2ZRAA

Msreca q196e atpgs
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
325
structure length
310
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGHVGLQARLMSQALRKMTGALNNSGTTAIFINELRTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 93
structure length 310
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zraA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zraA01
4HZUA 1R0ZA 5JCPA 1Z3IX 1RVDA 3ZD6A 1VECA 3ZVLA 5GJCA 4LV6A 2JLXA 2EVWX 2QU8A 1QHXA 2HV8A 4NYJQ 2GKSA 5J40A 3SOPA 4XTRA 4B71A 4O25A 4M22A 2YINC 1SVKA 4HUQA 4JBXA 4ZCIA 1G4AE 1M74A 4WVFA 2DB3A 2WKRA 1RYFA 1FW6A 1FOEB 3A58B 2F3TA 2OSBA 2R62A 3U60B 2WWYA 1BKDR 2PBRA 1CJUC 2OESA 3IIKA 3TSWA 5KPDA 4ZDKA 3RAPR 4UNPA 5GJBA 4AYTA 3GLIA 1YR9A 1D5CA 2IS1A 2ORVA 1O3YA 4C2UA 4Q9JA 2ZJZA 5CYOA 5G53C 1UPTA 1YHNA 4JJZA 4Q18A 1SVLA 4TLAA 1KI6A 3QXCA 4HAWA 2NO9A 4N1AA 4B2LA 4DSNA 3ND8A 1UADA 2ANCA 2WWHA 1KJYA 3F8TA 1XEWX 5FUXA 2IWHA 4Z8YA 5TDHA 3W90A 5E4FA 3QF4B 3B1ZA 4US1R 1T3HA 4LZZA 4PQRA 4M1OA 3BJIC 3IIMA 3CBQA 3LBIA 3I61A 1SVMA 4CGZA 1S1CA 2IW3A 1VYVA 3MGCA 5AJXA 1TEXA 3KFXA 4PHTA 2DYKA 3X2SA 2V7QA 3CR8A 3K0EA 2IF2A 2XNSA 4C30A 2AK3A 1T4GA 1EFCA 2AFHE 2WPDD 5J4KA 3CRRA 4CDGA 4RD0A 4TLDA 4RD2A 2DWPA 1Z06A 4AIIA 4DC9A 3GJ0A 3I8XA 2V4ZA 1WE2A 2FA9A 3THWB 3SYLA 5CDFA 2NGRA 4TZ0A 1CR1A 1WXQA 2ZVQX 2FWRA 4LJ8A 3SHWA 5AUQA 4CEJB 4ESVA 1II9A 4IXMA 4KLNA 2W6ID 1GIAA 3AUXA 1KTVA 4XIGS 4AD8A 3ONWA 3TRFA 3JZAA 3W3ZB 1F3OA 2VSXA 1HT1E 3BC1A 1TQ4A 3WNBA 1PZNA 1E32A 3WNCA 2ATVA 4FIDA 5K8LA 1GSIA 3P27A 1W4RA 4OI1A 2ODWA 1QVAA 2F1IA 1GFIA 2BMDA 4IDHA 4EDHA 4RSGA 4UXHA 1ONBA 2QNRA 3P32A 4TTRA 1N5LA 1J99A 1TNDA 2JIZD 4MKFA 3U7FB 2I3BA 2RCNA 5JZVA 4G1UC 1WDTA 1HYQA 1XTJA 4DJTA 2BKEA 2O8EA 2YC2C 2ZYUX 4PQYA 1Z28A 4V0KA 4LYHA 4Q4AB 3K0CA 1ZC4A 4LPSA 3E5HA 4O2LA 2A5GA 3LX5A 3WMFA 3CX8A 3NH6A 4OQFA 1BMFA 4OHWA 3AVWA 3H4MA 2QMOA 3A4NA 4CYMA 2B8WA 5C2JB 5CB6A 2ANBA 2AXNA 2DWOA 3KB1A 2CMKA 1XU4A 1G3RA 2JATA 4LV8B 1QZXA 3ZGXA 4D81A 2JEOA 3Q8XB 1NKTA 1YQTA 5IHPA 3NVAA 4MRPA 1T3SA 4N0EA 1ANKA 1KSJA 1CS4C 3PUXA 1IY1A 2YV5A 2ZANA 3VKWA 3MRSA 2J9RA 4G3XA 5H70A 5FTKA 1IN7A 2RGAA 1KMHB 3QKRB 5A0FA 1DAHA 4TSFD 4IFEA 4G5SA 3UIEA 2J0UB 1ZIOA 5FTLA 1XP8A 1C4OA 4CW7A 2YWFA 2XZPA 3L82B 4DB2A 3LW7A 1U0LA 1HH4A 1YZKA 1C9KA 3K0FB 1OKKD 3THWA 4YMTA 1EFTA 1KI7A 4BLOA 5EP4A 3NDBB 1E96A 2J45A 1ZJ6A 1U98A 1S9DA 2XB4A 1N5IA 3JZMA 4TL8A 5FBLB 4YQFA 4WBSA 3R9WA 1E2GA 1QBKC 3D6TB 1CLUA 1OT3A 1SXJB 2FSGA 1VG9B 4JBYA 4GDFA 1MO5A 2OCPA 5FTNA 2FF7A 1KYIA 2ZAOA 2HCJB 2MMCA 3NEYA 2XSZD 3PEWA 2JJ2D 2CNWD 3WRXC 1GDDA 2O8FA 3TNFA 1PJRA 2G1JA 1CJMA 1AQYA 1S3SA 2WSMA 4NCNA 3ZYCA 4ESHA 5BN3A 1IHUA 3EPLA 3GQBA 2OCAA 4OBEA 3L8YA 5LBIA 2A78A 2JLUA 2GVZC 3PUZA 3VKHA 3IEUA 3QKUA 4UQOA 5A5GA 1G16A 4JVLA 4LJ5A 5GJWC 1W36D 2GAOA 5G3YA 4Z8XA 3DPUA 5FR1A 2R9VA 2OLKA 3L0PA 2CK3D 3PEVA 4MYTA 1ZM2A 4PO1A 2QBYB 3QKSB 4FW9A 4XH9B 5EJEA 1P2TA 4FCVA 3TR5A 1JXOA 4KYIB 2BM0A 4IDQA 1ZUNB 1D8TA 2P65A 1RE0A 2G83A 2QAGC 1II8B 3BERA 4JVNA 2KB0A 2NQ2C 3PEYA 4KYUA 1RRFA 2WICA 3TSZA 3CM0A 1R5BA 1DTSA 1ZMXA 1QHHB 2ECKA 3AP1A 4BZQA 4ZV4A 1XTRA 4M8NE 1VHLA 4TLCA 1GWNA 3P4YA 2GTPA 1CP2A 2PZGA 1N6KA 2Q21A 2G77B 2PEYA 4B34A 5J4YA 3P1JA 4CT5A 3GJ4A 1D2MA 4QFMA 1E2NA 4A92A 1JJ7A 3MWKA 1W4BA 4Q7MB 2OG2A 4A2PA 4DLVA 3HR7A 4UKDA 1K6MA 4I4LA 1BO6A 2J5XA 2IYZA 3X1YA 2RGGA 1KGDA 4PC3A 3DMNA 2ERXA 2C95A 1P61B 1KJZA 1VCMA 2N1BA 2LKCA 4QKQA 4TMTA 1DBSA 4TMXA 2XITA 4W9MC 1KSGA 2QM7A 1NMZA 2NZJA 1KSFX 2CE2X 1W2GA 1U0JA 2A2ZA 4BFYA 3SFVA 1E9EA 4NYMQ 1UKYA 2DFLA 4HB0A 4PHGA 4GL2A 3UXMA 3TW8B 3A1WA 3EZ2A 1U9IC 1BIFA 1GRNA 3NBFA 3CKLA 3T5GA 1GVNB 3BBPA 1UDXA 3TVDA 1Z0DA 2XTMA 1ETUA 3FMFA 2REOA 3S1AA 1G7TA 2NO0A 1D2NA 2X77A 3BFXA 4MYUA 5KSOA 1Z5ZA 2CL6X 4Q01A 4D80A 3NBZC 3ECCA 5SZJA 2PCLA 3FFAA 1Q0UA 1Q1EA 2IUSA 2WSSA 1A82A 4L15A 4PSAA 4G5QA 4A8JC 1AQUA 1E6CA 2V1XA 3ZZTA 3K70B 3WNDA 5IRCD 2QRZA 4C0AC 2PT5A 1KZ7B 3BH6A 2EFDB 3O47A 2CJWA 5L3SA 3KTAB 2OFWA 4GT1A 4P3YA 4V0ME 3RSLA 5DHFA 2WBLC 3O8BA 3SBEA 2CCKA 2CDNA 2UKDA 2V8OA 3U7GA 1LTQA 1S8FA 1Q3HA 2A5DA 3AV0B 4KFUA 4CVNA 1OB2A 3BB4A 3I8SA 4GZLA 2H16A 2GJKA 2R6GA 1N6LA 3QBTA 3VX4A 4Q9KA 2ORWA 4FMDB 4PC6A 2F43A 4XD7D 4TQ9A 2P2LA 5HPYB 5HZKA 4A6XA 2OUKA 4BLRA 4ZIRB 5DHAA 3MCAA 2F43B 5J4VA 1PUJA 1G19A 1E9FA 4B73A 2FN4A 1KK0A 4Z54A 4JL6A 1OV4A 1M1YE 3X1ZA 3EPKA 2P6NA 2OT3B 4M1TA 3KX2A 1TQ2A 5H8WA 5ANRB 2IS2A 1RIFA 5BXQC 1IBRA 2ZRPA 3IGFA 3R20A 1IJFA 2PH1A 4DRZA 3KB2A 4RKEA 1LF5A 1G3UA 1IOZA 4NONA 3TH5A 2V6IA 1VG8A 1P75A 4K81B 4MKGA 3H2YA 5TV2A 1X86B 3I5XA 2ZTSA 4Q4LA 4Q9IA 4AKEA 1E99A 1M34E 3MMPA 4MGYR 1P2VA 2FGJA 2D4HA 2GF9A 2YJTD 3SBDA 1YZUA 5EP3A 2WOJA 1IXZA 3GD7A 1QRAA 2YNMA 2QE7D 1YR7A 4ARZA 4GOXA 1KI3A 1XPOA 1DEKA 8OHMA 2CCJA 3AF4A 2RGDA 5KOYA 4LJ7A 2YVUA 1UBGA 2ORIA 3ZIAD 3PQCA 2VF8A 3UK6A 2ZJYA 4BECA 4WW0A 1U0HC 1VCNA 1E2HA 3EC2A 4G5OA 4EPVA 3VR6A 1HY3A 4KXFB 4HATA 4HAXA 5IK2D 4WZBE 3QIAA 2J59A 4PO9A 1EG7A 1G4UR 4BE7B 2MSCB 4PHFA 3X1DA 2CXXA 3TK1A 1XPUA 4CF7A 1DAGA 1ZUIA 3V00A 1SGWA 2CHVA 4EPYA 5CITA 2F55A 2FFHA 2AL7A 1YRAA 1DVRA 2C77A 3FVQA 4KODA 2VHJA 2W83A 3IQWA 4JLVA 4LHWA 2VTKA 3KKNA 5E7JA 2LCFA 4I1SA 3Q5EA 4U00A 5F98A 1XNJA 3QPVA 4DSOA 1XCMA 1UBCA 3KXKA 2RGBA 1RW4A 3DM5A 1KI8A 4LJYA 3VKGA 1EK0A 3CIOA 3NKVA 1XZPA 1RYHA 3GFPA 4KJZA 1Q3TA 3ZJYA 1NLZA 3SYKA 4EQ6B 1Z6AA 5DISB 1YR6A 2FJUA 2J87A 221PA 2FPKA 1CRQA 3NG1A 3OE7D 2AN9A 3IUYA 1HQCA 3LBNA 4B3XA 2AKYA 3OF5A 4B43A 1AZSC 3ZLJA 1I4LD 3KJGA 621PA 2QP9X 4LX0A 2FEMA 3E70C 3REFA 4B3DA 4NYJR 1KKMA 3PENA 1F48A 4E07A 2QENA 2HDNB 3GLIB 3MLEA 2CL7X 3OEHA 5AR1A 2OCYC 4TZ6A 3V4FA 4AYWA 4DLRA 1AS0A 1GUAA 4IDPA 3B1YA 4IOMA 4GOJA 2GBLA 2D74A 2XAUA 1N6NA 4XJXA 5C18A 2CHGA 2H8KA 4C0JA 4MGKR 3GLHA 2P3SA 3U3RA 2F6RA 3EPJA 1TEVA 1P9WA 4PZLA 1D2EA 5FUWA 2ZRJA 2PL3A 1VDZA 3IHLA 2DBYA 4TLBA 3KJHA 4BPBA 2ZPTX 3CF2A 3NEJA 4JLKA 2VSFA 5BN5A 1E3MA 4RKFA 2IYWA 4JT4A 4KV9A 1VCIA 1P60A 2J7PA 2BMEA 4QM7A 2IHYA 1MKYA 2WJYA 3GLFB 1NVWQ 4BGDA 4B48A 3Q7QA 1EWRA 1P9NA 3AKDA 3GP8A 3KKMA 3TUJC 3C41J 3LNCA 1MOZA 1NIPA 2G1KA 3IQXA 1KAGA 2GJSA 2Z4SA 1GNPA 5DN6D 3THXB 4I1OA 521PA 1WBBA 3K0SA 3RRNA 1HA3A 1Q1ZA 4BASA 3B60A 3VR4A 2GZDA 4C0LA 1ZAKA 3SJCA 4Q66C 1XDBA 1U8ZA 4K8OA 1UFQA 3RNLA 1CR0A 1IY2A 2L0XA 5DSZA 4HYYA 1RC8A 2ZR0A 3QQ5A 3W6PA 2Y8EA 4EJSB 2F3RA 4RD4A 1MO6A 4QGGA 3E1SA 3TE6A 1T0HB 4LBZA 1N25A 3SN6A 2ZI3A 2GXUA 3CZPA 1D9XA 3G5UA 1J8YF 1PLKA 1PVOA 1W49A 3PUYA 4HB2A 3EZ7A 3W6NA 4CIDA 2ZI9A 4GOKA 1XXHA 1Z8FA 1M7HA 3GCGA 4GPTA 3VU9B 2XXAA 4PFSA 3TUZC 3IPYA 4Q02A 4UNSA 2ZRLA 3TLXA 1Z0KA 1NF3A 1W36B 1COWD 3HYTA 3IDQA 1VIYA 3QF7A 2IA5A 4M1WA 4ZCLA 1SXJA 2R44A 1TPZA 3DL0A 1MO3A 3FKSA 4W7SA 3GEIA 5CYPA 3TBKA 1E2MA 3B1XA 1RKBA 3ADCA 1AIPA 4QHSA 1EX6A 1XJCA 3MD0A 1LW7A 4HLUC 2JDID 1AZTA 1OB5A 4LHXA 4KBGA 4Q4HA 5BYKA 3ZQ6A 3CPJB 4JLMA 4WZ6A 3IILA 2J0UA 2VPPA 1OXVA 1GITA 5B30A 4Z1MA 4OI0A 2OE2A 4XVQA 4A15A 4IVRA 2WIBA 5FBQB 2NIPA 1K5DA 2ZRNA 3PJRA 2F9MA 3QKSA 4JLDA 4W5JA 1MABA 2A5YB 2QBYA 3LD9A 4AI6A 3UMFA 2O0HA 4B2PA 5CJ2A 4NZYA 4B3GA 4AWXA 5TXGA 1G7RA 5EP2A 3TVTA 3RC3A 5KHOC 1F2TA 5L3QA 1O87A 4V03A 1Z0IA 2BMFA 1FUUA 4BLTA 5CB8A 3ADBA 4A0RA 4ZO4A 3THOA 1P2UA 5UKDA 2GK7A 1FUKA 2P5TB 1G21E 1KMHA 4FMDF 4GFDA 5JWOA 4BEBA 5HCIA 2J7KA 3N5CA 1JPNA 4D0LB 2AD1A 1OXXK 3BD9A 5DH9A 1G8HA 1NVXQ 5F9FA 3WHLA 3EARA 3QE0A 2IUTA 4PHHA 4TQUS 2VP5A 3B82A 4BFVA 4E22A 2MSDB 2XEXA 1N3BA 2W00A 1NY5A 3PITA 1GOTA 2PMDA 2WOOA 5EUQB 1DG1G 2XOKD 2C9CA 2W6JA 1GKUB 4Q4JA 2KBFA 4BZXA 4HUTA 4P32A 3KXLA 3LWNA 1N6HA 5EE1A 1Y3AA 2EWVA 4LBWA 1NVUQ 4W5WA 3U61B 3B2EA 5C1BA 3RWOA 4AKIA 1NBMD 1Z6XA 2PJZA 5FBRB 4JVSB 3GLIE 3GFTA 4V0NA 2ZR7A 1Z0JA 1E98A 1KHTA 2ZJBA 1VYUA 3T1VA 3TQFA 4ARZB 2H17A 2I4IA 2F7SA 4HDQB 3BOSA 4DCVA 2WJGA 2R6FA 1BS1A 4A8JB 1YKSA 1CJTC 3BFKA 2V9PA 2WJJA 1KDRA 1BMFD 2QM8A 1CR2A 5DI9A 5BWMA 3HU2A 2EFCB 2IS4A 4F91B 1NY6A 1NLFA 5C4MA 2GETA 2BDTA 2IYYA 3W34A 3EIHA 1WP9A 1DO2A 2PZEA 2A30A 3DOEA 4F4IA 4DEXA 1RZ3A 4C3ZA 5AK0A 2A9KA 1PLJA 5TY0A 1HE1C 1KZGB 2OM2A 3A4LA 3GEEA 4OQXA 1ODFA 4AG6A 5JLJA 3WYFA 2J41A 4NKRA 4OK6A 4UNRA 1E2DA 3RSOA 2GWHA 2V1UA 2I1QA 1G7SA 1IY0A 3THXA 5DYGA 2OXCA 2DCUA 5FOVA 1A4RA 1TUIA 2ZI4A 3O8RA 4WOPA 1PV4A 2ZS8A 3U6KA 5IT5A 5ELXA 1P2SA 4R2IA 2O0KA 4TT3D 4ZIRA 5GADl 1GNQA 721PA 4RD1A 3GLFE 1LNZA 2ZE5A 3QF4A 2ZRIA 4FI3C 1UKZA 1W2HA 4FMCB 1ESNA 1OYWA 2XJ4A 3HJNA 4EPTA 2D2EA 1FP6A 1A7JA 1AK2A 5KDOA 5LPNA 2VHQA 1GL6A 4TMZA 3ASYA 1AS3A 4DEYA 2ZSBA 1E4VA 1KSHA 5LD2B 4XWAA 2F1HA 1Z22A 4RVCA 2C9YA 1KK1A 3A1SA 2AX4A 2AKAB 1ZC3A 3FWYA 2QPAA 2K5UA 4QGFA 3W8NA 1LV7A 4DCSA 3T06B 1FMJA 1K8RA 3GJ7A 4MRSA 1TF2A 4C7OA 2QAJA 5J47A 3A1TA 3IPXA 5JEEA 3QPWA 3I32A 4ITRC 1I2DA 3U4QA 4WXPA 2IYUA 1ELOA 2OBNA 3HR8A 1JEEA 2JLQA 4DLWA 2GEVA 2AD5A 4L5BA 4NYIQ 4PSKA 1IM2A 1NRJB 3MJHA 4NP6A 4QG7A 5JEDA 1KOFA 2GEUA 3S1AB 1X8JA 1H8HD 2VH5R 3CZQA 5HCNA 1OH5A 2W2TA 4FCWA 3L0SA 5HR5A 2VIIA 4C0QC 4OI2A 4OKSA 1KK2A 4BFXA 4EUNA 2GRJA 3B9PA 4ASUA 2RHDA 4CEHB 4L4UA 2R8RA 1E4YA 1Z2CA 4IOJA 1CKEA 3AGPA 4LPKA 3TR0A 1U90A 5P21A 4DUGD 5JI2E 1IAQA 3N2EA 2E87A 2ZI6A 2FFBA 4OHVA 4HB4A 4WXRA 3M1IA 3W6OA 3MAAC 1SVIA 3H1TA 4B44A 1E2FA 2C78A 2CJWB 3IEVA 4F7WA 3T1TA 4MRVA 4B6FA 2W2VA 2Q0HA 4KAXA 4MRRA 3SR0A 1E1QD 5JHGB 2W0MA 4LJAA 5K8UA 2HXYA 1RRCA 1OFUX 3M0EA 4FXPA 5CM8B 1R0WA 4X8HA 5JSZB 821PA 4F4JA 3W8RA 3RWMB 3G82C 1WCV1 4TTQA 4OHZA 3ZQJA 1DOAA 5LDDC 1TAGA 3A1VA 3CF6R 4YMWA 3SFZA 3UPUA 1VYTA 4RZXA 1ZIPA 1E9DA 1GILA 4Q7KA 2OCBA 3L0IB 4G0NA 1P7CA 1N5JA 2IC5A 2YWEA 3CRQA 4FWTA 4RFVA 4TQAA 3NTUA 3TAUA 2W6IA 1XX6A 3HP1A 1SQ5A 5E7IA 2WAYA 3KQUA 3OFNA 4LYJA 5JWHA 4S35A 2OHFA 2WMOB 5TARA 1SVWA 4N3NA 4JKIA 2QL6A 3QXXA 3AVOA 1G291 1CR4A 4NCHA 4WAUA 2G9NA 3U3KA 2OV2A 5FOUA 4C7OB 2EYUA 1JJVA 1TF7A 2OAQ1 3EC1A 3B5JA 1MO4A 2ZYVX 1N6OA 4NTZA 421PA 4DHEA 1YE8A 4JZKA 4TMKA 3OFND 1NVVR 5JCZA 1UBFA 4GMDA 2JAQA 3ZS8A 1XZQA 4IEEA 2JA1A 5GJVC 4MA4A 1E9AA 2FSFA 2ZEJA 2ZJAA 4HZUB 4IVPA 3LVQE 1GRQA 3NBXX 3SNHA 4D4LA 5DI3B 5JS8A 4D26A 1W4AA 1RJ9B 2Q3MA 4A2QA 3BGWA 4KCGA 3NHAA 2FV8A 1E1RD 2QAGA 1OIXA 2KSQA 2O0JA 3DZDA 3LDAA 4UJ3A 4JL8A 1JAHA 4LC0A 1P3JA 1EFHA 5KO2A 4KHZA 1M8PA 2PX0A 1XF9A 4GSYA 1T8TA 2RGCA 4M9XA 4DVGA 4ERNA 3AF0A 3AP2A 4NCKA 4TYPA 2AWNA 5B57C 3KQKA 1WB9A 4IEIA 2XNDD 4U7DA 4C0HA 1JR3A 1XRJA 4F38A 3AVQA 5F2EA 4TYYA 2YWGA 4M1YA 5HE8A 4BWYA 4NPHA 5FPSA 1FP7A 4XTCS 3CB4A 1PUIA 1GL7A 2ZJOA 3DMDA 3L0OA 3U44A 3TAHA 3T1OA 1WA5A 2A5JA 3BWDD 4WIAA 4LY6A 2GCOB 3IBYA 2BWJA 4LYFA 2NPFA 3ADDA 2WVJA 4C2TA 3CX6A 3GEHA 3PXGA 1FMLA 2HUPA 2HCBA 5FUYA 1XXHE 1E69A 4R7ZA 2C03A 5FI0B 2NMVA 2VP6A 4RY2A 2VA8A 4JYBA 2QI9C 2IXGA 4KFRA 1L8QA 2WWWA 4YXWA 4TYWA 1ZU4A 3NDPA 2GCOA 4LCBA 2R2AA 4Q4AA 3QUSA 3B6EA 2IXFA 3KKPA 3OEEA 1EFUA 2EFHB 2FPLA 2W6JD 1N0VC 2PEZA 2Q9CA 4URZR 1KNQA 2ZRAA 4XVUA 5J5CA 1W36C 4CEHA 3SEAA 1W0KA 2Q3HA 1F2TB 3MSXA 4M2LA 4L16A 1KO1A 4I99A 4UNQA 3ZIAA 2Q6TA 4HZIA 1E79A 4LYAA 1J7KA 2PLRA 5KNBA 1E0KA 2JASA 3QOFA 5J4LA 3SE0A 2IYSA 1KK3A 2BEKA 4JSTA 1U81A 2XJ9A 1CBUA 4FINA 4IW3B 2QP3A 2QTFA 2ZAMA 2ZQ5A 4ZDIA 5B58C 3AVUA 5AUNB 2ATXA 1NG1A 4B35A 1DAKA 3OIWA 1U2RA 4P4SA 3H84A 5G40A 2FZ4A 1IN6A 2ZUDA 3FMIA 4FMBB 2J3EA 2ZRMA 4Q1DA 2QA5A 3UG6A 5JJIA 2BC9A 2ZS7A 3DEFA 2ZM5A 4M0LA 2WSSD 1V43A 2QMUA 3WY9A 1OJLA 1EFRD 4P33A 2D62A 2JDIA 5LB4A 3RANA 1G6HA 5G41A 1DARA 4JKYA 2OFXA 1DAEA 3DVLA 4NL4H 5AWFC 4Y0AA 3VR5A 5TMPA 2VLIA 1I4DD 4LGMA 4XOIA 4BFTA 2QGZA 3K70D 3AVVA 1T0JB 1LFDB 1W5SA 4ZDWA 4F4CA 5EQTA 1CJKC 1F2UA 1J70A 1DE0A 3AQ4A 3FKQA 2QMHA 1ZCBA 4JLAA 4MUBA 4ZI2A 4US2R 4MGZR 1G3IA 1NJGA 2GXSA 1NN5A 3VHXA 4P4UA 4AKHA 5KYKA 4RZ2A 1E0AA 1IQPA 1VCOA 2GXQA 4MDEA 4URXR 4LJ4A 1G5PA 2KI5A 3D7MA 1KI2A 1HQYE 4DLSA 4PXAA 3B8HA 1G41A 4DDVA 4LC1A 4HLCA 1A5TA 1NBMA 4DLUA 1GNRA 2WWGA 2CLCX 1Y63A 3M6AA 1QHGA 5KSYA 4D4JA 4B2IA 2JJ8A 4TL7A 3RS0A 4D4KA 2YZ2A 4YXWD 1AA3A 1N6IA 2BKUA 3TIFA 4QGAA 3GLHB 3CRW1 2J1LA 4II7A 4Q48A 1AKYA 5DNYB 1NBME 1A2KC 1TQ6A 3B1WA 1S9HA 3K53A 4OJKA 2NO6A 5CIWA 4DZZA 1E2LA 1OSNA 4KO8A 3SQWA 2QPTA 1M2OB 4PANA 3QG5A 5JMTA 1SHKA 3UWKA 4A0FA 2ZROA 2VHUA 3BXZA 3NBYC 3TGPA 1YZGA 2WKPA 2Z43A 5EZ5A 4DCUA 4MRNA 3SZRA 3QSYA 3BB3A 2C2HA 1II0A 3SS8A 3AH8A 1QG2A 1RRPA 3CLVA 2ZE8A 3HPRA 4KLZA 5CDFE 3KQHA 4XWKA 3GFOA 4Q21A 2J7PD 4BLSA 3K0CC 3U3JA 5FH9A 1ZM4A 4M9QA 1EESA 5F9HA 3B9QA 1Z29A 1JAIA 1S96A 1JR3D 2HYDA 3FGNA 3FYHA 5KTYA 3RABA 3U7EB 2O52A 2YC4C 4HDOB 3AVXA 2ZRHA 5H68A 4NCJA 4PQFA 1T91A 3CX7A 2QZ4A 1NSTA 3OESA 4G5GA 4OQLA 1Z47A 3EXAA 3SJZA 5HZHA 1RPZA 3SJBA 2REXB 3AKCA 2BJVA 1JB1A 4XSHA 4ZI3A 4GP7A 2C04A 4HDCA 2MMGA 2ONJA 4D25A 2O8BB 2BBWA 4LHZA 3TUIC 1Z83A 3IO3A 4I1UA 3DKPA 4JYCA 5FBVB 3AVYA 3ZH9B 5L3QB 1KY2A 2QN6A 5EUMA 4QJ3A 4A6PA 2JLVA 4EPXA 3REGA 4BLPA 2HJGA 5DO9A 1S0UA 1MRNA 3KJEA 1R0YA 5EE9A 1AM4D 4EJSC 2C5LA 4HAYA 1G17A 2H57A 3HU3A 2HJVA 1NJFA 2OXRA 1RRGA 3AKYA 1NN3A 3QI2A 3FE2A 4GZMA 4PSVA 1OW3B 2DFKB 2HF8A 3A37A 5EXSA 2YKGA 4Q1CA 3MG9A 3DOFA 1R0XA 1G6OA 2N42A 4AY2A 4DWJA 1M7BA 3C8UA 4JLNA 5BN4A 1A2BA 4KVAA 3OHMA 5BW8A 2WJVA 2OBLA 2HT6A 1S1MA 1Q12A 1GAJA 4Q4JB 4PR0A 4U5XA 2GILA 1Q22A 4EPRA 3V9PA 3THYA 1T8UA 1SXJD 4JLOA 4AC9A 2RB4A 4MITA 5FR2A 3K9HA 3B85A 5D3QA 3ASZA 5FL7D 4L9WA 3C4JA 2O8BA 4YC7A 3BH7A 2IYQA 3GJ5A 1MH1A 3RRMA 2IYTA 2QT0A 4BLQA 2GXAA 4PTLA 5CLQA 3T5DA 3C16C 4A8JA 2B6HA 4B76A 1EWQA 4ON9A 1XMJA 2AHOA 2BJWA 1R4AA 4ZCMA 2CK3A 2GF0A 2IEYA 5JSZA 1G3MA 4V02A 1W0KD 2CCGA 3ICEA 4EFMA 2BCJQ 2QY9A 2Z0MA 3N70A 5FL7A 1QHNA 3CRMA 1L4YA 1LY1A 1TU4A 4QBGB 2ZREA 3OZXA 3K8YA 2GNOA 4C4PA 2ZRDA 1W46A 2FH5B 3LO5A 1CIPA 2XTZA 3BIFA 1NKSA 5D3MB 1E2JA 3CNLA 3LLUA 4HB3A 3BE4A 2WAXA 2FEOA 1CJVC 1R10A 4V0MA 1AS2A 3EPHA 2KJQA 4NYMR 1HURA 1G20E 2IEZA 4AURA 3RS3A 3WBJA 1XEXA 1Z07A 2E9SA 4P31A 4TT3A 2EFEB 4G01B 2G88A 2OO7A 2GESA 3GMTA 3R7WB 4OQMA 3K1JA 4X8LA 2O8CA 3P4XA 4JLJA 2KE5A 3ICQB 3A6PC 1D6JA 2VRWA 1ZM7A 1FTSA 1XCPA 4JLBA 4DIDA 4XVRA 1GKIA 3FOZA 3OIYA 1XEXB 5EXXA 3K09C 1HT2E 2X19A 4KSBA 3OE7A 1IN8A 1ZNWA 4YLGA 1R8QA 1FX0B 1E2KA 1CF4A 2EYQA 3LRPA 4C0KA 4IFBA 4ACBA 3CR7A 1OLOA 5H1YA 3NXSA 3GJ8A 3ND9A 1W4CA 2NO7A 3I5YA 3SJAA 2F9LA 5JHHB 5EXPA 1SKQA 2XZOA 3K9LA 3QKTA 1HEIA 3AEZA 3C14C 2H18A 1ZRHA 1DO0A 3WP1B 5HTKA 3U44B 5DI3A 2VF7A 2YWHA 4FCTA 3T61A 1R5OA 2CNWA 4OK5A 5CK4A 4D2IA 4Q5IA 3C5HA 1ZNXA 1E79D 3ZZ0A 1Q1QA 4HLUA 3I92A 5IDVA 3VU9A 2REBA 1H65A 4MDFA 3U7HB 1U99A 1LS1A 1FQJA 2GCNA 1GRRA 2QPOA 1YU9A 5L8VA 2PCJA 4Q00A 2SHKA 3AGQA 1E2EA 121PA 1MR3F 1R6BX 1KDOA 3RRYA 1X6VA 1EXMA 1S4QA 2WHXA 2QQ0A 3AF1A 4M1MA 1OFTA 3KZ1E 4EIWA 4YMUA 2HXSA 1YJ5A 4DCNA 4US0R 2ZJ2A 3DHWC 3JVUA 4B75A 1U8YA 4YDSA 4P4TA 3KJIA 1KMQA 5JRJA 1II8A 2QAGB 3MJRA 2Z5FA 4EQ6A 3BRWD 3TKLA 4A9AA 3DDCA 4R98A 3W5IA 4LOAA 3SC3A 3H0KA 1WF3A 4QOSA 5AJWA 5L3VA 1E0SA 4QHYA 2RMKA 5KPJA 3W3AA 4QRHA 4MKHA 2O8EB 4TL9A 4TSFA 1VTKA 3I4LA 2QT1A 4MGIR 4BFZA 5LD2C 5DN6A 3PUVA 4XWOA 4LI0A 3NHBA 1SZPA 4QBHA 1WQ1R 2NZ8A 1JR6A 4LWZA 4V0LA 1NI3A 3LX8A 1XD8A 1E9RA 5FFMA 1WBDA 1NG9A 3B13B 4YDHB 3L2OB 4OHYA 4JJKA 3SYNA 2G0TA 1OXSC 2P5SA 3B1VA 4E09A 1OFIA 2BMJA 1KO5A 3H86A 1DELA 1AN0A 4DSUA 3V4RA 2P6RA 1OF1A 2HEIA 1N6PA 2GJ9A 3TQCA 2NO1A 4A0GA 1BOFA 3VAAA 5JS7A 3A36A 1NIJA 3AM1A 1U9IA 3VNUA 1CEEA 1SULA 2V7QD 1XPRA 2GBLC 1YVDA 1FX0A 2XGJA 1JEDA 3CONA 4FWIB 5KSZA 3AF3A 2D7CA 3QEOA 3FHOA 2YOFA 3P20A 3I73A 1E0JA 1BYUA 1TX4B 3LH5A 2E1RA 1TTTA 1NN0A 4BFUA 3EIEA 4DKXA 2ZU0C 3RRZA 2C96A 2DFTA 4NE2A 4R2HA 4M9SA 2XOKA 3T34A 4IRUB 3BK7A 3O8CA 3D3QA 2NG1A 3RDPA 3BORA 1UM8A 1QF9A 1XMVA 4IHQA 3T12A 1G7CA 3OEED 4TMWA 3ZDQA 5GVSA 4TMVA 1RJ9A 1ZINA 2NOAA 2J0SA 4ZKDA 5FOXA 5E95A 1XFAA 1AGPA 3G0HA 2IBMA 2P0EA 3KL4A 2ZSDA 2AWOA 2ZITA 1E1QA 2FFAA 5IK2A 2QTVB 4B3CA 3LW8A 2ZI5A 3CWQA 4BFWA 3CNOA 1DAFA 1NN1A 4Q47A 2F1RA 4GP6A 1R2QA 3ZVRA 4IVQA 3SDZA 2D7DA 2VL7A 3E2IA 1SVSA 2RHMA 2RGNC 3AB3A 3EAQA 4PX9A 1QHYA 1LB1B 4YONB 2HLDA 4Q1FA 3RS7A 4DCTA 2IYXA 1XTSA 2DFNA 3Q5DA 3RS2A 4MKIA 2FU5C 4Q4HB 3CWZA 4QC2A 1KJWA 3VFDA 1T9HA 2JJ1D 4LBVA 2WTUA 1SKYE 3R9IA 1JI0A 3WRYC 3Q85A 4J0QA 4BUJA 3FHCB 4JIMA 4OYHA 2WV9A 1VIAA 4HI0E 1VHTA 3IIJA 3UMRA 4KITB 2MSEB 3PIRA 2XXAB 2QQEA 2G3YA 1HTWA 3VR2A 3CO5A 5HKKA 2EQBA 2G6BA 1VMAA 2ZI7A 4BFSA 2A3RA 1W1WA 2V6JA 1Z08A 1C1YA 4C9BA 1GL9B 4KSCA 4O2RA 2IXEA 1OH7A 3EIQA 2A7QA 5FOWA 1YRBA 2YOHA 4XSGA 2ZJ5A 4IDNA 2OEPA 4P4SB 4QGHA 2CBZA 1Z6YA 1OXTA 2WWIA 4K46A 1Q57A 4TL6A 2ODBA 3BB1A 2Q3FA 1ZP6A 3BS4A 4URUR 2IL1A 4RCZA 2FGKA 2IYRA 4GMXA 4B3FX 4RFSA 4DB4A 1MABB 3QNUA 3TJZA 3PG5A 4KBFA 2O8FB 5FOTA 2OAP1 2GJAA 4QNRA 4IKEA 1BH2A 4FD2A 2QMEA 1YZLA 2BHRA 3MWLA 4I1VA 4BRUA 2JLYA 4PPQA 4D6PA 4RD3A 1NNEA 4AKGA 5FTMA 4LSGA 2OLJA 1L2TA 2O8DA 3EW9A 3RHFA 2QROA 3LY5A 5FTJA 4WA7A 3FTQA 4B74A 1GKYA 4V0OA 3LQQA 5FL3A 3NH9A 2O8DB 1NLYA 5DE3A 1G1MA 3FDIA 1V5WA 1KO8A 3R8CA 1B23P 1CTQA 3QXJA 3WBKA 3GJXC 4RJLA 4B32A 3VQTA 4PAOA 3CPEA 1W48A 5TVKA 2ODNA 5FUVA 1F5NA 3VHLB 4OL0A 3J81k 1P5ZB 1Q44A 4Q03A 2O8CB 1UF9A 3NWJA 2R6AA 2BOVA 3KUDA 1F2UB 3PV0A 3D31A 3EZ6A 5J4HA 5JJLA 4RD6A 4L9SA 1B0UA 1SHZA 2CLDX 2OFOA 1ZNYA 2AR7A 2IK8A 3WP0A 4ZDJA 5A4JA 3Q9LA 4TN1A 2ZS9A 3CRVA 3F3YA 2GEDA 4BRWA 4TYQA 2KWIA 3HWSA 4Q1BA 4RZUA 3C5CA 4Y0VA 4X8MA 1N2CE 5AUPB 1OKKA 2QG6A 1PLLA 4DLTA 3FHTA 1Q20A 4CT4B 2GVDC 3N2IA 1X1RA 4HAZA 3SU8A 1W0JD 4M9ZA 3TW4A 3X1WA 3K9NA 1K5GA 1S3GA 2NTYC 1IXRC 1FZQA 1KIMA 5JFGA 1IN4A 4Q9HA 3HPQA 3C15C 1HE8B 3PUWA 4ASUD 1F60A 1H8EA 5E7MA 4A0HA 4QHTA 1ZCAA 4HAUA 2DY1A 4MH0R 3IKJA 5EXTA 1FNNA 5LB2A 4C0SA 4NYIR 4DUGA 3CPHA 3OEHD 1TMKA 4HUQB 3RYTC 3QXSA 4CRWB 1XMIA 4DDWA 2WMNB 5DLQC 2ZJ8A 1VPLA 3UMSA 3SQXA 3T35A 5C4GB 1IONA 3BFVA 3QEJA 1ZM9A 1KI6B 1M7GA 5FPYA 4FN5A 4URYR 1Z63A 2ZU6A 3THYB 1EFRA 3CF0A 4NBSA 3ZVMA 3RVBA 2RH5A 3AUYA 1JALA 1X8LA 2RGEA 1XWIA 4IOKA 1L7VC 2CLSA 1E94E 4E03A 2AXPA 5FPKA 1G9XA 3FB4A 3MFYA 3ADKA 4Q1EA 4M1KA 5CJPA 3LAWA 4D0GA 1DAIA 3UATA 1GG2A 3FPAA 4TYNA 3CNNA 4A2WA 3GJ6A 2XNDA 4KI0A 1HUQA 2VBCA 3WXMA 3GLGA 1XJQA 1WMSA 3ETLA 3QJYA 4AG5A 1XBTA 3KTAA 2ZSEA 2RGNA 2JGNA 1DG3A 1Z2AA 4H9GA 1VKJA 4LJ9A 2ONKA 4LBYA 4Q7JB 4A36A 3KKQA 2TMKA 1OIWA 3GJ3A 4UXJA 1ZUHA 3GLHE 2DR3A 3GLGE 2WKQA 4G5RA 1UEIA 1JNYA 3NC1C 4Q19A 1X8KA 3EA5A 3K09A 4IXNA 4Q1AA 2IUUA 2XZLA 3IHWA 3C7KA 1UJ2A 1XEFA 1Q1BA 3WMEA 2W0SA 1D9ZA 2ZETA 3GPLA 2VO1A 4OJQA 1TUEA 1M6NA 2ZRCA 1CULC 1JQJC 2A5FA 2WJHA 1HV8A 2AK2A 5EE5B 3U2QA 1UDWA 4CEJA 2ZR9A 2ODEA 1OIVA 3QG1A 1JXMA 3QKRA 4FMCF 2QTHA 3EA0A 3I1FA 4QL3A 1XCGB 3WHKA 2WM9B 1W0JA 2CE7A 1ZD1A 3K0AB 3EASA 1X1SA 4DT1B 1GM5A 5TB5A 1UAAA 4OQNA 2C9OA 5G3ZA 1YR8A 4PO8A 3RC8A 1SXJC 4PZYA 1Q21A 1LVGA 2RKOA 4JS0A 3CW2A 4TLEA 4ACAA 2IYVA 4NH0A 4EKDA 5JJKA 2FSIA 1NSFA 1FQKA 1CXZA 2UZ3A 3QVVA 5SZHB 4EFLA 2D06A 3CUEF 5CIQA 4OI4A 2JCSA 4OK3A 1IXSB 4JBWA 3F0TA 2IF0A 1N5KA 4U02A 2F1JA 1SVOA 2HYIC 3LQRA 3EZ9A 4DXAA 5B64A 5JWRA 3FFBA 4NMMA 4JL5A 5F3WB 3Q7PA 3PVSA 2NPIA 4IOLA 2C98A 2R6DA 3X1XA 1KDPA 1XJ0A 2ERYA 1JPJA 4EPWA 2XB2A 1WRBA 1W5TA 3I3SR 1N6RA 5HE9A 2IHBA 3QY0A 1DADA 1U8AA 3EZFA 5CK5A 2ZRGA 1EX7A 4JSYA 1Z6TA 2DWQA 3CH5A 3A1UA 1G5TA 1YZNA 3U5ZB 2PLFA 4PPNA 3KFVA 3LV8A 1JR3E 2ZE7A 1XTKA 2EWWA 1KNXA 3VTKA 3ZD7A 1SKYB 1I2MA 2JJ1A 2H5EA 2B7CA 2BIFA 2P67A 3B78A 3DZ8A 3PEUA 3L43A 2D3WA 3RLFA 3B7GA 4DDTA 1W47A 4LUCA 2QORA 5DGXA 2GJ8A 5M04A 4QJ4A 3IO5A 1VG0B 2FFQA 3EWSA 3RS5A 4EFNA 1H8ED 2PT7A 1L4UA 2B92A 4DDUA 2DPXA 4WZAE 1XMSA 5CM9C 4EJSA 5EE0A 5KSPA 1GZSA 4DLYA 3FMOB 2IS6A 3WYAA 1FFHA 2WPDA 4TWZA 1QHIA 3K9GA 1P6XA 4URWR 2ZYTX 2VEDA 1CU1A 1G64A 1ZBDA 1QG4A 4NHOA 4P0TA 4PPGA 5SZKB 3OAAD 1AGRA 3PFIA 3T1QA 3KQNA 4DSTA 2XSZA 2LWIA 2GAAA 3TMKA 4D0NA 2BVNA 2X2FA 3LXXA 4BQSA 5JECA 2JLZA 1QVRA 2ZSFA 4M53A 5AJVB 2EW1A 3KKOA 4OHXA 1ZNZA 3W9YA 4DLZA 1ZU5A 3R9XA 3U6BA 2IT1A 1UKVY 4AYXA 2QSYA 1RFLA 4O3MA 1ZW6A 3MUFA 3U3MA 4M1SA 1DS6A 2X2EA 1CRPA 3LBHA 5EP1A 3FMPB 1T5IA 3IBGA 3SHFA 4NDZA 2OILA 2GDJA 3M4YA 1G5RA 4RCYA 1J90A 2ZXUA 4ZKEA 3UWOA 1NMXA 2HLDD 4L8GA 1OYYA 3Q72A 1DPFA 1E1RA 1W44A 4LV5B 5BYJA 1AJEA 2Z83A 2VP0A 4AK9A 3LA6A 4S2EA 1T5LA 1P9RA 1E2IA 3A8TA 3JVVA 1OXUA 2R65A 2Q9AA 2FMXA 2QUZA 1EGAA 3LFUA 1AKEA 2ASEA 3MWYW 2EU8A 4LDJA 1OPXA 2Q9BA 4ZPXA 4H1UA 2GHIA 3QENA 1E9SA 2ZRFA 4B33A 4PC7A 5GVRA 2GZAA 4F93B 2FNAA 4MYCA 1JBKA 2GZHA 4UXIA 5AJZA 1T6NA 2C99A 1ZD8A 1FNMA 2V54A 5FOSA 4PZZA 5FPHA 3UG7A 4B47A 2B8TA 3LLMA 3F5FA 4JT2A 4QBIA 1XD9A 4KU4A 2FX3A 3SI7A 3ZVNA 2FG5A 1E9CA 1G8GA 2RGXA 2Z4RA 5AUOB 2ZVPX 2X1VA 5KU1A 1QHHA 2IYLD 3QVUA 2B7BA 1FL9A 2YYZA 4JLPA 4GNKA 3HU1A 5JBQA 1NP6A 3NIBA 5DIFA 1OH8A 2JJ2A 4GBMA 2VP4A 2QGNA 3KXIA 3VMFA 3HYRA 4ABYA 2BCGY 2FE4A 4H1VA 1LS6A 4UJ5A 4D82A 4NCIA 3EG5A 4R9UC 6Q21A 1TQDA 1KI1A 2QRNA 1N0UA 1JECA 1P72A 2JLWA 1BYIA 1P73A 4RFSB 3EWAA 1UKEA 1OFHA 5B2ZA 4CZ2A 2H92A 2QP4A 1KKLA 1QDEA 1MRSA 2UVQA 2KBEA 4CEIB 5FPTA 4IJMA 3KQLA 5FI1B 4TTPA 3MWJA 4HSEA 3AVTA 4ILEA 5JRZA 2BEJA 1KY3A 1H8HA 1OHHA 1R5NA 4Q7LA 1NMYA 2FDCA 2DHRA 1J8MF 3AF2A 1XXHB 3AVPA 1XB2A 2CVHA 2HF9A 5SZIA 1W7AA 3ZS9A 3CH4B 2W58A 4KFTA 1XTIA 1Z0AA 4N0DA 1MV5A 4D4MA 1KAOA 2GCPA 4M21A 4QNMA 4EAQA 3WYGA 2VHTA 3UANA 2FPMA 1NL3A 3AP3A 1I4TD 2BBOA 2WWXA 3NC0C 1KI4A 3L8ZA 2XX3A 2ZE6A 4O0MA 4A82A 1R7RA 1ZD9A 3U3OA 3I72A 1YZQA 4Z1MD 1T3LA 1GTVA 1TL7C 2IWRA 3A4MA 3O8DA 4A4DA 2ZRKA 1Z6GA 5L3RA 3WMGA 4QXAA 5KNCA 2WWFA 4PPFA 2FSHA 5EE3A 2HT1A 3VR1A 3QBVA 1MT0A 2VSOA 3P26A 4PC1A 2PMKA 3EX7C 5KDLA 1VG1A 1KO4A 4HEJA 3W5JA 2JLRA 1G8FA 2X8AA 5CLLA 1US8A 4R71A 4PC2A 4F92B 4LRWA 4LHYA 3OAAA 3R7WA 4QM6A 1N0WA 2LKDA 1XTQA 1FTNA 4A1FA 3VR3A 1ZYUA 2OZEA 3I62A 3KDSE 4HLQB 3LVRE 3U4QB 2RAPA 2ZUBA 2XTNA 2J0QA 3D8BA 1U94A 1X3SA 2PZFA 3RS4A 1G8YA 2H1LA 5HKKD 2BBTA 3AKEA 3K0FA 2ZIAA 2FZLA 2ZSAA 1J2JA 2FOLA 5KNDA 3HDTA 4GRAA 1TF5A 1US8B 5KDDA 4W5HA 1KO7A 2CL0X 2QEQA 4LK2A 1IJEA 4MYHA 1GP2A 2V3CC 4GI7A 2QSZA 1OH6A 3FKSD 2R6CA 3LXRA 4CEIA 2Z6VA 4KFSA 4YMVA 1FPMA 4UNNA 1IN5A 4M4SA 4DIEA 1COWA 3KUCA 1ZM3A 1LF0A 4NU0A 3VNVA 2J0VA 1E2PA 4JVMA 4DT1A 5DYIA 1E2QA 2YHSA 1P62B 2VQSA 1UBEA 4HAVA 1OHHD 2CVFA 2CEAA 3TSOA 4E5UA 4MQBA 4LJ6A 2IX3A 4HLDA 4IDOA 2WZQA 3UKDA 1XD2B 2P6UA 4C0BA 3GLGB 3QPUA 2BV3A 1NVVQ 3DKVA 5JI3E 2EFGA 2GK6A 3ZZUA 4X8OA 2JIZA 4PAMA 1E9BA 4I81A 4QJ5A 4JMPA 1S2MA 3K70C 2ZYWX 5FBWB 4Z51A 4Q9LA 5BQ5A 2WIAA 1ESMA 1ZVQA 1TADA 2C8VA 2O5VA 3QXHA 1XEWY 4QBFA 2BM1A 1XD2A 2VHCA 2WJIA 5C46F 2ZUCA 2YOGA 3BH0A 2I1VB 4DLXA 1UEJA 2J46A 4PAQA 2VP2A 2PJRA 2VP9A 1G8PA 1KI9A 2BBSA 2OBMA 2PX3A 5K8TA 1OE0A 1QHSA 4KVGA 2G0NA 3R8FA 5EZ6B 2B21A 2V55B 2ZRBA 3DM9B 3PR1A 1Z0FA 4XD7A 3K0AA 2H7VA 3T15A 4B6EA 1G18A 2AFIE 2JLSA 5D3MA 3PCRB 3OIVA 1AA9A 3GLFA 5K8IA 4B3BA 1JQLB 1TU3A 2UZIR 1G3QA 1A1VA 2D2FA 1KDTA 1P4SA 3OIUA 3VX3A 4BZPA 1YZTA 4URVR 1R8SA 4LHVA 1SXJE 5IF9A 5KUTA 2GA8A 1DAMA 2W2XA 3Q3JB 4YMSA 4MUAA 3BAFA 5E3HA 2QE7A 5AJYA 2VYFA 4BEJA 5L3SB 4DBLC 2N46A 3DO6A 1F6BA 4POAA 2CHQA 4RZ3A
chains in the Genus database with same CATH superfamily
1QE0A 1E5XA 2SCUA 4HZUA 4EATA 3SKXA 1Z3IX 5JCPA 1KQNA 3ANSA 2X42A 1RVDA 2A57A 3NYWA 1DQYA 3RVQA 3ZD6A 1WOMA 2J08A 2JLXA 4C7MA 2WE7A 1QHXA 1ZQ9A 1WW2A 2HV8A 2ZAIA 3I9V6 1WCXA 2A86A 2EJWA 3JWEA 3OLZA 5J40A 3U1VA 4EJMA 1F0PA 5KTPA 1NJSA 2ISCA 1G4AE 1M74A 2D8MA 5K0LA 2WKRA 4B7CA 1RYFA 4XVHA 4KQCA 4YAFA 5FNZA 1H3FA 2PUVA 1UBMS 1XSEA 1XZNA 2F3TA 2R62A 2X9NA 3I12A 3IPAA 2WWYA 1LPBB 2F8TA 1CJUC 1P1HA 2JA2A 5KPDA 3OTIA 4HT3B 1EE9A 2QRQA 2GPSA 5GJBA 4HWRA 3ZIDA 4AYTA 3GLIA 3HLTA 1D5CA 1M3SA 1J21A 1PL8A 1RM4A 1ZGGA 1P4RA 1ZXXA 3DVRX 4DIUA 2B69A 4C2UA 4Q9JA 2ZJZA 1VHQA 5IM5A 2I8LA 1UPTA 4JJZA 5BRNA 3DMTC 4RUKA 4TLAA 4DMRA 3P4UA 4HAWA 4EY6A 5C35A 2CNKA 2NO9A 4OLJA 3L1HA 2HC9A 1YCHA 4B2LA 1ISFA 1UADA 2OGSA 3SF0A 1Z6QA 3CW8X 1KJYA 3F8TA 5HKOA 4ZJPA 1OC4A 4JQSA 5FUXA 4YJKA 3VPDA 2H4YA 1I3CA 4L27A 1JIUA 2F3UA 1PVVA 2VXYA 2C4VA 5JAZA 4JI7B 3PPYA 4IIYA 2UZ1A 3EAGA 4CCAA 3OHSX 1U5CA 4HDRB 4BNDA 1SVMA 1S1CA 4HQ6A 3SX0A 4CPDA 1VYVA 1WHSA 1I7SB 3LBAA 3KALA 4GEKA 4IRXA 4PHTA 3PIIA 1NVBA 1RRVA 2V7QA 1FA9A 4PLHA 4YCBA 4C30A 1Z4IA 2AK3A 3KQVA 1T4GA 2CNBA 4DR2B 3L9XA 4IQFA 1YL7A 3OE1A 4AULA 4RTOA 3S6JA 3PQEA 4RD0A 3KR0A 2DWPA 3DBHB 3JATB 2X6TA 4LZAA 1EHCA 1QF7A 1JXAA 2Z9DA 3NDJA 4Y1FA 1A76A 4MYDA 3THWB 3SYLA 3AIKA 4M38A 3B5IA 2NGRA 2ZJ7A 3A6DA 1UXJA 1WXQA 4F9TA 2FWRA 7GPBA 2X4LA 1FFAA 3SCZA 1BCRB 1UJNA 4ESVA 2QUHA 4M99A 1CZLA 5JQGF 3KTOA 4GPBA 5AW4A 1KTVA 3EOAI 3ONWA 4B4DA 3TJRA 3VHRA 2CLLB 1HT1E 3OTGA 2XYPA 5B7GA 3A4VA 3EQ2A 4FIDA 4J94A 4OI1A 3WJAA 1GNSA 1U4OA 2ODWA 1VRVA 3UYKA 2IU4A 4OY3A 3V48A 1HM5A 2XEDA 2XWQA 1FXWA 4J0CA 3WB1A 4C6HA 4EDHA 1BGXT 4BNDB 4AWBA 4O2AB 3QJ5A 3BXOA 4CIXA 2PWPA 2JFGA 4MUJA 1M8FA 2H1FA 1V9LA 4J1TA 1ONBA 3P32A 4UXHA 1N5LA 2IGBA 1TYAE 2I3BA 3KLPX 3NDRA 4KKVA 4YP9A 3EGWA 5L4LA 3GXBA 3DFUA 4MPRA 3ZNPA 3WK9A 3ZY6A 1XTJA 2R11A 1JW9B 5JH7A 3KXDA 4F4DA 2QYTA 3OD5A 3GL9A 4Q4AB 3N0XA 4GE3A 4UDNA 4JJ6A 4R1OA 3E5HA 2FWIA 3LX5A 4KOEC 4MW5A 3FRHA 5AI8A 3CX8A 1NXSA 1QLHA 3NH6A 4Q3NA 1LRLA 5T4HA 3I6ZA 3UN1A 3H4MA 2RDMA 4KIJA 4N0PA 2QI9F 3A4NA 3W6ZA 4DA6A 4R0MA 4H3VA 2X4GA 5A5EA 5FAKA 5CB6A 3RV3A 1I9GA 4HNQA 3S70A 3EEQA 3ZGXA 2Q5CA 1QZXA 2FQWA 1MLDA 3GGCA 5L7WA 4NDAA 1DI0A 4HHEA 4D81A 2JI4A 1MGPA 5BUZA 3H9UA 1NKTA 1YQTA 3FM9A 3OH8A 4UPVA 3H9GA 1IMOA 5E38A 4MMYB 4QYSA 2OO3A 1NVMB 3IDOA 1N34B 4HSGA 3M6IA 3QYPA 5CXQA 1ZH8A 3NHPA 3O8OB 2ZANA 2QLBA 2C5GA 3P94A 1VGVA 4DQKA 2A0KA 4FOLA 4JCOA 1S89A 4TROA 4CKEB 4NBLA 5HIMA 4OH1A 5HZGA 3DPIA 5BR1A 2FFRA 3AEKB 5A0FA 3BIOA 3W3AD 3N5KA 1XRPA 3UK2A 5BSKA 2ZZKA 3IVGA 5CHYA 1ZGAA 1XF1A 1ZIOA 2XLBA 3EVDA 3JTEA 5IH3A 4XASA 3WGQA 3WWOA 4CW7A 2QZ9A 4F72A 5BSHA 4QDOA 4JP3A 3GNQA 5KCZA 5AW1A 2BY4A 2DAPA 4DB2A 1P19A 2QR5A 1U0LA 3B6JA 1GQYA 1A8UA 1C9KA 3K0FB 5CUQA 1TMYA 3ZN2A 3LCRA 1Q7GA 1EFTA 1KI7A 3LKBA 1ZUD1 4CLOB 1NP3A 4O8ZA 2OP1A 5F5LA 3TLKA 3CRNA 1S9DA 2DX7A 1BXKA 3D8HA 3QX9A 4MIYA 4OM8A 4PLVA 4G67A 3RVSA 3SMQA 1QBKC 1SXJB 1OT3A 2IPNA 1ESCA 2VUHB 3UT5A 1JFRA 1M34B 1YGYA 2OAGA 1FE8A 2V9CA 1YK0A 1X1AA 2VUTA 5K0NA 4GDFA 5FTNA 3EXG2 3KHKA 4KDFA 1EJBA 4YRLA 2EATA 1A0OA 3GZNA 4WLNA 1U0SY 5IULC 2JJ2D 2R8OA 3D3NA 3K4HA 3ASUA 3PEWA 2FLWA 4QSHA 1VIDA 3CEJA 1GAWA 3OY2A 5HFNA 3BMXA 1RIIA 1PJRA 2G1JA 3R0XA 1AQYA 1JLSA 4NCNA 4EO9A 1EUZA 1IHUA 2FPPB 2Y1GA 3ZWNA 4UFPA 2OYSA 1EE2A 2EFJA 2EQAA 1GQRA 4B8YA 1VPVA 5KBYA 3IEUA 4FFOA 4HQLA 3MA0A 4IQGA 4R3WA 3V8RA 3PX7A 2TYSB 4LJ5A 4YXFA 3UKJA 5GJWC 2AG0A 2GAOA 1DJOA 3CG4A 5G3YA 5FR1A 1JKFA 3RF6A 4BWVA 1C50A 4TKZA 4BGIA 3QLUC 1TVCA 4PO1A 3UFXB 5LXTB 4FCVA 1GYPA 1EGMB 4MR7A 5A5FA 1P81A 4LVNA 2OV4A 1KVUA 2P65A 4WUVA 2W2NA 3DO5A 3WAGA 1C2TA 4YRJA 1PVDA 1VA5A 5LMCA 2H1CA 1QIJA 1QMPA 4CG1A 4IH4A 4WCFB 4BTLA 2CXHA 5AH0A 3WLFA 5DULA 3TSZA 1VYHA 2E4ZA 1BMDA 4ZV4A 1OI3A 2EKBA 2ALJA 1FU7A 1VHLA 1Y4DE 1ML3A 1VM6A 2GLXA 3L04A 4G5HA 4O02B 2CFSA 4TLCA 2G9RA 2Q21A 4B34A 4K0RA 4BNVA 5J4YA 3L49A 2M1ZA 1XZFA 1BE8A 2VNKA 1UPCA 3MWKA 3AI7A 3EIOA 3AEQB 4JR2A 3I01A 1PR4A 2OG2A 4J0IA 5DTJA 2X0DA 3ZI4A 4BKRA 3KCQA 4UFNA 4DLVA 1OU4A 4ZJUA 1FRVA 5ALVA 4QTUB 1IVSA 1M54A 2I2AA 2VYVD 3NHFA 2R86A 3KSDO 3X1YA 1KGDA 1ULZA 1QV6A 2NPOA 3JAMA 3H9EO 1Z5VA 1IBSA 1KJZA 1RTKA 4Y6LA 1L5ZA 1VKNA 1EFVA 2VNHA 4ZYXA 4IG4A 3M3HA 3RU9A 1C0LA 2XITA 3WLTA 1Y3HA 2X2OA 4W9MC 2IZOA 1UWCA 1YUBA 2QM7A 3F4LA 3ESYA 4C6TA 4OMUA 3A04A 4JX9A 3VSEA 4RK0A 1AF4A 3OPYI 3T95A 4BFYA 4IIDA 5BURA 1UKYA 2DFLA 1T9AA 4KE6A 1A9YA 4MUNA 5IJ0B 1SU6A 1PP4A 3LOPA 3W0LB 3V4ZA 2X0FA 1EUDB 4G86A 5ESXA 3KJFA 1GRNA 2QUKA 3LWDA 2C4HA 1Q7TA 2LNDA 2ZBGA 3CKLA 2DLNA 3TLEA 3BBPA 2BFFA 3BX1A 5K3OA 3LY8A 1QIHA 2OZLB 3WQHA 1L1EA 4BO2A 3BFXA 4MYUA 2FQYA 2WIJA 1Z5ZA 4YREA 5JS1A 1R6XA 2CL6X 5JD4A 3C6XA 4DL9A 3I5UA 4Q4DA 3T8YA 2H1WA 3KSBC 1MZVA 5ALTA 1MH9A 3C5WP 1MEOA 2F8MA 2DPYA 4ZO9A 3ZV5A 4MWOA 1T4BA 4XFJA 2WSSA 1OWLA 2YN2A 1A82A 3PQ6A 4M7OA 2HQBA 3Q6MA 4G5QA 1AQUA 4QDJA 1E6CA 4UAUA 2PLNA 1V35A 5HFJA 1A4XA 4FYYA 3RSGA 5L45A 2PT5A 3BH6A 1EJ2A 2D5BA 1F14A 3WG9A 3O47A 1CR6A 4XUDA 5L3SA 1TUBA 4P3YA 3RSLA 2PY6A 2X0KA 2CNLA 2H4XA 2YMLA 2QAIA 3DZFA 2CCKA 4G2NA 3WA7A 3FROA 2X4IA 3U7GA 2MR5A 1LTQA 2G5CA 1O0SA 2WT4A 2H4ZA 3G0BA 3D7NA 2WFZA 4HVAA 2F90A 4CVNA 1OB2A 1CUSA 3I8SA 1PQUA 2CVZA 4GZLA 3R6WA 2F00A 1H2HA 4AJ4A 3I2IA 4MJ7A 2B0CA 3M6VA 4R4JA 1J0EA 2R6GA 4XM1A 5DCYA 1CZKA 3VX4A 2ORWA 4EVIA 3IT1A 1TJ4A 5CDTA 1EDBA 1J8FA 2HPZA 4TQ9A 4B4UA 5HPYB 3VVCA 4A6XA 1I51A 1BX0A 2JVIA 4HN4B 2PGOA 3IP9A 2FPXA 1RD4A 1DUIA 2ES4A 5KWJA 3IMCA 2ONCA 4DCMA 2Y4NA 1KK0A 2UZ1B 4JL6A 2GCGA 2Y05A 4G63A 4LZNA 2FAXA 2I6FA 3HUUA 1NWCA 2RAUA 2X5JO 1TJ5A 3F6YA 4RDXA 3UHFA 1QFSA 4RLQA 1E8DA 1D1PA 3KQOA 2Y1FA 3KX2A 2BRUA 4M1TA 3SJUA 1UP4A 1XLTC 5I5EA 4FK8A 4OU5A 5BXQC 3LL7A 2CUTA 4QZVA 3IGFA 1NP7A 1IJFA 2PH1A 2Q1TA 3LUFA 4DRZA 3AHDA 5IJ9A 3HXQA 2CF5A 3MOGA 4LF8B 3S8YA 3NTLA 1LF5A 2V6IA 1LH0A 3G1TA 1AMOA 3E05A 3VTAA 1FZTA 4K81B 5ALFA 1X86B 4W7HA 4Q9IA 2B6NA 3URMA 1WD5A 1NF2A 3W5SA 4YRZA 2X9GA 3NIWA 2R4QA 5JUWA 1QZ3A 2GF9A 2WF5A 4RW0A 4YFVA 3SBDA 5ALGA 4IPTA 3I0NA 1WKBA 3MERA 3CRZA 3MNFA 3ED1A 1TA0A 3GD7A 1TJ3A 2YNMA 5JNLA 1LWNA 4ZWNA 1U3VA 3SM9A 4FYHA 1CZUA 3CY6A 5EIEA 1I01A 1EA7A 1S6YA 1HSZA 1L7EA 1QIIA 1PNOA 3NONA 2RGDA 2F4NA 1A97A 2ORIA 3NEPX 4WA8A 3NRBA 3PQCA 4IUYA 3ZIAD 1I6WA 2VF8A 1Y3BE 4EG3A 3IHTA 2EZ9A 2IYEA 1GZ7A 3TZCA 5ALLA 2OQ2A 1U04A 1P1JA 4WW0A 4W8HA 1ZJZA 1G6Q1 3EC2A 4ZQGA 2CKMA 5GM1A 2HUNA 4GZ6A 4IIGA 1HY3A 4EPVA 5JBIA 1ZKMA 5K0TA 4HAXA 4C07A 4DAOA 3ETEA 1FFXA 2YFKA 3U9LA 1IG0A 1LPSA 3JZIA 3LK7A 1EG7A 3LT1A 2ZDQA 3LPLA 3QQPA 4PZAA 3SSNA 3X1DA 1LC0A 2CXXA 3GAZA 1JDTA 1SCNE 3HCPA 3TK1A 4BCDA 2HBZA 4CF7A 1CYEA 3OMXA 1SUPA 2W2KA 2WUFA 4YTEA 3TEMA 5CYGA 4EPYA 1GCUA 3DJYA 2F55A 5E4JA 2FFHA 3HO8A 2FWJA 3R7DA 1YO6A 3ET4A 1THGA 1YRAA 3ABRB 1NDQA 1DVRA 1YBAA 2C77A 2CLKB 1HZZC 2VHJA 3IQWA 3KYCA 1DKUA 1QYCA 2D5IA 2VTKA 2ZAGA 2ZJ4A 3CXRA 4I1SA 3IUBA 4IMRA 1MG0A 3DE5X 4X00A 3PA8A 5BQFA 4OBBA 1UBCA 2DUMA 3QYJA 1RWOA 5FUBA 2I6GA 2RGBA 1RW4A 3N87A 3SK0A 3WYEA 1DDIA 3VKGA 1F4PA 4EKGA 2O54A 3AHHA 3CIOA 3NKVA 3IP3A 1Z2OX 4EX7A 2YKQA 1W96A 5GINE 1RYHA 3SSMA 1D4FA 1VE6A 4UBOA 2JIDA 1Z26A 1MX9A 1EA5A 1NLZA 2XQGA 4LEIA 3SYKA 4C4SA 4IV0A 2JANA 1QQAA 2Q1WA 2BSQA 5GONA 1YR6A 4NCXA 2FJUA 3IQZA 221PA 3K4PA 2FPKA 3FOEC 4CF4A 3LBNA 5K09A 1R6TA 1BH6A 2AKYA 3OF5A 4QOJA 3W4KA 4UHKA 1I4LD 5FIUA 1HTBA 1FSSA 1OWPA 3W2IA 3LPMA 2G6TA 4DM4A 2OY0A 2A1TR 2FEMA 1L4KA 3JX9A 4FJ0A 1AXRA 2IFTA 3PENA 4RVHA 2YS7A 5DMXA 5IVIA 1KMCA 2QENA 2VJQA 3GRUA 3Q3VA 3VPSA 5KQLA 4XWGA 4AS2A 2CL7X 4LTMA 3SICE 2OCYC 3D9QX 2Y9MB 5FADA 1ISSA 1N7JA 4HWKA 4RIGA 4DPKA 2AGVA 2OWDA 2A3NA 3BKWA 4HBZA 3CKMA 1R3UA 5ER9A 4DQXA 4PO3X 1DQZA 1GQ2A 2BMWA 1D3AA 2BEUA 3F9CA 3LQKA 4C0JA 2G9QA 1QCCA 3BIWA 1C9NA 5LOVF 2O2HA 1ACJA 3MJ4A 3DB1A 4YI3A 2PE5A 3GLHA 1K6EA 3HJAA 4LXTA 2F6RA 3LCMA 4J90A 1E3DA 1M8KA 5TGZA 3EPJA 3PL5A 3ROFA 1VMIA 3E7WA 4L02A 4Z49A 1N5OX 1D2EA 4GRIA 5DX8A 1CUAA 1GNLA 2ZRJA 1A9QA 2PL3A 2XDYA 4OFBA 1KQPA 1XXLA 2C0QA 2C7RA 3CF2A 5T4EA 4BPBA 1H1LA 4UZFA 5FP0A 4X7MA 5IBQA 4M9RA 1X77A 4RKFA 3WMRA 1YQXA 1HDGO 2GTHA 2B0JA 3CURA 1MAUA 4L28A 1YZYA 2ZFUA 3ZZ1A 3WQBA 4KN8A 3FYUC 3GLFB 3RAGA 3EXHA 5K01A 3Q7QA 3PUHA 1P9NA 3AKDA 3HU5A 4P22A 3MLBA 1AU9A 1TA4A 2W2QA 1DT5A 3DAGA 3LNCA 3P97A 4XR9A 4YCNA 1UH5A 3OICA 2GJSA 3E3OA 5JY1A 1GG9A 1DLIA 1TM3E 3HCBA 521PA 1Y6RA 2CHUA 1BWSA 4YWJA 1I7NA 2YWJA 3X1JA 2VPYA 2X7XA 1E4EB 1KEZA 4UARA 3VNQA 5KC9A 4C0LA 5U4QA 3W4IA 1P1KA 5IWAB 1W0CA 4Q66C 2KPOA 3ITDA 1NR7A 2GPYA 3SJCA 2O5EA 1I8TA 1BDJA 3DAFA 1CR0A 2L0XA 2PZMA 1U0NA 1C7ZA 2IPAB 1GADO 4IO1A 2CKDA 4MUEA 4O4IB 4TSKA 2RJNA 2KW5A 4TTSA 5DSZA 3QQ5A 3W6PA 1RC8A 2JFVA 4R2KA 4ROSA 1MO6A 4JP8A 4F5EA 4MVXA 3E1SA 3TE6A 2DU8A 3WX0A 4EL0A 1ETHA 4NNJA 2VPTA 1Z18A 4LBZA 1N25A 3FFTA 1Y9DA 2P6OA 1J8YF 1PLKA 3OZ7A 4JXXA 1BU8A 4HEHA 4XFDA 4MV1A 3SHQA 1THTA 2JAWA 1KE2A 3JAKB 4HWGA 1SC6A 1XXHA 3ZG6A 3SZOA 3GCGA 4GPTA 3JWIA 3VU9B 2D1RA 4PFSA 3WNQA 5U4XA 2KX7A 3L4JA 4BQRA 2ZRLA 1T36B 5C52B 1Z0KA 3WK5A 4OFWA 1O77A 2JCGA 3FLAA 1SXJA 4M1WA 3UT5B 3ER8A 4G4GA 1NQAO 4C0XA 1KJ8A 3DL0A 4ZI7B 1MO3A 3FKSA 4W7SA 4B3TB 5CYPA 2QXUA 4EEKA 2BFEA 3IKMB 1IBLB 3AYZB 3RC7A 3Q11A 3W9BA 1CSEE 1B42A 2JHAA 4P7BA 4UQPA 1YASA 3PXEA 3TTXA 3VZRA 4LHXA 4PG4A 4Q4HA 2UYGA 5BWOA 2JNWA 3Q4GA 5CDYA 2I9KA 3EXEA 4JLMA 4WZ6A 3HDGA 3NYQA 4ZCRA 3AONB 1T2VA 2V96A 2PR7A 1TFUA 3BSFA 4PCUA 3FTNA 5F77A 5CA0A 1XVUA 1R5JA 1UIMA 4H2DA 1LRKA 2ZRNA 5CP8A 1P17A 1CX9B 2F9MA 2QD3A 3QKSA 4JLDA 1V96A 2LE0A 3IUPA 3SHTA 3AX6A 4P2BA 2A5YB 2DGDA 2OV6A 2VZ8A 5AK5A 3S7ZA 3KG2A 1ZJ4A 5BRJA 1P80A 4E4RA 4KRFA 2XGOA 1GGVA 4F6CA 1TAUA 3D6FA 4YPFA 3A9CA 1AKMA 4RVOA 2C97A 1MOPA 3A9TA 1U11A 1NDUA 4ZO4A 2CXNA 3THOA 1P2UA 4Y2VA 2GK7A 3C8DA 2JGDA 4I7EA 1CUIA 2GLUA 5HQTA 1WS6A 3HNPA 1G21E 4GFDA 4B4KA 4CEIA 1Y1LA 3G2KA 3WRXA 5K6RA 1PFVA 3JQ9A 4B6PA 4M0MA 1D03A 2AD1A 2HZBA 3BD9A 5DH9A 5DLYA 2R7AA 1RXWA 4HLNA 3WGHA 4PHHA 4E22A 4PSCA 2OFPA 2UAGA 3G8YA 2MSDB 4AQYB 4W63A 5FWAA 4YRMA 1N3BA 4PLZA 2QKYA 5KWEA 3MLAA 4E4YA 5EUQB 4FPXA 2VF4X 5EJ8A 1DG1G 2XOKD 3GNTA 2C9CA 3CSDA 4HWSA 1VE1A 4MQ6A 4MWGA 4ZPJA 1C3LA 3H87A 3HCNA 3ICPA 4C6TB 3WGOA 4AP5A 1L5FA 4DQVA 2ID8A 1Y3AA 4LBWA 1THMA 1NVUQ 1WSWA 5BXYA 5EY5B 3VR2D 4E5KA 4GWLA 5FB3A 2L2QA 3RGWS 2PJZA 5C51B 1NX6A 2WNSA 3IJRA 3FNFA 3GLIE 2ZR7A 2KYRA 2ZJBA 2AE2A 2JCBA 2F7SA 2H17A 3B5EA 3HCAA 3IC5A 3K16A 4HAOA 4HDQB 3RIMA 4E1VA 5JIBA 2AXQA 1JF8A 4AY3A 2RSLA 2WJGA 4D3YA 1N8TA 2QXYA 2RKBA 5JVDA 2M6LA 5JY6A 4JUDX 2KLHA 4TWIA 4ZEXA 1VL0A 4QJBA 3OFKA 4H3SA 4DUZB 3I83A 1BMFD 1EBBA 2AYYA 4RO0A 2I91A 4GC5A 1CR2A 2Q5LA 5TQ0B 3UAYA 2NO4A 4OUDA 3KDPA 2EFCB 1H0RA 4F91B 2PSFA 2VRBA 3OF3A 1NLFA 2FPGB 2HJSA 3O4FA 2AMLA 4F21A 1X74A 3IKLA 4FDLA 2CXQA 1F9EA 5CFOA 1D1QA 5HJ2A 4C3ZA 3U4DA 4E46A 1VJ0A 1PLJA 1EEHA 4K9SA 4JYZA 2HWXA 3CNHA 3ODGA 4E3WA 1N5DA 2BKXA 2O50A 4MQFA 3HABA 5JH7F 4P38A 1C9YA 1XL1A 4PG8A 5EHNA 4QQNA 2TMGA 3PC7A 3AEKA 4JGGA 4OXXA 1NHGA 2J41A 2JKYA 4R31A 5EOVA 3MN1A 2GWHA 4EGFA 2I1QA 5E7QA 2V3VA 5HYVA 2OXCA 3ZE7A 3HTXA 1A4RA 1TUIA 3GT0A 3Q9SA 5CT4A 2FW1A 2YJ3A 1CNEA 2O0KA 4MLDA 3DE1X 4BQPA 3NUGA 1BTOA 1GNQA 3NJ4A 4BQIA 4YJDA 5MN5A 1E3WA 2Q1XA 3HYCA 1DIRA 5JPCA 1W2HA 3PS9A 2C57A 1ESNA 5TPZA 1H2AS 5AVOA 5GWXA 4JDUA 1OYWA 3JALB 3KBOA 4J7AA 4EPTA 2D2EA 4CJXA 1CRZA 1WMBA 1OGJA 3GPCA 5KDOA 1A8QA 4UMEA 1FPQA 5B4UA 2J07A 4TMZA 3FTFA 4YUAA 4N5IX 1E62A 5F7XA 2Y0DA 2ZSBA 1E4VA 1JIIA 3MFQA 3B7WA 5FCDA 2QUBA 3OJWA 2F1HA 1RI4A 1DWUA 1FIUA 3WL8A 4YUZA 2AKAB 5HWSA 3E9QA 4QGFA 2QPAA 1Z37A 2VHXA 1ZWKA 3UAGA 3S5JA 1EMDA 2J09A 4ZAYA 3ZY4A 5AVVA 1XRRA 3DGEC 4MRSA 2QAJA 1Z2DA 4HYQA 2LW7A 4XPIB 3IALA 1B6RA 1I2DA 3TEJA 1U7TA 3BE6A 5I4KA 4WXPA 1GPAA 5FORA 3TB6A 2XVMA 3CZ9A 3EE6A 3G2LA 3OKAA 4HQKA 4DLWA 1KQOA 2GEVA 2XW6A 1ZRSA 3INGA 5J9FA 4GLBA 1FVFA 1M33A 1NRJB 3MJHA 2QMQA 1GTMA 1KOFA 4MR7B 3TM5A 2ZYSA 3RU7A 5E1DA 2XTAA 2OZLA 3F96A 3G2QA 1H8HD 4PCAA 2VH5R 2GCIA 3DZJA 4N82A 4CMBA 2QTBA 4C0QC 1EWYA 5IYZF 3R1IA 4OI2A 4GWKA 3G7UA 4BFXA 2WP8J 4EUNA 4Z4QA 5TJHA 3B9PA 4JYAB 3QVWA 4CEHB 3TMYA 3ZWBA 2A67A 3ZLVA 1Z2CA 3C98A 2REQA 1O5OA 3E0XA 2P1RA 4XD2A 5TE9A 3NPMA 2W6NA 2YYAA 4OHVA 1YR3A 3FW1A 4BXOA 3M1IA 3B3JA 4DWVA 1SVIA 4CR6A 5IT9A 3K8ZA 1WKCA 1E2FA 1NVTA 2CJWB 3EHDA 1F4LA 3NTOA 4LY0A 1VL2A 2G63A 4BNZA 4G0XA 1WP4A 3UXYA 5ALEA 4BL5A 1RLJA 1H6AA 2W0MA 1QCYA 2YV4A 4LJAA 5GZ6A 2UUAB 3W5BA 5BQ3A 1RRCA 1NOKA 1TYEB 3M0EA 5CD1A 1J9ZA 2M2IA 2CB0A 1YOVB 2OCKA 1JE1A 4NBKA 1WCV1 5KHAA 3VA7A 1MHTA 3UJHA 1DOAA 1JA0A 4NE9A 4B7AA 5LDDC 1WR8A 1VIVA 4YRSA 3MAGA 4NMXB 3UPUA 4L5YA 5LWQA 3H1PA 2CL5A 2YJNA 3AOEA 4RZXA 2PKCA 4Q3DA 1GILA 1NA5A 4P3NA 2DKFA 2CYBA 4G09A 1MW8X 2QW0X 4N12A 2X5NA 2HREA 1H2YA 4IIJA 3B53X 1ZOSA 2IC5A 2WF7A 2YWEA 4ND7A 1K1EA 4QDUA 4TV9F 4TQAA 4S05A 1V48A 2FZGA 5J5AA 3TAUA 1KJJA 4ROTA 2ZYGA 2R00C 3QWBA 2C54A 2ZIFA 1E3LA 1EPUA 3M89A 4IIEA 4WXEA 5A7HA 4CCWA 4EYEA 4AB1A 3OFNA 3FYTA 2OD9A 2FE1A 4S35A 4YRPA 5JWHA 5TARA 1QP4A 4ALMA 2JI6A 3ETNA 1NRXA 4N6NA 4YVFA 3VVBA 1KP2A 6ADHA 1WCIB 1HX7A 1P0CA 1ZONA 4CF6A 4NCAA 3HB1A 4NCHA 4WAUA 2SICE 4J0EA 1HYBA 1NGSA 1V7QA 2PUAA 2BF4A 4C7OB 1JJVA 2B4RO 2VQDA 1NSYA 1J0BA 2JGJA 3M1LA 1MO4A 4MAAA 5L7TA 1QIKA 1LDBA 2OHOA 3R5KA 2A0WA 2R8ZA 1YE8A 2VHZA 2WUVA 2Y6VA 3DTVB 1BG6A 4JZKA 5JQGA 4MI9A 1Y6ZA 1NVVR 3OFND 4YMHA 5JCZA 3IEKA 3UCXA 1S8NA 5DK4A 1NBEA 4GMDA 1KERA 3IAHA 4RX1A 4UC0A 4E15A 1W6UA 2I4TA 1QQ6A 4H7EA 4G84A 1YF3A 3AHFA 1E9AA 2FSFA 1A5SB 4HZUB 2OTCA 3GLTA 4K40A 1O94A 3U13A 4BS9A 3IT3A 4KK4A 3VH4A 5JAPA 5JS8A 3FD8A 5I7AA 4PONA 3DBOB 1RQLA 3PJGA 1IWOA 1X3LA 3NYIA 4WZBB 1EVIA 4ALLA 4A2QA 2F48A 2EF1A 1E1RD 1YDFA 3M1AA 5B1HA 4FXOA 3OPMA 4EZEA 2O0JA 2P2ZA 4MW1A 4PGGA 3BGIA 1AQIA 3LDAA 3V5NA 3A28A 3NETA 3KIPA 3PPIA 4UJ3A 4L7QA 3KEOA 3UHAA 3ZIUA 5KO2A 3R7BA 3N2GA 1IUOA 1T4MA 1TCBA 1M8PA 1OJ7A 2PX0A 3WVNA 5JXJA 5A62A 2RGCA 2VEOA 4ED9A 3ZDAA 2ZB7A 1G1AA 1E1LA 4B84A 3KYBA 2H9AA 3MPOA 1AGNA 3AP2A 4MW6A 3TQSA 3WLHA 5JO0A 4RTKA 1CETA 2XH8A 1G9SA 4IEIA 4XQ0A 1I5RA 2DUJA 3AJAA 2CXUA 4F38A 3VR5D 1CUDA 4JNCA 5SYMA 3RWBA 4K2HA 4F2GA 1DXQA 4TYYA 4KTTE 1UBUS 1YXMA 5JADA 5HFAA 4O2BF 3ZE0B 4LDAA 5BQXA 5JS6A 3Q2KA 1UDAA 1XZEA 4XLTA 1HR0B 2G7ZA 1GEGA 1PUIA 3DMDA 3FA2A 3DMGA 1XKXA 3OZVA 4QSMA 1YMVA 1SVNA 4ZRNA 3TAHA 1RBMA 3P8ZA 3Q40A 5JD5A 3QYFA 2LDYA 3BWDD 4JXKA 3ITKA 2GCOB 2XB6A 4LYFA 2DT8A 1QX3A 2WVJA 4U2GA 3RFXA 3ZWVA 1XDZA 4D1YA 4PLWA 5THXA 4YS6A 1CUJA 1E69A 1FK8A 2C03A 1HMPA 1V8ZA 3BK2A 2FPIA 4KIUA 5FHQA 2VKTA 4Z0NA 4JYBA 7YASA 1J1UA 1ZOPA 1AGYA 1L8QA 1N8SA 1SC4A 1TD1A 1XTPA 1Y3DE 1YQEA 4QU0A 2EKLA 4YXWA 5I4IA 4J0DA 3HXMA 2E4YA 4PFJA 4LCBA 5KVAA 2B3DA 3IEPA 4HDKA 4Q4AA 2EGUA 3QUSA 2Q4TA 3IB3A 3WWZA 2E1PA 1PT5A 2IXFA 2EFHB 3G0OA 5CG2A 4FEEA 5F35A 3VYRB 2P9ZA 2Q9CA 1A69A 5FWDA 5EJ7A 3OO0A 1JTVA 1JZSA 1Y0BA 1DTWA 1PG5A 3H9BA 3PHCA 3SEAA 5I48A 2AJLI 4CEHA 2FJ0A 4M2LA 5HQJA 4I99A 4QEZA 3ZIAA 3FCYA 1N9ZA 4HZIA 2HSWA 2G1UA 2X8JA 2FMHA 1YJAA 2ILTA 2UYYA 3T9EA 4DA4A 4LYAA 2PLRA 2Q50A 3AI2A 2JASA 4BCBA 5D5QA 2Z2YA 1V3VA 2XJ9A 2V7VA 4PIVA 4FINA 4YQZA 1Y7LA 2J6HA 1AKRA 1S02A 3CNBA 3A32A 5DLPA 2PTHA 4R1PA 5EKSA 2NQ8A 3M83A 1LPPA 3UJ6A 1DRVA 2PV0A 2NTEA 3AY0A 4IXDA 1LBTA 1UFVA 3PCXA 3R9KA 1EH5A 1RKVA 3K6KA 4MW2A 5ECDA 5C5CA 1LKZA 1ODLA 3ON5A 1U2RA 1FDTA 3GVPA 4H31A 2FZ4A 2JVKA 2R7NA 4QTZA 1FJXA 3FMIA 4NVRA 5CT8A 3OT5A 4HQRA 3UG6A 2DLDA 2QUIA 3H5RA 5IWCA 2ZS7A 4M88A 5AXDA 2ZM5A 2WSSD 3H2SA 4P7FA 3GN2A 3HDHA 2PGLA 3ENVA 4IIVA 3L8EA 3QHPA 1GCOA 1QWOA 1XRNA 4N39A 4OEHA 5F33A 5H02A 3DC2A 1ZIDA 2OFXA 1DAEA 3DVLA 1MJHA 4ECEA 2JGRA 4FDUA 4RKRA 3NATA 2DUNA 4WVLA 1GA1A 1WHSB 3VR5A 1VXRA 4CDNA 4F97A 3ZW7A 4YI5A 3JALA 1C5KA 2WIDA 4MVJD 1FBTA 2QV0A 3B70A 3NWPA 3QRWA 4HR7A 4WDRA 2CEKA 5ALXA 1XLVA 1AHNA 1PT6A 3R75A 1LFDB 1LQTA 4F4CA 5GZ3A 1AQJA 3BWMA 1CJKC 1F2UA 1J70A 3ZKAA 3P0HA 4JLAA 1SRRA 4K03A 4MV9A 3F4BA 1YRHA 4PN7A 4KMMA 2GD0A 1NN5A 1YQWA 4WBNA 1QS0A 4TVKA 3I2KA 4RZ2A 5B7PA 3KCNA 4X1KB 1F8YA 4WY2A 3FZYA 5E0KB 3ZJ4A 4CQLA 5IC4A 3F3KA 3QIVA 4C5CA 1MVOA 1GG5A 1M5UA 4DXHA 1SH7A 1Q7RA 4DDVA 2X8LA 3HZZA 4HLCA 3T38A 1A5TA 2H7XA 3GIDA 2JS7A 5BMOA 1YU6A 2Z5LA 3I9LA 4PV7A 5KSYA 4TL7A 3RC9A 2YZ2A 1K68A 1AA3A 4OJYA 4YXWD 1E6KA 1EVEA 1G8SA 2JH8A 5EJIA 4NATA 4AMVA 1AKYA 2W2PA 4NCBA 1OLXB 1R9JA 1S9HA 3K53A 3HB9A 1YIDA 5KQGA 3THSA 1VRWA 1UP7A 4KO8A 4N7BA 1IWBB 2MINB 4GMHA 5LP6B 3IR7A 4HXFB 1M2OB 1NOJA 2QD1A 2PUTA 1SHKA 1VLHA 2ORED 1VSQA 2ZROA 3TGPA 3BXZA 3E23A 2CLHB 2AN4A 2D2IA 2Z43A 4DCUA 3AILA 3COWA 4FGKA 1ZI8A 3DKKA 2QSUA 4NESA 5BSMA 4AFNA 2WU3A 4JXJA 3BB3A 4HNAA 3SS8A 3AH8A 2BFCA 4JNKA 3HPRA 1QKJA 3B1KA 2VYCA 3F3SA 3N7TA 3GFOA 3MWEA 2FWBA 4V1CB 2M6KA 2GKGA 1K3TA 3KZXA 4M9QA 3UJPA 4MWEA 1PFYA 2W6PA 3W7AA 1RC0A 1S96A 2NTJA 4H7KA 3SEZA 2C2ZA 1T15A 4NECA 5DW3A 2HYDA 3C45A 4XWTA 4UCQA 1N57A 5KTYA 1SOAA 1LI4A 3RABA 4AU1A 1OI7A 2ZRHA 4R1QA 1BXRB 5H68A 1T91A 1ZSNA 2ZTLA 3DDWA 4G5GA 4OQLA 1SUDA 3EXAA 1AV7A 5HZHA 1E4EA 2REXB 2QRKA 2WU8A 2BGRA 2WIGA 1FX1A 6LDHA 2RJ3A 1JB1A 2QN8A 2PLWA 3F6SA 4KQFA 5AM2A 3PDUA 1V8OA 2C04A 3Q3HA 4HDCA 3HHPA 4EG0A 4UOQA 2O8BB 2BBWA 3WV5A 3TUIC 1Z83A 4I1UA 3DKPA 1PR0A 1T5SA 3ZH9B 4HF7A 1QO9A 3DLBA 4OJTA 4A6PA 4CMIB 4EPXA 1XLUA 3PD7A 3HL0A 4RZSA 2BGUA 1QVZA 3WK8A 4DNFA 3MTJA 4FFDA 5EE9A 2C5LA 2WWVD 4JROA 2H57A 2LGJA 2VDWB 4UVGA 4FYMA 3HU3A 1HWYA 1TUBB 2HJVA 2R6R1 2OLEA 3AKYA 4ZODA 3ZLBA 2ZT6A 2DFKB 2HF8A 4MA0A 4HH1A 3EJWA 2FJPA 1SUFA 3FUUA 4JHXA 4R01A 3PRYA 3MG9A 4UBNA 3UGKA 4O4LA 4AO6A 8LDHA 3K6SA 1Y1TA 2W98A 4WLVA 2N42A 3SJ7A 4FE7A 2ST1A 4WK4B 5BN4A 3C8UA 4JLNA 3S27A 3R09A 1A2BA 4KVAA 2AI2A 5JMWA 2JPDA 2ZJ1A 4W99A 2OBLA 2QJFA 3FUVA 3H9JA 4MS4A 4Q4JB 3KEMA 4WBXC 4BJ6A 4AWAA 3KSMA 1RP1A 4XE5A 4KR6A 3BE5A 1Q22A 1HGXA 4PBTA 3X2FA 2R47A 1SXJD 4UPEA 1ISIA 4AC9A 4PSUA 5KTSA 3C0KA 2FEKA 3FVRA 1UAGA 3ZDFA 2CUZA 3EQ8A 3C1TA 5T57A 3H17A 4F2HA 3PZBA