2ZR9A

Msreca q196e datp form iv
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
327
structure length
312
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINELRTTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
total genus 100
structure length 312
sequence length 327
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr9A01
2NPFA 3NEYA 1SVKA 3NG1A 3TW4A 1NG9A 3W9YA 4S35A 1RC8A 2YWHA 1U98A 4PC3A 1BIFA 4D0GA 1A5TA 1TPZA 1UKVY 4TTQA 2AD1A 2ZS7A 1T6NA 1W4AA 2NGRA 2QPTA 2HT1A 2AKAB 1E1QA 1T8TA 2GETA 5JLJA 2HCJB 4DSTA 2BJVA 1T91A 2GDJA 2IS6A 3QY0A 4XTCS 1FTNA 3RS5A 2G88A 2HJGA 4WXPA 1A82A 1G7CA 2XSZD 5CM8B 3FFBA 3Q8XB 1ZM7A 1P3JA 2FSHA 1XB2A 4RD0A 4BLRA 3PEWA 2IYUA 3THYA 3C14C 1G6OA 1I4LD 1PUIA 2C98A 2QY9A 2W6IA 1PZNA 3OIUA 4KI0A 1RIFA 1KTVA 5FI0B 2ZUDA 3FMPB 1FUUA 3CM0A 5DN6D 5DISB 1KHTA 3VR2A 4PXAA 4TYPA 4V02A 5JSZB 2AXPA 1CU1A 3NHAA 3OEHD 1MRNA 1Z8FA 3KUDA 4MYHA 1GM5A 3AVUA 3U44B 4NKRA 1N5IA 1RRFA 2J59A 5FBQB 1Z5ZA 3FE2A 3DMDA 4OK5A 3U5ZB 1SGWA 3A4MA 4M9SA 2YWGA 4M4SA 3SYNA 4GL2A 1N2CE 3R9XA 2O0HA 2VF7A 3L0IB 5TB5A 4PPQA 1G21E 1G4AE 1ZRHA 2QMOA 2A5FA 1N0WA 1BH2A 2HLDD 4XSGA 2H57A 2DWPA 4PC6A 1TADA 1N5KA 2VHUA 3P32A 4IDHA 5FTJA 3W34A 3WYAA 5J4LA 2PEYA 3KKOA 3ZZUA 1QRAA 4TWZA 2JLVA 4ZCLA 1F48A 4KCGA 3OE7D 2X8AA 3QJYA 4IEIA 2MSEB 1XTKA 1UBEA 1M2OB 1TU3A 1NN3A 4D4MA 2NO6A 3KJGA 1DAFA 1XTSA 3E70C 3PITA 2G0TA 2JDIA 4URUR 4FMCB 1TQ4A 1G5TA 1YR8A 4OQMA 4YMWA 4PSVA 3RC3A 5L3SB 2R9VA 2RGGA 1U0LA 4EAQA 2ZRKA 2R2AA 1OXUA 2RB4A 2IYSA 4QKQA 2IEZA 1ESNA 2ZETA 1OF1A 1UM8A 2GBLC 1MO6A 2WWIA 3I5XA 2ZM5A 2AXNA 1DS6A 521PA 3T12A 2PT7A 1NMXA 4B3CA 4DC9A 4POAA 4M21A 3D7MA 2FGKA 2ZTSA 4TZ0A 2AWOA 3BH7A 3QBVA 2CLCX 1TQ2A 2BEKA 3K0EA 4ESVA 2J9RA 2ZRHA 1RE0A 3L0SA 3WNCA 4DCNA 5JJIA 1EFRD 1YZUA 2GK6A 4XSHA 2C77A 3W6PA 1NN1A 4EDHA 3PENA 4II7A 3CR7A 2IUUA 4Q4AB 3X1ZA 3TQCA 3CZPA 2XOKA 4Q1AA 2OAQ1 3QKRA 4NYJQ 4Q1EA 3BS4A 1JXMA 3SBDA 2AK2A 2CDNA 2FNAA 2ZI5A 1R10A 2W2TA 3QXSA 2P6UA 5FBWB 2CEAA 3LX5A 1GVNB 5EE1A 2WMNB 1QF9A 2C95A 3PEVA 4DUGD 3CNLA 1AKEA 1WA5A 1FOEB 3H0KA 3EZ6A 4JLDA 3TBKA 2YOFA 5DYGA 2JEOA 3KXKA 4QBIA 2JJ2A 4Q19A 2I4IA 3S1AB 3SJCA 3Q5EA 1LV7A 3WNBA 4A1FA 3CNOA 3DPUA 2P67A 5FPHA 5JBQA 2Z83A 4Q4HA 3EA5A 2IT1A 4KLZA 1GOTA 4IEEA 1YQTA 2XJ9A 4L5BA 2DR3A 3HR7A 3NTUA 4JYCA 3NDBB 1AS3A 2CE2X 1GIAA 4Q9KA 2CVFA 3QVUA 1W4CA 2ASEA 2ZRJA 2QQ0A 3AF2A 1OHHD 3SR0A 2QAGB 2P5TB 2VF8A 4QGAA 5SZIA 2FEMA 2RH5A 4I1OA 1BMFD 3I4LA 5E7IA 4WA7A 1CJKC 3UMSA 4ZIRB 4MDEA 1P9WA 1XMJA 2I1QA 3CZQA 1OFTA 1AGPA 1NVXQ 1QVAA 2WJGA 4MGKR 4P4SA 5HKKA 4OHYA 3MUFA 1JPJA 4D4LA 4A2PA 4L15A 2V3CC 1IJFA 1YZGA 2KBFA 2IYQA 4IVRA 1Z6XA 5FL7A 2JLQA 3LBHA 2E9SA 4AY2A 5A0FA 2ZR0A 5B2ZA 2DFTA 1X8JA 1WCV1 4HSEA 3B85A 3FHOA 4Q02A 1K8RA 2BV3A 3I8XA 1N25A 4RSGA 2JLRA 2ZJ8A 4BZQA 5JHGB 5H8WA 4B2LA 4JLVA 5D3QA 2JJ8A 3ZQJA 4QJ3A 4MKFA 1QHIA 1SHKA 3BD9A 1R8QA 4TLAA 2BKEA 3C8UA 3OIYA 1LNZA 4JIMA 2WKQA 2ERXA 4LBZA 3RRNA 4HAWA 3PJRA 2X19A 3WRYC 2IXFA 2VHQA 2ZI9A 3PUXA 3B1VA 3KFVA 4XD7A 2ZS9A 1SKYE 1QHSA 1AGRA 1XTQA 4AD8A 4CRWB 2GCNA 4Q1DA 4JVMA 5G41A 1KI2A 3AGPA 2R6CA 1HEIA 5HZHA 1PLJA 2IXEA 4PZZA 3B2EA 2FOLA 4CZ2A 1G64A 1IXSB 4OK6A 4LJAA 5J40A 3QENA 4YC7A 4TSFD 4LY6A 2ZU0C 4MGZR 3T61A 1D9ZA 2Z43A 4EJSB 2OCBA 1CJVC 1G8GA 2A3RA 1DPFA 2IYRA 2XTMA 3IIMA 3NHBA 121PA 1BO6A 4Z54A 4K8OA 4O2RA 2ZI6A 4P3YA 4OKSA 1JAHA 2WJYA 2FU5C 2QE7A 3I32A 4NE2A 2HLDA 4BZPA 3ZIAA 3DZ8A 4IDPA 4M9QA 3QSYA 2J5XA 2D4HA 3GLIA 1Z22A 2QTVB 1VYTA 3O8DA 3OFND 3MWJA 2DFNA 3GEIA 4QG7A 2LKCA 2RHMA 3VMFA 2FN4A 3SJBA 2A5DA 2V55B 1P7CA 2F1IA 3PXGA 4GSYA 2ZROA 3VR6A 4TZ6A 3FB4A 3GCGA 3KQLA 3SFZA 4OI0A 1G8PA 1KI9A 5JEEA 1AM4D 1ZUIA 5KHOC 8OHMA 1T4GA 5DI3A 3EG5A 3QG5A 2FSIA 3TSZA 1VHTA 3QKTA 3SN6A 3B5JA 4EFLA 4PQFA 1RRCA 4LC1A 2PLFA 3FDIA 2PX3A 3BH6A 1KSHA 3WHKA 4PHGA 2IEYA 2VP5A 3D31A 1D2NA 4JL6A 4IXMA 1F5NA 2WVJA 4DSOA 5BYJA 1SXJB 4FMCF 3F5FA 5FTMA 1J90A 1D8TA 1OYYA 3ZD7A 1FTSA 1CJTC 5CB8A 3ASYA 3A1VA 2HYIC 3VFDA 2FZLA 2WZQA 3K0SA 2QROA 3B1XA 2FA9A 3X2SA 5L3QB 3U3MA 1LB1B 1DADA 3THYB 1GFIA 3AF3A 5FR1A 1ZMXA 4BFVA 1EFRA 4AYWA 5KDDA 2PZFA 4YXWD 2RHDA 1TMKA 2BBSA 4M1KA 4CIDA 3WHLA 5EUQB 3HJNA 4TT3A 2IYTA 4AG6A 5FTLA 3RYTC 1L4YA 3DKVA 4DLYA 1UJ2A 4KV9A 4YDSA 5UKDA 4C2TA 4AI6A 5SZJA 2XB2A 2BBTA 1KAOA 3QIAA 4MDFA 2A30A 3EWAA 5EE5B 2ZAMA 1ZIPA 1FMJA 3EARA 1WE2A 3F8TA 5E3HA 2JAQA 2FMXA 2BIFA 1M7BA 4KFSA 1E2DA 5LPNA 1CIPA 1E1RD 1K6MA 4N0EA 1EFCA 1VCMA 3SC3A 5FH9A 2FFBA 1OFHA 1YZNA 4DEYA 2QZ4A 3X1XA 3U4QA 1UAAA 1RJ9A 3MGCA 5KNCA 2ZSAA 4IOMA 3KJHA 5HE8A 3RS7A 4LRWA 1AK2A 4LSGA 1LW7A 1SVWA 2NO1A 2G9NA 3IEVA 1G5PA 1Q3HA 3RC8A 4B32A 3ONWA 2VYFA 1G3IA 1R0WA 1XJQA 1FUKA 2C9YA 4DEXA 1MV5A 1OFIA 5CIQA 4JZKA 1WXQA 1PLLA 4GT1A 2XAUA 3B1YA 1E94E 2ZJZA 1XEXB 3QXJA 3ZJYA 2BEJA 4ERNA 3P4XA 5EE3A 2IS1A 3SJAA 2ZYUX 2VP9A 2G0NA 1EFTA 5GJWC 1FNNA 3ZZ0A 4BLQA 4ACAA 1FQKA 1DE0A 2WJIA 1KAGA 1OYWA 2A78A 1W36C 3EZ2A 3WY9A 3THWB 2BCJQ 4PR0A 4JYBA 4TLEA 1NMZA 3GLGB 5J4VA 4UJ5A 1X1RA 1XTRA 3I1FA 1F2UB 1VTKA 2QG6A 1G3RA 2PJRA 3BFVA 4UKDA 4KO8A 1QHHB 1E32A 4Q47A 3UG6A 3WBJA 1Z0JA 1YZTA 2H5EA 2R8RA 5HTKA 5JMTA 4DLRA 4DHEA 3TJZA 4M0LA 3VKHA 3UMRA 1YU9A 2ZJ5A 1HH4A 3IQWA 1Z2CA 3KZ1E 1KI3A 1LS1A 4IW3B 2FZ4A 3AEZA 2FFQA 3DVLA 3LA6A 4JLNA 3TUZC 3KKNA 3AF0A 4RD1A 5JWRA 2QU8A 1G20E 1U94A 4PQRA 1S0UA 2W2XA 2KE5A 5LB4A 3IGFA 2GF9A 2BMDA 1Q0UA 1PV4A 3SYLA 3ADDA 4PO8A 1JJ7A 4LHVA 1HE8B 1LTQA 3GD7A 3LXXA 4BFYA 4B3GA 3GMTA 1NI3A 3KQHA 2ZE7A 5TY0A 4EPXA 2EYQA 4ASUA 2MMGA 1N6OA 3WXMA 2P65A 3A6PC 3AP3A 3MMPA 1Z47A 1HTWA 3HYRA 4M53A 1JR6A 2VLIA 3KXIA 5DIFA 4G5RA 3M1IA 1CR1A 5H68A 4D4KA 3TNFA 1OH5A 3WMGA 3AKYA 2GEDA 1S1MA 3GP8A 4LJ8A 1W36B 4AURA 2W6JD 4HUTA 5CB6A 4PQYA 3GEHA 1R8SA 3T1TA 3RAPR 3K09C 4M2LA 1TUEA 2A5JA 2GAAA 2JIZA 1II0A 3KDSE 2Q9CA 4LJ5A 1AS2A 5FR2A 2OLJA 2WIBA 4JBWA 3IBGA 4OI4A 4BFUA 1R6BX 4H1UA 1ZNZA 1QBKC 4NDZA 1G7TA 2JA1A 4PAQA 5EP3A 1SXJD 2BHRA 2QMUA 4QHTA 1Z08A 2OFOA 2VSXA 1CKEA 1NRJB 1VKJA 1EESA 1VYUA 2PMDA 2F43A 5FUXA 3V4RA 5C2JB 2D7DA 3DHWC 5C4GB 3MCAA 1E2QA 4MGYR 1H8EA 5JCZA 5KOYA 1OH6A 3ND8A 1ZCBA 1D5CA 1JBKA 4FWIB 4PC2A 2PX0A 1E2HA 5GVRA 1QZXA 5DHFA 4IOLA 1W46A 2X2FA 5LD2B 1VG9B 1KNQA 3TW8B 3FGNA 3NC0C 2BMJA 2VSOA 1WQ1R 4L9WA 4B44A 4A8JC 2ZRAA 4A2QA 2JLXA 4TLDA 3ETLA 2E1RA 4D81A 3FMOB 3PQCA 4GPTA 4JLBA 3I61A 4NP6A 1G1MA 1ONBA 5K8UA 1UF9A 1SVOA 1IOZA 2GCOB 1JEDA 2NO0A 3PUZA 4FW9A 4YQFA 2GXAA 1E9CA 2ZSDA 4TYWA 1KJWA 4YXWA 5AUNB 4HB2A 5EXTA 4V03A 4BFSA 2OBMA 2XZPA 1Z83A 2IL1A 5EP1A 4C0KA 4M1MA 3T5GA 4A6XA 2AK3A 2VHJA 3VTKA 1ZM9A 4RCZA 3K70B 2WBLC 3BH0A 3PCRB 2GJKA 2GILA 3AB3A 2QUZA 3NWJA 2J0UA 4ABYA 3RHFA 3HU3A 3KQUA 1WB9A 1FW6A 2UKDA 3FMFA 5K8IA 2ZRLA 1Q57A 3KXLA 1G7RA 4IFBA 5BXQC 2ZAOA 2BM0A 2GAOA 1W48A 2WJVA 1VCOA 3GJ8A 1COWD 3UMFA 2O8FA 1UPTA 3HYTA 3GLIB 3DOEA 4MRRA 3O8CA 2ZEJA 4Z8YA 2VO1A 2ZPTX 4AKHA 1YHNA 4PPNA 2AFIE 4EPRA 2ZJ2A 3I62A 4M1OA 2O0JA 3I3SR 4MKGA 2WSSA 5IT5A 2GHIA 2Q9AA 1G5RA 4LJ9A 5DI3B 1XF9A 1MO5A 1GRQA 1L8QA 2JASA 1ZNWA 3B1ZA 2O8EA 1VIAA 3GJ7A 2D06A 3AGQA 3GJ0A 4G5OA 1OIVA 5KUTA 3BORA 4CEJA 1R5NA 2WKPA 1ZC4A 3HP1A 1H65A 3TQFA 3HR8A 1MOZA 1UDXA 2WWHA 3UANA 2MSDB 4JT2A 5GADl 2X2EA 5FOXA 3CX8A 4ZKDA 4HB3A 1TTTA 3ADCA 1D9XA 2F1RA 1NVWQ 2QENA 2VPPA 5FUWA 2D2FA 1GL6A 2EFDB 1E2GA 3BC1A 2J0VA 1NBMD 2RGNA 1GITA 2ZSBA 4BPBA 4QL3A 1Q1EA 2GNOA 3FKSA 2OESA 1ZM4A 1JPNA 1YZQA 2YINC 4YMSA 3LD9A 5EXXA 4G1UC 1VIYA 4JSYA 3K9NA 3CWQA 1XCPA 1VG8A 3IPXA 1M6NA 4DB4A 3KFXA 4FI3C 4AC9A 1S3SA 2CLDX 1FX0A 3CRQA 4QRHA 3EXAA 3CBQA 2QL6A 1VYVA 4M8NE 2JJ1D 1W36D 4N0DA 5EUMA 2ZE8A 3GFTA 3H2YA 1PLKA 2Q9BA 5GVSA 2ZRPA 4HAXA 4PC1A 4TL8A 5FFMA 4ZDKA 2P3SA 2F9LA 3AV0B 2FGJA 3U4QB 2RAPA 3NH9A 4HAYA 4X8OA 4OQNA 4QJ4A 4NZYA 2CL6X 2EVWX 3HPRA 2CHQA 5HZKA 1EG7A 2G83A 4CEHB 1ZC3A 4JBXA 3LY5A 3KJEA 4TL6A 1T3LA 4FIDA 4BWYA 5EE0A 2ZR9A 3CLVA 3QKUA 4IXNA 1P60A 1JB1A 1P75A 5FTNA 2O52A 3DO6A 2J0SA 1SKQA 2ZITA 4DCTA 4JLOA 1G291 3ADKA 2KI5A 5BN3A 3TR0A 5DSZA 2P5SA 1MT0A 1KO4A 4EUNA 1G41A 3KTAB 3CPEA 4W5JA 3R9IA 3M4YA 5IRCD 3SFVA 4DXAA 1Z6TA 2O8DB 2XB4A 4NL4H 1EX6A 2ZUCA 1NJFA 2RGXA 5CLQA 1U2RA 1EGAA 1KI8A 4LK2A 2ZJBA 2ERYA 2XXAB 5EE9A 3BIFA 1C1YA 1J99A 5J4HA 3QXHA 3K9GA 1JQLB 4LWZA 3SJZA 2HEIA 4LJ6A 1CF4A 3QF7A 5FOTA 1MABA 4NYIQ 1SVSA 1W5SA 3C4JA 2I1VB 4UQOA 1OXXK 5DE3A 1NVVQ 4B43A 1XJ0A 4Q5IA 4ZV4A 4OHXA 4Q9HA 4A2WA 4B48A 4C0JA 1PVOA 5CDFE 1Z07A 4JLJA 1WRBA 1II8A 3FPAA 1E0AA 4KVGA 4RD3A 1ZD8A 1F2TA 3QXCA 4LPSA 4A0GA 2Z5FA 4IRUB 3NH6A 4TQ9A 3GJ3A 3CUEF 1GAJA 3C16C 4PTLA 2NMVA 4R2IA 4RVCA 2ZSFA 4LHXA 2ONJA 2C03A 4HLDA 2ZRFA 2PT5A 4ZPXA 4BFXA 1DEKA 1LF5A 1N0VC 1TAGA 2TMKA 1GL9B 1Q22A 3IUYA 2O5VA 3I72A 5TMPA 2ZJAA 3A1TA 1TEVA 3K0CC 3F0TA 4G5GA 3TKLA 4US2R 4O3MA 1KI4A 3CH4B 1RKBA 2QP3A 2QSZA 3BFXA 4NCIA 2QAGC 4NH0A 4BZXA 3A4NA 4DKXA 3IEUA 1Y3AA 2IYYA 4KODA 1MRSA 2ORVA 1FP6A 3W5IA 1TF7A 1U9IA 821PA 4BFWA 5J4KA 3TGPA 5KTYA 5EP4A 2KJQA 2XZOA 2REBA 2GKSA 5EP2A 1E2PA 3V00A 1E2KA 4LBVA 3K9HA 4MGIR 1SULA 2ATXA 1AZTA 1OW3B 3P1JA 3BK7A 4BRUA 4D0NA 1HE1C 5KSYA 4CGZA 3ZVNA 2GZDA 1KK1A 2NO7A 3E5HA 1NLFA 3A58B 4KYIB 4EFMA 3M6AA 2J3EA 2NTYC 1NP6A 4LI0A 1NJGA 1G6HA 3IILA 1EK0A 2J45A 2IBMA 4WOPA 2P2LA 1NSTA 4LYJA 4TMVA 2ZYWX 3H4MA 4Q48A 2B6HA 4PPFA 4HLUC 4RD6A 5AR1A 4LYFA 1M74A 1E9DA 1W0JA 1GP2A 2DPXA 2KBEA 2GWHA 3DDCA 1O87A 1ZD9A 3KKPA 3AUYA 4C0BA 4C7OB 1E69A 3A1WA 5KNDA 3ZVMA 1S2MA 2VRWA 2RCNA 1FL9A 2YC4C 2CNWD 1S9DA 1KMQA 3AKEA 4UNPA 2WWGA 3U3OA 2DFKB 4JLKA 5BWMA 2C96A 3VX3A 2QBYA 5JRZA 3Q72A 1KY2A 5LB2A 5KU1A 4TTRA 1XPRA 2XZLA 4PSAA 1NBMA 3DMNA 1NIJA 4Q18A 4AKGA 1Z0IA 4PAMA 4C0LA 4XVUA 3TH5A 2GJSA 3OIWA 4EKDA 1S1CA 1UBCA 1DO2A 3NBZC 3QEJA 5JEDA 1G17A 1YJ5A 4X8MA 3GFPA 3QKSA 1ZU5A 1Z0FA 3NVAA 1XEFA 1ZP6A 2V7QA 3IO3A 4IOKA 5F2EA 2ZRNA 4MH0R 4EJSC 1JR3D 4AKIA 2YOHA 4WVFA 5CK4A 2J0UB 2A5YB 2GZAA 2VH5R 4O0MA 3OEED 1ETUA 2OBNA 5E4FA 4US0R 2FDCA 1QHYA 5DLQC 3KL4A 2CE7A 3GLHE 1E98A 2O8FB 4U02A 5IK2D 3LXRA 1NVVR 1ZIOA 4NPHA 2ZJOA 3TAHA 4B6FA 1RRGA 3G5UA 1BKDR 1KIMA 1R0ZA 3LVQE 5JECA 4FD2A 4GZLA 3HPQA 1KI6A 3MJRA 2J41A 2ANBA 1KO1A 2ZANA 5KO2A 3BB3A 5AUOB 2X1VA 3L0PA 1W49A 2RGCA 4LZZA 421PA 1E96A 4HI0E 4CF7A 4LJ7A 2XSZA 2V9PA 2O8EB 5FOWA 1Z3IX 3N5CA 2FE4A 2B92A 5G3YA 3EC1A 4DLTA 4WZBE 1US8A 2EW1A 2MMCA 1SXJC 2GK7A 4IHQA 2CCGA 2ZYVX 1IN5A 4MRSA 1XBTA 2GXQA 3B60A 5DN6A 4DLSA 3OZXA 3REFA 1NKTA 4GI7A 3OEHA 2OCPA 4TLBA 1Q1QA 1Z06A 3ZQ6A 4RFSA 5P21A 4Q7KA 1J8MF 4G01B 4GOXA 4RZ2A 4Z1MD 4P31A 1GRRA 1JNYA 1S9HA 3AVTA 2WJJA 2DHRA 4BASA 1YE8A 2EFCB 4F92B 1TQDA 2YWEA 4H9GA 4DT1A 4XWOA 2F3TA 3NBXX 2W0MA 4JLPA 1KMHA 1N6RA 1Z6AA 4NCNA 1P9NA 1XD9A 4C2UA 4A0HA 3QPVA 1W47A 3DM5A 3HWSA 3RSOA 5CJPA 4OI1A 4QOSA 1AZSC 2HXSA 1T5LA 4FMBB 5KPDA 4UNNA 4ACBA 2R65A 3OE7A 4WW0A 1SKYB 1FX0B 1NKSA 3V9PA 2ZRIA 2C78A 4NYJR 1CR4A 3PUYA 4Q7JB 2WKRA 3BBPA 2MSCB 3IIJA 1D2EA 1UEIA 3RDPA 1XU4A 4BECA 3MAAC 3EW9A 3X1DA 2QP9X 4XVQA 1OE0A 2AD5A 2IYZA 3MWYW 4FCVA 4Q4LA 3K0AA 1R5BA 3ZVLA 2BOVA 1J7KA 4UXIA 4PO9A 4RD4A 1I2MA 4DRZA 3QI2A 2L0XA 4QGGA 2PZEA 4C30A 5K8TA 1QHGA 1WMSA 2EU8A 4W5WA 3E1SA 2C04A 2HCBA 4TL9A 4A8JA 2ZRBA 1B0UA 2OO7A 2OSBA 1N3BA 1KDTA 1XFAA 2QNRA 4QBGB 2UVQA 1VPLA 2D2EA 4X8LA 3ZZTA 4TMXA 2CMKA 1F60A 1IXRC 2GJ8A 1ZBDA 2ZRCA 1R4AA 2H1LA 2WPDD 1OKKD 4HUQA 3RWMB 4MITA 3UATA 3CRVA 3VNUA 2XNDD 2ZYTX 2AKYA 2WTUA 2FFHA 2QI9C 4PANA 3LFUA 3W3ZB 2VP6A 2YV5A 3CWZA 1OPXA 3Q7PA 2BVNA 4DUGA 2O8BA 2WM9B 1KK0A 2G1JA 4DZZA 3THXA 3AVPA 4URXR 5J47A 1E79D 4I1UA 2D3WA 5TV2A 4W9MC 1E0SA 3U3JA 4HZUA 4JVNA 1CRPA 3P27A 4B3XA 4PZYA 1KI7A 1A2BA 1E99A 4DLZA 3SS8A 5CITA 3MLEA 4EFNA 1F2TB 1LFDB 5SZHB 1XTJA 2NG1A 2VQSA 2LWIA 1IAQA 3W6OA 4YMVA 4Q03A 1PUJA 3Q85A 2FWRA 4GDFA 1KGDA 3RRMA 3AQ4A 1QDEA 4LYAA 1CLUA 4RZXA 5DO9A 4MUAA 1XPOA 1P2VA 3ZS9A 1OHHA 3U6KA 4OQXA 4ZDWA 1FZQA 3W6NA 4EPTA 2V8OA 4U7DA 1BMFA 1JECA 5L3RA 3EPKA 4ZCIA 2G6BA 4BRWA 2PEZA 2WICA 5FOUA 4CT5A 5JHHB 2QPAA 1JJVA 2QORA 3L8ZA 4Z8XA 2CCJA 1W0KD 1E3MA 3B82A 3TR5A 5KSPA 2W00A 3LO5A 5JZVA 5C4MA 1RYHA 3D8BA 3CPJB 2ZRDA 3SI7A 4A15A 5FBRB 4Q7MB 5ANRB 1TU4A 4URZR 1YR7A 1K5GA 4LV6A 4Q01A 3QEOA 5DHAA 2V54A 3UK6A 4QFMA 3LDAA 3VNVA 1UKYA 3LQRA 3ZS8A 4DWJA 1LS6A 3WYGA 4HB0A 3PIRA 1P4SA 2H18A 5JI2E 2FJUA 3ZLJA 1NBME 3QKRB 2OG2A 5AUQA 4MYTA 5JSZA 3PEYA 4ZCMA 4H1VA 1R7RA 3CO5A 4LX0A 3QF4A 2H7VA 2ODEA 1Z0DA 4MRVA 3CKLA 3O8BA 4URWR 5JFGA 2RGBA 4Z51A 3FFAA 3EWSA 3KKMA 1GRNA 4Q00A 2FX3A 3NDPA 1S8FA 2B21A 4EPVA 5LD2C 3OHMA 1H8HD 4QHSA 3O47A 4GRAA 1ZJ6A 1KZGB 1W2GA 1W4BA 3AUXA 4JJKA 2Q3MA 4Q4HB 3QVVA 1E2MA 4DBLC 3MD0A 2ANCA 2YNMA 2CLSA 1XTIA 1EWRA 2H92A 3N70A 4F93B 3ECCA 2V4ZA 2VHCA 3TAUA 1F3OA 3CF2A 4BFTA 3UXMA 4JL8A 3ICEA 1ZAKA 4KU4A 1U90A 2E87A 1Z6YA 4TSFA 4V0MA 4D0LB 1U0JA 5CDFA 3QPUA 1IY0A 2FPKA 3EZ7A 5JWOA 2ZVPX 4LBYA 5AJWA 3MRSA 1U0HC 4TTPA 4V0LA 1NN0A 2Q3FA 5TXGA 3K70C 3WBKA 1G18A 1CRQA 3QKSB 4FCWA 4P4SB 4D4JA 1G8FA 2H17A 3AVOA 4NCKA 2DWQA 1E1QD 2CBZA 1WBDA 2IUSA 4D6PA 4R71A 3OFNA 1XCMA 3QBTA 1KDOA 2ORWA 3G82C 4CW7A 1VDZA 1OXVA 2QRZA 1KK3A 5E95A 1U8AA 1TF2A 2W0SA 5A5GA 5CK5A 2IYXA 1X1SA 3VR5A 2JGNA 2H16A 3TUJC 4HYYA 2QT0A 4RKFA 1S96A 2W6ID 1VHLA 5F9FA 4UNRA 3D6TB 1E9BA 3LH5A 4ITRC 1QVRA 1JALA 2WOOA 1RYFA 2ZUBA 1CEEA 1QHXA 3SHWA 4WIAA 3FHCB 3RANA 4IOJA 5CM9C 2XEXA 1SVMA 4D82A 3RNLA 2CK3D 5FL3A 3EASA 1LVGA 1XZQA 2EFEB 3AVQA 2P6NA 5KSZA 1J2JA 1Z2AA 1XD2A 3VKGA 3QNUA 2IK8A 3UWKA 4ILEA 4AG5A 2OUKA 4C0AC 3DEFA 2IUTA 3S1AA 1US8B 1XZPA 3CR8A 4OJKA 3AKDA 4S2EA 3SOPA 1K5DA 4DLWA 1KKLA 5CYPA 3VR3A 2WJHA 4JLAA 4EQ6A 1UBGA 4M22A 2YKGA 4JMPA 1G16A 4PAOA 3DOFA 1UFQA 4CVNA 5B57C 5B30A 2VHTA 1XXHE 4ZI2A 3GLFE 3MFYA 3R20A 4C3ZA 1T3SA 3CX7A 1NLYA 2QTHA 4F4CA 1AKYA 3K8YA 2GBLA 1ZUHA 3LW8A 3OIVA 3K0FA 4O2LA 5G40A 2CHGA 1P9RA 2JDID 2IC5A 2J7PD 3X1YA 4DIDA 2BCGY 1E1RA 1DAKA 2ZREA 3TUIC 4CEIA 1ZU4A 4IVQA 1ANKA 2J7KA 2AFHE 1E2EA 2ORIA 4OYHA 1G8YA 4DLVA 1DAIA 3EIEA 3A36A 2Z4RA 3VHXA 4HDQB 2IX3A 1G9XA 1X86B 1XEWY 1UKZA 3SQWA 1FMLA 4RJLA 3WP1B 5CIWA 3AH8A 2REXB 1EFHA 3T1QA 2IYLD 1GSIA 4A4DA 3FYHA 2FPMA 2KB0A 2OE2A 4KBFA 2IA5A 2ODNA 2ZS8A 3CIOA 3L2OB 2Q3HA 4I1VA 1I4DD 1OV4A 2H8KA 4B2IA 2ZU6A 1G3MA 2BC9A 4XH9B 3REGA 3VKWA 2Q0HA 5C46F 3U7FB 1P2TA 5HE9A 1M8PA 1ZCAA 2VIIA 3LBIA 2JATA 4QJ5A 2XOKD 4BEBA 2QQEA 3GJXC 4BLPA 3JZAA 2GF0A 1GDDA 1JI0A 1R5OA 5E7JA 3T1OA 4F7WA 4NYMQ 5EXPA 5B58C 1AA3A 2QT1A 4RFVA 1XMSA 1NY6A 4NMMA 3U3RA 5G53C 2RGDA 1WBBA 3GLHA 3BWDD 5JJKA 2C9CA 2QRNA 1G8HA 2GA8A 4C9BA 2JJ2D 4I4LA 1NNEA 2GRJA 3AP2A 5IF9A 2XGJA 2AL7A 4LUCA 1DVRA 3UKDA 4D26A 2Q6TA 4LHWA 3U61B 4DLUA 2RGAA 3C5HA 3VR1A 4YMTA 1XJCA 1GILA 1X6VA 4QGHA 2GJ9A 5KYKA 4YDHB 4OHZA 2Q21A 1VCNA 2QAJA 3IO5A 3OAAD 2O8BB 1BYIA 1TF5A 4Q1CA 3RLFA 1KNXA 2A7QA 2BWJA 5FPYA 1JR3E 2CVHA 3THXB 3C5CA 1NSFA 221PA 2N1BA 5JJLA 4URYR 2ZI4A 2DWOA 4Q9IA 3NEJA 4G0NA 3U3KA 1W5TA 3U7EB 4B34A 5E7MA 1Q21A 1U81A 2IF0A 1S4QA 3ADBA 1RJ9B 3PG5A 1X8LA 5HKKD 1T5IA 3WP0A 3CF6R 4E22A 2XNSA 1FFHA 1GWNA 1VG0B 2W58A 3RS2A 5FBLB 1EXMA 2REOA 2PH1A 4YLGA 3L43A 5FL7D 4MKIA 4DVGA 5F98A 1OLOA 5JS8A 1KK2A 2ZI7A 5JCPA 1DELA 1P61B 1BYUA 2XITA 5HCNA 2XTNA 2HDNB 1IXZA 3MJHA 1IN8A 4WZ6A 5FUYA 4DDVA 4FN5A 2PZGA 1NIPA 3H84A 1A1VA 3IDQA 2W6JA 3FWYA 1R2QA 3BB1A 1SZPA 4HLQB 3BOSA 4JT4A 1GG2A 2F3RA 2RGEA 2HV8A 1RW4A 3A8TA 2OCYC 2XTZA 3NXSA 4D25A 2XX3A 3PFIA 1TEXA 3SYKA 6Q21A 3ND9A 2N46A 4PPGA 3P4YA 3SZRA 4AKEA 1SXJA 4ARZA 4R98A 4M9XA 5KPJA 1Z0KA 5AWFC 3GQBA 4IJMA 1ZM2A 2YWFA 2ZQ5A 4JSTA 1RRPA 1G7SA 4OI2A 4A0FA 5ELXA 1IBRA 4GFDA 2B8WA 4B75A 4ESHA 5AUPB 4TQUS 1OSNA 2EYUA 3EZFA 1DO0A 4W5HA 5L3QA 4OBEA 3LV8A 1KSJA 4XD7D 4N3NA 2P6RA 4I1SA 4V0ME 3ICQB 2NIPA 5DH9A 4LJ4A 4QBHA 4D80A 5H1YA 4V0KA 4LYHA 4LOAA 4KAXA 4I99A 4DSUA 1P72A 4MA4A 4MUBA 3QF4B 4KJZA 5BN4A 3V4FA 3LQQA 3CRRA 1CTQA 3PV0A 1R0YA 4FCTA 3K70D 2VSFA 1T0JB 3LBNA 5EQTA 5TARA 2CK3A 4QM6A 1IN4A 4JVSB 1DTSA 1E0KA 1ZINA 4ZDJA 3CH5A 4PHFA 2VP2A 3IHLA 2DCUA 3R7WA 4TMZA 1JEEA 1KDPA 4BE7B 2FG5A 1E4VA 2GVZC 3Q5DA 3RS4A 1E9RA 5DGXA 1CBUA 2CHVA 2DBYA 1N5JA 2QE7D 2QP4A 4HZIA 3ZIAD 1HUQA 4P4TA 4NCHA 4JKYA 3DM9B 2LCFA 3BRWD 3AVVA 2OHFA 5LBIA 2F1HA 5DYIA 4XWKA 4NHOA 2QM7A 1NMYA 3EPJA 4KYUA 4Q1FA 3BFKA 4TMKA 3RRZA 3PUVA 5AJZA 5GJBA 4NYMR 3TSOA 3W8RA 1Z6GA 5SZKB 2DFLA 2OAP1 1Z0AA 2D7CA 1M7GA 2J7PA 3GFOA 4E07A 1E2JA 2NZJA 2QMEA 1M1YE 2YZ2A 1XEXA 2OEPA 3CB4A 4TQAA 1COWA 5GJVC 3UPUA 3B9PA 1HQCA 4Q4JA 1HA3A 3FVQA 4U00A 3IPYA 2OXCA 1A7JA 3DZDA 5BW8A 4GMXA 5FBVB 4DDTA 4KFUA 1Z29A 4UNSA 5HPYB 2CCKA 3GEEA 2F43B 3IHWA 3OF5A 3QG1A 3BAFA 3ZH9B 5A4JA 2YYZA 4XIGS 3M0EA 3T1VA 3THWA 3GLGA 1IN7A 3RSLA 1F2UA 4HLCA 3ZDQA 4B3FX 1HV8A 1QHHA 1R0XA 2IYVA 2PBRA 4LPKA 4TT3D 3VAAA 1L2TA 3W3AA 3GPLA 1I2DA 1ZVQA 4QHYA 1NN5A 4KHZA 1Z63A 1NL3A 3KKQA 3P20A 1B23P 4F38A 3K1JA 1N6NA 3C15C 3W8NA 4ZKEA 4B71A 4P4UA 2RKOA 1XD2B 2PCJA 5IHPA 3A37A 2QPOA 5F9HA 3BGWA 3L0OA 1GKIA 1ZNYA 1KI1A 4BGDA 1DG3A 2VTKA 1HY3A 1KJYA 2F7SA 1W2HA 4RY2A 1X8KA 4L4UA 5TDHA 5EJEA 1NY5A 3LNCA 3PVSA 4NBSA 3LW7A 4E09A 1RFLA 3WMFA 4EQ6B 2V1XA 2YC2C 3SHFA 2QSYA 2F6RA 5JRJA 4FMDB 4QNMA 1SHZA 3LLMA 5LDDC 1IONA 2O8CA 3QQ5A 3OAAA 4F91B 4OL0A 1GNQA 2ZRGA 1D2MA 2RGNC 3Q7QA 2ODBA 3I5YA 1CJUC 1P73A 3CPHA 1GTVA 3DKPA 2ZXUA 4LDJA 1T0HB 3K0FB 2FH5B 1F6BA 1AIPA 1KSFX 2JJ1A 4CEIB 2GZHA 2GCPA 4HDCA 3BXZA 4NYIR 4FWTA 2CXXA 1AA9A 2HF8A 4UNQA 1TUIA 3VX4A 1A2KC 1N6IA 2PL3A 1JAIA 1XDBA 3PEUA 3RS0A 3EA0A 4UXHA 4M9ZA 4E5UA 1DG1G 3VR4A 4PSKA 3MWKA 4KBGA 1Q1ZA 2D62A 2KSQA 4HDOB 3DL0A 4P0TA 4JKIA 3TLXA 3WNDA 1ZUNB 4GP7A 2PMKA 2ZIAA 4QNRA 2YHSA 3R8FA 2ZI3A 1Q20A 3K53A 1II9A 4BLTA 2FSGA 1C9KA 2IS4A 4LHYA 5D3MA 1GKYA 4BQSA 2OZEA 3U7HB 4US1R 4UXJA 1DOAA 5J4YA 4AK9A 4CEJB 4TYYA 1NG1A 4B3BA 1NF3A 5L3VA 3SU8A 3T34A 3PUWA 1OJLA 2NQ2C 3OESA 4JL5A 4GBMA 2BMFA 3B8HA 1OXSC 1M34E 3GLHB 4C0QC 5F3WB 1QHNA 4TYNA 4XWAA 3BE4A 2ZVQX 4WBSA 4TMWA 1TL7C 3X1WA 4M1SA 4C4PA 4DCUA 3ZD6A 2GCOA 2B7BA 3JVUA 2X77A 2IHYA 1RPZA 2VA8A 3ASZA 4PHHA 2V1UA 1XCGB 1CS4C 4I81A 4XVRA 3B6EA 2QN6A 1UBFA 2BBOA 4NONA 1OH8A 4HEJA 2OV2A 3NBFA 1M7HA 2R6FA 4MYUA 3LX8A 4OHVA 4P33A 3O8RA 3GJ6A 1SQ5A 2B7CA 1XNJA 2G1KA 3AF1A 3K09A 3LAWA 5DI9A 2GXSA 4OHWA 4ASUD 5EZ6B 2OBLA 1XWIA 5G3ZA 2HYDA 3C41J 1DARA 4AYXA 2EQBA 1N6PA 3EPHA 5TVKA 2ATVA 1SXJE 1IHUA 3Q3JB 2WOJA 5B64A 1MH1A 2A9KA 1L7VC 3H1TA 1TQ6A 1Q12A 2JIZD 5L8VA 2F9MA 1E2LA 1G19A 4C0HA 1ELOA 2ZJYA 2IWRA 1XXHA 3RS3A 1OFUX 3GLFA 2CJWA 2A5GA 1N6KA 3P26A 1KJZA 4DIEA 4QGFA 2VP0A 2F55A 2J0QA 4LCBA 1G3QA 4K81B 3IBYA 1QG4A 1Q1BA 4JBYA 4F4JA 4A9AA 1ZNXA 5KSOA 1Q44A 3L82B 4JJZA 1IY1A 4IDNA 2FV8A 1H8ED 2ZE5A 2LKDA 1WDTA 2OT3B 4NTZA 1GNPA 1Z28A 3EZ9A 3HDTA 5FPSA 5JS7A 5HR5A 2I3BA 4J0QA 3T35A 1VG1A 5AJYA 1VMAA 3JZMA 4PFSA 3G0HA 2JLYA 3KB2A 2C8VA 3B78A 3SDZA 1AN0A 2WAXA 3W5JA 1U9IC 4V0OA 4ARZB 3KQKA 2IS2A 4QM7A 3U60B 5KDOA 4MKHA 2UZIR 1P2SA 3NBYC 3EIQA 3QPWA 3QXXA 4MYCA 5AJVB 4EIWA 4MQBA 2JLUA 1MABB 4M1TA 1GKUB 1EX7A 4PO1A 1AQUA 2PJZA 2WIAA 4BLSA 2OCAA 2V6JA 3U6BA 1U8YA 4NU0A 2EFGA 3R8CA 4B74A 3KB1A 2AHOA 4MRPA 1E2NA 4Y0AA 4BEJA 1II8B 4PHTA 4EPYA 4QC2A 1IQPA 2QGNA 3B13B 3RRYA 4DDUA 4L9SA 2QEQA 5BYKA 1FQJA 1Y63A 2DY1A 3VU9A 2WWFA 4WXRA 1OIWA 4GOJA 5FI1B 2ZSEA 2NZ8A 1KO5A 1P5ZB 2CNWA 2BMEA 3CX6A 1UDWA 5C18A 3R7WB 2AN9A 4GOKA 2FPLA 4BFZA 4DB2A 3QOFA 3THOA 1KY3A 4G5QA 4IKEA 3MSXA 2YVUA 3EX7C 1RZ3A 3F3YA 4BLOA 4ZDIA 1EFUA 2D74A 1E2IA 2AX4A 4KITB 3BB4A 4KXFB 1AQYA 4BUJA 3T15A 3ZYCA 2OLKA 5CYOA 3I73A 3GLGE 1SVLA 2R44A 3EC2A 5CJ2A 2Y8EA 1XPUA 1L4UA 5FOSA 2IYWA 4M1YA 1OIXA 1ZD1A 2CL7X 3AM1A 4HATA 2NO9A 2IXGA 2W83A 1XMIA 4B47A 2WWWA 1EWQA 4CEHA 1JR3A 3FTQA 1KSGA 1GUAA 4RKEA 1HT2E 2WSSD 3TIFA 1MKYA 4JVLA 2YOGA 2HJVA 3OEEA 2R6DA 1D6JA 4FMDF 4OQLA 3IKJA 3IQXA 4XJXA 1P2UA 3VHLB 1N6HA 1PJRA 4B2PA 2IW3A 3HU1A 4TN1A 5FTKA 4Q7LA 1MO3A 1UKEA 3KTAA 4B35A 5JI3E 1E4YA 1N6LA 5IK2A 1Q3TA 1OB5A 1ESMA 2GJAA 1XP8A 1A4RA 4IFEA 1V43A 4Q4JB 4TYQA 4V0NA 2O8DA 2QGZA 5HCIA 3UIEA 4RD2A 3CF0A 2PCLA 1KO7A 2IHBA 3LVRE 2XXAA 1KZ7B 5BN5A 4LV5B 3U44A 4KFRA 3KQNA 1UADA 1SVIA 2PLRA 3L8YA 4ZO4A 1MO4A 1NLZA 1IN6A 1E0JA 5EZ5A 1HYQA 3Q9LA 1DAHA 2F1JA 2HUPA 1DBSA 3FKSD 4GMDA 4R7ZA 2VBCA 4R2HA 1DAEA 2WSMA 4GNKA 4G3XA 3EAQA 4LV8B 3MG9A 1O3YA 2GEVA 3LRPA 4HAZA 4ON9A 3UG7A 1KDRA 2ZR7A 1XEWX 3AVYA 1WP9A 2FFAA 3T5DA 1QG2A 1TX4B 1WF3A 3LLUA 2HF9A 4B33A 1BOFA 3CNNA 721PA 1OT3A 2OXRA 5GJCA 2QBYB 4Z1MA 2WWXA 5H70A 1IJEA 4OJQA 3MWLA 4B3DA 4A92A 2Z6VA 1E2FA 3NKVA 3E2IA 4CDGA 1GL7A 3A1UA 4G5SA 5L3SA 2Z4SA 3SE0A 3I8SA 4IVPA 2UZ3A 4E03A 3N2EA 1DAGA 4R9UC 2O8CB 1FPMA 3T06B 3TVDA 5IDVA 1XD8A 4OQFA 1OH7A 1IY2A 4D2IA 3KUCA 1V5WA 3HU2A 1HURA 4RZ3A 2GESA 3AVWA 3K9LA 1YZLA 2G3YA 2KWIA 1J8YF 2EFHB 4N1AA 3B7GA 2ECKA 4FXPA 3NC1C 2FF7A 1XMVA 1E9SA 3AVXA 3UWOA 3KJIA 2JLSA 3A1SA 3WYFA 1VECA 1GNRA 4IDQA 4Q4AA 2XJ4A 5AJXA 4KFTA 4PX9A 1CP2A 1CR2A 4MRNA 3SNHA 3EPLA 2A2ZA 1LF0A 4KLNA 2VP4A 1CR0A 1U99A 1GZSA 1KI6B 2EWVA 2QMHA 3CRW1 3U2QA 1DAMA 5CLLA 4AWXA 3QUSA 1OXTA 3TRFA 4GZMA 1OB2A 4AIIA 4DLXA 5K8LA 2JCSA 5D3MB 4QXAA 4RCYA 1YR6A 1YRAA 2ZRMA 2C9OA 3AF4A 4B76A 3IIKA 4RZUA 5C1BA 2YJTD 3GJ5A 5FPTA 2J1LA 5AK0A 2BDTA 1IM2A 1T8UA 4PZLA 3TK1A 1W4RA 3VQTA 4A82A 2WPDA 1OKKA 3FKQA 4HAUA 2BBWA 4C0SA 1HT1E 2P0EA 2XNDA 1FNMA 2OILA 4C7OA 1X3SA 3PR1A 3D3QA 1CULC 4DSNA 5M04A 3CW2A 3R9WA 3SBEA 4P32A 2G77B 2WV9A 1HQYE 4RFSB 3TVTA 3WMEA 3GLIE 4HAVA 3LWNA 3RABA 3QE0A 2CL0X 1ZW6A 3K0CA 3ZVRA 4CT4B 1G3UA 2QAGA 1BS1A 4DT1B 621PA 2R62A 3JVVA 4F4IA 3TMKA 4LJYA 1E79A 3FMIA 4KSCA 4YMUA 1KMHB 2J87A 1TNDA 2SHKA 4JLMA 4Q9JA 1J70A 2WWYA 3TSWA 1KOFA 4ZIRA 4XOIA 2Z0MA 4YONB 4DJTA 2GVDC 3B1WA 4LHZA 1YR9A 4KSBA 2AR7A 3RVBA 3CONA 1JXOA 2VL7A 3KX2A 1N5LA 5FOVA 2OFWA 3WRXC 4FINA 2JLZA 3AKCA 2GEUA 2BM1A 1E9EA 5DNYB 2HT6A 4Q1BA 4A36A 1P6XA 3W90A 1T3HA 1YVDA 2OFXA 2ZE6A 1T9HA 2FSFA 3GJ4A 4DCVA 2DB3A 2C5LA 4O25A 4DDWA 1XXHB 3K0AB 2RMKA 4A0RA 3GLFB 2CJWB 2QM8A 4WZAE 1ODFA 4JS0A 2WAYA 1ZYUA 4QBFA 2IWHA 1W1WA 2WMOB 4ZI3A 4A6PA 1MR3F 5KDLA 3J81k 1AJEA 1W0KA 4B6EA 4HLUA 2HXYA 4Y0VA 4A8JB 3FHTA 4LBWA 1ZM3A 4PC7A 4U5XA 2V6IA 1CXZA 3RWOA 2N42A 2NPIA 3H86A 4KVAA 4X8HA 5BQ5A 4L16A 2K5UA 5J5CA 2EWWA 1C4OA 2FEOA 1FP7A 1YKSA 3CRMA 4L8GA 4OK3A 4GP6A 2IF2A 3AP1A 4AYTA 2C99A 2R6AA 4HUQB 1E9FA 1E9AA 2BJWA 5JWHA 1W0JD 1E6CA 3FOZA 1AS0A 4XTRA 3I92A 4EPWA 5FPKA 4W7SA 4TMTA 4IDOA 2GTPA 1XX6A 3ZGXA 2R6GA 2QTFA 3SQXA 3A4LA 2C2HA 3TE6A 2NOAA 1G4UR 5KNBA 1KYIA 2O0KA 1YZKA 2AWNA 2VEDA 1RVDA 4NCJA 1LY1A 2DYKA 1W7AA 3NIBA 1UEJA 2J46A 4DCSA 4EJSA 1S3GA 2B8TA 4URVR 3BERA 4TL7A 2JLWA 2ONKA 2GXUA 1NVUQ 1N0UA 1VCIA 3EIHA 1H8HA 1I4TD 2WHXA 4LC0A 4Q21A 4TLCA 5EXSA 4UJ3A 4HZUB 1CJMA 4WAUA 2QA5A 1KO8A 4CYMA 2BKUA 4LGMA 1P62B 3U7GA 2V7QD 3B9QA 3VU9B 4B73A 4Q66C 3N2IA 1KKMA 4K46A 1U8ZA 2OM2A 4Q9LA 1XRJA 2W2VA 3C7KA 3BJIC 5FUVA 1W44A 1YRBA 4HB4A 4M1WA 2ODWA 1JQJC 3SEAA
chains in the Genus database with same CATH superfamily
1NUUA 2ECFA 3EDOA 4IJ6A 5DRTA 3BG5A 3VOTA 2TRSB 3U16A 2V6BA 1PS0A 3T7RA 4ZYLA 3W9YA 1DRWA 4L95C 2CVPA 1FTYA 4S35A 4YUZA 4ZGWA 1U98A 4GX5A 3CZ9A 1YZ3A 3G5MA 4EUFA 3HNPA 3LUGA 3VOBA 1JPVA 2CFIA 3LGSA 2I4OA 1HQDA 4MW2A 3A3PA 1GM5A 2OBXA 1B93A 1P77A 1XQWA 2P75A 2AKAB 2JI8A 5EKSA 3FCCA 5TT1A 3RU3A 1RBQA 3DE0X 5HUJA 2PIAA 3RT1A 3ZWCA 2FW1A 2P2CA 4RE5A 1K0UA 5IYZB 2ZUUA 5F7ZA 3MA0A 1BVRA 1FTNA 5G0UA 4WXPA 5K0JA 5CM8B 4FDMA 1YC2A 1P0IA 3AUSA 3FFBA 3JD0A 3ZHZA 2JRCA 3QFRA 2C83A 5SYAA 2IYUA 1G6OA 1I4LD 1ZI8A 1KXJA 1QYXA 2ACEA 1XCBA 2C98A 1NR1A 4UU0A 3QHPA 1H3FA 1RIFA 1KTVA 5FBHA 5JC1A 1GL3A 2WG0A 3FMPB 1VGRA 3BCSA 4XIFA 4UVHA 5C1PA 5LXTA 3VR2A 2B2NA 2HX1A 4DYDA 4ZRMA 3LVBA 1CU1A 5JSZB 4DR1B 1KOGA 4CQMB 1WV1A 2PD6A 2Y67A 1QYVA 1LVUA 1PWYE 1QE3A 2Z5GA 4JUAA 4ALJA 5HG0A 3I34X 2NQ8A 3U44B 2J59A 1J42A 4I4TA 4MVJH 2P35A 3GLKA 1SGWA 3A4MA 3QEKA 4GLBA 4M9SA 1VMIA 3R9XA 1KPIA 2VRCA 2GYVA 4YMLA 1DIHA 1L7DA 3L0IB 3DQZA 4Z7QB 4KXVA 1ZRHA 4F2PA 1XWFA 2QXTA 2VH1A 1N0WA 5DTIA 4AMVA 4L5CA 4D5EA 3F2VA 3DT8A 4BFCA 4UEJA 2JKYA 1I9GA 3JAKB 3HCDA 3P32A 4J9VA 4GNRA 3W34A 4F3NA 1C30A 3KKOA 1VKNA 3WMXA 3MM4A 2O2DA 4TWZA 4HBZA 2QRGA 1ZVKA 1F48A 4C21A 5K0LA 3OE7D 1J39A 2X8AA 1W5BA 1GPYA 1RJEA 1SOUA 4RY8A 3VSDA 1OTHA 3W4IA 1TU3A 4NK5A 2PVPA 1XN1A 3PC7A 1GARA 3M1AA 3FVVA 1IRXA 3R3JA 3KJGA 4OAOA 5BSTA 1DAFA 4CT0A 1XTSA 3K8OE 5JSHA 3RYCB 4NXNB 5K3EA 3I04M 4KFCA 1L8LA 3R6WA 1TQ4A 2DBZA 2A5LA 4OQMA 3SX0A 1XAGA 2GX6A 3RC3A 1TECE 4I5IA 1L4KA 1K86A 2ZBQA 4IIJB 4L5IA 4CFYA 2BEVA 1H2FA 4F5YA 2RGGA 4MW0A 3OEYA 1ICIA 1OC4A 1TK2A 2UDPA 1WMEA 3EGXB 4WOKA 1MJGA 1OMOA 1XQXA 4JMLA 4L4YA 2ZQYA 1IPEA 4GXTA 4LF9B 5FADA 1OF1A 2GBLC 5BRJA 4KHPB 2PT7A 1Y6ZA 2AB0A 1D2AA 4TT8A 1E58A 1ZAYA 5FLKA 4FE3A 3UO8B 3WL6A 3HO8A 3P0FA 3L8MA 1CVRA 1WZCA 1SCIA 2FGKA 3IOEA 5FNZA 4CM6A 4EYQA 5CLFA 4TZ0A 1C9JA 3BH7A 3QBVA 3AOGA 2BEKA 1O94D 3ENQA 2V6MA 1TYAE 1CP3A 4EUSA 1QV6A 1YZUA 2X7XA 3QUAA 4FQ8A 5KTTA 2ZM6B 2C77A 4EDHA 2JGKA 3V3KA 4XB2A 5SY6A 3CR7A 1Y82A 2YDXA 5GP1A 3V6LA 1KOJA 3TQCA 1A4IA 4H27A 2I6GA 2JI7A 4JI1B 3NAQA 4DQDA 1VI5A 2R7LA 5KTNA 4U63A 4Q1EA 3BS4A 4YWJA 4AMYA 1JXMA 4G4GA 3IE2A 1Y48E 3ML1A 2ONZA 3JRNA 2FVYA 3QXSA 5K0ZA 3WLKX 1YOBA 2WVHA 4DJ5X 5KVQA 3LC7O 1R8JA 4DUGD 1BCRB 4OH1A 1QG6A 1JQ3A 3PR3A 4H7KA 2NTJA 4MVYA 3ZG6A 4C4SA 3GVPA 1FOEB 3FFWA 3EZ6A 1AK1A 3H0KA 1CY0A 1JV2B 3M6UA 3CX3A 4Q19A 1SEVA 3Q5EA 4J29A 3Q8MA 3IB6A 1W4ZA 2Q7XA 2NYRA 1OXBB 1WF6A 3CNOA 1XVAA 3FIJA 1ABEA 4NCBA 4KE7A 5JBQA 3L0ZA 1A69A 1IHPA 1V1RB 4NHEA 2IT1A 2ZG6A 2XKJE 1FYEA 1MEOA 2E2WA 4Q93A 4MSUA 5LQUA 4EY8A 1T9ZA 3NDBB 5LQRA 2QOEA 3DE3X 2ON6A 4KR9A 5IM4F 1GIAA 3M6VA 1TLFA 1CQJB 3NNNA 3RUAA 2CVFA 3QVUA 1X1BA 4HNTA 1DQSA 1I7LA 3GWGA 1TQ8A 4CKWB 3QA3E 3HWWA 3V4ZA 1M9NA 3SR0A 1I14A 1EZ4A 2P5TB 2QAGB 2VF8A 4H0NA 2DERA 2FEMA 3TEMA 2RH5A 1DC4A 1L5HB 2A0FA 4WA7A 2C31A 3V8MA 1CJKC 2JFBA 4G4JA 1BE8A 2RHJA 4OKIA 4Z9FA 3RU9A 3KQLA 3F6CA 2AMFA 4AQYB 2QVBA 2V98A 1OFTA 5JAPA 5LMUB 2IPXA 1P0FA 1KORA 3F97A 3VHXB 1Y98A 2XIQA 3KYDA 1ZZGA 5LZ5A 1LU9A 1T5BA 3M2TA 1IJFA 1NUAA 4L15A 4OVKA 5I7FA 2ZIFA 3BCHA 4RVOA 2JLQA 1M2VA 2VKQA 3LBHA 2E55A 4C4OA 4PF1A 4EG1A 4WXYB 3GEDA 5A0FA 4UBOA 3PRHA 1JFVA 3CUUA 1V8BA 1UJMA 3A11A 3CGGA 2QD4A 3MAJA 1WCV1 2R97A 4HZGA 4CN8A 4QUGA 4CI9A 5JBNA 1K8RA 3BHIA 3MT0A 2BV3A 3I8XA 3NIGB 4XUCA 4DYHA 3UXHA 4RSGA 2JLRA 1Z7YA 3LHKA 3ZWOA 1KEWA 3FYUB 3DOJA 2BFEA 5ALOA 3TW8A 3VO1A 1C0LA 2JJ8A 5LM3A 4G25A 4QJ3A 4CQMD 3KSRA 1WMFA 2Q46A 1IBKB 2NUAB 2QN3A 3P9XA 2A4MA 5CCDA 1LWNA 1ISHA 4HNGA 4Q9NA 3DA8A 3EVAA 4RCVA 3AI3A 2I2DA 2WKQA 4EELA 5B53A 4YUAA 2FK7A 4LBZA 4EVIA 3TMYA 3MOIA 2VAVA 4DUZB 2AUNA 5B12A 5HDQA 3WRYC 2IXFA 2V97A 2NZWA 2Z08A 2ZI9A 3PUXA 5F5NA 5K3BA 3SBOA 3DUWA 5L4SA 1OI4A 1QKIA 3TAXA 1IEXA 1SC6A 1GR0A 2R751 3MRXA 5T41A 3RVMA 4FNOA 3LE8A 4UOEA 3ZD8A 2F8SA 4XIJA 5IXYA 3K05A 4QOFA 3B6KA 3E22A 4HTFB 1PLJA 4OU4A 3ZY5A 4FNAA 1UIRA 2ALJA 5K4AA 5K51A 2FMTA 1QNFA 2FOLA 4BBZA 3SHTA 1GU1A 4DWOA 4EJ6A 2CZCA 1G64A 2IY9A 4OK6A 1KS9A 2XUKA 3WL5A 3FZGA 3JQ7B 3VTFA 4DR2B 4ZI5A 2ZU0C 2Q6KA 3FLEA 4EJSB 2Z43A 4DA9A 3ZKWA 1CJVC 4FYYA 3A6JA 3AL3A 4OBXA 2XTMA 1U6JA 2DLDA 121PA 4XZ3A 3UGQA 1M0SA 3AUUA 4R4JA 5JMPA 4LIPD 3WQSB 2WJYA 1GZ5A 1M34B 3HDJA 4IL5A 3KS9A 3MTQA 2OXIA 4M9QA 3WR5A 2PGLA 5ARDA 3PZBA 3WV4A 1BGVA 1GG5A 5IG2A 1VYTA 2YIJA 1S6YA 2OFPA 1CQIA 1Q74A 3KPVA 4QPCA 2FN4A 4I8IA 2UYCA 3R44A 2V55B 1P7CA 4R1MA 4GSYA 1ZRMA 1JDZA 3VR6A 3D4LA 1DWQA 1FNDA 3G88A 4IBOA 1DRKA 4DMLA 1G8PA 1KI9A 2QIOA 4MB6A 4TXLA 1PL7A 1ZUIA 4PFKA 3QKWA 4ARSA 3KALA 4QDTA 1AB6A 1W76A 4QYWA 1JDNA 5AK6A 5DI3A 3TSZA 3UMYA 4PGMA 1KDZA 1WTCA 2AEMA 3QPCA 4PQFA 3WX0A 3TZCA 1RRCA 2X6TA 2PLFA 3N0VA 5JFTA 4YLYA 1KSHA 4XCXA 3IDOA 2VDPB 5AKGA 3U13A 5KB3A 3G8BA 1KHHA 1D2NA 2E18A 2QN2A 3D31A 1XZ8A 3I1YA 3H2KA 4IXMA 4JL6A 5TPWA 4DSOA 1WSWA 5BSVA 3ESXA 4FMCF 1AMNA 4MV6A 1R64A 3FJYA 1IZZA 3OURA 1OYYA 1OT5A 1WDWB 3ZD7A 5CB8A 1RZRA 3OUZA 1Z4OA 2NZUG 1PFQA 3A1VA 2WMDA 1F0PA 3B1XA 4R3UC 2WT8A 5CA1A 4ARCA 2Q29A 1ZEJA 5BY2A 1GNLA 3ZK8A 3A9WA 1LB1B 4UTOA 1G60A 1JG2A 1GFIA 3ENVA 3AF3A 1POXA 4INJA 1V35A 1ZMXA 1V39A 1Z2NX 2OCKA 1C50A 2PZFA 2Q3LA 2WYHA 2Z56A 3JYQA 2BM9A 3CTMA 4A6EA 5LXTB 2W2PA 1H4TA 1SMKA 3FUXA 2C4TA 3HJNA 1GPH1 3VZQA 1U02A 1DDOA 1L4YA 1T5HX 4AG6A 2WU0A 3HB4X 1UJ2A 4PLTA 4YJ3F 3GGJA 5BN4B 3H4TA 1KMCA 4ZOEA 5KC9A 2P9GA 5H82A 5EKXA 2XB2A 3STTA 3GEBA 4G9GA 3KSAC 2GD1O 1N8TA 2G72A 1FFBA 3KLPX 4YJFA 3P9RA 2GH1A 3INYA 5KMGA 1JJFA 3C3MA 4ZVUA 2ZBRA 5H3HA 3L1VA 3ND6A 3R9XB 3AHJA 3SWWA 5AVYA 4XKJA 2NXWA 2EKQA 4BB5A 4NV0A 5MFPA 3PNYA 1KC1A 4N0EA 3KR9A 2QT9A 1OFHA 1FSSA 4L7QA 1YZNA 2BHTA 3P0IA 4GL2A 2QZ4A 4QUBA 1C30B 2QTAA 3GC6A 4RPIA 3X1XA 1RJ9A 2OL4A 1LDMA 3G49A 3FCEA 3KJHA 4IOMA 3RS7A 1C8BA 4LRWA 5EY5B 4LSGA 1RLIA 4KO1S 1GPAA 4EY5A 4DGSA 4CMHA 4NG4A 4KVZA 3SYMA 5CTAA 3OOWA 4RWEA 1XJQA 1ZD2P 5AT1A 2QLLA 1MV5A 4CR7A 3LRXA 4RLFA 3V4PB 1B6SA 4U7JA 2GFIA 4DCGA 4K88A 4EG4A 1A72A 1CY6A 2XAUA 3IQZA 1KR5A 1V16A 2GHRA 3B1YA 4YFYA 3SX2A 5DEOA 3DNPA 4MR8B 1XEXB 2GM5A 2J3KA 3QM1A 2EAUA 3SSMA 5L6MB 3V8VA 1CRWG 4GPZA 5EE3A 3SJAA 2IS1A 3LG2A 2FXVA 5ILQA 3D2CA 3EGOA 3H97A 5DYYA 4G0OA 1H94A 1MD9A 3GLUA 1ZK2A 3KLOA 5SYNA 1FVFA 4OUDA 3M5PA 4O08A 3UJPA 3EZ2A 2PX5A 4PYNA 2VYVA 4WY2A 3WY9A 2G09A 3THWB 1UH5A 4JYBA 1JYFA 5DGDA 5J4VA 2WWRA 4UJ5A 4OSPA 3VC1A 1Z0SA 1XTRA 3D4IA 2QG6A 1G3RA 2JKZA 1LJLA 4WLVA 4N0PA 4UKDA 1JHQA 7REQB 3NWPA 5BNFA 4HWSA 4NJMA 3WBJA 5HTKA 3RG2A 1YDMA 3ZU2A 1DKQA 1E3TA 4C22A 1NQWA 4R6XA 1T8SA 4M0LA 5JS1A 1XVVA 2XUHA 3UMRA 1RWWA 1YU9A 3AIKA 2H59A 1RFGE 3JATB 1KIAA 1Z2CA 4P8RA 3AHFA 4IW3B 2EZ4A 3AG6A 1H5NA 3LA6A 2CZQA 3L8DA 3C87A 3OFSA 4GIBA 4JLNA 3ZI0A 4ZGBA 3TUZC 3KKNA 4KN6A 1AX9A 2Y9PB 1FC0A 1MIOB 4RD1A 1YFLA 2QU8A 1G20E 3I2IA 4HWRA 2W2XA 3U4HA 4ZJZA 4HFJA 1VA5A 1E20A 2XGMA 3KWFA 2P9EA 4H0CA 5ILGA 1L9KA 2BFDB 3G0DA 5CGQB 5COQA 2CZGA 1PV4A 3SYLA 1S89A 3ZHYA 4LHVA 1UCFA 2AN4A 1EDDA 2C7RA 3H04A 2XKBA 3QFCA 1LTQA 2HO4A 3JZDA 4DM4A 2CB9A 2FZWA 3LXXA 3WWEA 4D3DA 4FZ3A 3V7WA 1ZIXA 4PNPA 3ZGOA 4R8VA 3IAM1 4A5SA 1NI3A 3SEZA 1EK5A 1IM5A 3DBRA 1Z9BA 3F9IA 4KPUA 4ZOQI 2AZXA 3UA3A 4L9RA 5T8KC 4G63A 2X4IA 4IQ8A 3DLHA 3FY4A 3V7NA 3CZCA 3STYA 3GOHA 3F7OA 3JWJA 2VLIA 4AZVA 2PL1A 4HWKA 4G5RA 5DIFA 1TVEA 2RBGA 2C7OA 1XYGA 2OGZA 4WERA 4EZIA 1UDBA 3N75A 3GP8A 5BV8A 3ZXYA 2W6JD 2PUCA 1TQHA 2FG6C 4J1QA 2J33A 2OGSA 3ZHUA 5CB6A 1W0CA 3T1TA 1CNFA 5AHRA 3CNHA 3RSQA 1V0JA 5K45A 2JIZA 1QCYA 3F8WA 3DJFA 2CXUA 1C3OB 3GDWA 1ZIDA 4P7BA 2HV9A 2OCGA 4Q05A 1NP7A 4ZXFA 2XPCA 2HR1A 3H5TA 1YRLA 4MI9A 1R6BX 3DAFA 3FNHA 3KYDB 4PZUA 2XQGA 1ZNZA 4NDZA 4S0ZA 1G7TA 3MCVA 4E5VA 4PAQA 4Q82A 2BHRA 5F51A 3VR5H 4N41A 2OFOA 4RY0A 1M2VB 2HU2A 1VKJA 2ZPAA 4L5YA 1VYUA 5HZMA 2XYQA 4DCOA 5K2MA 1NJ5A 1QFYA 2AMVA 2QJFA 3SVTA 1QIKA 2XYHA 1VBMA 4OP1A 3PXUA 5FBKA 1K2WA 3D7SA 1FTWA 3DOIA 3GRAA 3LKBA 1KEEA 2G5TA 1JI3A 1L5FA 4H7JA 1VLQA 2C4KA 2VJCA 2YCLA 1P81A 4NC9A 3X1KA 5GVRA 2H2IA 5DHFA 3I5XA 4Y2PA 4BVKA 1F1JA 2I33A 2X2FA 4AMZA 4RIEA 4ZOAA 2B4TO 2CMHA 1QANA 2QTBA 1GZDA 3TW8B 2EG5A 1QGAA 3SGLA 3O82A 1WQ1R 5I5GA 1MZPA 5EPUA 3RK4A 3RODA 4A2QA 3ZE9A 4F12A 4TLDA 3ETLA 3V2HA 4G0ZA 4OGFA 3F74A 3VI3B 3L07A 4BC1A 4JLBA 4GPTA 3I61A 2OD7A 4JR0A 1ODCA 3ISJA 1Q91A 2HU7A 1ONBA 3PNSA 4PM4A 4R40A 4KB5A 1T0IA 3HCWA 1ULSA 5C9ZA 3OQ6A 3EAGA 1LRKA 1IUNA 2GCOB 4K9RA 3C6YA 1JEDA 3PUZA 5LOVA 3VVCA 2YR0A 4O4IA 4AJOA 4I50F 2Y68A 3DHNA 2AA3A 3PFGA 4JROA 1V5IA 5EXTA 5I01A 4V03A 2I2XB 3E22B 1UBUS 2HFJA 4QOGA 3RC9A 4ALNA 1MB9A 1Z33A 2IL1A 3A25A 2JHFA 1NWCA 3T5GA 3H87A 2OO5A 4JU8A 2VHJA 2JFYA 3PL1A 1VFPA 4I5GA 3N8KA 2WBLC 3PCRB 4JAVC 3GN2A 2FMUA 4MKRA 5FKJA 1TFUA 3WLIA 1K6JA 3N5KA 4TXHA 4EB8A 4HXGA 3ZKWB 3AB3A 2GPYA 3QI7A 2XBUA 2WI8A 4URHA 3RHFA 1WB9A 1VLJA 2CWWA 4P36A 3A4TA 3MJEA 5JZSA 1Q57A 1M67A 5E7QA 3KXLA 3O1JC 4YREA 4KTVE 5ALXA 4BMYA 1G7RA 3LU1A 2D1RA 1FFEA 3F5SA 4Z9YA 2DQZA 2HRCA 1MTOA 1SN7A 4RA6A 1COWD 1R9JA 2L82A 4K9NA 4NEGA 2R87A 5CD1A 1PJTA 3O8CA 1EHIA 1BXKA 1CQIB 2QQ5A 4FDVA 4UPVA 4AKHA 4EPRA 5LQKA 2A9VA 1QNLA 4IHJA 5F12A 4NICA 1JSZA 2WSSA 3UJBA 5IT5A 3IBTA 3AZPA 1CUHA 3AM3A 4EUEA 4KRFA 4DJFC 5I3CA 1G5RA 1GJRA 5DI3B 3CVJA 1XLWA 2FF5A 1XCOA 3IXLA 1V8FA 3H16A 4Q3OA 3ZYZA 1FRQA 2HNKA 3NOOA 4FDAA 4KX3A 5IC4A 2XDWA 2R4QA 3O8OA 5LIRA 5LWQA 1Y81A 3O93A 4G5OA 5EHIA 4AMBA 5M2QA 3JWHA 4QECA 3IBSA 4AJPA 1H65A 1U7XA 2RKWA 3ABRB 1UDXA 2K87A 3RVQA 3X1JA 2ZZKA 1C1DB 3C74A 3LWDA 5IBRA 1IBSA 5JC8A 4ZWNA 1TC2A 4HB3A 1TTTA 3SXPA 2P3OA 2XCIA 1Z4LA 2YRFA 3GAAA 2D2FA 4NBTA 5C81A 2QLBA 3IOCA 5B1IA 4NZZA 5B58T 3T1HB 2EFDB 1E2GA 2AX3A 5JG7A 1CERA 4Y3UA 3VPXA 1XMPA 1NBMD 5EYPA 4YK7A 4DRXA 3HFRA 1GITA 3QJGA 4I7EA 4D9JA 1Y6FA 4UD6A 2XNHA 4IWYA 3G2LA 3W04A 3L7AA 2X8LA 1Q1EA 3V80A 5A4IS 4TUYF 4EKYA 1ZM4A 5BUCA 2GN8A 4EGCB 5TJ9A 1YZQA 1V7PC 4Y2UA 4JI4B 1G63A 1N4DA 2Q1WA 1FXWA 5F64A 5TLSA 3U40A 1SG0A 2PFKA 3L0DA 5EXXA 2YTZA 5AVXA 1VIYA 1G5IA 4PZCA 4YO8A 5B1SA 2TSYB 1XCPA 1VG8A 2H7CA 1M6NA 5K9ZA 3LK6A 1F7VA 4YJFB 1HK7A 1UJ4A 4QUAA 5K6TA 5KMGB 2I91A 2CLDX 3IB3A 1PBNA 4G4IA 2FRVA 3CRQA 4QRHA 4RE6A 3TLJA 2I76A 1E4EB 1S2DA 2QL6A 3RSGA 2GB4A 1ODLA 4TM8A 2LD4A 3KAPA 3SLKA 3VJLA 3H2YA 4X97A 1UUFA 2ZRPA 2JFFA 3A6GA 5EKUA 5COBA 3CURA 5FFMA 5EFZA 5JNWA 3ER8A 2QGFA 4KQJA 1BOOA 1WCWA 1ZRNA 1TK3A 2JJMA 2PR2A 3NH9A 3Q3VA 4BKRA 2VJYA 2GN0A 4NZYA 3ZHVA 1Z15A 5C1IA 4FEYA 4OGGA 4BMXA 1RXIA 1Z2EA 2F62A 3OFKA 1KY5A 4G2TA 5BWCA 1L5NA 2AG6A 2G83A 4YDRA 3RUDA 3LY5A 3MIZA 4Y6QA 1EK6A 4FIDA 3OT5A 5DX1A 3UC9A 3FUWA 4DUYB 1RXWA 1GTRA 3CVYA 4YTEA 2DHEA 2JH8A 1G59A 1P75A 5FTNA 3DEHA 4FFNA 2J0SA 5A62A 4XM2A 1G291 1TLLA 3ADKA 3NRJA 1V16B 4N3GA 4RVSA 3TR0A 4EUHA 4YAJA 5A2GA 3KQOA 2Z3WA 1JHXA 2RG7A 3WMWA 3KTAB 1E7QA 2QMZA 4KJXA 4W5JA 2CJFA 9LDTA 3L06A 5KTMA 1EKXA 1XU9A 4EMSA 2Y27A 1AY0A 2I99A 2O8DB 1E66A 4NCAA 4YI3A 4NECA 3BQMB 5KOYA 4K3UA 1EX6A 3LYAA 2X7JA 2ZUCA 1N2IA 1NJFA 4IMPA 1U2RA 3EW7A 2ZXFA 1NXSA 4OUDB 5HFNA 3KBOA 3USES 3BIFA 1GPDG 4E14A 5J4HA 2Q8PA 5JTUA 3IBFA 1KZHA 2BUAA 1O5IA 1HG1A 2G9ZA 1F1BA 4X7MA 3UK2A 3WGVA 5DPMA 3QF7A 2VQ6A 4S1PA 1Y1PA 1M5UA 3RF6A 1NVVQ 3LRTA 2YJZA 3PQ8A 5CHYA 3HB5X 1PV2A 3IT3A 5JDIC 4NJMB 2J6CA 3GMIA 1OZ0A 1UP6A 1ZK0A 4B48A 5FWYA 3I5MA 4O8CA 1NLUA 3D3JA 4JLJA 3RYHB 4EI2A 4JI2B 4BCCA 3QE2A 3TKAA 1BWPA 1F0NA 3GB9A 1ZD8A 3LT4A 3N0WA 3PC8A 3PI7A 3RAFC 2E5LB 3QXCA 2Z5FA 3KUUA 1HI9A 1PYGA 2M1ZA 2Z09A 1UQRA 5BNWA 1Y8RB 1GO2A 3GVIA 4B4WA 4H6PA 4YCDA 2W4QA 1NATA 3C16C 3KAQA 1DINA 4BV8A 1I5RA 3K16A 4RVCA 5BV7A 1V4VA 2GBCA 3NHSA 4Z9AA 1FP4A 3DWEX 5IH3A 1HDZA 2C03A 2CYAA 2ESRA 1KPHA 2YXLA 4HLDA 4Y2TA 4F86A 3FPSA 5LQMA 1EVIA 3EMKA 1L5SA 1DEKA 5CGZA 1N0VC 1FFXB 2CUKA 1LBTA 2TMKA 2PO7A 1B14A 2X14A 5AO9A 4D4HA 1L4NA 5HM6A 3A27A 3I72A 2O7SA 5TMPA 2FWBA 2ZJAA 3A1TA 1WUJS 5BVGA 5ES3A 4MVXA 4Q3LA 3C7DB 3K8QA 4O3MA 1LTKA 5E6UB 1RKBA 3KZVA 4NH0A 5JCXA 2Y2VA 2EARA 4DKXA 3IEUA 3RIHA 1VA4A 1MRSA 2E3JA 2I65A 1FP6A 3PBKA 1TF7A 2VNJA 1A9PA 1D4ZA 5F2NA 5KTYA 1M8FA 1JEQA 2C5FA 5JCJA 1P4HA 3L1IA 2ZDQA 2REBA 3KKKA 3C8ZA 5F4ZA 5FAKA 1RR6A 4LMAA 1Z5OA 5EMKA 1E2KA 4GECA 2HJHA 2IHVA 1YIDA 4NBVA 4U3JA 5G1OA 3TRIA 1EXWA 3TXAA 3BK7A 3U09A 3PLAE 4PE5B 1GCIA 3E81A 5DLYA 3D6JA 4CGZA 4FLMA 3LTNC 3RIMA 1T6BY 4FDUA 4CDNA 2AI2A 1DBRA 2HHCA 2WKSA 3L8EA 4XAQA 1JVBA 4KYIB 1GKLA 2NTYC 5JANA 1NP6A 3A6KA 3D8NA 3DAPA 4ROTA 3SM9A 4EMUA 4KGZA 1KEEB 2J45A 4UE6A 2IBMA 2W98A 1EINA 1Z4NA 4LRSB 1NSTA 4GUDA 4LYJA 4YB8A 2COEA 3PGA1 4ZOBA 4DVJA 4EHAA 3B70A 2B6HA 1L4GA 4PPFA 4GC5A 2Z98A 4AZ3A 4R5HA 4D98A 1BHSA 3ACBA 5J1TB 2X0IA 1E9DA 1T1EA 4OFXA 1IZ0A 1W0JA 1GP2A 2DPXA 2FPOA 2GWHA 2WKWA 3DDCA 1ZD9A 3DL4A 3AUYA 3HFJA 3ND7A 5I45A 5KNDA 2G1PA 4K6FA 1EEXB 1XNRB 3H6HA 3G8CA 3GYGA 2CNWD 3F7MA 1KMQA 1F38A 2VJAA 3JSXA 2NUBA 3CUTA 5BWMA 3VJRA 1VL6A 2OCLA 4PYOA 4LZAA 2QBYA 1KY2A 2ZYGA 2HSDA 2AYYA 4BJ3A 1OVMA 2HY7A 3MJCA 1NIJA 4Q18A 3GZNA 4Q7QA 4PAMA 5LOVB 1C7EA 4C0LA 1J06A 1W6UA 1NRXA 1PBTA 1S1CA 4H15A 1CUAA 1OX4A 1Y3IA 3BGSA 1F9EA 2PGIA 4R2LA 5A06A 1UEXC 4P58A 5JEDA 1NUSA 1H2EA 3GFPA 3QKSA 1Z0FA 3B38A 1XEFA 2RK6A 3UOWA 4MR7A 4R0NA 1E3LA 4QYIA 1NGSA 2CLLB 2C7BA 2JD2A 2YOHA 3CJRA 4HDSB 1V71A 4QQ8A 1QYCA 1CHDA 2XB9A 1R4MA 4EMTA 3W5BA 4XJVA 3R5SA 5AW0A 4FZ5A 4BBPA 1WMBA 1P1JA 3UMJA 3OEED 2QRVB 1PWHA 1ETUA 2P3QA 1HKHA 1Q2XA 2OBNA 3LP6A 4K87A 3QK7A 4N9QA 3VNQA 1AKMA 4CG1A 5AW7A 4US0R 2W6MA 3AJAA 1R3DA 2Q1UA 4J1SA 4IH4A 2ZUEA 1B6GA 1O4WA 2ONCA 1TEHA 3VR4H 2V0CA 4R2WA 1JQ5A 4E5SA 3LXRA 1PUXA 1ZIOA 5DYNA 1Y8ZA 2O8NA 1QJCA 2ABWA 4A3SA 3G5UA 1BKDR 2W2KA 1KIMA 4J0IA 4GX2A 1Y5NA 3HI4A 4PRLA 1L5KA 4BL5A 3TNYA 3NHMA 1R0ZA 5IJ9A 1ZMRA 4E08A 3LDGA 4GZLA 3MJRA 2XUZA 4ZYUA 5F1KA 4FEGA 2ZANA 3E2MA 1X94A 4B6OA 4U9HS 3BB3A 4MDHA 3RM3A 4L8LA 5ALZA 2HJ9A 2ETXA 4LZZA 1E96A 2W2OA 1QIFA 5JD6A 4FYJA 3WMRA 2SKCA 2XSZA 3B9BA 5GGYA 3UWMA 5FOWA 3OE5A 1U2GC 2FXIA 1Z3IX 3TW0A 3F5QA 2WDPA 1LSJA 1OU4A 3IP3A 1GQFA 1VI2A 3LCCA 1XALA 2FE4A 4JP1A 2NSJA 1CDDA 3GVCA 2VJOA 3EC1A 5EQFA 4DLTA 5BSFA 2MMCA 3HC7A 4ZZ3A 1FNSA 3AEUA 2AR0A 4G8JA 3QUTA 1I33A 4ZV7A 3PVCA 1XBTA 3B60A 3KQYA 3UM9A 5DN6A 3E9EA 1APBA 4MI1A 1CUFA 3AJDA 3WAKA 1OGYA 3WQQA 4GI7A 1W9HA 4CGYA 1PWZA 3EVZA 3GA7A 2PRIA 2VDLB 2ZT6A 1QKKA 3T9DA 1Z06A 4KO2S 1KH3A 1XQ1A 3E9DA 4RZ2A 5LZ9A 3RUIA 3IP9A 2L42A 4RF2A 1E5VA 1ADGA 4FR0A 4KE6A 4QDJA 2HEGA 1NDQA 4WBNA 1Q0HA 3IEPA 5EYPB 4JYMA 1L5GB 1YE8A 4DRXB 4F92B 3PC4A 5I7SA 3LKDA 4YAIA 2X4LA 1SUCA 4XWOA 1JU9A 2W0MA 2D1FA 4JLPA 4Z0TA 1KMHA 4V38A 4NCNA 4WFIA 2XGOA 3GLRA 3KL2A 4C2UA 4A0HA 2VUSA 2AN1A 2YMPA 3DB2A 1EFPA 3Q10A 3QPVA 5TGZA 1HE2A 3SKYA 3MXTA 2PZMA 5JY6A 4B8WA 2D4AA 2O2GA 2NU9B 1AKRA 1M83A 3EQ6A 4QOSA 4HO1X 4M0CA 3KPUA 3QNWA 3LUAA 3EF0A 2GYYA 4K9MA 3O0TA 1FW8A 2V7WA 1SKYB 4ZODA 2QLTA 3C98A 2CWDA 3H9JA 3G2IA 3DGEC 2JAWA 2W7TA 4Y18A 1U0GA 1CR4A 2HTFA 3PUYA 4WK0B 3WKBA 3IX7A 3ORFA 4IEFB 4AO6A 3IIJA 2NSDA 5IJZA 2CXSA 2SBTA 3I9V6 1YSCA 3KYIB 2QP9X 3D6VA 5DV9A 5KJEA 4I1PA 4XVQA 1P2DA 1USWA 1OE0A 2AD5A 2IYZA 1M1NA 2NXNA 1UPBA 2OHGA 2VYND 3H0CA 3OQ1A 2RC6A 4NG5A 4Q4LA 4BTEA 2C57A 3FROA 4I5EA 1R8XA 3MNFA 2XRMA 1M54A 3K94A 4J91A 2BOVA 4F97A 1J7KA 4GI5A 4PO9A 4ZI7A 4I19A 4RD4A 2O05A 4LDZA 4QGGA 5DBFA 1I24A 4REQB 3RPEA 1NASA 2ZIXA 1OUMA 2ZRBA 3K9BA 3GOQA 3JY6A 1KDTA 5BN3B 5TF0A 2NT4A 3G0CA 2HMSA 3C1TA 5A7HA 4Y30A 3GPBA 3EYAA 1VPLA 4BZWA 1JG4A 1BFUA 1P4GA 1CVIA 4UCQA 5J5VA 1R4AA 1ZBDA 4HUQA 2H1LA 2WPDD 4Y2GA 3UATA 4X24A 3VNUA 3HVHA 2H65A 3DXZA 2K2WA 4S1OA 5T4FA 2W43A 3G2PA 1SZDA 2Q5HA 3F7TA 4CKYA 5KYNA 1DXQA 4BXOA 4QX6A 3IUJA 2FR1A 1U7WA 2YHIA 3HA3A 5AOCA 3W3ZB 2YV5A 3CWZA 2ZWVA 4CFSA 2PG3A 2O3SA 2UYGA 3RU2A 2FLKA 4DIBA 1FB5A 1UJ6A 2L19A 2I2CA 2PSSA 4Y9SA 4B40A 4DV0B 4ZV9A 3O9ZA 5ALLA 1NR7A 5T4BA 5FWYB 3UYKA 3NETA 3VM6A 4B31A 5J47A 4G1FA 1SUEA 3D64A 3A1FA 2UXDB 3LKZA 5BRAA 5LZ4A 4B3XA 1KI7A 2FUG6 5KBYA 3SS8A 5CITA 4IJKA 5SZHB 2G4LA 4K9QA 1XTJA 5IBQA 3LPDA 4BHTA 4CTMA 1F7UA 3NBUA 1RQ2A 3NHRA 1PWEA 4BJ5A 3S29A 4KR6A 4B6GA 3DAOA 3GPIA 3GK3A 5DYWA 2FWRA 2IDZA 3PA8A 1MB3A 4WXMA 3WG9A 3UBMA 3RRMA 3GAZA 2K7FA 5L40A 1CLUA 1VIVA 4MUAA 1FP4B 1P2VA 1YBHA 1PW5A 3L3BA 4MK4A 4N47A 4AICA 4DDKA 5K4GA 2WHEA 4R7GA 4EPTA 5IZCC 1QCDA 4EOGA 4F4DA 5AVSA 1DLIA 1HLFA 5INTA 2GZSA 4ZCIA 5F76A 3COPA 2OY0A 1EA5A 5A3QA 2QPAA 4G0MA 1LK0A 4WN3A 6GPBA 1PGPA 5HHTA 3DZFA 3MPUA 1NM5C 1DXOA 5KYWA 5C4MA 3S1SA 2MU1A 3FBWA 3DZIA 3A9UA 3LYUA 1RYHA 2ZP1A 4CU5A 2JFWA 3LQ4A 5GINE 1Z8HA 4XA8A 4A15A 4AJIA 4MA5A 5ANRB 4URZR 5KJFA 1BZYA 4LF4B 2YKQA 1GUFA 4NSNA 2VRBA 3OMWA 3PE3A 5DHAA 3U7IA 4DCCA 5LA6F 3OPQA 2R0QC 3X44A 3LDAA 4HJXA 2WM8A 3MINA 4CTJA 1ESDA 2I34A 3ACCA 2FQ1A 2FR0A 3RKRA 3FD8A 5JI2E 3KWMA 2HMTA 1FFAA 5HBGA 3ZLJA 4AT1A 1FDTA 2OG2A 3LUCA 2BSQA 3L4EA 5AUQA 4MYTA 2MR6A 3CLRC 3PEYA 3RTCA 1I1HA 2QNIA 3CO5A 3O4RA 4EHKA 2ODEA 1Z0DA 4P08A 1YJ8A 3PHBE 3LBYA 4URWR 3SFTA 3VKVA 5JFGA 2LCIA 2B98A 1PSDA 2PWBA 1FEZA 3DT9A 3EXEA 2VQDA 4NMWA 4YNBA 3CT4A 2RSLA 3NTVA 4E12A 3KHTA 1DIGA 4YJKA 5A3RA 1RLOA 1U3VA 4N5HX 2B21A 4YWHA 2G06A 5ALNA 4AZ3B 4GRAA 4UATA 4BQNA 4V3CA 1NE2A 5AM3A 1Q0ZA 1XVIA 3AZOA 4ZZ0A 3AUXA 3ROGA 2Z9CA 4NE7A 1EXNA 3UT0A 5IBCA 4EARA 1O89A 1BA3A 3OZTA 4OXRA 3I23A 4F93B 3AIMA 3OZSA 3TAUA 3WSVA 2QJWA 1I1QB 2AH5A 2AMLA 5LN1A 4KU4A 4C4RA 3UCXA 4Y9DA 1Z6YA 4WGFA 3CU5A 3HCAA 1XXLA 4R68A 2FVXA 4EGQA 1ODIA 5CDFA 1Q7EA 3EFHA 1UFKA 2ZVPX 2AOUB 3HSKA 3GXBA 1YJCA 5DHUA 2I62A 3KZMA 3SSOA 1OX4B 2ENWA 1HLDA 1MBZA 2I4TA 2QUAA 3AHIA 4TTPA 3K1TA 2OBYA 4Y1RA 1MC1A 1NN0A 5TXGA 3QKSB 4D99A 5CFNA 3M4XA 1G8FA 3ES9A 2DWQA 3LC0A 2CBZA 5FFFA 1K68A 3TRDA 2XOEA 1AF7A 2X9NA 1QRUA 2PQ2A 3FA2A 1XCMA 1XRMA 2RHBA 4C4YA 4HTAA 2QRZA 5HCUA 1KK3A 2QTWB 3Q98A 1U8AA 2NX2A 1SC1A 4J2HA 1NVMB 3R4CA 4JX8A 1TF2A 4WLUA 5IS2A 1M1ZA 4KIWA 3HKCA 5IJWA 1A8PA 3CG4A 4IS3A 3F6RA 1K7EB 2GNAA 5FUQA 4Z53A 5AVJA 4MUXA 1IHOA 4BWVA 4K0KB 2R6HA 1BHO1 3DZCA 4UNRA 2WSBA