOZA 3GLHE 3DXXA 1N0VC 1L7BA 1UKAA 4NJOA 2XKBA 3DMHA 3IEVA 4K87A 3A0UA 3LI2A 4DMRA 4EPRA 3I2FA 4BBAA 3AHFA 4JUAA 4HI0E 3RRNA 5EMMA 2OQ2A 4BO2A 2IJGX 4U5XA 1DC6A 2HBRA 1N5JA 3I6ZA 4NU0A 2BBWA 4AZ0A 4PAOA 1SQ6A 3ZNNA 2ZW9A 3P2EA 1AB6A 3U17A 3NM4A 4H7IA 2GEUA 4I1VA 2PGOA 4M55A 4E22A 2ZGVA 1XV5A 5A0TA 4Q21A 1UBLS 4PYQA 5HR5A 3X3HA 4OATA 3QTLA 3ADBA 3T6KA 3ABZA 2PFGA 2B20A 3R2JA 4FEEA 3HEMA 1Z7WA 4BMPB 2AQHA 1O94C 4WFQA 4BTLA 2A0YA 2C58A 1KS9A 4X71A 4A8TA 3P0FA 4YRSA 5ITZA 2Q99A 3FETA 4QPCA 1D9XA 1F2UA 3MERA 2P5SA 1T8YA 4EI2A 3UPUA 1Z4LA 2JGDB 1NRWA 3N07A 1MORA 4MVJD 5DV9A 3A6JA 5IEBA 1JSCA 3GRYA 4FMDB 3PGVA 5LUBA 5FWXB 2VH1A 5KI6A 4HVCA 2XSZD 2HWWA 2YRWA 3IJRA 1XK6A 3L84A 2Z04A 2QLTA 3ES9A 2ZE7A 3X1YA 3MILA 1ETUA 1M1UA 3L0CA 1XROA 1EM8A 2NZ2A 2PKXA 2Q9AA 1X77A 3OLVA 3TTUA 4NEGA 1UM9B 1BU8A 1KEUA 3ZCXA 2VTEA 5HGXA 1KI9A 3BL8A 3K1TA 3M4ZA 1LWOA 5EZSA 4LDZA 3ER9A 1KYYA 2X9GA 3BMOB 3QFSA 4YJHB 3O8QA 3JRXA 4OJKA 4JL6A 5H0IA 3BCUA 3VOTA 1G21E 2ACKA 4H1UA 4C2TA 1J2EA 3TMKA 4RV4A 4X6LA 2CXRA 1RQNA 4ZVPA 2ZI9A 3AHIA 4HF7A 1CF9A 1PS8A 3LIPA 4GD3Q 2Y1WA 5DM1A 5H8WA 1EDBA 2WFZA 2R66A 3BBPA 1C9YA 1AV6A 2H1WA 3B70A 3ZS8A 4PC1A 3IJEB 2FX2A 4FS8A 4HQNA 3I9LA 4DJFC 3WIOA 1JU3A 2EWWA 2B5WA 1Z47A 3I28A 2VDNB 4B2LA 1FUIA 3SD7A 4A0GA 4F8EA 1PJQA 3QF4B 1SU4A 3K5HA 2RGXA 5FUQA 2PRYA 3I61A 2P79A 4RL6A 2JGRA 2Z4RA 1J49A 2XCSB 3OZSA 4QTXA 3KWFA 1OI4A 4HRAA 5TGTA 1LDYA 1ZGCA 4DREA 1CVLA 2EKZA 3LQ1A 2KBEA 2GO1A 5G1OA 3SIPA 4DB4A 1EWTA 1S8NA 2FXIA 1XMIA 1DWUA 3FFXA 4Q7MB 1HLDA 3NP7A 2B5OA 4IO1A 4DEXA 3I5YA 2G08A 5ELMA 1F8FA 1WQ1R 4JJ8A 4KJXA 3QPUA 1CFZA 1DAPA 4I9UA 1SKYB 1V41E 5FLKA 4F45A 3T1HB 2ACVA 1OAKA 1EJ6A 4PPGA 3FUCA 4UNSA 4EA7A 3GD7A 4QREA 4C3ZA 4C22A 1A4UA 2GLUA 4NDAA 4D41A 1SRQA 2C94A 1N6IA 1VCNA 4L8YA 3RAPR 1S0UA 1R6UA 3SHFA 1R0YA 2DFNA 4PHFA 2YTZA 1T5SA 1LLFA 5DBFA 2A8YA 5KTSA 1QQ6A 2BLNA 2P9GA 1XD8A 3LXMA 1HSOA 1WXEA 2CHGA 2C3YA 2LW7A 1J8FA 3CMCO 2ZB8A 3CLUD 4FDVA 1XEWX 1IDOA 2EFDB 1T8WA 3V1UA 3U9TA 3G2MA 3W7AA 3VKGA 1H8HA 3ZBTA 3RS9A 5JATA 2MSLA 1UAGA 1JG7A 5K8UA 2JI9A 1Z9BA 3UCXA 3QFTA 1T5TA 2OAQ1 3F5DA 5CW1A 4R05A 3QBEA 2X4IA 4B81A 5HJEA 5KTNA 4R1LA 4S1WA 1HEUA 1Z4MA 7REQA 2G63A 4OGFA 4WCFB 3TMYA 2QTGA 2MSKA 4TYQA 2OAEA 3ZXSA 4BRUA 2G1JA 2R47A 3QKSA 4FGLA 4NL4H 1CE8A 1WZIA 2WF6A 4RLHA 1E1MA 4YLGA 3ZH2A 4BWVA 1G5HA 4J0JA 3AKZA 4KO4S 1PV4A 2VJLA 4RGQA 3V7FA 2AK2A 4R54A 2DBQA 3DKVA 5AW5A 2AVDA 4XOIA 5AJHA 5TF0A 1TIBA 2C1EA 3ADDA 4OHXA 3AY0A 3WE7A 2H92A 3ESCA 4IJUA 5EAIA 2C2HA 4LW8A 2GX6A 3V7WA 3P2MA 2PLWA 4BLOA 3ISVA 1TM4E 2QN2A 4YPVA 1PL0A 4EECA 3JSXA 3SI7A 5KSYA 5BUCA 3PUZA 4J0FA 2HJ9A 2R79A 1UM9A 4LHYA 3W0LB 3FX2A 1XTVA 3TL2A 4C9BA 1UMCB 2H00A 3PPVA 3W90A 2IYQA 5KYUA 1SPBS 3GRUA 3ZKWA 2VXBA 3FYTA 1Z0AA 3DLAA 1JLMA 3M1YA 3WNBA 1PHRA 4BLPA 1DQSA 1MC4A 3TINA 4NOLA 1GPH1 2GZ3A 1MO6A 1N2HA 4OL0A 2FEKA 4PQRA 1VJ1A 2FR8C 4CCYA 4ERXA 1SVSA 2F1KA 4K6GA 2MSNA 5HF6A 4BE4A 3T4UA 2XZOA 2X9NA 3TR5A 1UXKA 3A8TA 1Q7EA 1PVVA 4LKOA 1DAIA 1GYRA 2O7QA 3ITEA 1ZUHA 3KTOA 3R40A 4GW3A 5ENDA 5G53C 3OEHD 1NR1A 3JRNA 2PZKA 5L3RA 1N5OX 3UMSA 4HYYA 1RKQA 3QF4A 3LBFA 4MCAA 1YA8A 3PFNA 5H68A 4YUWA 3DOHA 1PR3A 3QLVA 1RQLA 2HWUA 1CR1A 4BFLA 3D5QA 4RXMA 2C20A 4P3YA 3CJRA 4LBYA 2VYCA 1TE2A 1Y0BA 2OFWA 3K32A 4LJ5A 3GVIA 3N58A 4B8WA 2GYWA 3LP6A 3OQ6A 2FZWA 3Q3EA 4RHUA 4PYRA 1SPXA 2HRZA 3ZQKA 1T8PA 3M9LA 2I4MA 4XJSA 1JQBA 4P5EA 3C3XA 1P2VA 1QS0B 2PGDA 2H07A 2EGUA 3FCOA 4EUHA 4QICA 3BQNB 3GELA 5DHUA 3KAPA 4BFWA 1M7GA 3AKCA 2PVCA 3EGWA 4RV5A 4ZU3A 2QL9A 2WWGA 1KMMA 3FNHA 2ZETA 3SY8A 2V7PA 3DFFA 4Q6WA 1ZRHA 1XFDA 2D06A 3O4VA 2A14A 5FBLB 5B1HA 2XBMA 2FA9A 1P74A 2WJZB 4FJ1A 3K5WA 2V7UA 1Y3HA 2FTKE 3ZDCA 2H4WA 2Z2IA 2FSGA 1LBTA 1QR2A 1XMOB 1PJCA 2MCFA 1GYPA 5A5DA 3ZD8A 4YV1A 1HDYA 3LHSA 4JEHA 2WG1A 4R4JA 3ZWCA 4CGZA 1YR9A 1MENA 1GPDG 3TAUA 3U44A 4N40A 4QAJA 4M1WA 2XUJA 3KZOA 5FHRA 2AD5A 4KQFA 1MJHA 3EEIA 1I4OA 4FQ7A 1DKMA 3T9AA 2F48A 1EEXB 4IDBA 4FZJA 2AR9A 3W9SA 5DM70 1P1HA 2B4AA 3IP1A 1G63A 1C3VA 1HFKA 2ZS7A 3AP2A 1G0NA 2QAIA 4RZQA 4BNZA 4CR7A 4M1ZA 2F43B 3EA0A 2APJA 3G0GA 4V39A 1LB1B 2PWYA 1RJ9B 4GL4A 3OVMA 1ZJ5A 1Z39A 2O3SA 1DC4A 2AEFA 2OV1A 3ICOA 4Z0HO 2FE4A 5M34A 3M1AA 4ITUA 4ODIA 5CB4F 1LSSA 2C5SA 2BFDB 3KNZA 3K16A 4IKOA 1W9MA 2X5KO 4CDNA 4JJEA 2X76A 3EQ2A 1RYBA 3FMGA 1W0CA 1IONA 1ZMBA 2IYNA 4IWYA 1E5LA 1MABB 1SVLA 3E0QA 4WPGA 1OAOA 3UMMA 3IKLA 5LBUA 5JXHA 3IAEA 2AIRA 1P3JA 4J16C 1KMHA 2PUWA 3RK0A 5AW4A 4RTOA 4UXIA 4ZMSA 1XTBA 1ZUD1 2WKWA 1P31A 2HLDD 4LBZA 4NE9A 4JT8A 4F11A 1P1JA 1F2VA 2P40A 1SBQA 3TGLA 3ANMA 1G20E 3BWXA 4LIPD 3IUMA 3GPCA 2C3OA 3RASA 4EIWA 3EISA 4JWTA 1DUVG 4I5DA 2QSUA 5I48A 5HJ2A 1JTFA 3HNPA 5FTWA 3AEZA 2I76A 2AI3A 3AQIA 3ZDFA 4CZ2A 1YXMA 4RL4A 4ZEOA 2QZPA 1VP3A 4Q24A 4LSZA 4TXLA 5DM2A 3LT0A 2GBCA 2YX1A 1NJGA 2C2YA 1LLCA 2X41A 2EZ4A 5HMMA 3VGJA 3W9YA 3AETA 1PKEA 1O95D 4GECA 4RKQA 5LIRA 1Z6PA 2C03A 4P2BA 1NQTA 3UWKA 4PRZA 2H5JA 1U5CA 3SBEA 1ABBA 4W8OA 4LMRA 1I4EB 1CY2A 2DTEA 2HB6A 3IAS1 3U56A 2G9RA 1NYLA 2Q62A 3KZXA 1Z12A 2QT0A 2OD9A 4URZR 4X24A 4BX2A 2OZKA 5BWMA 3KPJA 4TLDA 4FKMA 4XGIA 4EZBA 2XYHA 4Q9DA 3M4YA 1ZN9A 4MWOA 1GIAA 2H85A 1G6HA 2NXNA 4LJAA 1N3BA 4LCBA 4TWRA 2B1GA 4RCZA 5K3EA 1GKUB 1T4CA 3MRVA 1VMKA 4L78A 3DSRA 2ECFA 1T34A 1XB2A 3D3WA 3M6VA 3O7WA 5THKA 2G6BA 3QG5A 1JDNA 1XRRA 5JSYA 3AVPA 2AEJA 4DV2B 5DHQA 4C4TA 3GR6A 3HZHA 3Q9NA 3DLHA 2YJTD 1F0KA 1ZO8A 2DGDA 2OY0A 1VI5A 1VHWA 1L5RA 3ZBUA 3AH8A 1XR3A 1T2AA 4UXJA 2VEDA 3HYTA 5CHYA 2XCQA 4GOXA 5DYNA 2IHUA 1MGPA 2JZNA 4L4ZA 4URHA 3WBFA 1R16A 4JODA 1U2GC 4LNUB 2D8AA 1YAHA 1Y3FE 4MHSA 5ALMA 2DQZA 3RV4A 3VNRA 4AURA 1VHJA 3MWKA 5TX7A 3WXMA 2CV2A 3NVKI 3L3BA 1L7DA 2IZOA 2G1UA 2JK0A 3QLUC 3K9CA 2XLCA 9MHTA 1T5HX 5LOVF 2C2WA 5A4MS 4X1KB 5IXSA 4D26A 1I7QB 1T2UA 4F46A 3LKBA 3PD0A 3CJTA 1R12A 4WI1A 2FQYA 4G4SO 5JMPA 4YCSA 5KNCH 1EVQA 1RJ9A 2YXDA 2BR3A 4BCCA 4WKNA 1PZNA 3G17A 1RABA 1YFJA 1E3WB 2H63A 3ETHA 1BH6A 4BE9A 4WH0A 4ALLA 4EG5A 3SLRA 1A8HA 3T7SA 4AN4A 3RH0A 4IIYA 2POQX 1MJGM 1AGXA 4BMCA 4PZEA 3QVVA 5JJ5A 3VJRA 4HRVA 3SC2B 4C88A 3ESQA 3JZFA 3K0HA 4ND3A 2B3DA 4JUFA 1R4NB 3GLSA 4UU8A 3RSFA 4NCAA 1Z82A 3B7PA 2GCNA 2Y8EA 2LV8A 1JB9A 3FGOA 3UQZA 4QFMA 2R1VB 3B13B 4TWBA 1U6IA 1EWVA 4LXGA 3W2GA 1IM2A 4JI3B 1IJEA 2OM6A 1K6IA 2NVUB 4N5IX 4EG0A 5BWCA 4ID3A 3BCRA 5F73A 2XLBA 1OHHD 2F3RA 2RGAA 2I2WA 4LI3X 2IITA 1JTEA 3R5XA 2GUWA 3TKLA 3DEJA 1HQDA 1EEHA 1K5DA 5BW6B 4B3JA 3ECAA 4NPHA 3ABRB 4Q93A 2PH7A 4IDHA 3TPZA 1ND5A 1VG8A 5BUSA 4P5PA 2GN6A 4RFSA 3VKWA 5JI3E 1YB4A 2VSQA 3DC7A 3HJUA 1PQYA 1PIWA 4YRGA 4MVXA 4D81A 1DO8A 2WI8A 3MTBA 2P9QA 2Q4BA 5LVAA 1TKAA 2V58A 2EGHA 4QGSA 2I1QA 4DLTA 3T1TA 1KJZA 2HLDA 3O1LA 2E49A 4UHEA 4EG7A 1ORIA 1BYUA 3E7WA 1I4DD 1CV2A 5CA0A 1DT5A 4NV0A 5IKEA 1XCJA 3BXZA 3L8HA 1MIOA 2PD3A 1RXYA 2A9OA 4QEDA 5F5NA 5JCJA 3C7TA 3G7NA 4ATNA 4WIAA 4CKBA 2X4GA 2CUZA 2GZMA 2WEKA 4AKSA 2H4XA 4W5NA 5D01A 4YI3A 4GEKA 1UP7A 3RS7A 4B35A 4JGGA 1A95A 3JQAA 4HAIA 4Q0MA 2QM3A 5B7PA 1OTXA 3Q3HA 1Y7LA 2ATVA 4FMCF 1Y1RA 1GPNA 3TM4A 2P4EA 1Q1QA 3S2IA 3TR6A 2WQZA 2DBVO 4W5WA 1FC0A 4CM5A 4Y2RA 2YR0A 3R9WA 4XWGA 4ZI7B 1NJ2A 1G66A 2VLBA 1TMOA 3RS2A 1HE4A 2VCYA 1YDEA 2FGJA 2WP0A 1TD9A 3L0OA 5BOSB 1N32B 5EEHA 2EQAA 2X22A 7AT1A 2OOSA 5B53A 2Z9CA 1KFCB 2ZAOA 1E2BA 5BWNA 4NBWA 3T15A 5K0LA 4CKWB 4WGFA 5BN4B 4C43A 5A5VA 2JD1A 1ETHA 4RBNA 4LKRA 4FB5A 3EHDA 2WPDD 5EPOA 2EP8A 2XD4A 4Z9AA 1YBHA 4UMDA 5A9SB 4MP8A 4DYVA 1SG9A 1U2EA 2P5YA 2F1IA 4XTRA 5K2MA 4UU7A 4EH1A 2O0KA 4CBVA 1GGHA 1LS6A 1I1QB 2QM0A 3OZIA 1LNQA 3DE1X 1P0FA 4TS1A 3WICA 3CXUA 2MWMA 1NL3A 3WDSA 1OU0A 2HU7A 3OJ0A 4RGVA 4JL5A 1RWVA 3GLIB 2WLSA 2GPSA 3I5UA 4FNOA 1NG9A 1F48A 1NBIA 5JJLA 2IOQA 3PK0A 2XUFA 3ZD6A 2TMGA 1CJTC 3H4TA 4Y2QA 3TO5A 5DYTA 1B76A 2AMVA 2W6IA 4D4JA 2EBFX 2RAVA 3IH5A 4X85A 5SZIA 1CUXA 4RX1A 4Z7QB 1B43A 3OM8A 3SKXA 4F93B 1EXWA 4XGNA 1JDUA 1WY7A 3AU9A 4QGGA 4CT5A 3DZBA 3IQFA 4L3OA 1YQ9A 1YU9A 4M54A 3AJRA 4A0RA 2BRUC 5ECYA 1XQVA 2OP0A 4HWSA 2QZ9A 3D3WB 1ATIA 1SUFA 4YJKA 1GSAA 3KXIA 2JFYA 2HFJA 2PCLA 4PG8A 2HCRA 3FYUB 4N8DA 3B60A 2I1WA 1D2RA 3QW4B 1P6QA 3WIBA 3ZWBA 5D1NA 4UNNA 3TD6A 2CHEA 1T6NA 3IT1A 2C4MA 1ADCA 2AMYA 4UQOA 1T1GA 4MUBA 4LECA 3OT5A 2IV3A 1AU9A 2CLSA 2JIDA 3K70C 2WNSA 3W3AH 1DJQA 1TECE 1O57A 4FONA 5DT2A 4AW9A 2P62A 4KRXA 1NVKA 3C41J 4IM7A 4JSTA 3D1JA 3NNSA 3Q12A 3V6MA 5KPDA 1AQIA 1KQPA 3F9CA 1A50B 3KU1A 4HWOA 4MVJI 3CB2A 4MWDA 4BGVA 5ELXA 2JA2A 1U5BB 3HVHA 3BJZA 2IS2A 3M7IA 4LF4B 2CL7X 2NO6A 4OI4A 3OU6A 4F4UA 5AESA 3GROA 3ZCQA 4C7XA 1V16A 2AW3A 3H7AA 1I6KA 4LJ9A 2P9YA 3MHTA 4RIFA 4EARA 2PT7A 3N7AA 4GX5A 1Y81A 3CF2A 3E2PA 3E7FA 3HDGA 1I10A 1GU0A 3K09A 3A6GA 1XTRA 3DM9B 1N9GA 3RSHA 3LY9A 5CB8A 3DT9A 1USUA 3U3DA 1BFKA 4OIFA 3G88A 5EUQB 3PPWA 2IH5A 3L01A 3T9BA 2R7MA 3B9BA 1W36D 4ND8A 3WRYA 2JFNA 2DF8A 2GS9A 1E4YA 2O0LA 3W79A 3LCVB 3MT9A 5EXDA 4HWGA 5E1BA 2Y66A 3CBQA 1UMCA 2GTPA 1Z17A 3H84A 3QU4A 1B41A 1KZ9A 2IRWA 2ANCA 2CDAA 4RM3A 1Y8RA 5KTMA 3IKTA 1R7RA 3R7NA 3S2FA 3SFZA 3OE4A 3SYMA 5BVGA 2XIQA 1IIRA 10MHA 1ZESA 5JIBA 2NYUA 4MVJP 5C8YF 2IH4A 2P68A 4RKYA 5JDCC 1UXIA 4CU5A 1XRSB 4QECA 5FTLA 2C4VA 5EG5A 1OXSC 4QJ5A 3TZLA 3NIDB 2FXVA 5FOXA 3H1TA 3DE6X 1YE8A 4BATA 3TEMA 1U8TA 2VFAA 3FPSA 4AJ2A 2IS4A 1M75A 4FK8A 1FXSA 1W47A 5BN5A 3W6UA 1JKXA 1QAQA 2RHGB 2IYWA 1Q1GA 4RMGA 4YASA 2ONZA 1HDOA 3DHEA 4AICA 2UXDB 4MV4A 3RC2A 3K6RA 3CN7A 3LHDA 4ISCA 4BMYA 4LISA 3QNUA 5A2GA 1ZJ6A 3DCIA 2VBCA 1L5SA 2YDXA 4OI0A 1UKEA 1GG2A 3CNEA 1ODJA 1IE3A 3WRXA 2C0QA 3BE4A 4HNGA 4DXDA 1I5EA 4ZVOA 1YIDA 1GEGA 3M1IA 2BKLA 1VTKA 1UXJA 3BJIC 4EDHA 1HQCA 5AOCA 1OLOA 1EK5A 1L5FA 2GN4A 3K53A 4AO6A 2GN1A 3KDPA 3DCYA 3GNLA 5B1SA 1PCXA 2V6BA 1GQRA 4PG7A 3RWOA 2PCJA 4DSZA 2BSQA 4QT0A 3U3KA 1A8IA 2ZRQA 1U3WA 3HP4A 1JF8A 3CE6A 4MB0A 3MB5A 2J3KA 1JWBB 4GP6A 4CLOB 1U31A 4EZEA 2VF4X 3RUPA 5C2JB 2AEMA 3FGZA 1GGNA 3H9GA 4M60A 4TV8A 2P7IA 5DOZA 2QP4A 5SYNA 4B83A 1K7EB 3AESB 4LXTA 2V6GA 2QP9X 2XVMA 4K9KA 2QRZA 4FMCB 2JRBA 1GTVA 1QE3A 2C2GA 3BH6A 3CM0A 4NS4A 4R0VA 4WXYB 4PR0A 1EXMA 4L22A 2FLKA 1X8KA 3BG5A 1Q0ZA 4XSGA 4EPTA 2LPMA 2QD5A 4E7OA 2BTEA 1ODFA 2ODQA 1TU4A 1NX6A 4CMCA 1ODLA 2ID4A 1UR5A 2R1TA 3QM1A 3G1UA 1EFKA 3Q5GA 5SZKB 2QGZA 1U0HC 4YQZA 1ZD1A 2VZEA 4FHDA 4LYJA 1U3CA 3FUTA 4LC0A 1NXTA 1UC4B 1J8QA 2FEWB 1I2MA 3DEFA 2EAUA 3RS4A 1M67A 2VDJA 3RTDA 4K0KB 4XDYA 3WHLA 1G21A 4WOJA 4F4JA 1XO1A 1ZS9A 1R3UA 3KHTA 1XTKA 1JPVA 1CVIA 1N5IA 1PW7A 4NCIA 3TLZA 4EHKA 2F00A 3FJOA 5JPDA 1U6JA 4ID9A 1HDXA 2FN8A 5KTTA 5DHAA 4FILA 2YOHA 4ZJPA 2FG7C 4TKUA 5AUQA 4XOUA 3NMUF 1REQB 4E1AA 2YJ3A 4MWTA 5K0TA 2Q5HA 5LLSA 4HYQA 4JU8A 1WMFA 3BK2A 3FLEA 3IP6A 3SIRA 1YV9A 4RDXA 2FPGB 2P2SA 4LVNA 2ODWA 2DQKA 4JVNA 4ZQEA 5JYBA 3ENKA 3RNOA 2CJWB 4LF8B 4WOKA 1T6ZA 4NMMA 4U3JA 1Z63A 5EE5B 1V7CA 2PFKA 4MB6A 3VSBA 5F3DA 2DBYA 3GB9A 4FFMA 4ZYZA 3MOSA 2G7ZA 1PT8A 2YMLA 5CTJA 5DHRA 1WEKA 3SHVA 4INOA 3W7VA 1AXRA 2FVXA 1NULA 4U0JA 4K9RA 3DB1A 4DGQA 4JH0A 5LD2B 3F49S 3LCJA 4YUZA 2OHFA 4MPTA 1G2OA 2YICA 1OUMA 3FBTA 3O8NA 3A25A 4I4NA 4OHVA 4RVCA 4ZOLB 4LCJA 5JNWA 3B48A 1V5WA 4KPGA 1NZJA 3H83A 3I39X 3ZUPA 4OLFA 1NKSA 4B47A 3STYA 1P17A 1PFGA 3RVOA 5JAQA 4Q9IA 4HOYA 1GSOA 4RVGA 2BTQB 1WHTB 3C1TA 1QF7A 4A26A 3TFOA 1OH7A 1L0BA 1VIDA 1LTHR 3S3TA 2Z58A 4B71A 1TZ2A 4BQPA 1P44A 1HNXB 1KAHA 4OQEA 4MO9A 4ZAGA 5TPZD 4QHSA 4LZOA 5D7NA 3V48A 3F5QA 1A04A 4GYKA 5IRCD 3NEJA 4HTFB 2R7KA 3G8YA 5F9HA 4MB2A 3VR2A 4GL2A 3RVPA 3RK4A 3URMA 3AKYA 3DZ8A 4KW7A 3IEUA 1UAYA 1R8JA 4WZAA 1DO0A 4PC7A 3ISJA 4INJA 2OCAA 5KREA 4C06A 4CMKA 3WQRA 1B7GO 2AOVA 3L4BC 4PZPA 5KVVA 4I8XA 2WJ4A 3KVOA 4I9HA 3TXYA 4L5YA 3WIUA 2OO7A 1EZ1A 4RELA 3M6UA 4ZI2A 1SVNA 1TO1E 2P9ZA 2W9XA 3GFGA 3H11B 4FIDA 4LHEA 3HFRA 4LOAA 4NWIA 2IEZA 4YP7A 1J5PA 1W85B 1IXKA 4K86A 4PZLA 4M1QA 2CMHA 1JT2A 3A4LA 4YJGB 3FPAA 4QHTA 2ZVDA 1V45E 3OZFA 2AKYA 1SCJA 4KR3A 1KHHA 2EGGA 2OUIA 3IAAA 1P4JA 1E6MA 3PLRA 5BYJA 4OHBA 3WMRA 5A7FA 2JFOA 1R15A 1OPXA 4MLDA 3LFHA 3OI7A 3DE5X 1IUNA 1WQ3A 3LT1A 4JR2A 3N86A 3IDOA 2J4CA 3MPOA 5KJ6A 4OLHA 1N4DA 3GRKA 2KM1A 3UAVA 3TW8A 3QA9A 2CVHA 3G9XA 3HHEA 3GMSA 1M6WA 4FMDF 3BCSA 3TN7A 4WZZA 2HUNA 2WUGA 2Z8ZA 4ICIA 3JARA 4RGBA 3JQFC 1AQ6A 3UJ8A 3BTOA 1GPUA 1K2WA 3GCXA 4KAAA 1NI3A 4N0QA 4OG2A 5J2UA 1MO5A 1TUEA 3HYNA 1A1SA 3ZZMA 3I6QA 4IAOA 4B73A 4DBLE 2GF0A 4S0XA 3WJ2A 4R0MA 4JC5A 3OSZA 5K4HA 1AH2A 1EI9A 1X7HA 7REQB 2ZUVA 1MAAA 4OOFA 4JWKA 4QA9A 1Y4UA 1H8ED 2GJ4A 2YHSA 1KBOA 3HXLA 4PG4A 5TMEA 1WQ4A 3T52A 1HDIA 3EQ9A 3K09C 4MKFA 4UM9D 4RKRA 3IAXA 1DRKA 3RF6A 1Q2UA 3S2SA 4XM0A 1XZCA 5EHZA 4K9DA 1CUYA 4CR8A 3BB4A 1RHQA 4BNNA 5HKLA 3ORFA 1X14A 1QLWA 2FSIA 2OHXA 3RABA 1QOQB 3DTVA 4URYR 3CLRC 2ZUCA 1HLPA 3H1PA 3Q5EA 1ZYUA 4KVFA 5I9TA 1PNVA 3KZVA 4LF9B 1EFHA 3IAM1 4OQMA 1VMAA 5LPNA 5AK0A 4OPMA 4GSKA 2JASA 4NYJR 4GICA 3GGDA 3UH0A 4Z6KA 1EFUA 2VDWB 4QTYA 5L51A 4RPIA 3I2JA 3N3BC 4LV6A 3C16C 4JKIA 5EZYF 2QLBA 3AESA 1FA9A 2QRVB 4BRWA 1M34B 2DBRA 3O2JA 1T1JA 2I2FA 4KVGA 2EFHB 1NFRA 2FRDA 2ZUBA 5FI0B 1YGYA 3VDXA 1ECGA 1L8XA 1SC3A 2QBYB 3W5SA 1H2YA 3U4QA 1DJOA 1A88A 4D5EA 3ZJTA 1G9XA 1USWA 2QOEA 3LSTA 2W2PA 2XB6A 4Q3DA 4A6EA 2XGJA 1WZEA 3O9MA 4YFVA 4IIHA 3ZE8A 4K1LA 4HAZA 2R8EA 2WFLB 3G5UA 3VKHA 1H2RS 1Z75A 3LE8A 9ATCA 1TIPA 4KH1A 2P11A 2E18A 2JAWA 1PAUA 2AUNA 2NSDA 3VO8A 4AK9A 1HO3A 1ZAKA 4MUYA 2C2XA 2ZJ4A 1DLIA 1BS1A 1H9BA 2BFBA 2I0FA 5GQSA 4G0ZA 1XEAA 5KYKA 3I8XA 3OKAA 4W5OA 4XQCA 1TLFA 1FDUA 1U1CA 3H1EA 5EJ4A 3P4XA 1BA3A 1D0VA 1QHHA 3NAQA 1HZJA 4QIHA 1N5RA 1DJLA 1II9A 3E1KA 4EDFA 5C1BA 3VSEA 3WRWA 4P3XA 2F9LA 4AS1A 1GXSB 4YY3B 4G1UC 5FEMA 1PTJC 3AF6A 4RKWA 2WINI 3KALA 3TWOA 3I42A 5JAHA 4HAUA 4D3ZA 1T9GR 3PJFA 4LRWA 4EG6A 4P4NA 2PG3A 2EG5A 3O4IA 3ZWYA 4UARA 5KTRA 3AF5A 3KJEA 4IH1A 3WZLA 5B3LA 1C0PA 3PDIA 3WK9A 4NVRA 4IO0A 2TMDA 4B4UA 1FFHA 2VP0A 2IDJA 2XMSA 4DMMA 2HF8A 3SDBA 4B84A 3KQVA 1F14A 1DVRA 4IOLA 1M0SA 4XDZA 4ZCPA 4ZVLA 1T8TA 1MQ8B 1PNOA 2PM8A 1S2DA 4JT4A 3E3NA 4NQRA 4PC2A 1Z6XA 4F7DA 1AKMA 3OZVA 2C59A 4ZZ0A 4KP7A 3CEPB 4ZKDA 2J41A 4GGMX 4J4HA 4XXHA 5EHNA 4AKTA 1P2UA 2VH5R 4IIVA 3ZD9A 2CUKA 4P83A 2O8DB 1VSBA 2B4TO 3ZE7A 5JALA 1OXMA 1PX0A 4EUEA 3TX6A 2AHOA 3GLHA 4FDMA 4JLOA