2ZR9A

Msreca q196e datp form iv
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
327
structure length
312
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEHVGLQARLMSQALRKMTGALNNSGTTAIFINELRTTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 100
structure length 312
sequence length 327
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zr9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zr9A01
2IEZA 4ESHA 5DISB 2IYVA 3AVUA 3A6PC 1I4TD 2QT0A 4IOMA 3DMDA 4PC2A 5JI3E 4D0NA 3ZD6A 4D4LA 2P5SA 2Q9CA 4C0QC 2XITA 2O8FB 3C5HA 1GVNB 3QKUA 1LV7A 2YOHA 4QM6A 2O0HA 3OEHA 4DLSA 4XD7A 2ZSDA 3DEFA 4UJ5A 2H92A 2IW3A 4G5RA 1E2HA 1I2MA 1WXQA 3TK1A 4BLPA 1R2QA 1X1RA 3NEJA 3UPUA 4Q5IA 4MGZR 3U5ZB 2ZM5A 1UKYA 2EFGA 1QBKC 1Z08A 3WBJA 1LB1B 5K8UA 2WV9A 1NMZA 4HYYA 4RFSB 4URVR 1FP6A 2KJQA 2RGNC 4QL3A 1ZAKA 3CH4B 1W4BA 2H17A 1AA9A 2Z5FA 2BIFA 1BH2A 3K0CA 5EUMA 2WJVA 3FTQA 1QHXA 3OE7A 4G5SA 3MWYW 1KY3A 1TPZA 3AF1A 2A5GA 2XTNA 2P2LA 1UKVY 3A4NA 3OE7D 4QHTA 1QHNA 2C78A 3B7GA 1US8A 5FOTA 5JS8A 2H8KA 1S96A 5JJLA 4XSGA 2FG5A 1HUQA 1UF9A 1OT3A 1XD2B 1N0WA 3GPLA 3W6OA 4O2LA 4B76A 4A1FA 4MRSA 4UNQA 4BECA 3VKGA 4W5WA 1VYUA 4GOKA 4GZMA 2R6AA 4Q18A 4Y0AA 2WSSA 1AQYA 5FH9A 3Q7PA 4JLDA 2ZROA 2VP6A 4LJ9A 4WIAA 5CM9C 5BXQC 1WB9A 4IFEA 2WJIA 4NYIR 1NG9A 1OXVA 4QBHA 1XCPA 1S2MA 2CJWB 1A5TA 1TUIA 4V0LA 2NO7A 4C0AC 2QSZA 3THXB 1DAGA 1OXSC 1QVAA 2Z4SA 3NHAA 3AVVA 2ZETA 3GLIA 3OFND 5DI3B 2LKCA 2CE7A 4PPGA 5EXPA 3OAAA 5AWFC 3IILA 1JAHA 5BQ5A 5KSYA 3LRPA 1OH5A 1BYIA 1II9A 1FOEB 4Q47A 3AVOA 3GQBA 1SVKA 1ZC3A 3RHFA 2QU8A 2FH5B 3QXCA 4NP6A 3UMFA 4UXIA 4TZ6A 5C4GB 3SJCA 4LWZA 4TLBA 5FOSA 4D6PA 1KJWA 1EX6A 2JASA 1XTKA 2QMOA 3F8TA 5CLLA 2RGBA 1F60A 4QC2A 1G21E 4TYQA 2PT7A 1XEFA 3BH6A 3AF0A 1KZ7B 4EQ6B 1YR8A 4JJKA 4KO8A 3TNFA 1W5TA 1GAJA 1KI6B 3GFOA 3CNNA 2NPFA 3IIMA 3SFZA 2H1LA 4TSFA 1WBDA 4A2QA 2A5FA 4TMZA 5B30A 1NP6A 1HA3A 1TF7A 4DT1B 1VCNA 1PUIA 3F0TA 3KKOA 4HAXA 4P4SB 2MSDB 3AP3A 2RGEA 2IUTA 3BE4A 4CW7A 2WJYA 1Y3AA 2J87A 1GKUB 2XXAA 5GJCA 1IHUA 5DLQC 1KMHB 2NO6A 2PEZA 4LBZA 4RCYA 3ZIAD 2W6ID 1EFCA 5DH9A 4TLEA 4C0HA 2CE2X 3I72A 3UWOA 3ZVMA 2IT1A 2ZS9A 5FTJA 5J4VA 1H8EA 4B3DA 1TQ2A 1T3LA 3FPAA 3PUVA 3LQQA 1JI0A 2PZGA 2CBZA 621PA 3RS3A 4LOAA 4UXHA 3C15C 4MKIA 4Q66C 3QI2A 2QRNA 4MRPA 4IXMA 5TVKA 4OI4A 5FOWA 3SZRA 2VF8A 2VSXA 4M9ZA 2C2HA 3ADBA 1P9WA 2AFIE 4OJQA 1RRCA 2FNAA 1Z63A 2BV3A 1YKSA 1G8PA 1SVLA 2ZSBA 3GJ5A 1G5RA 3IBGA 3I8XA 1Z5ZA 3A1UA 4CYMA 2CL6X 4IDNA 3I3SR 4YDHB 3LBNA 1ZD1A 1R0XA 2EWWA 4EQ6A 3R9WA 1N5KA 3TW4A 1U90A 2BEKA 4M22A 3KQNA 3AP2A 4KVGA 4G5QA 2X1VA 5SZKB 1E1QA 1T3HA 2QGNA 4TLDA 5AJYA 5CDFE 1WF3A 2BDTA 1N0VC 1J70A 5JWHA 5C4MA 2X19A 1NIJA 1TQ4A 1NKSA 4MGYR 2V3CC 2VF7A 3CX6A 1QHGA 5G3ZA 2IUUA 3VMFA 2VEDA 5EE3A 3TIFA 4HI0E 2WKRA 1D2MA 1DEKA 2V1XA 2YC2C 1R6BX 4JT4A 4TL7A 3K9GA 5EZ5A 1J8MF 1G5TA 5E3HA 4KITB 5KSPA 4BFUA 3B82A 2D62A 2GWHA 3CB4A 5B57C 1XMIA 2ZRDA 2HJGA 3MJHA 4TMWA 3T61A 2R6DA 1XD8A 4LI0A 1G7RA 5J5CA 2WZQA 4RCZA 2JDID 2IYRA 1JALA 5EE9A 1GP2A 2GJSA 2WIAA 2BM1A 2ZYUX 5L3SA 2QBYB 2YWGA 3UXMA 2X2EA 2J46A 2ERYA 3LO5A 4TYPA 1LTQA 3VR4A 4YMVA 2BBTA 1ODFA 3D7MA 1IXZA 3DVLA 4JLAA 1ZM9A 2FFHA 2JJ8A 2RGGA 3H84A 3UG7A 4BZQA 2JEOA 3LNCA 2BHRA 4RD2A 2JJ2D 1P9NA 2ATVA 1YRBA 2BKUA 1ZNZA 4FMBB 1M7GA 5AUQA 4TTRA 5FI0B 2WPDD 1OV4A 3HJNA 2YWHA 4TT3D 4FWIB 2AKYA 2OESA 1OH6A 3VTKA 4BRUA 3SQXA 3BOSA 1E4VA 1SXJE 2CHQA 4M1MA 1YZQA 2IYTA 4QNMA 4HLCA 3TUIC 2PZFA 2WMNB 1GNQA 4LBYA 4A6PA 1ZJ6A 2KSQA 4PC7A 4WZAE 4NE2A 5AK0A 3EZ6A 1WA5A 3O8BA 4A82A 3DZDA 2IBMA 3VQTA 1P2SA 2RMKA 2VYFA 3LW7A 4AIIA 2WJGA 1GDDA 2Q0HA 4NYMR 2QTFA 4GOJA 4JVNA 4NCIA 1KAGA 2V1UA 3L2OB 5KHOC 5IRCD 1KDTA 4I1SA 3X1WA 1CR1A 2GZAA 3JVVA 2IYYA 3C14C 4F92B 3FGNA 2WIBA 4JYBA 2W0SA 4HB2A 4TLAA 5G53C 2NO1A 1W36C 1WBBA 2BWJA 2WWFA 5FTKA 5CK4A 5UKDA 1COWD 2ATXA 1S4QA 2FJUA 2OBNA 3TUZC 4FMDF 3Q5EA 1ONBA 4E5UA 1F2TA 3NBZC 3TBKA 1PV4A 2RGAA 3RNLA 3P26A 2RKOA 3OFNA 4LYJA 4MUBA 1X8LA 5FI1B 4PAOA 4W5HA 2GAAA 4B3GA 5HZKA 2EW1A 1D8TA 3KQUA 4N3NA 2HT1A 4Y0VA 4MKHA 2ZREA 2OM2A 1G4AE 4DZZA 2Q3MA 4YMTA 5KDOA 1XNJA 1RC8A 1UFQA 1A4RA 2G1KA 1FPMA 3CONA 1MO6A 5HKKD 5FUXA 2GJ8A 5ANRB 3IIKA 2R65A 4DUGA 1VCOA 2FSFA 3RWMB 3FMOB 3SHFA 2BJVA 1A1VA 2WOOA 4QJ4A 5A4JA 2FE4A 3BFXA 4JVSB 1EGAA 4H1UA 3BS4A 2Q3HA 1KMHA 2IYZA 4F7WA 3QKRB 4A0FA 1G18A 1VG8A 2XZPA 4BLOA 2QTVB 4V0KA 4KYIB 1Z0FA 2DFKB 3C7KA 1FQKA 5LD2C 1KJYA 4NDZA 4HATA 1XWIA 2PMDA 3PV0A 5HZHA 2QM8A 2CHGA 2X8AA 3CF2A 1OB2A 1Z3IX 4QJ5A 1T9HA 1CP2A 4DLTA 1WQ1R 1U0JA 2OZEA 2PBRA 5J4KA 2J0VA 4KSCA 1U2RA 4OQFA 2VHCA 3U3MA 5HE8A 5KOYA 2ZE8A 1NNEA 3QKTA 2P0EA 1YHNA 2N46A 1JPNA 1LVGA 1N6HA 4D0GA 2QN6A 2QP4A 2AX4A 4Q4AA 1WMSA 4XD7D 3OEHD 3EPLA 3H0KA 4LCBA 4G3XA 2J0QA 3RDPA 5JCZA 2PZEA 2CLDX 2IXGA 4IOJA 4EPVA 4V03A 1EX7A 3E5HA 3EA5A 1Q1EA 3QF4B 2N1BA 2W6JA 4QOSA 4PAMA 4ZO4A 2R9VA 5FBQB 3CZQA 3TGPA 1RJ9B 2DWOA 4LV5B 4P32A 2A2ZA 2GCOB 2W83A 1E2LA 3RRMA 4M1YA 4DLVA 3ZDQA 3ZLJA 1TAGA 3GLHE 3VHXA 1U81A 3DHWC 4M1TA 3X1ZA 5JBQA 4LSGA 4L8GA 2ZRCA 4IHQA 3W34A 1CJUC 4OHWA 1CRPA 3GCGA 4XJXA 1DOAA 3Q5DA 4BLSA 2QG6A 3BORA 2VHTA 3UATA 4AI6A 3NVAA 1I2DA 4TN1A 4FXPA 1NBMD 4N1AA 4QHSA 2JCSA 1TUEA 1TNDA 1XEXB 3CKLA 5EQTA 1K8RA 1Q1ZA 1KI7A 2EFCB 1HQYE 4AG5A 1Z83A 2YJTD 1JR3E 2OG2A 3LBIA 1VCIA 3EZFA 4DBLC 3Q7QA 4II7A 1NLYA 1AS0A 3NWJA 2F43B 1OIXA 1RRFA 4G01B 4M4SA 1YQTA 1HE1C 3P1JA 3QKSB 4TYWA 3AP1A 2GXQA 3PQCA 4FD2A 4DB4A 1SVOA 2XNSA 1ZRHA 3HU1A 2CCJA 2L0XA 2FFQA 5IDVA 4OK3A 3ZZ0A 2G77B 2QE7A 2OCBA 4TMTA 1NY6A 1FX0A 1P2VA 4PHHA 3SS8A 2R6FA 2A9KA 4U00A 1JEEA 3BB4A 4LV8B 1RKBA 2ZUBA 2XEXA 2HEIA 3G82C 1ZNYA 1ZUIA 1Z22A 1RFLA 1IOZA 4TTPA 1VYTA 4B44A 3Q3JB 2GCOA 2AD5A 4ZIRA 1XDBA 3CLVA 1RPZA 1VDZA 2OO7A 5TB5A 4I1OA 3IO5A 2OUKA 3PENA 3NEYA 4A6XA 1UBEA 5LDDC 4HUQA 3ASZA 3VAAA 1W4CA 1OFUX 3NH9A 4Q9LA 2QP9X 4B74A 2EYUA 5B58C 2D2FA 1GSIA 3D8BA 3WNDA 1XMJA 1D2EA 2ZRMA 3BERA 2F1RA 1M74A 2GKSA 1R5OA 5FL3A 3PIRA 2B8WA 5EP4A 1HURA 4HAUA 4AY2A 1KI4A 1I4LD 2QENA 4B32A 3UANA 2QP3A 2PMKA 3TRFA 3EC2A 3M4YA 1F2TB 3OAAD 1R5NA 2ZE6A 1P72A 3K9LA 4L4UA 4ZI2A 2ZRNA 3PCRB 2V9PA 4F38A 2QEQA 2J5XA 4LRWA 3BB3A 3U4QA 2GEVA 3HYTA 2G9NA 2WMOB 4KLZA 2BBSA 3BRWD 4KXFB 1KDOA 1L4UA 5H68A 1KMQA 2I1QA 4A0HA 4IEIA 4B6EA 4CIDA 1S3SA 3AVTA 2P65A 1ZM2A 1SVMA 4HB0A 2ZYVX 4WVFA 4RKEA 1E2DA 1E6CA 1U98A 4EUNA 2ODNA 3DMNA 4NPHA 3VU9A 1G8HA 3ZVLA 3QVVA 2EFHB 2RGXA 4IEEA 2C98A 4EIWA 1LW7A 3SBDA 4B34A 4CEHA 3P4YA 4CEIB 1IN7A 3I5YA 4B2IA 4ACAA 5L3QB 4JIMA 5BYKA 1VHLA 5DI9A 1UBCA 3IEUA 2W0MA 5GVSA 1KHTA 1XBTA 2NGRA 5J47A 2JLUA 3K8YA 4M0LA 1G7CA 2HF9A 1UEJA 5CDFA 4OI2A 1E94E 2D4HA 2RB4A 5DN6A 1OE0A 3REGA 1Z6GA 1N5LA 2J3EA 3KTAA 1Z0DA 2WAYA 2WKPA 3W9YA 4ARZB 2R2AA 4XTRA 5M04A 4FCWA 3FMFA 2FSGA 5KSZA 3WP0A 4Q9JA 1YR6A 1Z06A 1Z47A 1E2KA 4K46A 4K8OA 2DYKA 5HE9A 3VR1A 3LXRA 1EWQA 2FV8A 5BW8A 2BCJQ 1ZVQA 3V4FA 3KJHA 4HLDA 4W9MC 4A9AA 2JLZA 1ZNWA 4BUJA 4BFSA 4UNNA 3K9NA 4CT5A 4JL5A 1HT2E 2D7CA 2IA5A 1CJKC 2WSMA 1F6BA 4RZUA 1E9BA 2OCAA 1T0HB 1W0KA 2YZ2A 2R62A 2PCLA 3A4MA 5JJKA 1COWA 4IOKA 1KSGA 2NMVA 5KU1A 3KB1A 4NYJR 1G8GA 3UKDA 5EP1A 2OBLA 3U2QA 3PEYA 2B21A 3ONWA 2BMDA 3FE2A 5F9FA 2PL3A 4GMXA 4JZKA 4A36A 4DIEA 2EFDB 2NPIA 2EYQA 4K81B 3GLGA 3TAUA 3LLMA 1KO1A 2ZIAA 4PSKA 1BO6A 1DE0A 1A2BA 2ZJYA 1CEEA 2OV2A 1GUAA 4RVCA 1E98A 3O8RA 1M8PA 2ZS7A 1RZ3A 4MYCA 1CJVC 4MDEA 3K70C 3U4QB 5EE0A 4POAA 3KQKA 2MSCB 2EFEB 3CH5A 1ZD8A 1VG1A 5B2ZA 1ZU5A 4ILEA 4IKEA 3VR5A 5AUPB 3CRMA 3SQWA 2ZI4A 2ZITA 2D74A 1MR3F 2C9CA 1E2PA 3E1SA 4FINA 2OBMA 3C8UA 4L15A 1AK2A 1P6XA 1VMAA 3PEVA 3IGFA 1G5PA 2G3YA 2NOAA 4DJTA 3PEWA 2IHYA 2ZVQX 1Z0JA 3VU9B 1ZM3A 3DM5A 4D0LB 4C2UA 3AKDA 3RANA 1E1RD 3TAHA 1AS2A 1LNZA 2G6BA 3Q9LA 1FNNA 4GPTA 3A8TA 1G3QA 4B48A 1G16A 3GEIA 5EXTA 3GLGE 4M9SA 5DO9A 1G3IA 1IAQA 1W2HA 1EFUA 2NO9A 1II8B 3C4JA 2AWOA 2W2XA 3QNUA 1ZIOA 2DFLA 2EU8A 2O0JA 3DDCA 4Q4JA 3W8NA 1KI8A 1U8AA 1UEIA 4HDQB 2GJ9A 2V4ZA 3WNCA 2HV8A 2GILA 4Q01A 5FBLB 1J7KA 1KI1A 1KO5A 2F6RA 2UVQA 1XB2A 2HCJB 3W90A 3G5UA 1TU4A 2WICA 5JWRA 2QZ4A 1HYQA 2GA8A 3CF0A 5F9HA 3WNBA 3KJIA 3CM0A 5CYOA 5B64A 1E0AA 2PH1A 4Z8YA 2VP9A 4C4PA 3KX2A 2QQEA 1U0HC 1B23P 2RAPA 4B73A 3VKWA 4NCJA 1AS3A 3I1FA 4FN5A 3U6KA 1CULC 1E2JA 3JVUA 3W3AA 4CVNA 2H18A 2QROA 1FZQA 1OIWA 221PA 4FI3C 2ZUDA 3SJBA 1E32A 4C0LA 1IN5A 3GJ4A 3ZVNA 3MWLA 1UM8A 3T5DA 4OJKA 4HLQB 2FPKA 1DELA 3DZ8A 4HEJA 1JXOA 4RD1A 4QBGB 1NI3A 1G7TA 3C5CA 1G1MA 2NG1A 5C18A 3QKRA 5KUTA 5G40A 1AKYA 1E0KA 1VPLA 2PT5A 2Z43A 4FW9A 4AD8A 1MABB 4MGIR 3CIOA 3KUDA 1IN4A 1AQUA 4XH9B 3FFAA 4BRWA 4JLNA 1N25A 1OXXK 2JA1A 4HB3A 2BMEA 3UMSA 1H8HD 3AKYA 2C8VA 4R9UC 4YMWA 3WRXC 4EFMA 1MABA 2FSHA 2QBYA 4DCSA 2ZRAA 1V5WA 4DSTA 4QRHA 4AURA 2ZSEA 4DSUA 3KZ1E 3R9IA 1MO4A 4KVAA 2QRZA 3IIJA 4YQFA 1Q20A 1KO7A 1JR6A 4DCNA 3VNVA 4HB4A 5JS7A 1ZMXA 1XJQA 2ZI6A 1F3OA 1WDTA 1S1CA 1AM4D 2J1LA 5FTNA 2LCFA 3K0FB 4YONB 3EARA 4M21A 1FW6A 2RGDA 3U61B 4QKQA 1CS4C 2ZU0C 1A82A 4Q21A 1H65A 1E2IA 1E2MA 1Q1BA 4AG6A 1W0KD 2WJHA 3BH7A 5AJZA 3CR7A 4P31A 3TKLA 3B78A 2YVUA 2A3RA 1RRPA 1TU3A 4RY2A 2MSEB 4Q7JB 3KKNA 3B1YA 3IPYA 5DSZA 3SHWA 3GLIB 5JFGA 3RYTC 3A58B 2CLSA 4URWR 1ETUA 3H86A 3L0IB 2QI9C 1DADA 3GLIE 2A5JA 1G20E 1OHHA 3TE6A 3ZS8A 2V55B 4LHYA 4DRZA 4Q03A 1L7VC 3GFTA 5BN4A 1W0JD 4OI0A 2DWQA 1R0ZA 1QHYA 5AR1A 3TJZA 3X1YA 5CITA 3FWYA 2VSFA 1MV5A 3GD7A 3QEJA 2J7PD 5L3VA 1GFIA 2D06A 4Z54A 3Q72A 2GVZC 2J0UA 4Q4HA 1SXJA 4LX0A 4YMUA 5AJXA 5DN6D 5EP2A 5CIQA 4O0MA 4CRWB 3GJXC 1G3MA 4NCKA 4Q1CA 3QG5A 3TVDA 5H8WA 2ZRHA 4HAWA 3D31A 4PANA 4CEJB 1SGWA 4LPKA 1RVDA 5CB8A 1YZGA 1S9HA 2IS2A 2O8FA 4YXWA 2KI5A 4L5BA 2GXAA 2E87A 4TMVA 2AFHE 1D9ZA 5H1YA 2ZS8A 1GNPA 2VIIA 3I8SA 4J0QA 3WYFA 5E7IA 5JRJA 4LZZA 5JHGB 3B2EA 1DAKA 4PTLA 1UDXA 2CK3D 3FDIA 3P20A 4CZ2A 4BEBA 3SYLA 4B2LA 2ZSAA 2Q9BA 4G1UC 2OT3B 4RFSA 1CR4A 3W6NA 3QJYA 1LY1A 2JLQA 5JLJA 1E9FA 4LUCA 4OKSA 1K5DA 4BQSA 4GOXA 2H16A 1L2TA 3NDBB 4B71A 1M7HA 1VCMA 2IK8A 1P61B 3BWDD 3X1XA 2JLYA 4JL6A 4KCGA 4OQNA 4CGZA 1TQDA 1Z29A 5FR2A 3TQFA 3NBFA 3BK7A 1Z6AA 1CRQA 4BE7B 2EQBA 3K70D 4A2PA 3PVSA 3U6BA 1CXZA 3C41J 2ZRKA 1G3UA 3B1ZA 3MCAA 4HZUB 4UQOA 5JCPA 1KK0A 2H7VA 2AKAB 4NL4H 4D4KA 1M6NA 2V6IA 1PLJA 3CX7A 5BWMA 3PG5A 1J90A 1E9CA 3EA0A 2FU5C 3L43A 3W5JA 5A0FA 3MLEA 2HF8A 3LH5A 4NYMQ 3OEED 2ZANA 2GEDA 3K0FA 4Q00A 4R7ZA 2A30A 4LDJA 2ZQ5A 3A1WA 4TQAA 3TLXA 3QBVA 1KDPA 2ZAMA 3HU2A 4A2WA 4MDFA 2E1RA 4LGMA 1VIAA 1PLLA 4OI1A 1OH8A 2WJJA 5F98A 3B1VA 2GDJA 4JJZA 1XEWX 3OEEA 3NBXX 2NQ2C 3AB3A 4ZPXA 2G0TA 5K8LA 5IT5A 4YMSA 3DKVA 1YZUA 2ONKA 3BJIC 3HWSA 2XNDD 5TV2A 1W5SA 1OXTA 2F3RA 1YU9A 3R8CA 3S1AB 2FF7A 2IYLD 2JAQA 3AM1A 2PJRA 1BMFA 4BFTA 1KI2A 3EIHA 4D4MA 1W4RA 1DAHA 3EW9A 3FHCB 4JLKA 3LWNA 1XJ0A 4X8LA 2IC5A 1KSJA 2BOVA 1Z2CA 3O8CA 4CEHB 4CEIA 3PFIA 3WBKA 5KPJA 3T1VA 1J8YF 4S2EA 3FYHA 4R71A 1OH7A 2X77A 5CM8B 2NZ8A 1FL9A 3IDQA 3EASA 1XP8A 4R2HA 4I99A 4PPFA 3T5GA 1PLKA 2XSZA 2WVJA 3BBPA 3ZQJA 2BCGY 1YR9A 4KSBA 2C9YA 4A8JB 3THYA 2CEAA 3BB1A 2P6RA 2W2TA 2QAGA 4JLJA 5FR1A 1W48A 1OF1A 2V7QD 3HDTA 3WP1B 3B1WA 4ZDWA 4A15A 1MO5A 4XTCS 2XZLA 2NTYC 5D3QA 2F9MA 4V0ME 3K0SA 1XPOA 1T8UA 2JLVA 4JVMA 4DT1A 4ZKDA 3OIWA 1DVRA 1E2GA 2IF2A 3NDPA 2XGJA 1YE8A 2H5EA 2QT1A 5HCIA 3ADKA 1OJLA 1Z0AA 4LBWA 4RD6A 4WAUA 4DXAA 2J45A 1NIPA 1T0JB 2A5YB 4PHFA 2AK2A 4HAZA 5DYGA 3NG1A 1S0UA 1OYWA 3NH6A 4ABYA 4LJ8A 2ZJZA 2HXYA 2DFNA 2WWHA 4DUGD 1UBFA 4I81A 1QZXA 2P67A 4Q4JB 4CDGA 4PHTA 2IYWA 4I1VA 4LJ7A 4EJSA 3J81k 3KUCA 2DBYA 5TMPA 4MRVA 4KYUA 3CNOA 1JB1A 2WOJA 4BZXA 2WM9B 1X8KA 5KYKA 3A1TA 3AF3A 1JJVA 1JQJC 4A92A 3UIEA 2P3SA 3FOZA 1MT0A 3KFXA 2O8CA 2D2EA 3U60B 1JAIA 4XIGS 1SXJD 4UJ3A 2ZTSA 1L8QA 2QAJA 4Q4AB 3LQRA 3RS2A 3U44A 1IXSB 3KXLA 4Q1DA 1W0JA 4Q7KA 1NLFA 1C1YA 1E2NA 1GTVA 2CMKA 3UK6A 5FTMA 5CJ2A 2JLRA 1TEVA 3QIAA 4DIDA 2QGZA 1E2FA 3OF5A 4TL8A 2VHUA 4UXJA 4F4CA 1XMSA 4PO8A 5KPDA 2VA8A 4P4SA 2F55A 1TF2A 3A1SA 5GJWC 1TX4B 5CJPA 3CBQA 2PLRA 1RYHA 3K70B 2X2FA 3EZ9A 1E2QA 5DHAA 1MRSA 1GL9B 4MKGA 4OL0A 4WZBE 4D81A 4TL6A 2GBLC 1GG2A 2V54A 4WOPA 3IKJA 2ZJ8A 4BFWA 4MA4A 3VR2A 1QDEA 4BZPA 3G0HA 1ZNXA 4JL8A 3VKHA 1IY1A 1G8FA 1RRGA 2QQ0A 3QE0A 4ZDKA 4IVPA 5EJEA 3DPUA 2OSBA 4BLQA 2FEOA 4PZYA 8OHMA 1R10A 1M1YE 4PPNA 1NN0A 4E03A 1YZKA 1DAMA 1ZM4A 1AN0A 1E9EA 4C7OB 2ORWA 1NG1A 2W2VA 4GMDA 4BFZA 2PX0A 4FCVA 2IUSA 3L8ZA 2GJKA 2O8BA 3QEOA 4YLGA 2VSOA 4HDCA 4LBVA 3B6EA 3IPXA 2O8BB 2CDNA 3QKSA 3PJRA 1QRAA 3GLFB 2F43A 3T1QA 4EJSC 4WXRA 3LXXA 3T12A 5CLQA 3A4LA 2REXB 4DSOA 1VECA 1X3SA 2G1JA 2UZ3A 1FX0B 3SN6A 2C5LA 4LPSA 5DYIA 1CLUA 4UNRA 2EVWX 2JDIA 3MAAC 4M2LA 1RE0A 4WZ6A 4PSVA 4BPBA 5FOUA 4C30A 4FWTA 4JMPA 2FWRA 4ZI3A 4UKDA 4P0TA 1IY2A 2XZOA 1RJ9A 4OQMA 4D2IA 4C0KA 1NN3A 4Q1BA 2ZE5A 2FOLA 2ZEJA 1NRJB 1SULA 5KSOA 2ERXA 4QXAA 2AK3A 4GI7A 1Q0UA 4PZZA 4DDWA 4FIDA 4P3YA 3FVQA 3IO3A 1NY5A 5DHFA 4ASUA 3MWJA 2ZI7A 2QL6A 3RRNA 1KK2A 2FZLA 3I32A 1EFRD 5DGXA 1YVDA 6Q21A 1QHIA 3T35A 3HPRA 1EK0A 4BLRA 3A37A 2FPMA 2HJVA 1RYFA 3ZQ6A 3I73A 1NVWQ 4XOIA 2GTPA 3B1XA 1HY3A 1NN1A 3CRRA 3WHLA 2ZJAA 4HUTA 2YWEA 3K09C 1IM2A 4C0BA 3H2YA 2VRWA 3CPHA 1Z8FA 4NYJQ 4O2RA 1W4AA 4BFVA 5DIFA 5JSZB 2BMFA 4DHEA 4OBEA 3A36A 3CF6R 3RS4A 3RS0A 2DPXA 4OQXA 4RFVA 5FTLA 5EXSA 4Z1MD 4TQUS 4QBFA 2QPAA 2DCUA 3U7HB 2QPTA 5EE5B 3LY5A 1G8YA 3R20A 4DLWA 2NZJA 2QMUA 5JWOA 2O8EB 1IN8A 4V0MA 2FZ4A 4JLVA 1TADA 1NMXA 2B92A 3CPJB 4BWYA 1GITA 4R2IA 2ECKA 4RJLA 3O8DA 4DCTA 3TVTA 2XOKD 2REBA 4R98A 5CK5A 5KNDA 2O0KA 4AK9A 5C2JB 2FA9A 1R4AA 4URUR 1XEWY 3SU8A 3ND9A 1R0WA 1X8JA 1U8YA 2VH5R 1T5IA 2HXSA 2QSYA 3V00A 3PUYA 4TWZA 1NL3A 4MGKR 1Z6YA 1ZP6A 3TSWA 1FMJA 3MGCA 1XMVA 1II8A 5D3MA 1G41A 1N6RA 3OIVA 4JLOA 4XWOA 3GJ3A 1FTSA 3LAWA 4C9BA 4Z51A 2OXRA 2QA5A 4PO1A 3LX5A 3QVUA 1SVWA 2GCNA 4JYCA 2BEJA 4C3ZA 2J0UB 3B8HA 1Q1QA 3EG5A 3QPVA 4GNKA 4IDPA 2DY1A 4AWXA 2ANBA 1KOFA 2BMJA 1KYIA 1W36D 1OFTA 2GF9A 3LVRE 1E99A 3B60A 2ODBA 3KXKA 1XXHA 4US0R 3VX3A 3CPEA 4N0DA 1DAEA 1XXHB 1KO8A 3FHTA 4ITRC 4KBGA 2VHQA 3GMTA 5IK2D 2V6JA 4HDOB 3AUXA 5IF9A 1SKYE 4Q1FA 5TY0A 2BJWA 1PUJA 5EZ6B 3SFVA 4ACBA 1C9KA 3N5CA 2IX3A 4PR0A 3QPUA 1S8FA 4TTQA 3NHBA 3K09A 4M1WA 1OYYA 3K1JA 5JEDA 3PEUA 4FMDB 4G5GA 2HCBA 2OFWA 3LBHA 4TMKA 1UJ2A 5KO2A 1F48A 1SQ5A 1YR7A 3QG1A 4KLNA 2C96A 2FGJA 1W2GA 2C95A 4X8OA 3LW8A 3R7WA 1UKZA 2GZHA 5KTYA 4LHWA 1WCV1 5L3QA 3M0EA 2OHFA 1E79D 1KSHA 3OZXA 1XTIA 5JRZA 3TR0A 2PX3A 5JZVA 4JBWA 2PEYA 4M1KA 1NLZA 4ZV4A 4BLTA 2RH5A 1UPTA 2JLWA 2CHVA 2JJ1D 3KDSE 3N2EA 4KU4A 3SEAA 2ZRPA 2CK3A 2WPDA 2C9OA 4OK5A 2G0NA 2Q6TA 3IHLA 4LY6A 2ZR7A 2ZI3A 2HYIC 5KDLA 5F3WB 3FKQA 1N3BA 2KWIA 3K0CC 4DDUA 2DWPA 4W5JA 3GLHA 3WY9A 1IJFA 5J4YA 4M8NE 4XWKA 1XPRA 1N6NA 1NN5A 2IEYA 4NTZA 2XXAB 2O8EA 2ANCA 5FBRB 3MWKA 5LB2A 4URZR 1P3JA 1YJ5A 4DSNA 3EZ7A 1E0SA 3MUFA 2F1IA 4YXWD 4AKHA 4QGGA 1BIFA 5TXGA 4Q19A 2CL7X 2WWWA 3RS5A 2GCPA 4O25A 3IQWA 4EJSB 3EPJA 3X2SA 5BN5A 2ZRIA 3LX8A 3CO5A 5DNYB 4DWJA 3LA6A 4ZKEA 2OILA 4XVRA 3QUSA 2PLFA 4UNPA 1TTTA 3EWAA 4MQBA 3GJ8A 5KNCA 1OW3B 4ESVA 4JKYA 1FUKA 2WBLC 3FFBA 1ZM7A 5KDDA 2Y8EA 3F5FA 4FMCB 2SHKA 3EC1A 3ZZTA 3GLGB 3ZGXA 3EPHA 1E1QD 4JT2A 1TEXA 2FDCA 2ZR0A 1GM5A 5BN3A 1O87A 2IYUA 1ZBDA 2A5DA 3KJEA 3L8YA 3KL4A 4FMCF 4NH0A 3DO6A 4RD3A 2D3WA 5FPYA 4P33A 4P4UA 2F1HA 5ELXA 4TQ9A 3T1OA 1J99A 3E2IA 1SXJB 1GILA 4Q9IA 1JXMA 2MMCA 2ODEA 5K8TA 4BEJA 1SVSA 2WTUA 1PZNA 2QAGB 5JEEA 1KKLA 2GK7A 3ND8A 4PXAA 1GIAA 3MRSA 2AWNA 1DAIA 1B0UA 3GLFE 1IY0A 1Q12A 1HTWA 5FUVA 4IFBA 2JJ1A 2IYQA 2V7QA 1IXRC 121PA 3CZPA 4A8JC 4PPQA 4V0OA 2NO0A 2YKGA 4QGAA 2QNRA 3ZS9A 5CYPA 1GNRA 1ZYUA 4KAXA 2AXPA 3RSOA 2FMXA 4C0SA 1KAOA 1H8HA 1M2OB 4JSTA 3X1DA 4JBYA 2CCGA 5SZHB 4LHVA 1CR0A 3GEHA 4U7DA 4ERNA 1G4UR 5E7JA 2W00A 1US8B 3I92A 3VR3A 4M9XA 2CXXA 3FMPB 3E70C 4M9QA 4F4JA 1KKMA 1KZGB 4PO9A 2ZJ2A 5FOVA 2Z6VA 4KFSA 1GKYA 2IWHA 4B3FX 2GK6A 3FKSD 1R0YA 3OIUA 4EFLA 1JJ7A 1P9RA 1XJCA 3GLFA 3GLHB 1XXHE 2UZIR 3KKPA 3CNLA 4IVQA 4X8HA 5IK2A 4PC3A 1G6OA 2W6JD 3ZVRA 2VQSA 4LYFA 2FFAA 4Q1EA 1AGPA 1NSTA 4DVGA 2RHMA 3ZJYA 4B3CA 1BS1A 3NKVA 3QBTA 4EPWA 3KKQA 4I1UA 3LD9A 1W49A 2B7CA 2BBWA 2C04A 1J2JA 1Z28A 4DEXA 1OKKD 5JMTA 2F3TA 2QMEA 5AUOB 1VG0B 4DLZA 5LPNA 4HSEA 3WYAA 2KB0A 2VL7A 2ZRFA 1XTQA 4KJZA 2IYXA 1MOZA 3TSZA 3ZYCA 4EAQA 2R6GA 2ZVPX 3AKEA 2OEPA 3DM9B 4D4JA 4DCVA 1Q3HA 2GNOA 4LK2A 2GJAA 1CR2A 1VKJA 5GJVC 2G88A 3TMKA 4QJ3A 1U8ZA 4ZCMA 1HQCA 1E9DA 1P4SA 3HP1A 4X8MA 3SI7A 2AR7A 2QORA 4PC6A 1PVOA 2ZR9A 3RRZA 1QG2A 4PAQA 5J40A 2A78A 1CTQA 2JJ2A 3FB4A 1KO4A 1RW4A 2BKEA 2YYZA 2AXNA 2C77A 1BKDR 2BVNA 4PZLA 3TW8B 3ICEA 4DDVA 2QTHA 3QPWA 2XB2A 3MJRA 4C7OA 1GWNA 2HT6A 4MYTA 1DO2A 1JBKA 4CEJA 1G3RA 1ZUHA 1F2UA 2RGNA 3D3QA 4G5OA 4V0NA 1M7BA 1SVIA 1QHSA 3CW2A 3I4LA 2OXCA 2XJ9A 4JLBA 2JLSA 4AYTA 1LS6A 2OAQ1 4O3MA 4JLPA 4EKDA 1CU1A 1JQLB 1YZLA 3W5IA 2R44A 2AD1A 3I5XA 4IVRA 2IL1A 1VHTA 2XX3A 3TUJC 2YNMA 1U9IC 4LJ5A 4OHXA 1XTJA 2CNWA 2W58A 2EWVA 1ZC4A 5JECA 2XSZD 3K9HA 1IJEA 5FPTA 1G19A 1AZSC 1Z6XA 3RSLA 2DHRA 4EPXA 2NIPA 4Q48A 3CWZA 2R6CA 1NVXQ 4A0GA 2ORVA 1DG1G 2WAXA 4GT1A 4TYYA 3OHMA 4H1VA 1JR3A 5CIWA 1AJEA 4JLMA 4QGFA 1FMLA 2RHDA 4M1OA 4H9GA 1EFRA 1T4GA 1DPFA 2FFBA 4PFSA 1XPUA 2F9LA 4LJ4A 2ZI5A 2O8CB 1BMFD 2WWGA 4AKEA 3PR1A 1N5IA 5E7MA 1R5BA 2FN4A 3IHWA 1U99A 5KNBA 3R8FA 3V9PA 3VNUA 4OHYA 2XNDA 5FPKA 1AIPA 5LB4A 2A7QA 2IYSA 1OFIA 4I4LA 1D9XA 2ZYTX 4MKFA 5FBWB 3KKMA 3VR6A 3CRW1 1KI9A 4GRAA 1P62B 1N6KA 1Q57A 3NTUA 1D6JA 4DCUA 1UBGA 1K5GA 1VIYA 2XJ4A 5HTKA 4KHZA 4RZ2A 2VBCA 1L4YA 1CJMA 1W47A 4L9SA 5FUYA 4WA7A 5FBVB 5FOXA 4MH0R 1DG3A 2UKDA 4HLUC 2P6NA 4A4DA 1EFHA 2GXSA 1W7AA 3BFKA 3IBYA 3SYNA 3ASYA 4U5XA 3B5JA 3FKSA 4NCNA 3WXMA 2PJZA 1X86B 3NC1C 4DLYA 1EWRA 2ZRJA 1E9AA 3W6PA 4B43A 4NMMA 4S35A 4KV9A 4QNRA 3L0OA 2I3BA 5A5GA 1S9DA 4TMXA 4YDSA 3SDZA 4LJ6A 1ZW6A 1OPXA 4L16A 3CUEF 3P32A 1XU4A 5P21A 3JZMA 1Z07A 1P73A 2XB4A 3B9PA 4JSYA 2HDNB 2XTZA 3KTAB 4HZIA 4M1SA 2B7BA 1ZU4A 2CCKA 4Q4LA 4US1R 5JSZA 4PHGA 3QSYA 3QENA 3BD9A 3O47A 1F2UB 3L0PA 1G7SA 4MITA 1KK3A 2P5TB 4WW0A 4RZXA 3AQ4A 4C2TA 1KSFX 1O3YA 3NXSA 1KK1A 2R8RA 3K0EA 3CRVA 1EG7A 1PJRA 3QF7A 3KJGA 2YV5A 4KFUA 2HUPA 5DI3A 2IXFA 1XFAA 4KBFA 3ZD7A 1MO3A 3P4XA 1DTSA 1T8TA 2LWIA 3GJ6A 3GFPA 3IUYA 4DLXA 3QQ5A 4LV6A 1OB5A 2OLKA 4D82A 1HE8B 1P7CA 3U3RA 1GL7A 1UAAA 3MFYA 5HCNA 2OLJA 3EIQA 2ZRGA 1KNQA 2WSSD 4KFRA 1OKKA 1AZTA 1Y63A 4EDHA 2GZDA 3RWOA 1XEXA 3AVWA 3F3YA 4Z8XA 3ZH9B 2ORIA 4HLUA 4W7SA 3ADCA 3QY0A 4QFMA 5JJIA 1H8ED 3SYKA 1E1RA 1LFDB 1F5NA 5IHPA 4A8JA 4M53A 4UNSA 3T34A 1W46A 1ESMA 4C0JA 2Z83A 1NVVQ 2Q3FA 1K6MA 2W6IA 3SNHA 1TMKA 1WP9A 1OSNA 1HH4A 2AN9A 4JS0A 4E09A 2YWFA 1VYVA 4BFYA 3RC8A 3B9QA 3T15A 3ZZUA 2C99A 2QE7D 2ZU6A 1Z0KA 2Q9AA 1T3SA 3K53A 3DKPA 4NHOA 3LFUA 1G6HA 3BXZA 4IXNA 3RABA 3DL0A 3LV8A 2VP5A 3B13B 5JI2E 2ODWA 4E22A 1CIPA 3EWSA 1GRNA 1G291 3BAFA 4A0RA 5E95A 4NBSA 2DR3A 1AGRA 1M34E 2QUZA 3AVXA 1NBMA 1P2TA 2GVDC 5EUQB 3RVBA 2CVFA 1CF4A 3PUZA 1NJFA 3I61A 1DO0A 3BH0A 1YRAA 1G17A 1LF5A 1ZUNB 2Q21A 3MSXA 4B3BA 4KODA 3WMEA 5GADl 3U3OA 2ZUCA 3H1TA 4TSFD 1EESA 3AVQA 3L0SA 4RKFA 2KBFA 2HYDA 2J0SA 4HUQB 3TR5A 5E4FA 5EE1A 1GOTA 5J4LA 5LBIA 1U9IA 2WWIA 3EPKA 1BOFA 4ZDIA 1IQPA 1MKYA 3CRQA 4NONA 1QG4A 4ZCLA 1BYUA 4DDTA 1JECA 1JR3D 3FMIA 2N42A 2B8TA 1FFHA 1S1MA 4PX9A 1XD9A 3HYRA 1XZQA 3SR0A 2VTKA 1KIMA 1IN6A 4PQRA 3KB2A 4AC9A 421PA 3THWA 1Z0IA 3M6AA 1SKQA 4RD0A 5EXXA 3KQLA 3SOPA 1QHHB 1EXMA 1FP7A 3LVQE 4F93B 1WRBA 1HV8A 3AVPA 2XOKA 4CF7A 1X6VA 2KBEA 3THWB 1Z6TA 4HAYA 4Q7LA 4P4TA 1Q21A 2ASEA 4GP6A 1SXJC 2WKQA 3TQCA 3AKCA 4IOLA 3RS7A 1Q3TA 2HLDA 1E4YA 1XTSA 2QAGC 1N6IA 4NU0A 4URYR 3THOA 2YOFA 2WWYA 5JHHB 1HT1E 2D7DA 3IQXA 3AF4A 5AUNB 3REFA 5C1BA 1N6LA 2O52A 1NJGA 1FNMA 2MMGA 3ETLA 5H70A 1HEIA 3R7WB 2ONJA 1ELOA 5HPYB 1V43A 4MYUA 4WBSA 3UMRA 4BFXA 3PUWA 1KI3A 5BYJA 1R8QA 4B3XA 4L9WA 1KGDA 1OXUA 2J59A 1AA3A 1XD2A 5AJWA 5DE3A 4MYHA 2JGNA 1GZSA 3KQHA 2ZJ5A 2ZSFA 4HZUA 2LKDA 5FPHA 4JVLA 4IDQA 2ZI9A 1NMYA 1GKIA 2QY9A 4GSYA 4KFTA 4Q02A 1SHKA 1Z2AA 2VP2A 3AGPA 3SE0A 4OHVA 3TSOA 2OCPA 3NIBA 4TLCA 4Z1MA 2CLCX 3C16C 4PQFA 3W3ZB 1YZTA 5HKKA 2IS6A 1Q22A 1E79A 1AKEA 3ICQB 4DB2A 2FGKA 1KNXA 4ASUD 2GF0A 1E69A 1KTVA 3D6TB 1E9RA 4QHYA 4RZ3A 4US2R 1MH1A 5HR5A 3HU3A 4QM7A 721PA 2I1VB 3QF4A 1A2KC 4KI0A 2KE5A 4DLRA 3HPQA 4IRUB 2VPPA 1ZIPA 3CR8A 1ZINA 3THXA 2K5UA 4IDOA 5FL7D 1OFHA 3UG6A 1XTRA 1N6PA 3AUYA 1T91A 1R8SA 2I4IA 3BGWA 3NC0C 4LYHA 5FUWA 3N2IA 1CKEA 1OHHD 3ADDA 4XWAA 4GBMA 5D3MB 1IONA 1D5CA 1XZPA 2J7PA 2OAP1 4AYXA 1ANKA 821PA 3IEVA 3HR8A 5C46F 1KY2A 5L8VA 4ZCIA 4YC7A 1OLOA 1EFTA 1GRRA 2GETA 4Q7MB 1NBME 3N70A 4QG7A 4BGDA 3EAQA 1JEDA 4NYIQ 4GZLA 4F4IA 3MD0A 2DFTA 3JZAA 1D2NA 4IDHA 1XRJA 4Q4HB 2ZXUA 2YC4C 4MRRA 2GRJA 4TL9A 3BIFA 4LHXA 5L3RA 3EZ2A 1X1SA 4AKGA 1P75A 3U7FB 1Q44A 3OESA 2ZPTX 4XVQA 1E3MA 1E0JA 2JIZA 4JKIA 1XCGB 3RLFA 2VP4A 3CWQA 4LYAA 4F91B 2Z0MA 4PSAA 2ZRLA 1JPJA 2FSIA 4ZDJA 3HR7A 5SZJA 4XVUA 1W44A 4XSHA 5EP3A 3AV0B 1N6OA 2QPOA 3PITA 2TMKA 4OHZA 3EX7C 1UKEA 3QXHA 4D25A 5G3YA 3VX4A 4B75A 2GESA 4TT3A 3BFVA 3SJZA 3DOFA 4MUAA 1JNYA 1XX6A 2O5VA 2J7KA 1SKYB 3M1IA 1KJZA 4LC1A 4HAVA 2O8DA 4EPRA 2ZJBA 4ON9A 1OIVA 5TARA 3TH5A 3W8RA 1G9XA 2BC9A 1TQ6A 4QBIA 1I4DD 4QGHA 1E9SA 3THYB 2O8DB 1T5LA 1GL6A 4Q9HA 4DKXA 3VFDA 1KDRA 2OFXA 3B85A 3SBEA 4LJYA 1RIFA 2CL0X 2JLXA 5F2EA 3K0AB 1E2EA 3L82B 4LC0A 4RD4A 1P2UA 3WMFA 2JATA 1ESNA 3V4RA 2IS1A 2AL7A 3MMPA 4ARZA 3AH8A 1GRQA 3KFVA 4AYWA 3GJ7A 4EFNA 4MRNA 4Q1AA 1G64A 2BBOA 2CVHA 3U7GA 3AGQA 2CJWA 4JBXA 1FUUA 2ZRBA 2F7SA 3U44B 3PXGA 2YINC 1N2CE 2QMHA 2ZYWX 1NKTA 4NZYA 2GXUA 2ZAOA 1P5ZB 4V02A 1ZCAA 3ECCA 5FL7A 521PA 2IHBA 1NVVR 4EPYA 5CB6A 1SHZA 1W36B 1FQJA 1T6NA 1ZCBA 3VHLB 1ZD9A 2CNWD 2ZJOA 1QHHA 3WHKA 2PCJA 1DARA 1SZPA 3EIEA 4URXR 1CJTC 4LJAA 1N5JA 3S1AA 3OIYA 2XTMA 1LF0A 3EXAA 4RSGA 4PC1A 3RC3A 4G0NA 1DBSA 2C03A 2OCYC 1NF3A 4NKRA 4OQLA 5AJVB 2V8OA 3QXXA 2VO1A 2FEMA 1NSFA 2IXEA 3GJ0A 3WMGA 1UDWA 2OE2A 4IJMA 1CBUA 3U3KA 1FTNA 2IF0A 3GEEA 3DOEA 1U0LA 4GDFA 4AKIA 3AVYA 2E9SA 4Q9KA 1II0A 5L3SB 5G41A 4B47A 5FFMA 4EPTA 1KI6A 2RCNA 2YOGA 3H4MA 2VHJA 2GHIA 3ZIAA 4B2PA 1C4OA 4OYHA 3SJAA 3LLUA 4D80A 1LS1A 1QF9A 3K0AA 4LHZA 2YHSA 3AF2A 5TDHA 2J41A 2GBLA 3MG9A 2AHOA 2GAOA 2RGCA 1N0UA 2WWXA 3WYGA 3T06B 3GP8A 3R9XA 4GL2A 3Q85A 4GP7A 2F1JA 4TZ0A 4TYNA 1TF5A 2H57A 2XAUA 3T1TA 5GJBA 2IWRA 4GFDA 5LD2B 1U94A 1DAFA 3FHOA 3WRYC 4B35A 3AEZA 5GVRA 1MRNA 4E07A 1E96A 1TL7C 3A1VA 2HLDD 2G83A 4FCTA 3RAPR 1YZNA 2IS4A 2WHXA 1S3GA 5SZIA 2P6UA 3BC1A 4CT4B 3NBYC 3U7EB 1XF9A 4IW3B 3RRYA 1NVUQ 2VLIA 1VG9B 3QXJA 2REOA 4ZIRB 1UADA 2QM7A 4OK6A 2OFOA 2ZE7A 3PUXA 4BASA 4B33A 3QXSA 4DEYA 2BM0A 2J9RA 3UWKA 4D26A 1P60A 1R7RA 1IBRA 4DLUA 2JIZD 4PQYA 2VP0A 4N0EA 1DS6A 3LDAA 3QOFA 5FPSA 1XCMA 2GEUA 2Z4RA 3Q8XB 1W1WA 5J4HA 1QVRA 3P27A 4B6FA 1VTKA 1A7JA 3KXIA 3I62A 4NCHA 3CX8A 2DB3A 2FX3A 4DC9A 3SC3A 1WE2A 5K8IA 4WXPA 2FPLA 4U02A 2B6HA 3U3JA
chains in the Genus database with same CATH superfamily
3N0WA 2IHKA 2HCTA 3NHUA 1MBZA 3WMXA 5EPOA 5C32A 3W05A 3HFJA 3AVUA 4CKYA 5DBHX 3ILVA 1I4TD 2GMWA 1IVNA 3MPUA 4GG1A 4MROA 1ZCZA 2QPLA 3HMQA 4LWOA 4HRVA 4HWOA 4C0QC 2QI9F 2R751 1JJBA 3MT7A 1YKGA 3QKUA 4MS4A 2A9JA 2YOHA 3DEKA 1ZBQA 1U0TA 4YP9A 3OEHA 1U7ZA 4HDKB 1YJAA 2H92A 5DK6A 7ABPA 4BLPA 1I4EB 2J9ZB 1R2QA 4TTVA 3TSCA 4XRRA 2X40A 4Q5IA 3HCWA 2WIJA 4D8VA 4I5IA 4DGQA 1Z08A 1NQOA 2NXEA 4OFZA 1RYBA 1YDEA 2XDAA 3TCKA 3ZU3A 1T2CA 3I9LA 2EGHA 4HYYA 2VDRB 4RFSB 4WY5A 1Z5OA 4ES6A 3OFSA 1J0XO 1PGJA 1E1CB 4HDAA 4QL3A 4UBIA 1GPYA 1W4BA 1TCVA 3P9IA 4M7PA 2OV1A 2VPXA 3D54D 3V6MA 4DS3A 4UEWA 3HDYA 3AIIA 3K0CA 2WJVA 1J9EA 3OWXA 5GZ6A 3OU2A 1S7GA 3OE7A 4CLDA 2FSUA 2Y27A 3EY4A 3MWYW 3ESRA 2R8OA 4BMZA 2IIVA 3BUSA 4U8HA 4W5OA 4RPJA 1M54A 4BNDA 3H87A 3A4NA 1I4WA 1HYHA 4MRMB 2JA2A 4R5HA 2QU7A 2VH2A 3B7GA 4YRDA 3SZUA 4DN6A 1Z4QA 4PCLA 1V37A 1UKBA 4HFRA 2LNDA 1GUDA 1AB5A 4G8DA 3CLUC 5H3LA 5CBPA 1HUQA 1XD2B 1O03A 1OT3A 1N0WA 1U8XX 4WNAB 2PRZA 4O2LA 1NR1A 4NNOA 3ZHSA 4L0MA 3RVJA 5I9IA 4W5WA 1VYUA 5ALZA 1PRYA 4Y0AA 1L7XA 4X64B 2PE5A 3IP7A 3NGXA 4FNGA 3ZDDA 3IRVA 4C29A 3NJ8A 3DWFA 5LP6A 3K9CA 4JKOA 5D5HA 4KRGA 2WJIA 3S2FA 4AL4A 3R41A 6LDHA 4XFKA 1S2MA 2R5FA 1GSAA 1L9XA 2Z2ZA 3W2EA 4D6YA 3O90A 4H2DA 4OL9A 3E5NA 1QVAA 3UBTA 2Z6AA 3HSSA 2PDAA 1RWPA 2LKCA 4M86A 2CE7A 2W11A 5EXPA 3OAAA 1JMYA 3VYRB 4LWQA 5BQ5A 2XRFA 3LOQA 3PTLA 3LRPA 3SIXA 3FCYA 4FR5A 2NX2A 2WA1A 2BTOA 2I6SA 5FUQA 4URHA 1B15A 5IZCC 3QBEA 4QUGA 2IOQA 4I4CA 4UXIA 3CNBA 2AC4A 1QIEA 3O4JA 4D6PA 2CDBA 1WJGA 2JASA 4Y1FA 5KS2A 1XTKA 4G1VA 4FGZA 3EEFA 1W1IA 4GO1A 3O1HB 1QE3A 2PT7A 3DE3X 3UJ6A 2H4FA 1PJZA 2BEWB 1V3VA 2YVAA 3C3WA 3G9XA 3SHQA 4HKTA 4MQ6A 3MWEA 2OCIA 1K6XA 1IH8A 1JDNA 1YQUA 3F98A 5A4MS 4FK8A 2HXGA 1FFAA 1VL1A 5EIHA 1KI6B 5KVVA 3GFOA 4KGXA 4U2KA 1BFUA 1CY7A 3I23A 3QU2A 5K0NA 2NPFA 3L8MA 3HBJA 2VYNA 3A4VA 3GUZA 2A5FA 3LY8A 5K3BA 4A2QA 1WBDA 4TMZA 2FRDA 1NP6A 1HA3A 1AK9A 3ETJA 1Z7BA 2HAEA 3TX2A 4E21A 2B5VA 2YIVX 3RBAA 4ZJZA 4CW7A 1Z7YA 3PNQA 1FVOA 1QM5A 3AP3A 3DZJA 4E5DA 3BE4A 2WJYA 1YB5A 3U4AA 2PPVA 3KTOA 1GKUB 4RK1A 4RZQA 1C7QA 2CVZA 1PTJC 1EJ0A 1NF8A 1SD1A 4LBZA 2AOUA 4RCYA 4GDMA 4F9FA 1C7ZA 1QK5A 4TLEA 3WWDA 1QG0A 3IEPA 2IT1A 2ZS9A 3WKCA 4FBLA 5FTJA 3G1WA 2JGRA 2Y92A 3GH3A 1J00A 3GV0A 3L6BA 4RIHA 4B84A 1TQ2A 3FPAA 1H66A 2KM1A 3LVBA 4M88A 4HP8A 4XGRA 4YLEA 2CBZA 3ILSA 2I7CA 3EQ9A 3GHYA 5A4KA 3REOA 1WB6A 2QTVA 2I99A 1A9TA 1GA6A 1L5HB 3B3JA 3QI2A 1DUVG 2CUTA 3E2MA 4MRPA 4YAOA 4DA9A 5CB0A 1SBYA 5TVKA 2QN1A 4WJLA 1N7GA 4W82A 3M1AA 3OFVA 1DC6A 2MR5A 2C2HA 3C6QA 3NAGA 5IYZF 2AFIE 1CR6A 2LIPA 3ADBA 1RRCA 1V8BA 1G60A 2FNAA 3S4YA 3T9BA 4AMYA 1K2WA 3S0JA 2BV3A 4C22A 4L9RA 4WBNA 4RTKA 2HJRA 3ZWKA 2NAPA 1L6RA 3GJ5A 4NOKA 5LQAA 1FXSA 2GUGA 4GBJA 3VSEA 3UMYA 1H3EA 1NV9A 2PKQO 1Z5ZA 1KOJA 2PIAA 1OOEA 4W8HA 3VJLA 2BSQA 4F85A 1H6BA 1TAQA 4X1KB 5KQSA 3LBNA 2QL9A 1R0XA 3ZZNA 2EWWA 3T52A 1N5KA 3GT4A 1U90A 4M22A 2QD3A 3UAGA 2ZDGA 3WADA 5JXJA 2X1VA 5LU8A 3L79A 4HEA1 4MUHA 4X1KA 1NDUA 3H8JA 5SYMA 1WF3A 4IZOA 5L45A 5JWHA 3FYTA 4N49A 2VNAA 1L7OA 3VA7A 1Z45A 5EIBD 2BAGA 1E63A 3QA9A 4JYMA 1SUFA 3ZX4A 1O0BA 3CX6A 3VMFA 3CN7A 1K68A 1XQ9A 2VEDA 2A9PA 4Y6GB 1DAOA 2G5PA 5EZ5A 2XUHA 4JT4A 1M6WA 1VB3A 1YOVB 2PTGA 5KSPA 3KWMA 3P9ZA 4KJXA 4HFMA 4AO7A 1XMIA 5DU2A 5JH7A 4HNRA 2WRZA 3EB9A 2R6DA 4MR7B 2QTCA 4WKNA 4GLOA 1N78A 5DLDA 3OQMA 2WW8A 4EX7A 1YL7A 3K6KA 5L3SA 1P5JA 2WIAA 1VL5A 2VJDA 4PQGA 1WB5A 4XPIA 4M98A 3DE5X 1ONPA 1N8TA 3AHHA 3VZDA 4Z0PA 3SF8A 4DYDA 1NTRA 2XCIA 1ZM9A 1ABEA 3R6LA 3H84A 3VZQA 4BZQA 3LNCA 2D0OB 1DKLA 2FN3A 1UBSB 3FYCA 1JDJA 2JJ2D 3AF6A 2Q3CA 1NDQA 2E5WA 3S1SA 2JHAA 2R6HA 5DZSA 1EP2B 1P17A 2PXCA 3QI7A 5AUQA 3GMDA 3KTFA 3AEXA 4LRSB 2WPDD 1XL1A 1C1XB 1OV4A 2OWDA 2ZIFA 4O2AB 3TR6A 3KOXA 3TRIA 1ENYA 2YXLA 2OESA 1NQAO 1RLOA 2UZ0A 3SQXA 2J3MA 2VQ3A 3D02A 1YZQA 5B1SA 2IYTA 2NUTB 3ZXIA 2YASA 3EGCA 4QNMA 3DDOA 3H05A 3BREA 3QVWA 5CGZA 1GNQA 1SA0B 3MQ2A 1ZJ6A 1Q83A 1NXTA 2AFIB 2IHZA 1MX1A 2D4AA 2KSQA 2RC5A 3OM1A 5AK0A 1ILWA 3ZGVA 1YS1X 3DE6X 2DUJA 3V4LA 4ZQGA 3TG2A 4MZDA 4MVJG 4BNLA 2EGUA 4JVNA 4CQNA 3UC9A 1RYDA 2ZJ3A 2R0QC 3ZNNA 4R84A 1VKRA 5FYQA 5BW5A 4L07A 1P19A 1K8QA 3L2OB 1FRZA 1CYDA 3BA6A 3T7RA 4MI6A 3V33A 4PGHA 4E5VA 2OHXA 3TG8A 4TUYA 1XJWA 2Y4NA 3QSGA 4F7DA 2OV4A 2GZAA 3HO6A 3JVVA 3LZ6A 2IYYA 2FWAA 4WX2B 1Z2NX 1U2DA 2PUHA 2NO1A 1CRWG 1SIUA 2BH9A 4Y3UA 1KQOA 3M5WA 3L05A 2WWFA 5UKDA 1KQ3A 1COWD 4BB6A 5H3HA 3DDWA 1UBNA 2BE9A 4K9NA 8LDHA 4MCHA 4TXHA 1RWQA 2OBNA 4LGCA 3HP7A 3MOSA 5ARCA 5EQJB 3VRHA 2Z3VA 5JQWA 3IQIX 3C8DA 1QE5A 2NTVA 2Y1OA 1UPAA 2Y66A 3OKAA 3AUJB 4RHFA 1KEWA 4KMOA 2FN8A 2SKCA 1X8LA 3H5AA 4HOYA 4ID9A 1J2TA 3V6LA 3LYHA 1M67A 2WYWA 1H1LB 1NONA 4ZOLA 2GAAA 5IZ4A 5HZKA 5K05A 1K0FA 2UU9B 2W8BA 3CNQS 1D8TA 1KFKB 1ZK0A 3AXSA 1FXWF 4BC0A 3ZDAA 4FYMA 1MPTA 4Q3EA 5JPIA 3UMGA 4B17A 4EF4A 5EHGA 2HBQA 4HJRA 2ZZMA 4MKHA 2C07A 4F0JA 2ZREA 1YB7A 2OM2A 5KTSA 4DZZA 2Q3MA 5KDOA 4BTVA 3F7MA 4RTLA 1IPHA 2GJ8A 2A0XA 3IIKA 3Q2KA 1XU7A 1FU7A 2FSFA 2FWMX 3SHFA 3UICA 4JVSB 1PNRA 2VNKA 3EFOB 1X3LA 4CF4A 1YRWA 2GAFA 3BS4A 3OJEA 1Q17A 3AFNA 3QKRB 3ZHYA 1FP1D 4M38A 3DCIA 1PZHA 5M2QA 3RYCB 2W2LA 1PX0A 4YCSA 4UD2A 4V0KA 3DBLB 4XCQA 2QRVA 4XFJA 4EHDA 5LD2C 3QMPA 3HKCA 2ZZNA 3DFKA 3FCCA 4ZQCB 3EXHA 3K1YA 2BZ0A 3JARA 3AILA 3KJXA 3A9UA 1KMCA 3EGEA 3MA0A 4AUMA 4DJ5X 1ZXBA 3GG2A 4DLTA 1WQ1R 3NYWA 4YAUA 4W1QA 1N9ZA 4OP1A 3FX2A 4ZC1A 1AKWA 2OGZA 5D86A 5EHIA 3ZCXA 3L7IA 4OHRA 1JH8A 5AOAA 3D1VA 2X41A 3KQMA 3NV9A 4QDZA 4JYAB 4G0UA 2J0VA 3ZWVA 1U2RA 3MHTA 3U3MA 5HE8A 4RVUA 1DL5A 1Q50A 3QKTA 5DCUA 4K9DA 3UJPA 2P0EA 5BXYA 2EJBA 3TQOA 1JPNA 3NS7A 3NYQA 4LFBB 4D0GA 2OGUA 2QN6A 3I01M 4ER7A 1NR7A 3N8KA 4MVYA 5CW1A 4XD7D 3CW9A 1P74A 5J2TA 2J0QA 1NF2A 2YL2A 2PZEA 1YQ9A 1ISGA 1MW8X 2Z2YA 4V03A 3EA5A 4JBHA 1C7RA 1OX4B 3A1EA 3C39A 1YJ8A 3TAXA 4PG8A 4PAMA 4ZO4A 3JD3A 1WCYA 4IJKA 5A0TA 4IICA 3TGPA 1JW9B 4B6JA 2DWOA 2QG9A 3ABZA 3Q0EA 4P32A 3U4HA 3UJDA 3G79A 4EAAA 4XX1A 4BX9A 5A4AA 3RRMA 4FVTA 4DLVA 2EXXA 1FUIA 4F8YA 3N87A 5HJ7A 1RYYA 2YX1A 1QP0A 3D2LA 2QVZX 3F1LA 2ZIVB 3JPWA 5CFQA 1JA0A 3W34A 3BYZA 1CJUC 3GPBA 1EFKA 3GCGA 2IU0A 5TMDA 3Q5DA 1BN6A 4NBTA 3PFFA 4URFA 2ESRA 4Y6PA 1M2KA 5D01A 1X7HA 2BGNA 4E46A 3DUFB 1WULS 2XY4A 4KOEC 1XKXA 3P0RA 2XVXA 3TIVA 4N1AA 4MR9A 4TWRA 1IHOA 2FG6C 1GJRA 3UWPA 4BGUA 2NO5A 1XEXB 4AG3A 1CS0B 3S2IA 1KI7A 2PLAA 2EFCB 3OZSA 4UM8B 4DILA 2JFFA 1DJMA 3KJZA 1K0UA 3N0VA 4N5NA 1BWRA 2WUFA 1JGTA 3GBVA 3IDZA 1DRVA 1PDOA 1NXXA 1QGDA 2G1UA 3HDQA 1AK1A 3JRNA 3LBIA 3KUKA 2PUBA 4ZMSA 3V1NA 4EA7A 4ECAA 3E9MA 4OU4A 2IEBA 3VO1A 1I0ZA 5MN5A 3Q7QA 1M6EX 1AS0A 2H1RA 3NWJA 1XYGA 2P5YA 5G1PA 5BW6B 5L95A 1W5AA 5TJ9A 3UV7A 3R9XB 1HE1C 3HB9A 2QZ9A 3QKSB 4LECA 4ZCPA 2IX9A 3PQCA 3K71B 1DFGA 2XNSA 3OP1A 3PNYA 1Q91A 1E3JA 1GZHB 5DYNA 2CCJA 3UH0A 2DHDA 1X2EA 5CX4A 3EQ8A 1NY6A 3DXYA 3I4CA 1TU0A 3CKMA 1UBJS 1P2VA 3JQ7B 2GEFA 3L4SO 3OZFA 2R6FA 3PQFA 3QVJA 1QO9A 3SS8A 4UBJA 4QGSA 5IX8A 1A76A 1RXIA 3TB6A 1RKBA 3GCDA 2XEXA 4Q1VA 4TZ6A 1B8VA 3HBNA 2WC1A 2QSJA 4F96A 3PI6A 1RFLA 4UUOA 3U81A 1CUDA 3NVDA 1PSZA 3PJFA 4B44A 2VAXA 3EUWA 3ZV6A 1XDBA 3KK0A 5AI8A 1RPZA 4L5IA 4KLRA 1VDZA 4E1BA 5I7EA 1ZQ1A 3IO5A 2OUKA 5CA1B 4LRXA 5JQGB 5DIZA 4MV3A 3PB3A 5D85A 5LDDC 2WNSA 4HUQA 2O2XA 5EERA 1RABA 3UK0A 1W4CA 4E88A 4Q9LA 2QP9X 2DUWA 1PGQA 1UMDA 3P2YA 5DK4A 5B58C 3COSA 1GLNA 2A9OA 4MICA 3GU3A 1GTRA 1SRRA 4BYGA 1D2EA 2DFPA 3G0OA 3ZW9A 2DECA 2F1RA 3PIRA 1LQ2A 3WE7A 4HAUA 1IZ7A 3OU7A 4YRZA 1KI4A 3K4HA 1UJ6A 3TOZA 5T6BA 1QCZA 1DNPA 2EX0A 5B4UA 1VMEA 4JMLA 3M4YA 4CFSA 1P4JA 4QUIA 1C3EA 3Q98A 1G1AA 2HZ7A 1KEKA 2FWJA 4L4UA 3QGMA 2YWBA 4QOHA 4ZI2A 3HB7A 3PCRB 3IDFA 4P53A 3OFJA 5KJ6A 4O02B 3HYTA 4KL8S 3V8EA 3PJDA 4QG3A 3WBFA 3BRWD 1O4VA 1KDOA 4H16A 3BSYA 2FK8A 2FPPB 4HXEB 5DLEA 4KG7A 4EB0A 4XJVA 3CVWA 2XYPA 4MO2A 1H22A 3QW2A 4YXFA 3SMQA 1MC8A 2YICA 4KUHA 2P65A 1AKQA 3SX0A 1ZM2A 3ANLA 2ZYVX 1E3SA 3IT2A 4RKEA 1E2DA 1NU6A 3I9NA 1U98A 3DXFA 4RWZA 4CT0A 2QL7A 4AZ3A 3OZIA 1C41A 3GJZA 1G8HA 2VJQA 2EFHB 2RGXA 3GDHA 2WT9A 1LW7A 4JBLA 2OXIA 1LVHA 3P4YA 3SBDA 1IN7A 1SC3A 5DNDA 3TPZA 4A6EA 5IWCA 5KWSA 3I5YA 2Y9PB 5DGTA 1GZ6A 4JIMA 4R1TA 3UTCA 5DI9A 3U9SA 4DARA 4ZYYA 3DZIA 2XMQA 3OO1A 5IAEA 3TPCA 2W93A 2Z57A 3TTUA 3L4JA 2NGRA 1Y48E 5J47A 2PXHA 4QUJA 1YTUA 3K8YA 3F1KA 3G2NA 2Q4BA 1P0MA 2PWYA 4M0LA 4O2AA 2WD7B 3W4IA 3CPSA 4PIPA 3HLYA 5EUBA 1CF2O 3CCBA 1WXIA 3R7SA 1ENOA 2XF2A 1Z6GA 4Z4GA 2H4JA 3PNSA 2WAYA 3UBMA 3CKYA 1A71A 1PO7A 1YD7A 1RBMA 1PU2A 3E7FA 3H5OA 5I5EA 3WP0A 5A9RA 2P0YA 4J0EA 1UBUS 1UAYA 1VJ1A 1JT2A 1YR6A 1Z06A 2O14A 1J9GA 4K46A 4ZOBA 2JKVA 3R3JA 2DYKA 3VR1A 2PVSA 1WP4A 1JDTA 1I6MA 3KKEA 3LXRA 3MT8A 4FCCA 4MLCA 5J2UB 5KHAA 2J9YB 3GJQA 2J3LA 4GXQA 4HLDA 3AEKB 5T5QA 3UKOA 2JLZA 1FYXA 2H1HA 1IULA 4YJGB 1Y7HA 2Q5QA 2BMVA 3K9NA 4RESA 5CDUA 3ED5A 4MQEA 4EO9A 1XQ6A 3COZA 2D7CA 5BUCA 4NNJA 5FEMA 2F62A 1CJKC 2RHRA 3IBSA 1LSOA 1F6BA 4WDRA 4WKBA 4PRLA 1DRKA 3H9EO 1AHIA 4J4TA 2OCAA 4IV8A 1LTHR 4LS3A 2X9LA 1W0KA 2VQ6A 1FFWA 1Y3DE 2PCLA 4ENQA 3CG0A 4YRCA 2GBFA 4CTMA 1RYEA 2Q1XA 4C07A 5JJKA 3AINA 2VNJA 2NMVA 3KB1A 1FS6A 3C6YA 1RE1A 3S99A 3UKDA 3VM6A 5JTTA 3LTEA 2BP7A 4MUYA 1UWLA 2BMDA 3U2QA 4BWVA 2PL3A 2HF7A 4DJAA 5FA6A 3BXFA 4GMXA 4JZKA 2XGGA 3DHVA 3OP4A 2EFDB 4DIEA 2Q1YA 4ND6A 1O95A 1E9VA 3DUFA 3NETA 2DM6A 2ZIXB 3Q1LA 4M37A 3LLMA 3IKMB 3NNSA 1FVFA 4Q37A 4PYJA 3ODGA 1NYTA 2NVUA 3RFVA 5K09A 3RSZA 1JBQA 2ZJYA 4G0YA 4RVCA 2R5NA 1DIOB 1E98A 2X8WA 3OIDA 2VBFA 1PSWA 4O4HF 5G1OA 2COEA 2GZSA 3GFVA 3FF4A 5EE0A 2G5CA 2WJAA 1YMUA 4JOBA 3EY9A 4Y9RA 3PXUA 4ZVOA 3UXHA 2SKDA 4GI1A 3UAWA 5AUPB 4DRXA 4LXGA 3UPDA 4K40A 2ZITA 4C7MA 3EGXA 1YIDA 2D74A 3V55A 2C9CA 1W19A 6ABPA 1UJCA 2NU6B 1A2QA 2CV0A 4L15A 1AK2A 1P6XA 3PEVA 3IGFA 1FBNA 1G5PA 1XQXA 1E2UA 2G3YA 1U28A 4BAZA 1JPUA 2VPTA 1YZHA 5BVHB 1ECGA 2WYOA 1R4MA 1ZM3A 4H7IA 4C5CA 3CGWA 1E1RD 3H0EA 1KJQA 5A4DA 1RP1A 1NJSA 3V7FA 1UIRA 4XEHA 4QSMA 1EFUA 2PGJA 5D6OA 5KWIA 5IUJC 3QNUA 1EZ4A 4KQGA 2EU8A 1BE8A 3DDCA 3INRA 4O29A 3UAVA 1NC3A 1U8AA 1UEIA 2GHQA 2X4LA 3JZFA 5E3JA 1KXZA 1C8VB 1U1GA 2H5JA 2V4ZA 4FDUA 3ZY6A 1RCFA 4Q01A 1I1QB 1J7KA 2CZGA 2F6RA 2J07A 2XT6A 3TZ6A 2HCJB 3ST7A 1N36B 1GDTA 2A9FA 1I5RA 3ENNA 5JWRA 2WICA 3K9WA 3DAGA 4JQSA 5IXSA 3H2KA 3LBAA 1HYQA 3KCQA 3O38A 1G20A 4AMBA 3X44A 5LBTA 3WNBA 3KJIA 4RVDA 4XA8A 1NTOA 3HXOA 3L1JA 3PGMA 1OWLA 4Z8YA 3IALA 4WESA 3F6YA 1RACA 5FJJA 1BA2A 4P7GA 3S27A 4KI7A 4B73A 4PYQA 1AKTA 1WSAA 3I1FA 3R5XA 4FN5A 2HMUA 2JGKA 4MW0A 1DFHA 4LVNA 1I0IA 2GI4A 3IP9A 3TW0A 2WTXA 4PZCA 2VKQA 5H83A 1PV2A 3PDWA 5ALOA 5EVCA 2X4DA 2H18A 4CVNA 1RQ2A 3ZE7A 1LSSA 1L4MA 1UPBA 1HDXA 5LOVF 4FE4A 1XN1A 2YJNA 4JXKA 3IEKA 2HN9A 4GQAA 1FSGA 2FLKA 4OB7A 5DSTA 5T3UA 4YJHB 4MIYA 1PYGA 2BFEA 5FWAA 3ZVNA 2P0AA 4DQVA 3CYFA 5M29A 3DZ8A 4QBGB 4DF3A 3U0VA 4YGXB 2F2TA 4YBRA 4PU0A 1GQRA 3FCSB 4MUIA 3I39X 3QKRA 5KUTA 1BU8A 1V8DA 1V2HE 4FW9A 1VPLA 3RVPA 1QVVA 4EI9A 1MABB 3MIIA 4L6CA 1WPGA 3KUDA 4WCFB 2GN0A 3DVSX 3FFAA 1VBNA 1N25A 2QYSA 4HB3A 3VR5H 3WR5A 4ZTBA 3TINA 3WLHA 1GG8A 4Q3OA 1EK6A 2VYND 3CG4A 3NKFA 3IKVA 3SLGA 1MABA 2FSHA 1T36B 2V98A 4BOYA 4UUNA 3R3XA 1PG0A 4KQIA 2ZRAA 4V38A 3ORFA 4N12A 2OZKA 5BWNA 1ZJYA 1YJQA 1PW5A 2Q50A 4QRHA 5HUHA 2ZSEA 4DSUA 4JJIA 2EAUA 2XT9A 2DTDA 2FKAA 3EOZA 4YPOA 1MOPA 2FQWA 1WW3A 2OYRA 4YQFA 3MWDB 5CG2A 4CETA 3TOSA 1JR6A 4JJ4A 2L18A 3E3LA 4L08A 2ET6A 3P2KA 4Y8VA 1N2JA 1ZMXA 3CISA 1CW2B 4LDZA 1XJQA 4Q24A 1F3OA 3CLTC 4RQTA 2X0IA 3FR8A 16PKA 3R8XA 1WDTA 4IV5A 4QDTA 4JUFA 3NANA 2AH5A 2WZBA 4MULA 4XPZA 5J63A 1M8KA 5FTNA 2ZWOA 3IUSA 1L5GB 1HRKA 3IE0A 1J8VA 4NC9A 2Z8XA 2ROQA 2VPZA 3EARA 4QYIA 4B79A 1OZ0A 2F90A 2HSGA 3DJYA 4LV8B 4F2PA 1ICEA 2LP4Y 4RPHA 3B6MA 2GSDA 1DEAA 3WWYA 3PK0A 1WUJS 2O06A 3V2UA 5FA5A 3HE3A 5I7OA 4CIBA 3WX0A 3IAXA 3I3OA 3UT6A 4AX4A 4ZZ0A 3BXGA 3NIGB 1EUCA 5AJZA 5KYXB 4LG1A 3B78A 2YVUA 4LXHA 4WJZA 4AICA 5ED0A 5SYNA 1JEQA 1R3DA 4G65A 1MAAA 3AESB 2I1LA 2MSEB 1H5QA 4L3WA 3PWTA 4XI9A 3B1YA 4HVAA 2PGAA 1UFOA 3FKJA 4TXMA 5JFGA 1GQ2A 2CLSA 1XLTA 4HTFA 1ETUA 1K4KA 3F71A 2O7RA 3FROA 4LXIA 3M3DA 1PIWA 1PR5A 3D1LA 3OOEA 1G20E 3LZCA 3ZDCA 2GF2A 5EJAA 4G1EB 2IYEA 5CT5A 5L51A 1W8DA 5I48A 1L7VC 1L9KA 4OI0A 3OJ0A 1T2DA 5LYJA 1R0ZA 1QHYA 2CJXA 2Z04A 1D7AA 2JIPA 5CGQB 1PWZA 2GT1A 1LCIA 1JQKA 1MV5A 1ZKMA 2VSFA 3IURA 3QEJA 5I7AA 1L7PA 4MNTA 3UT0A 4RVHA 3ZIDA 4Z54A 1RMQA 1QYRA 3KAJA 1FU4A 5DN6D 4JCOA 3U48A 5CIQA 5TPWA 1RZUA 3W9SA 3PC6A 2CWDA 5F73A 4CRWB 1G3MA 1QR6A 1TM5E 1TTPB 1NJ2A 1IPEA 1ZMTA 1F6DA 3QG5A 4RW0A 4WLVA 1CUIA 1DJQA 1EDOA 2ZRHA 1T9CA 2FW1A 3QUBA 4PWZA 4ZJUA 2Q3EA 1QH1B 1Y80A 4LDAA 4GGMX 4UUPA 5GONA 4JC4A 3RK4A 4YMLA 2C8LA 5AYVA 1PJTA 1LJ8A 2O8FA 4YXWA 2H29A 3CZRA 1T5DX 4U2FA 5K0JA 2ZOSA 1Z15A 5A03A 2EZUA 1LQTA 2YW9A 2J3KA 3I8SA 2VIIA 4J0QA 4C04A 5E7IA 5JRJA 1XE3A 3B2EA 3HY3A 1FVXA 1QGED 4PTLA 3HGQA 2ZYGA 3BJRA 4BEBA 2JLBA 4E7OA 2E6UX 2X0DA 2BZSA 4AZ0B 1AHNA 2ADFA 1CG6A 3RU9A 1FFXB 1FDSA 4N3BA 3W6NA 4P0PB 2BEVB 1C3VA 4PAGA 1PJ4A 2JLQA 4C0XA 5ES4B 2VWHA 3TLGB 5HEKA 4B3RB 3Q6IA 4OKSA 1NAIA 3Q11A 4GOXA 4HGYA 4BQSA 4K9QA 4ZYLA 5BR1A 5AI6A 3GI1A 2TSYB 1AF7A 1S2OA 1U1DA 4C4XA 1AKMA 2ICAA 1ZGBA 3EEQA 3BRWA 5JYDA 2FEKA 4KNVA 3CVOA 4BP8A 4CMEA 2JLYA 1MVNA 4OQNA 5DLPA 2R79A 5FR2A 3LTNC 4Y1EA 2GO1A 1GPH1 1RHUA 2JLAA 3WL4A 2O6HA 3PVSA 1CXZA 2JL1A 3MCAA 4UQOA 3SWWA 4HZUB 3DL4A 4QOEA 1DC4A 1K98A 2H7VA 5ER6A 4QPPA 4MW6A 1MX5A 4L4ZA 4EHFA 1KKUA 4KIWA 1EFVA 3OMXA 1VLLA 1HWYA 3O26A 1JXQA 4UDOA 5MF6A 1QQ6A 1AMOA 1U3CA 4IWXA 1CVLA 3FNGA 1LLCA 2D54A 2HF8A 3LH5A 3F3MA 1Q1GA 4BO9A 4EI2A 3OEED 5FHRA 2ZQ5A 1T0UA 4BKOA 3GJRA 1W30A 5IJ0B 1YBMA 2CJYA 4LGMA 4TS9A 3UT5A 4F3KA 1OH8A 2FHSA 1EVZA 3VNBA 1XEWX 5JDIC 3LQYA 4KPUB 4C06A 3NBXX 1ZISA 1ONNA 2B0CA 3K0HA 1E7WA 4B81A 3BILA 4DL9A 1OBHA 3C4QA 5K8LA 3WIEA 2NN3C 3MGKA 1JG6A 3AXTA 4TM8A 4K0KB 2NUAB 2FWIA 4X71A 3N0RA 4I1YA 1OXTA 5EFZA 4E70A 3R8CA 2JAQA 3ETEA 3ID6C 4XCXA 4FFNA 3AM1A 2V7UA 1BMFA 1JDBC 3LC2O 4O4IF 5G1NA 5ELMA 3SAJA 4GKBA 3TI9A 3ZH2A 2BR5A 2ZB8A 1BRMA 5IW8A 1A69A 3QLVA 4KDFA 4NMLA 2FN7A 4P5PA 4DMLA 5JXGA 2B36A 2BOVA 4HGPA 4U0JA 4GLFA 1S3FA 3RWBA 1RRKA 3M1YA 3AY3A 3G2KA 1NVEA 2HGZA 4S2EA 4J0GA 5KNCH 3FYHA 3S29A 3OT1B 1DT3A 2X77A 2NZ8A 4CLOA 4BP1A 3E18A 3EASA 2DF8A 2VWPA 4XIIA 5K4GA 4PPFA 2EKPA 2VNSA 3ZXSA 2C4WA 1P2GA 1PLKA 1YE5A 3ZU2A 1H4TA 2BCGY 2CFTA 1X13A 4DXHA 1J22A 1YR9A 2QLLA 3ROFA 5KC8A 1C3OB 5E2BA 4JLJA 2NP7A 1HG1A 1MUUA 3HDTA 1O97D 4D3SA 2HIGA 3TLKA 4EUHA 1NR5A 2BKAA 1UM9B 1WMEA 1RBZA 4XTCS 3IRUA 4UUAA 1YVEI 2XZLA 3AW9A 3L18A 4GLJA 5BO5A 3IE2A 3MJ4A 1B7GO 5AM3A 3ENWA 4FT2A 1FSFA 1VIDA 2NTYC 1ZICA 1SA0A 3MTIA 1F0KA 4V0ME 4RDXA 3K0SA 1V8ZA 1T8UA 3KXDA 4DPMA 1ADJA 3LPDA 4JVMA 3HKEB 4ZVUA 2RK3A 1FSPA 4BNJA 3F6CA 1E60A 1YE8A 3NDPA 2QT1A 2VRNA 4DXAA 4WAUA 3D6JA 4ZAXA 1U3WA 4B46A 2AR0A 1NIPA 2H48A 1KRHA 1RQXA 1EDEA 1YCDA 3AHFA 3K15A 3BHNA 3D4NA 1XR3A 1A98A 1OYWA 3NH6A 4ABYA 1KS9A 5EMHA 2ZJZA 4MHSA 5BOSA 6REQB 2HXYA 2DFNA 5J23A 3OICA 1ZK3A 4EATA 4I3FA 1HQDA 3H7IA 4MOWA 1QZXA 2P67A 4Q4DA 5DEOA 2VXBA 3K31A 3P0JA 4PHTA 3M5CA 2Z6QA 2V5AA 3HZOA 3NWEA 3Q9SA 4C21A 1YA8A 1Q0TA 2DBYA 2X14A 3P9SA 5TMPA 3L0CA 4L0CA 4DPLA 3AR6A 1HK7A 1L5KA 4AJKA 3PQ4A 1YU6A 4JYPA 1WVGA 4LXXA 1X8KA 4KPGA 4BWGA 5I3CA 3TO5A 4M55A 1ICIA 3AF3A 2SCUB 4B9EA 4YRMA 4EUFA 1PDVA 1FEZA 2RH9B 5EGSA 3HU5A 4DOMA 2P3SA 4Q4CA 1MLDA 1MT0A 4DQ0A 2HRRA 4B6QA 5JVDA 3C4VA 4PRKA 2ARKA 3TQTA 4D3DA 2M6LA 2Z6UA 1SOWA 2XWQA 1ES9A 2YY6A 4TLLB 1HGXA 1XLTC 2WHYA 1T10A 1T34A 2XDYA 1XMPA 1PT6A 2E37A 3TQRA 1B76A 3LDFA 5SV2A 2HDOA 3U44A 1RXCA 5AW3A 4U2CA 1DC5A 1LLQA 5EIEA 1KZHA 1NLFA 2C5BA 2QTBA 3HUUA 1ADCA 1AUQA 1C1YA 1N9GA 3WGIA 1O0CA 5D7BA 3HL4A 3MB5A 3TKAA 1N34B 4HK4A 3SE7A 2JLRA 4OMFG 3WO0A 4V1CB 1GSOA 1RJFA 2H9IA 2BISA 5DYTA 1CDOA 4JA0A 5KPDA 4TRRA 4JC5A 2VA8A 2FZVA 1TF2A 3A1SA 3LX4A 1N92A 3CBQA 2VJCA 4YRQA 4F6CA 1KARA 4NOJA 4EJ0A 2XE8A 2ZAGA 4WZBE 1FDIA 2A94A 3AY0A 1XIVA 1EM8A 4UARA 1DHRA 5ESXA 5BWOA 1FTYA 3Q8WA 2YXPX 3DAOA 3VR2A 4BZPA 1UOQA 1ZNXA 2C88A 3L4KA 2R7AA 5DXAA 3NBQA 3OFKA 4GR9A 4UZEA 5ALYA 5EJEA 3FZEA 3D6MA 4WSOA 5EWLB 1OBCA 1HI9A 4D9HA 1NOJA 1S4MA 3UB2A 1NN0A 3T8YA 4O5AA 4BYMA 3GGJA 1SB9A 4ZAVA 5KVCA 5JG7A 3L9XA 1ZONA 3EGDB 2BTEA 1CUXA 2QRKA 3WQHA 5DMHA 3HKDB 3MOIA 1WNFA 2QJRA 3O4RA 4KR0A 4AN0A 1XNQB 2O8BB 3QVSA 4CJXA 2P4QA 3UOAB 4EJSC 3UUWA 2C92A 3VSBA 1TM1E 4FFMA 1YHZA 2D8AA 2WT4A 2NU6A 3F4KA 1BFKA 1U0OC 3BAZA 1GZVA 1KEEB 5KVQA 4GSLA 1HRDA 2EVWX 3EAGA 3MAAC 4KRYA 2PZKA 2R6R1 4WZ6A 5AMXA 1QPGA 3ZCPA 4IKPA 4DBLE 5FOQA 5GIOE 3ZDBA 1BXZA 1T6BY 5JNRA 2CBXA 3REQB 3DMTA 3UJHA 4CTOA 1C29B 4DV4B 4J8PA 4D2IA 4KO3S 2A1UA 3EHDA 5L7YA 3OVMA 3EF3A 4Y2QA 4Y2PA 4H77A 2ZEJA 5EJ2A 4D9JA 1VMKA 5FWNA 3GP3A 1QUEA 4A8TA 2AK3A 4YJKA 2PT6A 2ZJ4A 4GNRA 1UIMA 2CNKA 4J90A 5FI3A 4JOCA 3VMMA 5DTIA 1YB1A 1Y5NA 2ZIZA 4J0CA 1V6CA 1IVYA 4ASUA 3ESYA 3U7QA 3RRNA 2QL6A 5GM1A 6Q21A 1YQDA 1EFRD 2NNWB 2ODTX 4BLRA 2PBZA 1EDDA 2FPMA 3MMSA 4TSRA 5DCWA 5LZ2A 3ZE1B 4F2HA 1NVGA 1EFPA 4KAJA 5I7SA 3NB0A 3ZQ6A 3I73A 1WAMA 1BCRB 2HA4A 1VA5A 1TZ2A 1SU4A 4MEAA 4UM9B 2F00A 4AB1A 4A23A 5CEEA 1PGPA 3BGVA 1PZFA 1WKCA 4HN4B 1NN1A 3KS9A 4LDQA 2B37A 4HUTA 2WYUA 4KX3A 5A04A 1JKIA 1UMBA 1IM2A 1W25A 5DV9A 3C5EA 2QLFA 4M6WB 3CPHA 1TDJA 1Z8FA 4NYJQ 4QQNA 3KVOA 1M6VA 5TQ2B 4BPRA 3GN2A 3F96A 4OBEA 3A36A 3K6SA 2ECOA 2JNWA 5BV8A 3RS4A 3RS0A 4K6OA 3DL7A 3IMFA 1V8FA 3PA6A 4RU1A 5EXSA 1YDGA 4B8WA 4BQFA 2ILTA 4MV8A 5KYWB 1E3DA 2X6TA 4KK4A 1I2CA 3Q4GA 4IUYA 3TQHA 3P5SA 3ZHRA 1DEHA 2I66A 2GM5A 4A16A 4CHTA 3VJRA 4DLWA 1EM8B 5JWOA 2JPDA 3DKRA 3GCWA 4LK3A 10MHA 4NXMB 9GPBA 3DW1X 2NZWA 2QOEA 3EVCA 3QIVA 4JLVA 2Z2JA 1NMXA 5EMJA 1Y8QA 2O2YA 1B73A 4RJLA 2DWCA 3AESA 3TVTA 2BCEA 4R98A 5CK5A 2O0KA 1XVIA 4KQKA 4X3PA 4ZALA 1H2EA 2P79A 1F8FA 2O1SA 2R8EA 1XEWY 3SU8A 3V34A 1UP6A 4DYHA 2VH5R 1BEUB 2FKNA 2PWZA