2ZRAA

Msreca q196e atpgs
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
325
structure length
310
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGHVGLQARLMSQALRKMTGALNNSGTTAIFINELRTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 93
structure length 310
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zraA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zraA01
4URZR 1EFRA 1DS6A 1TNDA 4I81A 1JQLB 2GNOA 2RGNC 3QVVA 2G88A 3ZD6A 4URUR 2A3RA 1T3LA 1G16A 3L43A 3ZQ6A 3R7WB 3IBGA 4BWYA 1KJYA 1R5BA 1UPTA 1WCV1 2QG6A 4HI0E 4BFVA 4DVGA 3MCAA 2C77A 1U81A 1VCOA 2AL7A 3OIYA 3GCGA 4WXRA 1ZAKA 5LD2C 3FKSD 2BKUA 3VHLB 4C7OB 3SR0A 4KO8A 2ZS9A 1XEWY 2JJ8A 2QAGC 4HDQB 3REFA 2G1JA 2OLJA 3IUYA 5FOTA 2JDIA 1CJTC 3N2EA 4JVLA 1KDRA 3CM0A 4POAA 1ZD8A 4DWJA 2VP5A 3GLGE 1CLUA 1KO4A 2VYFA 3AF0A 2OILA 2ZIAA 2DHRA 1XCPA 1OJLA 5FOUA 4RZ2A 1X8LA 5EXXA 1D8TA 1GILA 1VCMA 3LRPA 3G0HA 3VR2A 2CL6X 3CKLA 2BIFA 3QUSA 3TVTA 4BFUA 4C2TA 5CM9C 4B2LA 2VO1A 2QPAA 3K0FB 5C1BA 4U7DA 1RRFA 3FYHA 3OIWA 1SXJB 1ESNA 3LH5A 4B71A 1GAJA 1Z28A 1VG8A 3U6BA 5J4YA 3WNDA 3AUYA 3NBZC 3IHLA 1YZKA 2WAYA 4PPNA 1J8MF 4TLEA 3A8TA 3GP8A 1IN5A 4LJ5A 3HR8A 3BS4A 3E5HA 2X19A 3EZ6A 1VIAA 4NCHA 4OQXA 1CU1A 1KI7A 2J0UA 1LNZA 3QKSB 4DSOA 3X1DA 1T3SA 1TF2A 2QP4A 4QNMA 4AY2A 3DVLA 3JVVA 1XMIA 5JWOA 1N6RA 4KLNA 2D7CA 4Q9HA 3KXKA 3NHBA 2FMXA 5AJXA 1F2TB 3U3RA 1M2OB 4D0LB 5J4HA 1MO3A 3ZVRA 2W6IA 1N3BA 3FHCB 3UATA 1E9RA 4MRNA 2R44A 1IXRC 1SXJE 2O0HA 2FZ4A 1HT2E 3NC0C 4G1UC 5EXTA 4HAXA 1CTQA 3B1XA 3FMFA 3P1JA 4KFUA 4UXJA 3R9XA 2OUKA 1QHXA 2H5EA 1QHYA 1LFDB 4O2LA 3DO6A 1E1RA 1DOAA 1DAMA 1MR3F 4P4SB 5JJKA 1SHKA 1VHTA 2B6HA 4TTRA 3LFUA 4HDCA 2A5JA 1UKVY 2JIZD 1M6NA 2YWEA 4UNQA 2H7VA 3F3YA 1E0SA 2N42A 3JVUA 4GFDA 1OYYA 2ATVA 1KDTA 1KI3A 4PO8A 1X3SA 3RNLA 4XIGS 1Q3HA 3AQ4A 2G9NA 1G41A 2VSFA 3KTAA 1Z08A 2NO0A 1T8UA 5EE3A 1X86B 2EW1A 2ZRAA 2ZRGA 2J0QA 2GESA 2OZEA 4IOKA 4IOJA 3B82A 1COWA 4Q18A 2QMUA 5CJPA 4XJXA 1DAKA 4M8NE 2I3BA 4DEXA 3TUIC 1YZLA 1R5NA 2ZI9A 1RIFA 1VECA 3UMSA 2BMFA 3PEYA 4KITB 2YVUA 4WOPA 1EFUA 1DE0A 4GZMA 4IVRA 5KPJA 2KI5A 1KO5A 2JLXA 4TWZA 3TAUA 2AX4A 1E2PA 2HUPA 4MKFA 4V0ME 3EA5A 1SVMA 4D4JA 4JT4A 1NNEA 3RS5A 4FD2A 4QNRA 3EA0A 2ZRLA 3B5JA 4JLDA 1GUAA 4ZCMA 4NKRA 4GOJA 4XVRA 1YR8A 3K09A 3X1XA 4Z1MD 1OH6A 3T1VA 1TPZA 2RGGA 2A5YB 4B3DA 2ORIA 5L3SB 3RRYA 2ZYWX 2W83A 1EFRD 3TBKA 1ZCBA 3B13B 1AS2A 1HYQA 1QBKC 1NVVR 4XVUA 2Q0HA 5G40A 3NHAA 1TF7A 3IDQA 4TTPA 2ZRDA 5HZHA 4RSGA 3DDCA 3IIMA 1Z2CA 3MFYA 2NIPA 1NN3A 3RWOA 3UK6A 2C9YA 1GKUB 3A58B 1FQKA 4NPHA 4C0KA 4U00A 5J4KA 1AM4D 1UFQA 2D4HA 3IIJA 4LHYA 2A5DA 1OFIA 3CLVA 4LJYA 1M7GA 2RGXA 3H4MA 3QXJA 3A4NA 3TRFA 2AR7A 4MRVA 4QM6A 1F48A 2ZJAA 1AQUA 4A6XA 1FP6A 3CONA 3KB2A 1T6NA 1DAHA 1TL7C 3RS2A 3D8BA 4IDQA 5JZVA 2YKGA 4WBSA 4LHVA 3B60A 3CF2A 5AJZA 4BASA 3SN6A 1GITA 2ZE5A 5B2ZA 2R8RA 1S2MA 2HCJB 4LY6A 4LYJA 4W7SA 5CK5A 4F4IA 1OXTA 2MSEB 2XB4A 4RY2A 3HU1A 1VHLA 2ZI4A 4WZBE 4XWAA 4ZIRB 3N5CA 1QRAA 2EFCB 2QA5A 4HUQA 5CIWA 3L0IB 4I1SA 1X1SA 1T0JB 2FPMA 3VX3A 1YZQA 4DIDA 4G01B 1VG0B 2JLWA 1BS1A 1DAGA 2V1XA 4DLXA 3CBQA 2J41A 1XB2A 1RRGA 2WIAA 1QHSA 5DI9A 4PFSA 1R0ZA 1W4AA 2OBMA 1CJVC 2PL3A 3T1QA 2CXXA 5CDFA 1LF5A 1T5IA 4LBYA 4LZZA 2XJ9A 4DEYA 3CRVA 4AYWA 3OE7A 3I73A 3MGCA 1OH5A 1U98A 1E0JA 2ZRNA 3REGA 2FEOA 2REOA 2IYXA 3C16C 4O25A 4B6EA 1P61B 5FPTA 3SBEA 1PUIA 4DLTA 2WHXA 4AKGA 4IJMA 3FDIA 1E2GA 4DT1B 1OSNA 2YHSA 1GL6A 2YZ2A 2J0UB 1YZGA 1SKYB 2PJZA 5TVKA 4DBLC 4PC7A 3ASZA 1K8RA 4DSTA 2YWHA 1OYWA 1N0UA 1JAIA 4MKGA 2QT0A 4JBWA 1CR0A 4JSTA 1XMSA 4B3FX 1N0VC 2F9LA 2GEUA 3SYLA 2ZUBA 1P5ZB 1SHZA 3AGQA 4OJQA 3RDPA 1LS1A 2PX0A 1IJFA 2W2TA 2NTYC 2W6ID 4M1SA 4PC2A 5L3RA 4IFBA 4D0GA 4ZPXA 1WQ1R 2V6IA 4A8JB 3PEUA 3RSOA 4JBXA 5TB5A 2HLDD 4B47A 2O8CA 2ZU6A 1KI8A 2FA9A 4WXPA 4A2QA 3FMPB 4KV9A 5E7IA 4X8OA 5D3MA 1II0A 3W90A 3AF1A 2VA8A 1F5NA 4X8MA 4ZI3A 2I1VB 1PZNA 5JSZB 2V1UA 2IHYA 4XSHA 4ESVA 4P0TA 3LY5A 3A1WA 4XD7A 4A0GA 4ZDJA 1RKBA 2GCNA 1W4RA 4LSGA 4KYUA 3KX2A 2AHOA 4JL6A 5DE3A 2WJJA 4QBIA 3VR6A 2AD5A 2H8KA 4QJ3A 1L2TA 4N1AA 1QHNA 1SKYE 3HWSA 4RD0A 1GDDA 3WHLA 3KQNA 1WB9A 3SOPA 2BJWA 2GBLA 1XXHB 3BRWD 3MMPA 2IBMA 4Q66C 3UPUA 2H16A 1FZQA 3PIRA 4WA7A 1COWD 3U7GA 5JLJA 3W5JA 1TQ4A 1OB2A 2EFHB 2PMKA 4IVPA 2O8EA 1KSHA 1ZUHA 5DI3A 4DZZA 3QSYA 3KXIA 3A6PC 2KJQA 1WRBA 1Q3TA 1SVKA 4HAUA 5EP1A 4HZIA 1OIVA 3ASYA 4ASUD 1QHHB 1XNJA 4NYMQ 1XTKA 2WIBA 4IDOA 4II7A 1NRJB 5LB2A 3L82B 1IY2A 1JECA 4D4KA 3DZDA 4DUGD 4QJ5A 2W6JA 1M1YE 2DY1A 2W2XA 2WICA 4ACAA 1N6OA 5FPYA 4K81B 2JAQA 1S1CA 1W5TA 3CO5A 2V9PA 5DHFA 1CJMA 1XU4A 4TMVA 5EP3A 1IONA 2BVNA 2ASEA 3CF6R 5BN4A 1YR6A 4BLRA 3C5CA 2CCKA 1T91A 3LNCA 3NH6A 3OFND 1GG2A 1LV7A 3WYFA 5J5CA 1ZINA 1U94A 1ZCAA 2ZPTX 3BIFA 4FMBB 2HXYA 4EDHA 1JNYA 1DPFA 1XXHE 4IEIA 1ZUNB 1AA9A 2UZIR 5F3WB 4X8HA 2VHQA 4BECA 521PA 4AKHA 2ORVA 3VR1A 3THYA 1PLKA 5KNBA 1RZ3A 4L9WA 1NKSA 3QQ5A 3RVBA 2ZRPA 2G77B 1BKDR 1G6OA 3C4JA 3KFXA 4RZUA 1ZNWA 1WBBA 4N0EA 1GM5A 1OE0A 2QROA 2ZS8A 1DO0A 3AVQA 3IBYA 1S9DA 3H86A 1N5KA 4F93B 1UBCA 3CR7A 2A7QA 4FXPA 4EQ6B 4OYHA 3TH5A 3IIKA 5DN6A 2XAUA 3MWKA 3C14C 1OFHA 1KTVA 3B1VA 2PT5A 5JS7A 2QQEA 4OHZA 1W5SA 2FJUA 1KI2A 3AKYA 4C9BA 3RC3A 5TY0A 4M2LA 4LYAA 1YZTA 2P0EA 4G5SA 4Q4AB 5FBQB 3TNFA 2QM8A 4M1KA 1XRJA 1KI1A 1CRQA 4MGZR 1UJ2A 2V7QD 3U3OA 4EUNA 1H8HD 1XTIA 2XX3A 3T34A 4IOLA 1WDTA 2WJVA 2VIIA 1IN8A 3QEOA 5IT5A 3ZIAA 1V5WA 1M74A 2KWIA 3GLHB 4GT1A 3UIEA 3ZGXA 2BBWA 2JLUA 3ICEA 2RGBA 1VCNA 2V6JA 2W2VA 3FHOA 4FINA 4AG5A 1E2MA 5EUQB 3PITA 3MG9A 2XJ4A 1Z0KA 3R7WA 1RE0A 3WXMA 5KSPA 3HR7A 2GEVA 3ADDA 2F1JA 2IYRA 3W3ZB 2C98A 2IEZA 3MJRA 4PPFA 1MRNA 5DYGA 5FL7A 2EWVA 2PLRA 2QT1A 3KKQA 1DADA 1YJ5A 2C78A 3OE7D 4TL7A 4G5QA 4KI0A 4BFTA 3O8CA 4DC9A 1XEFA 3CW2A 1OXSC 3UG6A 2WWYA 5ANRB 2XZPA 4NZYA 1P2TA 3AVVA 2EYQA 1Z07A 4Q1CA 3WYGA 1IM2A 3C5HA 1XEXB 3IHWA 1E2FA 1FP7A 2V55B 4EPVA 5HTKA 1NF3A 3ZQJA 1GZSA 1XJ0A 2FWRA 2R6DA 1W4BA 5SZKB 5H8WA 1VTKA 4OBEA 4Z8YA 4A36A 1BMFA 2C04A 2HJGA 2P2LA 5KSYA 2E1RA 4Y0AA 3R8CA 3S1AA 4LJAA 3R9IA 1ZW6A 3EPHA 3CRMA 2ZAOA 1J90A 8OHMA 1L4YA 5KTYA 4QC2A 1NMXA 2ZE6A 5G3YA 2ZS7A 2J0VA 3VX4A 4JT2A 5HCNA 1E94E 2W00A 4UNSA 4ZCIA 1G4AE 3K0FA 1QHIA 1TUIA 3KJEA 4OK6A 3WY9A 5FOSA 5C2JB 1P62B 2JJ2A 3SNHA 4AC9A 1NI3A 2FOLA 2OESA 2DWQA 1HT1E 3BE4A 3O47A 1W36C 5FI1B 1QG2A 1TAGA 5CDFE 4L9SA 4XD7D 2C03A 2ZI3A 3R9WA 3EZ9A 3RWMB 4TZ6A 1UDWA 3GLFB 2F1IA 1TQ6A 1LS6A 4NYJQ 1GRNA 1GP2A 4C0LA 3ZVMA 1GFIA 2QTVB 3HDTA 1XD9A 2ZI5A 4HLCA 4JLJA 3QVUA 3M4YA 5EP4A 3K0CA 4AI6A 1EWRA 1S3GA 3QKSA 4RD1A 5TV2A 3T35A 3VR3A 4AYTA 2DB3A 1IXSB 3GFPA 2CJWB 2GTPA 2J46A 2P5TB 5KSOA 2O5VA 4HUTA 3FGNA 1G3QA 1GIAA 2BV3A 3NH9A 4BFSA 3NTUA 4TZ0A 2WV9A 1AGPA 3CH5A 3LBHA 2AK2A 2ZR0A 4PPQA 1F2TA 2FE4A 4GZLA 3BGWA 4JVNA 4IDNA 5AUOB 2HF9A 5H68A 1ZM4A 2CK3A 3NC1C 4PSAA 2BEJA 4UKDA 3PEWA 2IT1A 2O8BA 5FTJA 4KBFA 1JEDA 3O8RA 2J87A 3BFVA 3GMTA 4KODA 4WW0A 3N2IA 4DLSA 1AKEA 3GLFE 2A78A 4Q1EA 4P4SA 1JEEA 1SVSA 2VRWA 2J9RA 1OLOA 4V0MA 1LVGA 3GFTA 2GKSA 4M0LA 2GJKA 1Q12A 1ZYUA 1N6HA 4W5WA 4KJZA 1E9FA 1GRRA 1UKZA 1ZM2A 4TMKA 2G3YA 3U4QB 4ACBA 2BBTA 2RHMA 3IO5A 1Q1ZA 2GXSA 4C3ZA 1TF5A 4JJKA 1DG3A 2W0SA 2QZ4A 4A1FA 2XXAA 3I62A 3DZ8A 3CUEF 1VG9B 4FMDB 1N6IA 5C18A 1R0WA 3ADBA 2PCLA 4LC1A 4I1UA 2GK7A 1QVAA 2OXRA 1RRPA 1UKYA 5EJEA 4FWTA 1H8ED 2CLSA 2G6BA 1G7RA 4FCWA 4JZKA 3P4XA 1MH1A 1U9IC 1BO6A 2IF2A 4NTZA 4AD8A 2RGNA 2WJYA 2FV8A 4Q00A 3W9YA 4CGZA 1MABB 5JI2E 1PLLA 2A5GA 4CRWB 3BERA 2J7PA 3RLFA 1SULA 2IK8A 1KNQA 4A6PA 2OO7A 1GKIA 1QDEA 3A36A 4URWR 3PUZA 1ZD9A 1KJWA 4PTLA 2NOAA 2XEXA 5GVSA 5B58C 3PUYA 1NIJA 2X2FA 3RS7A 4DLRA 4HZUB 3UANA 1AS3A 2ECKA 2ZSDA 4RD3A 1KSGA 3PENA 2O8FA 3DM9B 4M1YA 1OHHA 4BEJA 1A82A 2GF0A 1TADA 1NG1A 5DISB 4TMTA 5FOXA 5JEEA 5L3SA 3K53A 2OXCA 5HE8A 1DVRA 3ZIAD 5FPKA 2QMEA 2OG2A 1I4LD 4A15A 4LHWA 1E1QD 1Q22A 2Q3MA 3VHXA 3BBPA 2ONKA 5CYOA 4NU0A 1TU4A 3W8RA 4H1UA 4TYNA 4KHZA 3K9HA 3ND9A 2NZ8A 1VIYA 5FL7D 4ARZA 3AP1A 5FOVA 1JBKA 3Q5EA 4BFZA 1B23P 3WRYC 3H0KA 2NPIA 2ZJ2A 1HV8A 1W47A 3EXAA 4LDJA 4TL6A 1R0XA 2WWHA 4ZKEA 1BYUA 3L8ZA 3ZD7A 1KK2A 3CZPA 4IXMA 4M4SA 2IUUA 1ZNZA 5B57C 3C7KA 3TSZA 1GNQA 3DKPA 1FTNA 4TYYA 2YOHA 3AF3A 4TYQA 2YYZA 1E2NA 2F1RA 1IJEA 4IDPA 2A2ZA 1SGWA 3U3JA 5CYPA 3HU3A 3EZ2A 4LPSA 3VNUA 1ZC3A 2VL7A 2QPTA 4H9GA 2ZI7A 4FCTA 1G3UA 3TK1A 3QF4B 1BMFD 2BEKA 4W5JA 1W0JA 5E4FA 1HE1C 4BZQA 3DPUA 1OT3A 4DSNA 3TQFA 3AB3A 4ZIRA 2V3CC 1DAEA 3M0EA 1KY2A 1M7BA 2IYQA 3QG5A 4MYCA 4JIMA 5L3VA 3I5YA 3S1AB 4TLBA 3MUFA 5FBVB 1ZU4A 1Q44A 3I4LA 5F98A 2F6RA 2WJGA 4FIDA 1JXMA 3IO3A 4HAVA 2CNWA 3K0AB 3ZS9A 4FMDF 3ECCA 2ZTSA 1SXJD 4NONA 4Q4HA 3IEVA 3X1WA 2WWGA 1ZM3A 2P6NA 1NLYA 3A1TA 2IS4A 1DAFA 3MLEA 3SBDA 2UVQA 1NKTA 4GOKA 2FPLA 4OQNA 1G8PA 4AURA 2WKQA 5BYKA 2GDJA 3F8TA 3CF0A 2ZSBA 1EK0A 1UBEA 1GWNA 5FFMA 2WM9B 5JCZA 2GXAA 1IN7A 1ETUA 4AKIA 5FTNA 4NYMR 2YOFA 4DT1A 4OHXA 4G5GA 3HYRA 2IYLD 3VFDA 3JZAA 4MH0R 1Z6XA 3CPHA 2BDTA 1A7JA 3AVYA 2C9CA 3ZZ0A 5JCPA 5EXPA 4PQYA 1N6LA 4FMCF 5GJBA 4A0HA 3EW9A 2D2EA 4D26A 2QM7A 2HXSA 3FMOB 4HB0A 3A37A 3AH8A 5FR2A 4OK3A 4GP6A 3AVPA 3RAPR 2JJ1A 3TSWA 1H65A 4RD2A 2CK3D 3EIEA 1Q0UA 2C96A 2C95A 4G3XA 2K5UA 3DHWC 4A8JA 5L3QA 3U6KA 4GBMA 2QU8A 3EG5A 4RKFA 4Q7MB 1YR9A 4RFVA 2O8BB 1TEXA 3GJ8A 5FPSA 2VHCA 3DKVA 2ZR7A 3B1WA 2FH5B 4PAMA 2ZJOA 4ZDIA 5JSZA 2DCUA 5AUQA 1AN0A 5H1YA 1JPJA 4OKSA 3GD7A 4LBZA 3EX7C 2OM2A 1VKJA 5KU1A 1E9SA 2GK6A 3TLXA 3KQUA 2F3RA 1XPRA 5KUTA 2J5XA 2ERYA 1HURA 4EIWA 2DYKA 3QBTA 1FNMA 2ORWA 5BN3A 2HDNB 2J1LA 1F2UA 2CVHA 3TGPA 3ZH9B 2Q6TA 2W0MA 1XXHA 2GXUA 4BZPA 2XXAB 3L0PA 4B2IA 3EWSA 5EXSA 3PFIA 3ZS8A 1N6KA 3KJGA 3BC1A 1KK3A 3PUWA 2CL7X 3THXB 1G3IA 1E3MA 4MYTA 4Q9IA 1AKYA 3SC3A 5AJWA 1A5TA 1QZXA 1P6XA 1RFLA 4CT4B 4LJ6A 3WP0A 4JMPA 1XP8A 1DAIA 1I2MA 2ODNA 1G7TA 1G64A 1QHHA 3SJCA 2J7PD 3WMGA 4NHOA 4D80A 1GVNB 1P9RA 1N0WA 1OKKD 1T5LA 3BB3A 3QXXA 6Q21A 3K70C 1A4RA 3O8DA 1FMJA 2WPDD 4GI7A 3NG1A 2WWFA 1S8FA 3KQHA 3U7FB 2GILA 1E98A 1KZGB 3QIAA 1G7SA 4RCZA 4JKYA 4IOMA 2EWWA 4EFMA 3T12A 3UG7A 1E99A 3FOZA 5LD2B 1OPXA 3EWAA 4LJ9A 4QOSA 1G18A 2O8FB 4QJ4A 2QAGB 4HLQB 4LX0A 3IPXA 2B8WA 3A1SA 1ZRHA 1XTRA 5SZJA 3QENA 1B0UA 3AF4A 2QORA 3WYAA 2A5FA 1DARA 1PJRA 3OEEA 3QY0A 5F9HA 3CIOA 1KDOA 5J47A 3QBVA 1WP9A 2BC9A 3U3MA 1TTTA 2BWJA 3HP1A 1Q1EA 2NO9A 5C4GB 1XZQA 1EFTA 1SQ5A 2XTNA 1CR2A 4LV8B 2VH5R 1E4VA 2WWIA 5ELXA 1BYIA 1OXXK 1ZIOA 4B75A 2MMGA 5FUYA 3BB1A 1HY3A 2B92A 4ARZB 4C0JA 4B3BA 1UM8A 3EPLA 5DYIA 5AJVB 3NBXX 2QPOA 1EGAA 4MGIR 4XTRA 4EQ6A 2JLZA 1G20E 4MKHA 3AEZA 3RYTC 2NO6A 3DM5A 1OFUX 1A2KC 1KK0A 1N5IA 2QMOA 5G53C 3SI7A 4QKQA 2JDID 1VG1A 4R98A 3ADCA 4OJKA 2ZANA 4R7ZA 3CX6A 2XNSA 2G1KA 2JASA 1P73A 1G4UR 2BM0A 4Q4AA 3SYNA 4CEIB 1TU3A 821PA 4M9XA 3TR0A 2R6GA 4NP6A 2IYUA 2VBCA 4EKDA 1RJ9B 4U02A 3OAAA 4DCVA 4LBWA 4D25A 3NXSA 1E9AA 1QVRA 5AWFC 2RH5A 3DOFA 3LO5A 2BBSA 2EYUA 2CNWD 5K8UA 3GLHA 1VPLA 1KGDA 1Z6TA 3C15C 3RSLA 4NYIQ 1W0KA 2GVZC 2UZ3A 1XFAA 1U0JA 2PZEA 4G0NA 4LYFA 1KMHB 1TX4B 1Q21A 3K09C 1BH2A 3QKTA 1KI9A 4Q4HB 5SZHB 3VU9B 4QM7A 1HQYE 2H18A 1ZM9A 4OHYA 1P72A 2IEYA 4ILEA 4LBVA 4JLNA 3VKHA 4MGYR 4CEJB 1CJKC 1GKYA 1KIMA 2PLFA 3CNOA 5FH9A 5JJLA 1EFCA 3QXSA 3GPLA 4DXAA 3KQKA 4FN5A 1JI0A 2IW3A 1XEXA 4GMXA 2QENA 4BUJA 4LOAA 1DTSA 4PPGA 3AKCA 4MITA 4IDHA 1NVUQ 1E9BA 3QG1A 4IHQA 5EUMA 4B74A 3K70D 4EPXA 4HB4A 1S4QA 2PZGA 4N3NA 3QJYA 1KKMA 3LV8A 4B3GA 2D7DA 2ZRIA 3LQQA 2Q9BA 3NWJA 4BRUA 4P31A 4UNPA 2OFXA 5B64A 4NMMA 1SZPA 3B8HA 3GLIB 2CDNA 1GNPA 2VP0A 3M1IA 3AF2A 4TLCA 5L3QB 2C5LA 3GJXC 3SQWA 1G9XA 4JYCA 3QE0A 1CP2A 2Z0MA 4NCNA 3T5DA 2JGNA 3U7HB 5TXGA 1G8FA 1GOTA 1KZ7B 1Z0DA 2ZROA 1E1RD 2CCJA 2G83A 2NZJA 4DKXA 3ZZUA 4QG7A 1NL3A 4URYR 3GLFA 1E2DA 4AYXA 4KSCA 3CNLA 1E79A 3ZJYA 2BHRA 1G7CA 4I4LA 1FUUA 1OIWA 3FHTA 1CS4C 2VQSA 5FBRB 2WJHA 3MRSA 3WHKA 3RHFA 4BLSA 1I2DA 1XCMA 4F92B 2BMDA 4E5UA 2LCFA 1F2UB 1II9A 2CJWA 3L8YA 3SDZA 3FFBA 4FCVA 3GJ7A 3WP1B 3K9GA 2HYIC 3WBJA 4B48A 1J2JA 1OXVA 1P2SA 4V02A 4P4TA 2ZITA 1YR7A 4DHEA 4HDOB 3T5GA 3NEJA 3TW8B 4Q1DA 2WKRA 4BQSA 5TMPA 3AVXA 5HZKA 4UXIA 5M04A 4MQBA 3LD9A 1TEVA 1WF3A 2FSHA 1US8A 2OBNA 2VHTA 2WZQA 2DFKB 2XNDA 4PHGA 4PHTA 1ZNYA 3I8SA 5EE0A 1EESA 3H2YA 1NBMA 2ZUCA 4BLPA 5FUXA 4M9ZA 1YRBA 2WOJA 4GP7A 4OI0A 2FPKA 1EX7A 1K5GA 2BMJA 5UKDA 4I1OA 2NPFA 1KJZA 1MO5A 1KMQA 2WWWA 3BH6A 3CRW1 1MKYA 3IPYA 4GDFA 1Z6YA 1XX6A 3U4QA 1XTSA 5BQ5A 5IF9A 2ZRKA 2FGJA 1JXOA 5A4JA 2QL6A 3AGPA 3D6TB 1RC8A 2OCYC 2XZLA 1U8YA 5CLLA 2IXGA 4E03A 3I5XA 1Q20A 1K6MA 2ZRBA 3KKMA 4YONB 3FTQA 1QHGA 2R6AA 1R8SA 3E70C 5CITA 1FNNA 3W5IA 4B3XA 4BEBA 4JL8A 3RC8A 2GBLC 4DCSA 1MABA 5DO9A 1VYVA 4M1WA 2C99A 2ZYVX 3NBFA 4HB2A 4UNNA 3U5ZB 1G3MA 4LHXA 4G5RA 3FPAA 1S3SA 2B7CA 3KDSE 4KVGA 4M22A 3SJZA 2CL0X 4R71A 3VTKA 1CKEA 2ZRHA 2AKAB 1U0LA 1SVOA 1XTJA 2EFGA 2YWGA 5JFGA 4P33A 3I61A 1ZMXA 4BE7B 4HZUA 1QG4A 4Q1FA 5TARA 1GRQA 1NSTA 2KBFA 4EJSC 4C0SA 1KAGA 5SZIA 1NY6A 3QOFA 5HE9A 4GL2A 3W6NA 1RPZA 1R4AA 3OAAD 4PX9A 1Y3AA 4A82A 5J4LA 5EQTA 3ZVLA 3CX7A 2ZYTX 4V0NA 1Z0IA 2X2EA 1DELA 4X8LA 4QBGB 4TLAA 5FBWB 4DLYA 2HCBA 3CPEA 2QRNA 1WXQA 2G0TA 3TIFA 5HKKA 4L15A 2BCJQ 1SKQA 1W4CA 1E2EA 4MYHA 3W8NA 4DSUA 4AG6A 1D9XA 3RRMA 4XWOA 1N2CE 1LB1B 2F1HA 1DBSA 2OFWA 4FI3C 3SYKA 1FPMA 3ZYCA 3KUCA 2GETA 3KKPA 2F43B 4HATA 1NP6A 3KFVA 1NVWQ 4AIIA 4ZDKA 4V03A 3NBYC 3B1ZA 2FFAA 3U7EB 3KUDA 3U61B 4XTCS 3ND8A 4HAWA 4Z8XA 3FMIA 4IEEA 1E2HA 5JMTA 4BGDA 4ESHA 3QF4A 2ZR9A 1Z0AA 2VP9A 2IWRA 1XMJA 3HYTA 1C9KA 5BW8A 4L5BA 4KYIB 2HT1A 4JLVA 3DMNA 2XITA 2CCGA 5EE9A 1MT0A 1E32A 4I1VA 1OXUA 3MWYW 3GJ4A 3GLHE 5CB8A 3FWYA 3MAAC 1NVVQ 2AXNA 3NDBB 3K0AA 4EAQA 3FKSA 4F38A 5B30A 1IOZA 4RVCA 5FPHA 2FDCA 2QP3A 2GXQA 4QL3A 3F0TA 1P9WA 4O2RA 2OBLA 4FWIB 5C46F 2P6UA 4M53A 3IKJA 4F4CA 3I32A 2N1BA 5DH9A 4F4JA 3VR5A 2RGCA 1ONBA 2IUSA 1GL7A 2QP9X 4KLZA 4YLGA 4Q7KA 1M34E 3D31A 5JHGB 4S35A 2W58A 4BLQA 1AIPA 4QBHA 3K9LA 2OEPA 4LJ8A 1T3HA 4DDTA 4KBGA 1UAAA 2KE5A 2ODWA 2JEOA 2PEZA 1EXMA 1GL9B 1YU9A 4KSBA 1R0YA 1XJCA 4R2HA 2NO7A 1I4TD 1WBDA 5F9FA 5FTLA 2IS6A 4F91B 3TUZC 1M8PA 1VCIA 4CYMA 2P5SA 1WE2A 1MV5A 1A2BA 2XNDD 2W6JD 4RD4A 4Z51A 1U9IA 2QY9A 3BH7A 4DB2A 2XOKA 1US8B 4KU4A 4ZCLA 1E9DA 3NDPA 4E07A 2JLSA 2ZRJA 1YQTA 4OI4A 2PT7A 1R6BX 4JYBA 4WVFA 3PG5A 3AV0B 2GCOB 4AKEA 5HPYB 2XZOA 1D2EA 1SXJC 2AWOA 4WZ6A 3SFZA 3VMFA 1HQCA 3B7GA 3B2EA 2J7KA 1KSJA 3Q9LA 4R2IA 3EASA 2GJ9A 4HLUA 5CB6A 1FX0B 3LQRA 1KO8A 3Q72A 2R9VA 3QPUA 3GEIA 4US2R 2FG5A 1MOZA 5GVRA 3P26A 3THXA 5GADl 3QKUA 3QPWA 1G17A 3P27A 1P3JA 3E1SA 3K0CC 3MWLA 1U90A 4Q48A 2DR3A 3WMEA 4CT5A 5GJCA 5EE1A 4L4UA 2QGZA 3KL4A 3HU2A 3L0OA 5AUNB 4MGKR 4YQFA 1OH8A 4QGHA 2HT6A 2RMKA 1R7RA 1ZC4A 4KCGA 5DN6D 3WRXC 3C41J 3QXHA 2FZLA 1ZNXA 4E09A 4V0KA 5LDDC 1NBME 4JL5A 5CLQA 4DCTA 1D5CA 2ZETA 1QF9A 3OZXA 2E9SA 3TR5A 4ABYA 1CBUA 5EZ6B 4RKEA 1G19A 1Z2AA 1UEJA 3LBIA 4FW9A 5TDHA 5JWRA 2QAGA 2WSSA 3NVAA 2PEYA 4FMCB 1M7HA 4B33A 221PA 2P65A 4JVSB 2ZI6A 4LRWA 5C4MA 1E0AA 2YJTD 1XDBA 3UWKA 1MRSA 1JR3E 2WJIA 5KHOC 4QGAA 4ON9A 2O0JA 1TMKA 2ZXUA 1YZNA 2HJVA 1KOFA 1ZM7A 2GAOA 2LKCA 3IQXA 4Q7LA 3RS4A 4PC3A 2X8AA 5HR5A 5KDOA 3RRZA 4GMDA 2CMKA 1CR1A 2PBRA 5JEDA 1V43A 4G5OA 3BD9A 1W7AA 1S9HA 5H70A 4TSFA 1TQ2A 5J4VA 4YMSA 2ANBA 2BJVA 1RW4A 2ZJZA 2ZUDA 4YC7A 4LYHA 1X1RA 3UWOA 4AWXA 3ZZTA 1P2VA 3GLGB 2OCBA 4ERNA 3TUJC 4TT3A 4B35A 1AA3A 3TW4A 1AJEA 5AK0A 1RYFA 1II8A 2NG1A 3KKOA 1W36B 1ODFA 1G1MA 2D06A 2GJ8A 2F7SA 1NMZA 1JALA 3U60B 2ZSEA 2OFOA 1A1VA 5AR1A 5F2EA 3V4RA 4CEIA 1CRPA 1E96A 4JLPA 3A1VA 3WNCA 4C2UA 4JLMA 4V0LA 4BRWA 3WMFA 2OAP1 5KYKA 1I4DD 1ZUIA 2HEIA 1OV4A 1RJ9A 3W34A 2GCPA 3PR1A 1ZU5A 3EZ7A 4DJTA 4L16A 3RS3A 2F9MA 2Z5FA 3EC2A 1PVOA 2IYZA 2C2HA 1UBFA 4PO9A 1LTQA 1P7CA 1SVIA 5KDDA 2IF0A 1JJ7A 4OHWA 2X1VA 1KMHA 2JJ2D 2QTHA 2FEMA 3IEUA 3SJAA 4PO1A 2HV8A 4ZDWA 3VU9A 4OQFA 4RZXA 2B8TA 4MKIA 4JVMA 3CX8A 1KYIA 3X1YA 5DNYB 3THWA 4PXAA 3A1UA 4UQOA 3BFXA 1X8JA 4JJZA 4CEJA 4TYPA 2CVFA 2QMHA 3THOA 3KJHA 4TLDA 4K8OA 2CE7A 2IX3A 3QKRB 4ZI2A 1F60A 3BWDD 3DEFA 2RGAA 1NN1A 1W44A 1AQYA 5FTMA 3E2IA 4IFEA 2NQ2C 5G3ZA 2XGJA 5FUVA 1FMLA 1GSIA 1E9EA 1ZBDA 2CLCX 4Q9JA 4Q01A 1NMYA 4HAYA 4P3YA 2Z6VA 1TUEA 3PEVA 5E7JA 5GJVC 4CVNA 3RABA 2J3EA 3GJ3A 5J40A 2WVJA 3GJ0A 2OSBA 1G8GA 4DLZA 3CWZA 5KNCA 3QPVA 1XF9A 2B21A 3W3AA 4J0QA 3GLIA 3SHFA 3FFAA 1DEKA 2GAAA 1T4GA 2VEDA 3CWQA 3L0SA 3FE2A 1N6NA 1YE8A 2HYDA 2ZSAA 3NEYA 4MA4A 1P4SA 2XOKD 4HYYA 3Q3JB 1P9NA 2XSZA 3K9NA 3VNVA 2XTZA 4O3MA 4D6PA 1ZIPA 4Q9LA 1R10A 5IHPA 3SS8A 2EQBA 2QI9C 4Q9KA 4CIDA 1T8TA 2ZYUX 3RANA 1YZUA 3HPQA 4JLKA 2ZRFA 1EG7A 1W48A 2OV2A 2IXEA 4N0DA 4W9MC 1YKSA 3C8UA 3LW8A 1R8QA 4ITRC 4IXNA 1IXZA 1NSFA 1T0HB 4NCKA 3KJIA 1R2QA 2FSIA 2WWXA 4BLOA 4Q4JB 2HLDA 3OIUA 4Q03A 1UDXA 3ZVNA 2I1QA 1G5PA 4BPBA 3TJZA 4B76A 5FI0B 1FW6A 2NGRA 3QI2A 4DLWA 4WIAA 1VYUA 5EE5B 1IAQA 2BM1A 5A5GA 5LPNA 1IQPA 4TTQA 3RS0A 4JLAA 4NH0A 2H92A 3LDAA 1IY1A 4CW7A 4LV5B 3GJ5A 3KQLA 2XTMA 1P2UA 1Z3IX 2NMVA 2JA1A 3CPJB 3OEHA 3D7MA 3LXRA 4DDVA 2KBEA 2GWHA 2F3TA 2EFEB 2YOGA 4Q1BA 4Z54A 4A9AA 3MWJA 5IDVA 2D74A 3LX5A 1NN5A 1DO2A 3V00A 3UKDA 4A8JC 1KAOA 1D2MA 3PUXA 2WSSD 1OHHD 3AVOA 3QF7A 3W6PA 4JBYA 2VHUA 1S0UA 2J59A 1CIPA 5JS8A 4QXAA 1NIPA 5P21A 3UMFA 1UADA 2ZJBA 4RZ3A 3V4FA 121PA 2FSFA 4ASUA 4P4UA 2ZJYA 4BFWA 3BB4A 2ZU0C 2HF8A 5EP2A 5IK2A 4XWKA 2VP2A 1T9HA 2R62A 3LA6A 5FR1A 2FFBA 2VSOA 4DUGA 1E0KA 3K8YA 2ONJA 4HSEA 4DLVA 1N6PA 4TSFD 1RVDA 4I99A 4H1VA 1EX6A 4Q5IA 3IGFA 1ESMA 3SQXA 2UKDA 3B85A 2B7BA 3K0EA 3N70A 4M1OA 1Z63A 2ODBA 3TKLA 2PZFA 2IS2A 2ZRCA 2JLRA 2JCSA 4HAZA 3VR4A 4MDFA 4TQ9A 3U44B 2FFHA 4TT3D 4C0BA 1LY1A 2KB0A 5CK4A 3OFNA 1CR4A 2VF8A 1L8QA 2IYYA 1KI6B 1JB1A 4D82A 4M1MA 1KO7A 3F5FA 4IVQA 4DB4A 1G5TA 1II8B 4HB3A 4QRHA 1XEWX 4PQFA 1XTQA 3AP2A 1JJVA 3A4MA 3EAQA 1J7KA 621PA 2QTFA 1P60A 1W0JD 1KI4A 2OT3B 1YVDA 2CLDX 2VLIA 2FF7A 2NO1A 2WMNB 2ZVPX 4Q7JB 4TN1A 3AUXA 2ZEJA 1VMAA 2WMOB 3UXMA 2QBYA 1N5LA 3PUVA 3T06B 3T1TA 5JRJA 4EPTA 4GNKA 2CEAA 1XD8A 1E2KA 3KKNA 4V0OA 1W2GA 2KSQA 4NYJR 5DGXA 2OLKA 5AUPB 1G6HA 4Q1AA 5LB4A 1HUQA 4MUBA 1K5DA 2R65A 3ONWA 4EFLA 3PXGA 4BLTA 2QEQA 2Y8EA 4KFSA 1O87A 2FNAA 2ZREA 5FUWA 4JSYA 2DBYA 3H1TA 4RFSA 5FL3A 1E6CA 4URVR 1X8KA 4KAXA 4Q19A 3THWB 2J0SA 4F7WA 1ZJ6A 2PX3A 3BH0A 4LK2A 4TQAA 2RGDA 1YHNA 2V7QA 1E69A 1H8HA 4B73A 3CR8A 3UMRA 2F43A 2AFIE 721PA 2WTUA 4P32A 4NE2A 3WBKA 1Z8FA 1OW3B 2R2AA 1WA5A 1NLZA 1XCGB 4DDUA 5HCIA 4QGFA 3X2SA 2AXPA 5JHHB 4ZO4A 4PR0A 3FKQA 4LV6A 2C8VA 5L8VA 5JI3E 5DLQC 2IA5A 2QE7A 1D9ZA 4WAUA 1ZVQA 1KDPA 3Q8XB 2JJ1D 3R20A 1G5RA 2FSGA 4LJ7A 1UKEA 4PHHA 5GJWC 2JLQA 4YMVA 4MDEA 2WOOA 3ZDQA 4OHVA 3EZFA 3GEEA 2ODEA 2R6CA 2XSZD 3B9QA 3SE0A 3T1OA 4KVAA 1EFHA 3PV0A 4K46A 5KO2A 5IRCD 3EIQA 1CULC 1VYTA 2SHKA 3SZRA 5FOWA 2O8DA 1Z6AA 3K70B 3AVUA 1J99A 4OI2A 2Z83A 2H57A 3BORA 3Q5DA 3G5UA 1XMVA 2WSMA 1XD2A 2WAXA 3LLUA 3MJHA 2QAJA 1W2HA 4QBFA 3LBNA 4PSVA 4QHSA 2R6FA 3DMDA 1ZP6A 4M9QA 1MO6A 2REXB 2QN6A 3OHMA 3LAWA 2GVDC 1IN6A 4RJLA 3DOEA 4YXWA 2ZAMA 1KHTA 3A4LA 4C4PA 3Q7QA 1E2IA 1ELOA 2FN4A 4LUCA 2OCPA 3GLIE 2CHVA 1Q1QA 4E22A 4YMUA 2ZQ5A 2REBA 3VKGA 2E87A 2ERXA 1AK2A 1CEEA 2VTKA 2IYTA 2TMKA 3BOSA 3OEHD 1J8YF 2DFLA 2MMCA 4UNRA 3P4YA 5KSZA 4IW3B 2ZVQX 3DL0A 1NG9A 3U3KA 3T15A 4PQRA 4UJ5A 1ANKA 2IYWA 1Z6GA 1KSFX 2V54A 4TYWA 2DWPA 1Z0JA 2Z43A 3KTAB 3D3QA 1ZD1A 3AKDA 2RHDA 3M6AA 2GCOA 4WZAE 4PHFA 2ATXA 1S96A 2DFNA 4LGMA 1KKLA 3I1FA 4DCNA 3LXXA 2BBOA 4GPTA 1KY3A 1NY5A 1L4UA 2VP4A 3LVQE 5JBQA 3OEED 2YC4C 4EJSA 2GRJA 2Z4RA 5IK2D 1JR3A 1FX0A 3MSXA 3V9PA 1HEIA 3K0SA 4LC0A 3ICQB 3TAHA 5JRZA 1OH7A 2WBLC 4A2PA 4TQUS 1O3YA 3B78A 4PZLA 4NDZA 2L0XA 2A9KA 4JKIA 3TE6A 3CRQA 4TMWA 1PLJA 4UXHA 4YMTA 2QRZA 4CEHA 3OESA 1PUJA 3BAFA 2VHJA 4R9UC 3CH4B 1RRCA 3EPJA 4NCJA 4M9SA 1EWQA 2FX3A 1Q57A 1Z29A 2QQ0A 2OCAA 4LWZA 2F55A 5KOYA 1E2LA 4B3CA 1W49A 2H1LA 4PANA 2GF9A 1U8AA 2DFTA 2O52A 3LW7A 5K8LA 4HEJA 4TMZA 2YV5A 4A0RA 2LWIA 5BN5A 2D3WA 4EPWA 1N25A 4JLOA 5DHAA 3SFVA 3CRRA 4MRRA 1C4OA 2CE2X 2OHFA 3QNUA 1H8EA 4RD6A 3T61A 2PCJA 2Q3HA 4Q4LA 3QXCA 3O8BA 3LX8A 2DWOA 2V4ZA 3JZMA 1W46A 4OQLA 1LW7A 2QBYB 1FL9A 1NN0A 4Q47A 1XZPA 2LKDA 5CIQA 1IN4A 3GQBA 2Z4SA 2YNMA 1W0KD 1U2RA 1JPNA 1R5OA 1OFTA 4M21A 5LBIA 2AKYA 5KDLA 1YRAA 1D6JA 4A2WA 1RYHA 3I8XA 1Z5ZA 2P6RA 1X6VA 3EC1A 3GFOA 2ZE8A 1GTVA 5G41A 1UEIA 4JS0A 2QUZA 4RFSB 3B6EA 4C0AC 1NVXQ 3GLGA 1E9CA 5DSZA 1D2NA 1OF1A 4B32A 1G291 2GZDA 3KZ1E 3GJ6A 4TMXA 4D2IA 4HUQB 1BIFA 2JATA 2BOVA 4IKEA 5CJ2A 4KXFB 3ADKA 4B44A 2XB2A 4IRUB 1E1QA 5K8IA 4YDHB 2BCGY 3LWNA 1Y63A 4PZYA 2QE7D 3PCRB 4URXR 2PMDA 4ZKDA 3MD0A 4L8GA 2FU5C 3X1ZA 2A30A 3CNNA 4B43A 1JAHA 2QSYA 2IHBA 4OI1A 2N46A 1HH4A 2VPPA 4C30A 3Q85A 3AM1A 1G8YA 1JQJC 4XSGA 3PVSA 2YWFA 3SJBA 4C7OA 1HA3A 1FUKA 5D3QA 5FTKA 2QSZA 4B2PA 2GA8A 4YMWA 1BOFA 3SHWA 1FFHA 3B1YA 4BFXA 4D4LA 2WKPA 2H17A 1G8HA 4RCYA 1AZTA 5KNDA 4QHYA 1LF0A 4LPKA 4XVQA 3B9PA 5FBLB 3BFKA 4Y0VA 4XOIA 3TVDA 2QNRA 2J45A 4PC6A 4PAQA 5K8TA 4LI0A 3TQCA 2BKEA 1E79D 4B6FA 5BWMA 2RGEA 1Z22A 2O8DB 3NKVA 1Z47A 1KO1A 1XWIA 3OIVA 1C1YA 2G0NA 4AK9A 1P75A 4MUAA 2DPXA 3QKRA 3FVQA 1XPOA 2PH1A 3ETLA 1AS0A 3TSOA 1TQDA 4PC1A 1XD2B 5DIFA 1PV4A 2PJRA 4US1R 2IS1A 4YXWD 2O8CB 3WNBA 3J81k 1SXJA 1FTSA 2MSDB 1NJGA 3QEJA 4NL4H 5D3MB 3ZLJA 1E2QA 3EIHA 1GNRA 5JJIA 2GHIA 4HLDA 1IBRA 1KK1A 1CXZA 2GEDA 2IYSA 1MO4A 2C9OA 4D4MA 1AGRA 2RAPA 2MSCB 3I92A 4U5XA 2CBZA 4NBSA 4C0HA 2OAQ1 1FOEB 3TMKA 1CJUC 1HE8B 4OL0A 1VDZA 2FGKA 4EPRA 1Z06A 4KFRA 2RB4A 4EPYA 1E4YA 2ZRMA 3PQCA 1NBMD 2D2FA 5BYJA 3RRNA 3VQTA 3K1JA 1AZSC 1S1MA 4JLBA 5E7MA 2Q3FA 4S2EA 4BFYA 3H84A 2RKOA 421PA 2O8EB 4C0QC 4A92A 5DI3B 1OIXA 1FQJA 4M1TA 1DG1G 3AKEA 5AJYA 1JR3D 2V8OA 4MYUA 1F6BA 2YINC 4LJ4A 4B34A 3PJRA 4Q21A 2AN9A 3LLMA 3Q7PA 1N5JA 4EJSB 5JECA 2CHQA 4W5HA 3I72A 3KXLA 4Q4JA 4D81A 3G82C 3I3SR 4DDWA 1IHUA 3R8FA 3KB1A 1KNXA 2IL1A 4YDSA 2IYVA 3P20A 1W1WA 1UF9A 1UBGA 2VSXA 4UJ3A 4OK5A 2GJSA 2AK3A 1JR6A 1HTWA 3CZQA 4A0FA 3BJIC 3BXZA 1U8ZA 3HPRA 3LVRE 4QGGA 2OE2A 2GZHA 4PZZA 2Q21A 3L2OB 2VP6A 2IWHA 3NIBA 2ZM5A 4NCIA 4CEHB 4XH9B 1OB5A 4MRSA 1XPUA 2BMEA 2ANCA 3GEHA 1NLFA 1J70A 2JIZA 2P67A 4DLUA 2JLVA 5JWHA 2Q9CA 2YC2C 1G3RA 3W6OA 2IXFA 3OF5A 5A0FA 2AD1A 2ZJ5A 3SEAA 4D0NA 3THYB 1XBTA 4NYIR 4US0R 4MRPA 1CF4A 2I4IA 3CB4A 4GRAA 5CM8B 3U2QA 1U99A 3EARA 2AWNA 4GOXA 2Q9AA 2GZAA 4CZ2A 3FB4A 1IY0A 1L7VC 2VF7A 4PAOA 3HJNA 4BZXA 2ZSFA 2EFDB 4A4DA 4ZV4A 3VAAA 1SVLA 4CF7A 2EVWX 3VKWA 4CDGA 3P32A 4TL8A 4LCBA 4QFMA 5E95A 1Z83A 3AP3A 4OQMA 3EPKA 1OKKA 2D62A 2CHGA 1E2JA 3IQWA 3SU8A 1XJQA 2JLYA 2WPDA 5EZ5A 2ZE7A 4O0MA 5HKKD 2GJAA 1NJFA 2EU8A 5KPDA 3BK7A 4Q02A 2QGNA 1G21E 3AVWA 1U0HC 4HLUC 1Q1BA 2IC5A 4KFTA 3AVTA 3U44A 2RCNA 4DCUA 2IUTA 1SVWA 2FFQA 2ZJ8A 5E3HA 1W36D 3IILA 1F3OA 4LHZA 4QHTA 4GSYA 4DRZA 1KI6A 4EFNA 5BXQC 4Z1MA 2AFHE 2O0KA 4PSKA 1WMSA 2P3SA 2X77A 4TL9A 4DIEA 1Z0FA
chains in the Genus database with same CATH superfamily
4IJ6A 4URZR 1EFRA 1DS6A 1N5MA 2J5BA 1RRMA 2O1EA 1LPBB 2HO4A 4PYLA 3Q8KA 1JQLB 2Y67A 4URUR 1K9VF 4K87A 5IZ4A 1YS2X 5GPBA 4BB6A 1VXRA 3WFJA 3ZQ6A 3R7WB 1DQZA 1U63A 1T4CA 2OYCA 4RIFA 4BWYA 2G9RA 1KJYA 4EO4A 1KPGA 5LXTF 5BR7A 1LKZA 1J1IA 4DVGA 1W8DA 2QIPA 3DDOA 1PJBA 1JH8A 3HFJA 1ZAYA 2C77A 3S29A 1VCOA 3DPIA 2JGMA 3RSHA 5LD2C 1ZAKA 1SOVA 2R1TB 1L9XA 3K16A 4XQ0A 4ATNA 3SR0A 3KWMA 1GG9A 4L8FA 5KNDD 1DPGA 1L4GA 2WKSA 2JJ8A 2QAGC 1SG0A 4E5KA 3JQ6A 3G13A 3WWEA 2ACKA 4G2NA 4BMXA 4EFKA 1QE3A 1IBLB 2NT4A 3QU9A 2QAIA 1HEYA 1ZH0A 2VSYA 1MIOB 3IUYA 4EHLA 5JSQA 2VJDA 2J08A 1V25A 2B5WA 2ZT7A 3N2EA 2VH2A 1Y4AE 1KDRA 1SC4A 3CM0A 3KPVA 3Q2IA 1J42A 3PDIB 4MW2A 1REQA 1TTHA 4BMZA 2AI2A 4ZTBA 3KL2A 2VP5A 4IIJB 4OU5A 3GLGE 4P5DA 5DPMA 1U8EA 3O4HA 3CEAA 4ZRMA 1WULS 2OILA 2ZIAA 3AEQA 3JAWB 3OOEA 4EYSA 2QTWB 3NUQA 5DK4A 5KWJA 3E6AA 2HSGA 1F6DA 1BXKA 2X14A 1MNQA 4Q3LA 4WHMA 1EKXA 1MXFA 3G2OA 3LRPA 5MN5A 1WEKA 4R9NA 4CGZA 3OIDA 1R37A 4JBLA 2BIFA 2DBZA 2Z2KA 3DEJA 5IVDA 4F21A 1ZBQA 4R7TA 3FTEA 1VJ5A 1T10A 1DWQA 1L4KA 1VYHA 2VHWA 5C1BA 1GTMA 1ODIA 1ZMBA 3SM9A 4E3ZA 4FI3F 1YMQA 3BA1A 1SXJB 1ESNA 3D5TA 1U0BB 2XYGA 2Q6IA 4DV7B 4B71A 3HXMA 1GAJA 4ZTZB 1VG8A 1KVSA 2HMWA 2PMFA 3U6BA 4NMHA 3UK0A 3AUYA 4EOGA 2HIAA 2XNCA 1F38A 1XZAA 1YZKA 3SHVA 4PPNA 1BX0A 1JSCA 2P41A 4O2AA 3A8TA 4G67A 3KOZA 3FYDA 1LX6A 1QIEA 4IIEA 2BLLA 1JKJB 5EIWA 4G4GA 5FO0A 4NCHA 1P0PA 4J0FA 1FDRA 3VVMA 4ARAA 2ZAGA 1CU1A 1O9BA 2OHHA 2UXDB 1I1QB 2WAAA 4KDCA 5E2AA 3L7AA 1TF2A 4JXJA 3TZEA 4XAQA 2RAUA 4UVGA 4BVKA 1VA5A 2ODQA 4YAKA 3D3JA 3HVIA 4N5NA 4LZPA 4NOLA 4NQRA 3S0JA 4MAMA 1T3ZA 3S1SA 2E18A 2HCTA 2N3ZA 3DVLA 3U1VA 4JODA 3ZKWB 4FB4A 3E35A 4K6HA 1T9KA 1CUAA 4Q9HA 1KFBB 2D7CA 2HJRA 3KXKA 2FMXA 4ZXPA 1FDVA 1M2OB 2JNWA 2QRJA 2DPMA 4N5LA 3ROEA 5U4XA 4BU1A 5J4HA 2FEWB 1MO3A 5ICSA 1N3BA 4G0ZA 1I4OA 4BBZA 1KZYC 1IXRC 1JG1A 2BFMA 4DE5A 3BEDA 2B1RA 5JNWA 3R9XA 3P1JA 4KFUA 4OJTA 4ZP1A 1UKCA 3IE2A 4V2UA 3HV0A 5FEUA 1QHXA 2JKZA 3PKZA 4JYPA 3AR2A 4O2LA 1LFDB 1ND5A 3BZWA 1E1RA 1DOAA 3MELA 3V8EA 1N8SA 3WK8A 4RKQA 5JJKA 2D0IA 4G0XA 2B6HA 1QH1A 1WUKS 5CVCA 4FCCA 1AMUA 3LFUA 2BTOA 1GN8A 1RWPA 1Y7IA 4LRSB 5I4CA 1UKVY 1WJGA 2WUFA 1XL1A 3ETCA 4PSUA 1RLIA 1VLLA 5HRUA 5CT8A 1ST2A 5JV5A 4ZICA 2N42A 4CG3A 1OYYA 1N2BA 2KX7A 3P19A 1X3SA 4G1BA 3FJYA 1G41A 2ZTVA 4DDMA 2NO0A 5HFAA 4MCIA 5I3CA 1AO0A 1X86B 3JARA 3JQ8A 4ND7A 1O6BA 1YL5A 2EW1A 3BRWA 4KLRA 4IOKA 3I1JA 1Y7HA 1FTGA 4DMFA 4J7AA 4O0LA 5CJPA 4YCJA 5DGHA 4QYXA 1GR1A 2UZAA 4H7HA 4MKXA 4UULA 5DBHX 2EX4A 1PT6A 3V1LA 4S1NA 3NR2A 4BU0A 3Q0EA 3DZIA 1U8UA 2NAPA 3BHJA 2YVUA 4EX6A 1DE0A 1E89A 2XQFA 3JQPA 4CLOA 2D1YA 2IPMA 2QUKA 3AY6A 5KPJA 1JG7A 2VK2A 3PJEA 4ENTA 3RBAA 3L41A 2OY0A 3R6WA 4E13A 5JCJD 5B4UA 3NHZA 3O73A 2IIBA 2ZM6B 3RIYA 2HUPA 3AFMA 4D26A 1YB5A 1TYEB 3EA5A 4GKAA 4Q82A 3K5IA 4D4JA 3RS5A 4FD2A 4O4LF 2HU2A 1D1TA 4QNRA 3ZOZA 4E51A 4WLUA 1GUAA 2Z5VA 3LRTA 4ZCMA 5KQRA 4GOJA 1EFLA 3K09A 3WGHA 4Z1MD 3T1VA 1YRWA 4ZYLA 1CUDA 1J21A 2IXBA 2LNDA 3C3KA 2O54A 3C8HA 1H0RA 3SF0A 2I2DA 3B13B 2D5LA 4C04A 4D6YA 1Y1SA 3E7XA 1NVVR 4F56A 4ARSA 5GIOE 1SXHA 3HEAA 1QYWA 4NBKA 5G40A 1T0UA 1Z2CA 4M87A 5DTRA 3ZWAA 3OOWA 2C9YA 3OPYB 1QRUA 1FQKA 3P7MA 1O54A 3HO6A 4G5HA 4C0KA 1BDBA 4BNLA 4I9UA 4UE6A 2D4HA 3IIJA 1SUFA 1UJCA 2J4FA 1OFIA 2O2YA 3DVAA 1KF0A 2CLOB 4OD0A 5ALSA 3TRFA 5CFLA 2AOWA 3MYYA 1ULSA 2AR7A 2WHEA 4X84A 1LI4A 1S8OA 4IWXA 2V7WA 4RM2A 4NU6A 3LF1A 1FP6A 3CONA 4EI8A 1D5WA 2I76A 3KB2A 4HV4A 1I3NA 3C3CA 1B1CA 3LY7A 3K8OE 4N7RA 2K4MA 3VBEA 1B42A 3O4IA 3D8BA 5ECWA 3FYCA 5C4IA 3URMA 2C7RA 4WBSA 1V2GA 3QLVA 4N39A 1RRVA 4TN5A 5G0TA 2BFOA 4N6OA 3FJ1A 4HYQA 1Q1NA 2VTVA 1L7EA 3CF2A 3H75A 5B6JA 4NCAA 3OF3A 2ZE5A 5B2ZA 2R8RA 3KR0A 3T7DA 5C7LO 1S2MA 3RYCB 4KR6A 4NATA 4GYKA 1GN9A 3ETDA 2Q7DA 3PUIA 3BCSA 3R4VA 5KQGA 1T5OA 2X3FA 1O95A 2Q07A 5LWQA 3HU1A 3WAJA 1VHLA 4QZVA 4QECA 5CG1A 3C1UA 3V2UA 1JBQA 1EK1A 2O2SA 2FW1A 4NG5A 1C3VA 5ALDA 1ISHA 2VDWA 5LZ9A 3O5AA 4I1SA 2UXBB 2FPMA 2Q46A 3RVNA 2WFLA 1AA6A 1SD1A 3D8NA 1O97C 1VG0B 1KETA 1USGA 1CLEA 1XYYA 2CNLA 2RBEA 3KYCB 1LH0A 1Z8HA 1GCOA 4YO7A 3T3OA 3KHTA 1L0BA 4RL6A 5E6UB 1SKAA 4UPEA 5ICMA 4BZZA 1MB4A 1UBKS 1U7PA 4WJLA 3M3DA 5DI9A 5ER9A 1W4AA 2FP4B 4KUEA 4D98A 3JQGB 3T1QA 2FR8C 2CXXA 2ZJ1A 4HOYA 5CDFA 3RUCA 2AYYA 3KZXA 5GMOA 2IUEA 1F4VA 3H87A 3CRVA 3IP9A 1NZJA 2BP7B 5D7BA 3MGCA 5JAQA 5A4FS 1V1MA 4MV9A 4JFRA 1E0JA 1BDMA 5F9MA 2QRKA 2H1IA 3KVVA 1Q19A 2IYXA 4MLCA 4H1HA 4Y6GB 2PZAA 5FPTA 5MGNA 3GGJA 3SBEA 1PUIA 2WU3A 3G89A 2PMEA 3ZZNA 3JXEA 4IF4A 4E94A 2PJZA 1L3BA 2WTBA 3W2IA 3ZE2B 1S7GA 3TIGA 4P93A 2QD2A 4AS2A 1NXPA 5E7QA 2CN1A 1JAIA 3IAM1 4MKGA 5K8JB 5LFAA 1MJNA 2VNHA 4OB8A 1XMSA 1RNLA 2JIQA 1N0VC 4L0MA 2F9LA 3QFSA 4RGQA 3SYLA 1T1IA 3RDPA 5KTOA 1DXYA 1W0CA 1Z56C 1LS1A 3GEPA 4XCXA 5DU2A 3CUVA 4J43A 3L01A 1XC7A 3H5LA 5L3RA 3IB6A 4D0GA 8ADHA 1WQ1R 1DXOA 3BJEA 3PEUA 2QVCA 4PSDA 4B47A 2ADFA 2Q8QA 2ZU6A 4WXPA 1SWWA 4A2QA 2G40A 4X8OA 3BE6A 3GK3A 4JUDX 5D3MA 4JI1B 3DAFA 1YZ3A 5JZ9A 1WNTA 5BVGA 1F5NA 1IRIA 3JATA 2D13A 4DUPA 3UUWA 1FS5A 3NAQA 3RSQA 1PZNA 3SHQA 3X3HA 4ZI3A 5JSZB 5TMBA 2V1UA 1QK5A 2IHYA 3PD1A 1YIOA 4WDQA 1DEHA 1EFVB 2RHCA 1JZSA 2WIFA 2XH8A 3R77A 5G2OA 5K51A 1IRXA 1YMUA 4EB0A 4FNGA 4ZDJA 3K6SB 3K5PA 3EHDA 4LSGA 4KYUA 4IL5A 2AHOA 2B99A 3EG9A 3GOQA 5DE3A 3PC8A 2NZ2A 3VR6A 1CCWA 3GNTA 3WHLA 3HWSA 4XLLA 1GDDA 2ZSHA 4KR0A 4LOHA 5CFOA 4V1CB 1OWLA 2EJBA 2GBLA 4MVJM 5AW9A 4AJ2A 4DNFA 1ZVVA 4YUWA 1P1IA 4EB6A 3ZBTA 1WSAA 1YQUA 1DDGA 2QTCA 3W7VA 1G0OA 3ZHQA 1P33A 3FW1A 2EFHB 3KTDA 4HBZA 5T57A 2EQ5A 1GNTA 2PMKA 2CLKB 1IY8A 1PZHA 4DZZA 4FKZA 5A62A 2OENG 1VBKA 1GTJ1 1GFZA 2KJQA 5AJHA 3IT0A 4HAUA 4P9NA 2EC5A 5CDHA 2XF8A 3VJLA 5COBA 1OIVA 4O4HF 3QU4A 4ITUA 1QHHB 4TXJA 4MQUA 4XGRA 4R83A 4YP5A 5K0LA 4IDOA 3R7FA 1VLHA 4D92A 5CBKA 1NRJB 4XDHA 5FOQA 1SBCA 3CLUD 2F9FA 4ZV9A 3FOAA 1KQOA 1QH8A 4MLZA 3U81A 4Q15A 2C4WA 2YS6A 4QJ5A 3RADC 4GM0A 3U13A 4D7AA 3MXTA 1S8NA 3N2LA 5EMHA 4UM9B 1GZ6A 1N6OA 1J8DA 4TUYF 1S1CA 4TWJA 4TS3A 1FTWA 4RHXA 2B1GA 2IYNA 1ESDA 1XYGA 1UFVA 1QRTA 4DQUA 1YQGA 3L7YA 3T7JA 2Y1KA 4CL3A 5ARBA 4ZT2A 1E3TA 1G21A 4RQUA 3NH6A 3VH4A 1GG2A 1KY5A 3WYFA 5AVUA 2ZVJA 4M3NA 3P9RA 4JUFA 2H07A 4XR9A 4BQNA 2CHEA 3DBRA 1Q50A 1P1JA 1NVDA 1B3RA 1JIKA 3MLBA 5AKXA 2Q50A 1Z4JA 1QCYA 3THYA 5KNBA 1H22A 3I9NA 4XI9A 5K0ZA 3AJAA 4IH9A 4V2IA 1C5KA 1NKSA 4A6DA 2HWYA 5BVHA 4M54A 5H16A 4G4IA 2D6FA 2WTNA 3P9PA 1ZNWA 3G1UA 3ZGZA 3H2IA 3ZNPA 1DFGA 2FPXA 2GD1O 5CVJA 3AVQA 3VA7A 2J3IA 2K2WA 2Q1TA 1V3VA 3L8CA 3H86A 4BX8A 5EJ8A 2YFHA 4F93B 2A7QA 3LX6A 5F1OA 4DA6A 4IWYA 1UZLA 3QX9A 2J6IA 3TH5A 4GU5A 4WXEA 5DN6A 4OB7A 3JWGA 4JJ4A 3TPCA 4PZPA 5JAUA 4ZVSA 1GPYA 4Q7QA 1SD2A 2FJPA 2VKTA 1WZEA 2QQEA 1S02A 1YHZA 1GLVA 3VU1A 4BJ6A 3H5IA 4GQIA 4L5YA 1H3NA 3ANLA 3VH1A 5BV8A 2D1SA 3GJRA 3N87A 5I9MA 1V1JA 3CMCO 4M2LA 1PE0A 3ESCA 4WY2A 4Q4AB 3VR6H 1JT9A 4F6LA 2OCLA 1KXZA 5EINA 4HDMB 1CVIA 1XRLA 3U3OA 1GPJA 2GRAA 1V0JA 2H0AA 2XX3A 3ZU2A 3F1KA 1M2FA 4BKUA 2GWRA 4XPIB 3M83A 1T2UA 1L5FA 4ARCA 2NAFA 4X1IB 3QEOA 1QANA 3HA3A 4ND8A 1EGHA 5JY1A 3NW9A 1L8OA 3AEUA 4FDTA 1O94A 2I0FA 1XNGA 1M74A 1MAHA 2X42A 3L46A 4E7PA 1G59A 5JALA 1JQ5A 3A9RA 1DC3A 1U4SA 4J1TA 1FPQA 4CV3A 4ZOEA 5BT8A 3FHOA 5HA5A 2WQZA 1B8VA 5EUQB 5J63A 5I5EA 1KYQA 4LKOA 2XJ4A 1Z0KA 2F8LA 5DM4A 5BN1A 1HPLA 4QELA 4KRFA 5KSPA 3IE1A 1V7PC 3HR7A 2GEVA 2EDAA 1X15A 3W3ZB 2Q4EA 2C98A 4CMJA 3KDPA 1CNMA 4ZA2A 2PXAA 5BQPA 2EWVA 2QT1A 2UVDA 2YJZA 3KR1A 3O38A 2C78A 4TL7A 5EXDA 4ZT3A 3SDBA 5A4KA 4DC9A 2CYAA 3UG6A 1SKBA 3WK5A 3NUGA 4MQ6A 5ANRB 4MWBA 3WE7A 1KFKB 4LY0A 3D3EA 3M70A 5THQA 3L5OA 1P19A 2EYQA 2AN1A 3C5HA 2IPLA 1I1HA 2IZ0A 3IHWA 1E2FA 2V55B 4IJ5A 3QJ5A 1JLSA 2FXVA 5CH5A 4CLEA 5JO0A 4PYIA 4LDAA 5BW4A 3L8GA 3D0OA 2R8OA 2PGDA 3AM4A 3FCOA 3SEFA 2YNMC 2NPFA 5ICEA 5H8WA 3AFOA 4PBRA 2CFSA 3FDFA 1BMFA 2C04A 2I7XA 5KSYA 1EUYA 1B73A 4Y0AA 3I9OA 3R8CA 3RFCA 4LJAA 5KNBH 4I9HA 4OXYA 4C5BA 2QRVB 3EPHA 2NN3C 3CRMA 3HEMA 1ENPA 3I30X 4ZOLB 5G3YA 2R48A 1XUOA 2ZBFA 4QYTA 3UHJA 3PQEA 3GU3A 3K0FA 4LNAA 1TUIA 5D3KA 4NXMB 4XASA 1N32B 3A06A 3E9YA 4OAOA 5EERA 3O47A 4BO1A 4A5OA 2PKCA 3BE4A 4FE3A 1BOOA 1M8GA 2HMUA 1SOAA 4TVKA 5HOQA 5LP6A 2C2GA 3H9EO 2NQ8A 4YP9A 2ZKIA 3EZ9A 3H9GA 4HWTA 5J59A 3VBCA 4TZ6A 4E2ZA 3MWEB 5TJ9A 4R1MA 1VDMA 4BNVA 2IZOA 3FUCA 4GLJA 1SU6A 1GP2A 3ZVMA 1DIHA 1RYEA 3OEWA 5T3UA 3QVUA 4UBNA 1KU0A 2B0CA 3CXRA 3NHPA 4LVCA 3OQ1A 3ELDA 2FWIA 4IHJF 3WI7A 4D9JA 5JNTA 3U39A 1YSCA 4IUYA 4AYTA 2JJMA 1IXSB 2DMRA 1NP3A 3FDXA 2CJWB 2J46A 2ZWIA 4XYGA 2VJOA 1UBJS 1CT9A 1I7SB 1PNRA 2ZWOA 2O5VA 4HUTA 4BAZA 2PZLA 1XRRA 4BFSA 3R0ZA 3KXDA 4TZ0A 1UZAA 2ISSD 4YGYA 3ZG6A 3E3NA 3CH5A 5M5BA 2BEWB 3TLGB 4PW0A 2W6MA 1MT3A 5ECGC 3Q7SA 2P9TA 3RSZA 3BGWA 4RA9B 3D54D 1N34B 4MJ3A 1ZWKA 1C2TA 4MWCA 2HF9A 4P4LA 4IO0A 2OV8A 1Y98A 5H68A 4PSAA 1BVUA 2BEJA 3H6KA 2IT1A 3CCFA 1SO8A 3BWVA 3EZLA 3FLEA 3GYBA 1AMNA 2OHGA 5FTJA 3Q6NA 2WNSA 3KHKA 3C48A 1MB2A 3O7MA 2J09A 2J87A 2XRMA 1IDN1 3TM5A 1CQWA 2PQ6A 4TTVA 6AT1A 4DLSA 4CLDA 1HYEA 2LGJA 3M3HA 4Q1EA 5DXAA 4DQLA 4EX7A 3P9IA 3CUYA 2X41A 2WJ3A 4DIKA 1E6LA 4IINA 3GFTA 2OBYA 4O8CA 3G8CA 1N6HA 4R8RA 3EFEA 1CWUA 1UKZA 3KKEA 4TQGA 3WLQA 5EIAA 5HDBB 1FXUA 5BSMA 1XOIA 4CF5A 1B26A 2HAEA 3DE1X 1KYVA 1X7GA 3H1BA 4H31A 3MZ0A 3KBOA 2XXAA 1K75A 2H1WA 2QL9A 3RS3A 3L8EA 1PGOA 1VG9B 1N6IA 1XU7A 1Z3CA 1GADO 4D79A 2ZZNA 3WYNA 4LC1A 2JHCA 1PQPA 3IFSA 1IOWA 4I1UA 4QRIA 4YROA 3PC4A 3FUWA 1ZLXA 5EJEA 3NDJA 1H8ED 4IILA 4U2KA 3GJSA 2NU6B 2SKEA 2C88A 1MH1A 1CUVA 1AF4A 4ZVTA 4NTZA 1KA9H 4CKZA 2RONA 2VZ0A 4MW6A 3W9YA 3MTDA 4KACA 1SG6A 4E08A 2QLMA 1SULA 4K6GA 1VKRA 4FS8A 1I1OA 2IP4A 4HQ6A 4R1NA 2E37A 3GNSA 4O8ZA 3E9EA 3ED1A 1ZN9A 1IDOA 3E22B 3L1UA 3GFVA 1N7HA 1R9NA 3WTBA 1AK9A 4HRVA 2Q2VA 2RE8A 2PX8A 5EL0A 1PVDA 4NU8X 1LNQA 4HZUB 1AS3A 4RD3A 4L3OA 1JA0A 3G0GA 1QO9A 2JB9A 3ZY4A 4CHTA 1U2TA 3DM9B 3NPAA 2MCFA 4QXOA 3CLRD 5LOVF 4XX0B 1R0KA 3FPFA 4LSWA 1GA6A 1NG1A 4JU8A 5DISB 1RWBA 3AZQA 2D2XA 3DV9A 1MAAA 3K53A 3QJGA 2OXCA 2PR2A 2VQDA 5HE8A 4ZK2A 5LOVB 2OG2A 3U3XA 1DRWA 5E9JA 3B1FA 1GJRA 4IQGA 4G9BA 3AERB 4YRLA 3OT5A 3IAM6 2PGIA 2ZYRA 5FA5A 3JQRA 1VHQA 2DR0A 3EVTA 3NFRA 1CUCA 2JZCA 2ZBEA 4B1FA 2QLLA 1WXWA 3W8RA 2JCYA 1THMA 3RKUA 2O4CA 4OBWA 4TYNA 1LWOA 2DSTA 4YTEA 5DB4A 2NZ8A 4DJDC 1VIYA 1QQ7A 3BRCA 3KOXA 2XZTA 1KE1A 4D5EA 1H6BA 2PNFA 3BWCA 4OLBA 1GTG1 3IEXA 1B23P 3EGVA 1UUFA 1PYOA 3GRPA 4LDJA 1TCCA 2DBVO 3EXAA 3EDRA 3GP3A 2WWHA 1HMYA 1V11B 2B82A 2XQGA 4PQEA 3WKAA 1UMBB 3TSZA 1YRYE 3E84A 4ARBA 4TYYA 4KV7A 2YOHA 4U7TB 2R6R1 1LJUA 3Q3CA 4TYQA 1FA9A 1E2NA 1CK4A 5DWQA 5J23A 4H35A 4CMEA 4IDPA 1DCTA 1RMQA 1SGWA 2QM0A 4WKOA 3HU3A 1XLVA 1B8PA 3OTWA 4UEQA 1XVLA 4IYRA 5CYPA 4YIKA 4MZDA 3LO8A 4BMDA 2VL7A 2QPTA 2RCYA 4FCTA 1UJNA 1G3UA 2YWDA 1FEZA 3D5QA 1A76A 3ZDEA 4W5JA 4PRZA 4Z2AA 4OREX 4U1RA 1RHQA 3R3YA 1FSFA 4HC4A 1T2DA 2QMYA 3TQFA 1C9DB 3D6UA 2A57A 4XGKA 1DAEA 4Y0NA 1I6KA 3M0EA 3ZWPA 5EMMA 1DIGA 2V3CC 2AHRA 5TS2A 4YRBA 4TLBA 3ABRB 2P2ZA 3MUFA 4CR7A 5CUQA 2WJGA 4J4HA 3G8BA 3JASB 4FIDA 1JXMA 1EVYA 5I7OA 2JVIA 4FMDF 4RVDA 3V55A 2B4KA 2H51A 1ST3A 4WN3A 1L5KA 3L7DA 1Y33E 4CUKA 2P6NA 1X7ZA 3UAYA 1A7UA 3VVBA 3OIFA 1DAFA 2PL9A 2XYQA 3GN2A 4Y98A 4KL8S 3HXTA 5KMGA 1OAOA 1KDVA 3SD7A 3UUGA 3WB9A 1P1BA 2FPLA 4FVTA 4Z5XA 2XBLA 3G2MA 5JYEA 2HUNA 3ER6A 1ZOOA 2NTVA 2WDZA 1CQIB 1BKYA 2DUWA 2XE4A 2WKQA 3L6UA 2JGIA 3EDQA 4FDVA 4ENWA 3CF0A 1GWNA 1UBEA 3HBFA 1ZGCA 2BTQB 3SKVA 1O9GA 1IN7A 4G4SP 4C4OA 4AQYB 2O2EA 5FTNA 4NYMR 3LA8A 1UQUA 4ANFA 4EHFA 2WE7A 2OXFA 3SQNA 2W9XA 4DT1A 1XDDA 2IYLD 4MH0R 1Z6XA 4ND3A 2XGOA 1U7HA 2BDTA 3R4CA 4YA6A 4OQZA 3AVYA 3ZZ0A 3BULA 3IV6A 5EXPA 4F5DA 4PQYA 4ZO9A 5AI0A 3FYUB 1N6LA 2VC2B 4FMCF 3EMKA 1YJBA 3FGZA 4N5HX 4U2GA 1R0LA 2QM7A 4Y2HA 5ALFA 4A0HA 5GJBA 2DY0A 5FR2A 3H0EA 1YUMA 1P77A 4QYIB 1JZQA 2JVJA 1TA4A 2XT0A 4IZ6A 2JJ1A 1TUGA 1UZMA 4LJSA 4RD2A 3SZUA 4EENA 2C96A 3DKIA 3Q8WA 4CKCA 1Y9EA 2XUQA 4G3XA 4PLVA 2PYDA 4A8JA 2FMHA 2QU8A 3EG5A 3MOSA 2C5SA 3ZJVA 4E5VA 3IMGA 3W4JA 4D9MA 4L2IA 3AU8A 5TX7A 5A5FA 2SECE 3GJ8A 3B1WA 3PGLA 4HNAA 2ZJ6A 4PZCA 3FOFC 2CFTA 4ZDIA 2PWZA 5DM70 3O4FA 4BO9A 5H1YA 4PEVA 4UDNA 2R4TA 3PLAE 1GGVA 3DWGA 2PNJA 1T36A 2OM2A 5H5JA 4ZREA 3N8KA 1E9SA 2GK6A 4IV8A 2OK7A 2XTJA 2QRHA 1NJ2A 1HURA 2NTJA 3D43A 5JMOA 3KYDB 3JY6A 1UBOS 2IY9A 1YKGA 4H7IA 5IDYA 3EXIA 2OKGA 3ERCA 2AC7A 1JFFB 1XXHA 3E03A 3I01M 3NP7A 5D86A 2GXUA 5FNVF 3Q1KA 4BQRA 2CZQA 1JEYA 4B2IA 4LZOA 4GM4A 5EXSA 5EWLB 3QWIA 2WSYB 3MTIA 1KK3A 3N2GA 4B6JA 3U37A 5EGSA 3LC7O 5LP1A 3WAGA 1G3IA 2QL7A 4XQEA 1P6XA 1RFLA 4CT4B 1VBFA 2H06A 4R68A 5K4HA 3LXMA 2XDWA 3BN3A 3PSHA 1ZH4A 3O84A 2C7OA 1DAIA 5ENDA 5BR4A 1G64A 4H7KA 3HXPA 1KZHA 3SJCA 2GBPA 5DFAA 2IEGA 1TZBA 1M66A 3NBKA 2UZ1B 1VPDA 5FBHA 2ZDGA 1GVNB 1T5LA 3BB3A 2C94A 2UUBB 1X42A 1GTL1 1A4RA 4AMBA 3ACCA 4JITA 2XA9A 3FMVA 4BB5A 3BYZA 3E8XA 3NYRA 3RLIA 2AXEA 2GILA 4OH7A 1E98A 4PYJA 2HB6A 1C1DA 2QD4A 4Y6PA 4JKYA 1L7PA 2EWWA 1RSZA 2VJPA 4G4JA 4YDRA 3H3JA 3KLPX 1Y81A 1IHDA 1EX9A 1N0HA 4WNIA 3EIOA 2FN7A 4LJ9A 4QOSA 2YXBA 4ND5A 3N1UA 3N8GA 4RTKA 2B8WA 3A1SA 4BGEA 2W48A 2PH7A 4OSOA 1HLPA 4EA6A 1OAAA 1CUBA 3VUEA 1DARA 3K05A 1PV2A 3QY0A 1KOLA 4R16A 5F9HA 2BJHA 2RJ3A 3IPAA 2JFVA 1XCJA 2XQIA 4W1RA 4W8HA 1L5MA 2PGLA 3H9BA 3U3MA 1PWEA 1WCIB 4DCJA 2WAOA 4OMCA 2BWJA 3TVYA 5JH7B 4H6VA 1XZQA 1DUVG 1JHQA 2WR8A 2HRCA 4RF3A 1SQ5A 1PNQA 1CR2A 3T3IA 3V8MA 3W6UA 1U04A 2GHRA 5FI3A 4HS4A 5ELXA 1JIQA 2I6FA 2DH6A 1MW9X 3BB1A 4C0JA 1XYVA 2W2NA 4YCBA 5ALYA 4RH3A 5IYZF 5DYIA 1NW3A 5AJVB 1LDYA 1QAQA 2OP0A 3NBXX 1LBTA 4EQ6A 4PFJA 2FP3A 3ZGLA 1N2CA 1G20E 2VHVA 3AEZA 1JDUA 2HPHA 4M9UA 2AI3A 4HEA6 2WHRA 1OGJA 3NHLA 5EHIA 1PFWA 3URKA 4YRQA 4BKMA 4Q0MA 1OFUX 2ZDHA 2M1XA 4J07A 4C7BA 3EXFB 4AAYA 5IDWA 4HYEA 4QKQA 3D2CA 4R6XA 2FUG6 1VG1A 2A1UA 4R98A 3ADCA 5BUSA 2RIRA 5JQWA 2ZANA 4R7ZA 4DW8A 1XQYA 3CX6A 1H6DA 4ZT7A 4K86A 4L72A 1IU9A 1PS9A 1G4UR 4MW9A 2IW1A 4YREA 3SYNA 2O06A 3F2VA 4JGGA 4UE3S 1NULA 1BDJA 2NW6A 4IMPA 4MMYB 2OZKA 3R3SA 1H1LA 1KEEA 5D3ZA 1H2ZA 2IYUA 1H69A 1F9EA 2DAPA 3WWCA 2CUTA 1DFHA 4EKDA 1T5HX 1U9CA 1IQ0A 2BBSA 2VJQA 3MCVA 3EIXA 1GPWB 3GOHA 2VZ8A 5AI5A 1BFKA 4NYIQ 3WS7A 3E15A 1J0EA 2GVZC 1XFAA 3HMKA 2BZ1A 2PZEA 4G0NA 4M8SA 1KMHB 1Q21A 4PLHA 4MS4B 3QKTA 1KI9A 1HL3A 3BMNA 1H2WA 4BO8A 2C2XA 3AXTA 1RMTA 3ND5A 1IUKA 3ESXA 5G4LA 4YQZA 4DTIA 1ZJWA 4HNQA 5J5AA 4OXXA 2A92A 3QVGA 1LPAB 4W9RA 4LBVA 5THXA 4BDSA 3VKHA 3A4VA 4UBKA 2I6SA 4MGYR 2BCEA 3R76A 1KIMA 1ZY2A 3HKBA 3ETGA 2F67A 1E7WA 1SCIA 5DHPA 2XGSA 2FVXA 4C3UA 4CM5A 3ASUA 1XMPA 4DXAA 4K1LA 5I9BA 2CNNA 4FN5A 1JI0A 1DT3A 2OZPA 3E9QA 5JYCA 4B0PA 1XEXA 1EXDA 4JQZA 1KPIA 1FBNA 4MMXB 4R9SA 4ENVA 5JZOA 3BD7A 4PPGA 1Z4OA 3ZCRA 1YL6A 1NVUQ 1E9BA 3PC3A 4IS3A 4Y1FA 1EMDA 4EPXA 1ZX1A 4MNTA 1J5EB 3CE9A 1ZONA 4G41A 1TECE 3TD6A 3P4UA 1R18A 3S1LA 2EARA 3A6GA 3WZMA 1W4LA 1XQ1A 2J48A 4HDRB 2X8BA 3LV8A 4OXIA 2ZRIA 4B3GA 3SXJA 3NWJA 4BRUA 4UNPA 3RODA 4ZQFA 4EM6A 4KYVA 5NULA 1W88B 1D4ZA 6ABPA 1JHRA 1ONPA 4OGKA 4EW1A 1UDCA 5JBNA 1XLWA 2ODAA 1ZVKA 4UU1A 5DASA 1RKXA 2GBGA 4TLCA 1PTJC 3O3MB 1JG6A 3ZGYA 1G9XA 2PVSA 2QZSA 3H8WA 3HJRA 3QE0A 4DM7A 2PZMA 4NCNA 1M2KA 2NSJA 5CYFA 3IOMA 5TXGA 2NYAA 2YS7A 1YFKA 2G7ZA 2DUNA 4RLFA 4WFIA 2I6UA 4MEBA 1E1RD 4DKXA 3COPA 3ZZUA 3GN1A 4AJ9A 5H4HA 3I2KA 1B41A 5IJAA 4PU0A 4FFVA 4AYXA 5I01A 1K6JA 4TV8B 1G5QA 2X9NA 3CSDA 3ID6C 1G7CA 4DNXA 4E1AA 5AESA 1OWOA 3W2HA 5KYYB 2VN8A 1E18A 3QX8A 4CFYA 3WLIA 3R41A 1L5NA 4YAOA 2B6NA 4AJLA 4WN9B 2YMQA 2FN9A 2WJHA 4CLXA 3EVBA 4C4RA 3NU1A 4L0CA 4YUXA 4K28A 7MHTA 3PXUA 4TV9F 4RUKA 3ZWDA 1VL1A 1RM3A 3V4VB 1YS7A 2Z1NA 2LCFA 7YASA 3K35A 3L8YA 2O3QA 3I6YA 3E8MA 6NULA 1RCTE 3WP1B 3Q2KA 4RE5A 3BSFA 4AICA 1NKVA 3HUTA 3CZCA 3WBJA 4B3HA 5AHXA 3R6TA 1YZHA 3BXEA 5GM2A 4QLBA 2QM3A 3G49A 3QBJA 4CU2A 4P4TA 4J0IA 3TOZA 2IHTA 2O2JA 3V80A 1HORA 3I6IA 2O05A 3RBZA 5LXTA 3T5GA 3NEJA 1T6ZA 4O5AA 5DSTA 3F6SA 4Q1DA 5B1YA 4JC8A 1C41A 2V8BA 2NXEA 1NQVA 3AY3A 5M04A 2Z3VA 3O1HB 2W4IA 5BNTA 3BGDA 3JQQA 5KS2A 1UR5A 2VDLB 2VHTA 2J32A 2DFKB 1XDZA 1QGDA 4OHMA 5EE0A 3PX7A 1MEEA 2R1ZA 5A0VA 2OWDA 3FOWA 1PJQA 4CG1A 4F8JA 5HQ3A 3G02A 4LVNA 3SPXA 2VXCA 2WOJA 5BUQA 1N2XA 4GP7A 3O03A 3TBFA 1EX7A 1FP4A 2JFNA 5J9FA 4I1OA 5UKDA 1KJZA 1UK7A 2WWWA 2QTZA 2WNHA 3BH6A 1MKYA 2DOKA 3CRW1 2EEPA 2AOXA 3D6FA 2JZOA 4OLJA 5LYYA 3PIDA 1KL7A 1XTSA 3QTBA 1U3FA 4IDDA 2F8MA 5G0WA 4GRIA 1KZ6A 4YJHB 3GHYA 3RTAA 3ZHBA 3AW9A 5IPFA 1CIVA 1DTWB 4FSHA 3CEMA 4G5FA 2OCYC 1RYZA 1YS6A 1E2UA 2IXGA 2ZYGA 3BVPA 4E03A 4I55B 2VTEA 5HF9A 3TSAA 4DV6B 2JEYA 3PNSA 3NQ41 1Q20A 3OKAA 2BZGA 3SIXA 5G1OA 3IP3A 4BO5A 4ER0A 4YONB 5J2UF 2C2BA 3E70C 4JP5A 3JQBC 4NEHB 1FNNA 2BF4A 1AQ6A 4W9NA 2VDJA 4V24A 1V2HE 1X70A 3QFHA 2IXDA 4ZODA 1MABA 2NU8B 1VYVA 3VYSB 3NBFA 3U5ZB 1G3MA 4CKWB 1YBVA 3KDSE 4TKVB 4YASA 3SJZA 5TQVA 3DBLA 1KE2A 4R71A 2PBFA 2D7JA 1NONA 4QA9A 1CKEA 3KIPA 4CMCA 2VJBA 5JFGA 1V3TA 1SVOA 2XCLA 1V8PA 2O2DA 4EA8A 5JRDS 2OBBA 2HJSA 3OMXA 5AKKA 2PXXA 2R11A 4WXYB 1H0SA 4QVIA 1HR0B 5TARA 1H9AA 2HRRA 5CP8A 3ABQB 3RTEA 3VYVA 4HNSA 1QQ5A 1X1QA 2A67A 3SOZA 5IG2A 1O95D 3S8YA 1U8TA 4NDAA 3ABSB 4BQFA 4BTEA 3DE5X 1B8OA 4BIMA 1Y3AA 4ZZ0A 1SWVA 3I9V6 4YRGA 2PUEA 1ODCA 1B74A 4V0NA 3RTCA 1IXKA 2JD1A 4C4ZA 4OHUA 5I8WA 4ZHQF 2X2EA 3KS9A 4GXRA 4KUHA 3KZKA 4X8LA 3ZI0A 5FBWB 2PUVA 4DCMA 1UMCA 2PVCA 3T38A 4OQPA 4QSMA 1M2NA 1N0IA 5EAIA 4RJIA 8AT1A 5HKKA 4MPDA 1HZZC 2Q1UA 1RWVA 3QVMA 2WT4A 1JXQA 1L1QA 1X7YA 2HSJA 2ZAYA 1TW3A 1MOPA 4AG6A 5JDIC 1FS4A 3RF6A 5IM4F 4ZAGA 4CI9A 3VO1A 5FO1A 2F1HA 3PDJA 4KN9S 2EW8A 3P8ZA 2IOHA 4FI3C 4MYSA 4Y2RA 2GETA 4NR0A 1Z5VA 2I29A 1ZSVA 3L6BA 4RANA 5TMEA 2HDHA 4BIIA 1UANA 4OKNA 3VOAA 4G6ZA 4BV2A 4QT4A 1QTQA 3GBPA 5JNRA 4HAWA 3H04A 3FMIA 4IEEA 2B2XA 3PA6A 3QF4A 5U9CA 3KCNA 2VP9A 1CJBA 5K9ZA 4EZIA 1SQFA 1B6SA 2D5IA 4JLVA 1PO7A 2X0KA 1F0NA 2FZWA 1C4WA 4B4DA 1MT0A 3I04A