2ZRAA

Msreca q196e atpgs
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
325
structure length
310
Chain Sequence
b'PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGHVGLQARLMSQALRKMTGALNNSGTTAIFINELRTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 93
structure length 310
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zraA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zraA01
2VF8A 3RVBA 1NN5A 3KUDA 1W1WA 2G1KA 2DHRA 3RC3A 2VP6A 4TQ9A 1F5NA 3FPAA 4IOKA 4DEYA 4TLEA 4MRSA 2OFWA 4AYXA 1ZAKA 2WVJA 4AKHA 1KDRA 5CJ2A 1HT2E 5C1BA 1TNDA 4FMDB 1U8AA 4ESVA 3A36A 3P32A 4K81B 4UNNA 4DC9A 2J0SA 4NCKA 2G9NA 5EE0A 3QKTA 3VU9B 1QVAA 4PX9A 5DHFA 2FPMA 2ZSEA 4TYPA 4DIEA 1OH8A 1ZCAA 3Q7QA 3EWAA 3EPLA 4DZZA 2ZRPA 1IHUA 1CIPA 1ZC4A 1G7CA 2J46A 5FTLA 2P67A 4LV5B 3NXSA 4A92A 3SZRA 4D4JA 3DDCA 1XPOA 5AUOB 1ZVQA 1K5GA 2CXXA 2IF0A 1T0JB 3NH6A 2J7PA 3WYGA 1VCOA 1W4AA 3KQHA 1PV4A 3LO5A 1JJVA 4D0LB 2XJ4A 5FH9A 1N5LA 3K0CA 1XXHA 2JDIA 4HLQB 3WHLA 1MRSA 2VP4A 2EVWX 3AB3A 2HF8A 1W5TA 3L0IB 3LV8A 3OAAD 3ZVRA 2J0UB 4PQRA 2DFKB 1MABA 1XMVA 3T15A 2PLFA 3C14C 4R2IA 2ZETA 121PA 3F5FA 4FWTA 4DT1B 1G1MA 4G5QA 2QTHA 3ND8A 3K0SA 2O8BB 1U8YA 1V5WA 4EFNA 2A30A 5FOUA 3SQWA 1P61B 4LJ9A 2ZSFA 1U81A 1OLOA 3V4FA 4A2WA 4M9XA 3W5JA 1R0WA 3LBIA 3KKOA 1TF5A 3T1OA 3GJ0A 4KO8A 5HZHA 4BFUA 4N0DA 1BKDR 2EU8A 3MGCA 2VSXA 4LHZA 4ACAA 4C2UA 4I81A 4C2TA 3SJBA 2IHBA 4WBSA 2JJ2A 1PLLA 4F92B 2ERYA 1E2QA 3NHAA 5SZIA 4A15A 2OEPA 1E2FA 1Z47A 3O8DA 2VHTA 1W4CA 1OXUA 4PAMA 4AK9A 2EYUA 3RSOA 3FKSD 4EQ6B 1I2DA 1XD2A 1OXVA 2P6UA 1W36C 1P4SA 2ZRBA 2K5UA 3IPYA 4GZLA 5CYOA 3VAAA 4EPWA 1YR7A 1E1RD 2ZI9A 1A4RA 3BD9A 3X1XA 2R62A 5CB6A 1VYVA 4P4SA 2WKRA 4BLRA 2Z43A 4II7A 4KYIB 3RRMA 3KQUA 1JECA 1Q21A 2OM2A 4WXPA 3WP1B 5LD2C 4Z8YA 3QIAA 2GILA 2GNOA 2G77B 4HZUB 2AX4A 4I1SA 2J9RA 4LDJA 2QAJA 5EE9A 2P65A 5CDFA 3WBJA 2HT1A 1XPUA 2ANCA 4DLVA 3K70C 1DELA 3TVTA 1C4OA 4PZLA 2GJ9A 2VHUA 5EQTA 2KI5A 3QXSA 4HZIA 4A6XA 2WWFA 2OO7A 4FWIB 1GL7A 3DVLA 2GXAA 4YMVA 4PZZA 2HXSA 2AKAB 2IEZA 3EXAA 3LWNA 3R20A 4MGZR 2GXQA 1ZNZA 3TW4A 1IJFA 1Z63A 4C9BA 1RPZA 1KNXA 3MUFA 2HXYA 4TTRA 4PPQA 2JIZA 4Y0AA 4LJ5A 5FR2A 5BXQC 1ZYUA 3BFKA 3KXLA 4Q4HB 1QHHA 5CM9C 2VL7A 3EC2A 2N42A 4NMMA 3GLGA 5C4MA 3T06B 1E9BA 1FMLA 3D3QA 3LW8A 3BAFA 1NN3A 4U00A 4DDWA 4ZI3A 4OQMA 1YZTA 4BRUA 1NVVR 1QRAA 4C0JA 4KSBA 4EFLA 5J47A 5AJXA 4FW9A 5A5GA 3TMKA 1IXZA 1ZJ6A 5DSZA 4NYIR 3TQCA 1Z22A 3RHFA 1YVDA 3QQ5A 1P60A 4FIDA 1S8FA 1Z0JA 1QHXA 2VF7A 1SKYE 2ODNA 1W46A 1Q3TA 1X1SA 3QKUA 4NPHA 4Q1DA 3U3KA 1RRGA 1KMHA 1TMKA 4Q4LA 1FUKA 4IVRA 1NY6A 1ZD8A 1H8HA 2RH5A 2YWFA 3DM5A 4TZ6A 1E4YA 1QDEA 2IK8A 3B8HA 2ATVA 1GKUB 5FTNA 4PHGA 3VR5A 2EW1A 1XRJA 4D0GA 2BEKA 3LLMA 4LPKA 1E69A 2PEYA 4LCBA 1NKTA 2QMHA 4BWYA 3ZZTA 4JVSB 3ZDQA 1US8B 2XOKD 821PA 3ZQ6A 2IYTA 2IBMA 4YQFA 1SULA 3DOEA 5H68A 3I92A 3SJZA 3FTQA 3CB4A 1X8JA 5B64A 5K8LA 2P6NA 4NYMR 2AK2A 2WIBA 3BGWA 5KPJA 1CRQA 1ZUHA 2RGAA 1SVOA 3GJ5A 3KTAB 3OIWA 4Q4AB 4DBLC 2W2XA 2CE2X 4LK2A 4NYJQ 1GG2A 1DAGA 1S3SA 1ZIOA 4G5SA 4B3CA 4ZV4A 1RW4A 2RGXA 1XMSA 2WZQA 1R10A 3AKDA 2HT6A 3TGPA 3FOZA 1VHTA 1UAAA 4ZCIA 4DLWA 2EFDB 2KSQA 5JHGB 2IC5A 5TXGA 4JLOA 2OBLA 3LA6A 4XWKA 2ZQ5A 2ONJA 3DPUA 1LV7A 5KSPA 3R9WA 2HV8A 1CP2A 3TUIC 4YC7A 4Q47A 1S9HA 3HPQA 3QXJA 4JBWA 4Q18A 5J5CA 2J5XA 2WAYA 2JASA 2NO0A 5GJWC 1N5KA 5F2EA 4YDHB 5TB5A 1KI4A 5EXXA 5KSZA 4ASUA 4RFSA 3LX5A 1TQDA 1G6HA 3MAAC 4IKEA 4EPXA 3HPRA 3GJ6A 1D9ZA 2V7QD 1RC8A 3UXMA 1EGAA 3PQCA 6Q21A 4L16A 5JMTA 2QY9A 2X77A 2ZRIA 1LS6A 3LBNA 2O0HA 3D8BA 4QOSA 1E98A 5JEDA 3AVOA 1ZIPA 4ITRC 1KZGB 2QN6A 1XXHE 4B6FA 1G3UA 3MG9A 5JZVA 4DCUA 1IY1A 3PEWA 3HDTA 3IHWA 3RLFA 3WYAA 4B74A 3CR8A 1OF1A 3L0SA 3K0FA 3FKQA 3K0CC 1VECA 1PUJA 3T1TA 4IDPA 3TBKA 3EAQA 1Z6XA 1E9AA 3VNVA 1JR3D 1IOZA 2GJKA 4B3BA 1G8FA 1E6CA 3CH4B 4MYHA 4B47A 4C0KA 1UBCA 4Q21A 3GJ8A 1KY3A 5EE3A 2D3WA 4F4CA 1MO6A 1BMFD 1J70A 3QF4B 4JMPA 2QAGC 4HATA 5H1YA 5TVKA 4FXPA 1J99A 1M6NA 1G64A 3HJNA 3RNLA 3RS4A 1K5DA 1GFIA 1YR6A 4HAZA 5TMPA 4DLRA 2GZDA 4PPGA 2ZE6A 1PJRA 1ELOA 5C46F 3GLHA 4I1OA 4DSTA 1YZLA 5L3QA 3THOA 2ZANA 1J8YF 3GLFB 4TQAA 4GMXA 3QEOA 4HB4A 2NMVA 3C5CA 2ODBA 421PA 1HEIA 2ZJYA 2QE7D 3MD0A 4EPYA 2XNDD 4BFZA 3LQRA 3L2OB 1FZQA 2CLCX 1XTJA 3NVAA 4Q66C 2QT0A 2JJ1A 2O8CA 4HDCA 1KKMA 3R7WA 1KI2A 2ZR9A 2ECKA 2H18A 3BORA 3OEHA 3PITA 2FFHA 5HR5A 3VHLB 4RZ2A 2XXAB 3T5GA 3UPUA 2BKEA 1DAMA 3I1FA 3TIFA 3LNCA 4I1UA 3KB1A 1X86B 1XX6A 3CF6R 4TMZA 3B60A 3G0HA 1F2UB 1N3BA 1P9RA 4GFDA 4L9WA 5CDFE 1EFUA 3BE4A 2FSHA 4JS0A 1NNEA 4IEEA 4QKQA 2OLJA 4KYUA 4NKRA 4KFTA 5FOWA 4PHFA 1JNYA 1DOAA 3U7HB 3OESA 5EP3A 3REFA 2CE7A 2A5FA 2OV2A 1IM2A 5CK5A 2DCUA 3SU8A 3W90A 5SZJA 3AUYA 2LKCA 1E79A 2UVQA 3BWDD 4IOLA 1GWNA 2PCJA 2ODEA 5J4KA 4Z51A 2GDJA 4QL3A 3KQLA 1CLUA 3EASA 2J87A 1KOFA 1OHHD 4W5JA 5L3RA 3GLGE 1E2LA 2W0SA 1JXMA 3B78A 1DAHA 3CW2A 1M7HA 4KFUA 2A7QA 4M21A 2W6ID 1XEWX 2AXPA 4XVQA 1G291 4CT5A 3CPHA 4RSGA 1M8PA 1EFRA 2BJWA 2NG1A 4JLDA 4B35A 4B48A 5L3SA 1FMJA 4UXJA 1NJGA 1W0KA 2C77A 2W2TA 4MKGA 3PEYA 4W7SA 1N6KA 4F91B 1ONBA 2WJGA 221PA 2QT1A 5KNCA 2F3RA 1KI6A 5FUYA 3Q85A 4LJYA 3WHKA 4ZIRB 2DPXA 3IUYA 3K8YA 3THXA 1RVDA 1E2IA 2DWOA 4LYHA 1AQYA 2ZAOA 1W49A 4V0OA 5FBRB 4DB2A 2G88A 4RKEA 5JS8A 4B2PA 3EPJA 4FCWA 621PA 1QG2A 4IXMA 2XAUA 1OFTA 4MDEA 3AV0B 4R7ZA 2KBFA 1MT0A 2WHXA 1XTRA 3FMPB 3GEHA 4FMCF 4JLMA 1W4RA 4Z8XA 4JL6A 3W3ZB 4NTZA 1FFHA 4CEIB 4C7OB 5JWHA 4CW7A 4B43A 2SHKA 2G83A 1KO1A 3IQXA 2XEXA 2NQ2C 2AFHE 2XTNA 2C78A 4FN5A 4M1YA 4URWR 1VG9B 4V0LA 3W8NA 3WRYC 2O8EB 2WJJA 3PUZA 1P2VA 5CLQA 2FX3A 3DEFA 5F9HA 3SNHA 3THYA 4JZKA 1R0ZA 4B2LA 1G19A 1RIFA 4QJ5A 4XSGA 1KK2A 2F1RA 3PEVA 1GTVA 3P27A 1HA3A 4HB2A 2LKDA 4B73A 5AJYA 5IDVA 3IBYA 1KMQA 4ERNA 3M6AA 2WMNB 4KFRA 1R6BX 2FFQA 4JKIA 4MDFA 2ZRLA 5FOTA 1H8EA 1XZQA 3E1SA 5DLQC 5AWFC 3RDPA 4E09A 2Q9AA 2GZAA 5G3YA 1HV8A 4YLGA 5A4JA 3K70D 1LB1B 3PXGA 3W9YA 2JLYA 2IYYA 1J2JA 3JVVA 1RZ3A 4Q9KA 3C41J 3GJ4A 4M22A 4BEJA 4GL2A 3K9HA 1A1VA 4RKFA 1Q1ZA 3NH9A 5CIWA 4MITA 5UKDA 2A5DA 2QRNA 4BFWA 4P4UA 2C95A 2GK6A 5KDLA 4KLNA 3AEZA 2QM8A 4CRWB 1VMAA 1Z8FA 3TW8B 1FPMA 5LB2A 1GKYA 4L5BA 3KXKA 4TL8A 2O0JA 1XJCA 1N6HA 1K8RA 4QHYA 2HJGA 1NIJA 4QFMA 4ARZA 1S9DA 2O8FB 2FPLA 2Q0HA 3CNOA 2GEUA 4DWJA 3VHXA 1FP7A 2RGCA 3B9PA 2BWJA 4H9GA 1HE1C 2JLZA 4EFMA 2BMDA 4EPVA 3ECCA 3L8ZA 3K0EA 4LHXA 4DSOA 2YNMA 2WSSA 3U44A 4X8HA 4QC2A 4B3XA 4D4LA 3BH6A 3OEED 1T4GA 2AD1A 2CNWD 4EPRA 4UNRA 1Z6YA 4QNRA 1OYWA 1SXJB 2A3RA 3B9QA 3EARA 4AC9A 4F38A 1DADA 3NC0C 4LYFA 4TL7A 4Q5IA 2BC9A 5KTYA 1E2KA 1FTSA 5FL7A 4A8JB 1DS6A 2QSYA 5AUPB 5DIFA 3NDBB 2JLVA 2CK3A 1NP6A 2W2VA 4A36A 5A0FA 2C98A 2CL6X 3GLHE 5BYKA 2QBYA 1OH7A 1BO6A 3H0KA 2QRZA 2UZ3A 4NH0A 4AG5A 1Q1BA 3CO5A 4PC2A 4D0NA 2OESA 5DYIA 3WMEA 3RANA 1C1YA 2QEQA 3K9GA 2RGBA 4RD4A 2X2EA 3CF2A 3EC1A 4C0HA 2D7CA 1IXRC 2JLXA 1ZM9A 3NBFA 1CEEA 4NBSA 2BBOA 3AVPA 4TYQA 5LBIA 2IWRA 3GD7A 5DI3B 5AJWA 3U3MA 1Z6TA 2R6GA 2QSZA 2VHQA 3BB3A 4D2IA 2XGJA 3AVQA 4L8GA 3RS0A 2QP4A 2DWQA 3TLXA 1Z08A 4IHQA 5CB8A 4TYWA 1XPRA 1GNPA 3MCAA 1R7RA 3WNDA 1LW7A 3EG5A 3HYTA 1NL3A 2RGDA 5FOXA 3WRXC 3SJAA 3EIEA 1S0UA 2P2LA 2GA8A 2ZRAA 1K6MA 2KB0A 1F2TA 5CLLA 1XJ0A 4KAXA 4W5WA 2FV8A 2NZ8A 2OCYC 1XD9A 4MGIR 2WWIA 5FPYA 1FOEB 1MH1A 2PMDA 4PPNA 5EZ6B 4MGKR 4M1TA 3DHWC 4TWZA 2AXNA 1MO5A 1DG3A 2HYDA 2Q6TA 3KUCA 4TLAA 3MJRA 4AIIA 3UKDA 1JJ7A 2J45A 4AD8A 1KSJA 1VYUA 2W6JD 2RHMA 1H65A 4LY6A 1NSFA 3GPLA 3KQNA 3TR0A 3EIQA 5LB4A 3UMFA 4UJ5A 5FBVB 4BEBA 3RSLA 4URYR 1ZUIA 2WV9A 2BMEA 3K53A 4AKIA 1S3GA 3FMFA 1HYQA 4HEJA 1OB5A 2GZHA 4RVCA 5FTKA 4YMTA 2J7PD 1OIVA 1II8A 4M8NE 4LHVA 2P6RA 1DAEA 3H4MA 2ZRGA 2IW3A 2GWHA 4BZQA 1RKBA 721PA 2JDID 5G41A 3T35A 3T1QA 4RD0A 1KK3A 2ZUDA 4DB4A 1S1MA 3ICEA 5JJLA 2F1HA 4LYAA 3CF0A 1NBMA 4JL8A 4ZPXA 3H1TA 2AK3A 3A6PC 5EZ5A 3DO6A 3IDQA 3ADDA 4D4MA 2V54A 4JT4A 2IXFA 1XBTA 5HCNA 1DTSA 2J0UA 2CCKA 1XJQA 3GFPA 2NIPA 5FUWA 4DCVA 2JCSA 1KO5A 4DT1A 2H7VA 2CEAA 1SGWA 2R6FA 5FI0B 3TNFA 2O8BA 2YC4C 1O3YA 1R0YA 1UJ2A 5B58C 4EUNA 5K8UA 2NO1A 1TU3A 4TMVA 2V55B 3SYKA 2JJ2D 1DG1G 5HKKD 3QVUA 3FYHA 5DHAA 1NF3A 4M1WA 5G53C 2GCNA 3K09A 4C0SA 1AQUA 2AN9A 4IEIA 1YZGA 4TN1A 2IX3A 1E1QA 4LHYA 1GITA 1AZTA 1HH4A 1XTQA 4B76A 2QPOA 4YMUA 3U4QB 1GL6A 3SFVA 4NCIA 1VG0B 3TVDA 5JECA 2QI9C 5FPTA 1IAQA 1N6NA 1R0XA 4US1R 2D2FA 3LXRA 3WBKA 4CYMA 4EQ6A 3QG1A 2UZIR 1MR3F 3I73A 3LLUA 1OIXA 3X1DA 3B13B 2Q9CA 2E87A 3A37A 4EJSB 1E94E 5F98A 1KI1A 1AKEA 2PJRA 2F1IA 3SQXA 3TE6A 4OI2A 4JVMA 1PZNA 2GCPA 3VX4A 1CR1A 1VDZA 2QAGA 2QMUA 3FMOB 3D31A 1G4UR 2D7DA 3PG5A 2PT7A 2VP2A 1E4VA 5FTJA 4IFEA 2D74A 1TPZA 2NOAA 1Z0FA 3F3YA 2O52A 3TH5A 4HZUA 3QPUA 3A4LA 1MO3A 3RABA 5C4GB 4B44A 2E1RA 2IS2A 3OZXA 4JLKA 5E7JA 2J1LA 2GJ8A 4V0NA 4NONA 3SN6A 4OQFA 1OXSC 2QPTA 4WOPA 3IIJA 4GBMA 4RFVA 4G5RA 1FW6A 3SI7A 2FG5A 2JIZD 4BRWA 1GOTA 5J4YA 1NLZA 1LF5A 3WXMA 1Q22A 1IONA 2QROA 4XVRA 1DAFA 3ZIAA 2IS1A 2ATXA 1KK0A 5J4LA 2WIAA 3MMPA 2WPDA 1L2TA 1EFCA 4FD2A 5CITA 2F6RA 2FFAA 2A9KA 2ZRMA 2O8DB 2ZYVX 2JATA 5E95A 3CZPA 2C04A 1ZP6A 4DXAA 3B6EA 4Q4HA 1U94A 2EFHB 2OCPA 2FWRA 3KZ1E 3NKVA 5GVRA 1XNJA 4HI0E 3Q5EA 1CU1A 3A4MA 3CLVA 2RB4A 3IO3A 3WMFA 3ZVMA 3E2IA 4C0AC 2KBEA 3BC1A 1NG9A 1N6LA 4TLCA 2R6AA 5B2ZA 2PT5A 4M2LA 3KJEA 3LVQE 3ND9A 1U90A 2NPFA 2JLQA 1H8HD 2ZEJA 3ZQJA 4MRPA 2V1XA 2ZRJA 1TF2A 1Q44A 3QXHA 2MSCB 1G17A 1GL9B 4NDZA 1Q12A 3E5HA 4GOKA 1SVLA 3IHLA 5DN6A 2V4ZA 2B8WA 2GCOA 1MABB 1E2DA 1JAHA 1EG7A 5DO9A 3RS5A 3QSYA 3NBXX 1ETUA 3LFUA 3CM0A 2EFCB 3N5CA 2HF9A 4HUQB 1E2NA 1KO7A 4MRNA 4HB3A 4XTRA 2EWWA 4Q7MB 3UWOA 2RMKA 1T3SA 3TSZA 2W0MA 1G41A 3U5ZB 3T34A 1AA3A 5DISB 4FMBB 2G0TA 4MRVA 5D3MB 1WXQA 5HZKA 1NSTA 2I1VB 4B3GA 1F60A 1US8A 3PUWA 3AP1A 1LTQA 4CEJB 2G3YA 3IIMA 1VTKA 4B75A 2C9CA 3K0AB 2XNSA 4UNQA 4PC1A 3O8BA 3OFNA 2ZRKA 4P4TA 2FMXA 1ZM2A 2C96A 4AG6A 3SEAA 3EZ9A 2HLDD 2W58A 3FFBA 4UXIA 3JZAA 2WM9B 3MJHA 4JLAA 3CPJB 3KTAA 3CR7A 4I1VA 4CF7A 5GJVC 2QU8A 4LC1A 3A1UA 2ORWA 2XB4A 3CBQA 3QOFA 4G5GA 4DDUA 5C2JB 2Q3HA 4TQUS 4OHZA 4DSNA 4MQBA 4DLTA 1T91A 2WWYA 3HU2A 3FKSA 4KODA 1SVSA 4ZDJA 4KBFA 3K9NA 5J4VA 2VSOA 3NWJA 1FTNA 2OHFA 2IHYA 5IF9A 4QBGB 2ZJ5A 4M53A 3THWB 2IYLD 2A2ZA 1W48A 2BBSA 1FQKA 1XTKA 1T8TA 2A5YB 2C9OA 3PIRA 1G16A 3QKRB 1S96A 4TMKA 4ASUD 2VSFA 4M1OA 1OIWA 1P5ZB 5KHOC 2Z83A 1Z07A 2BV3A 2QTVB 4HB0A 5H70A 1JR6A 1IN5A 4URZR 2QGNA 1AM4D 2MSDB 4QM7A 1R8SA 2ZI5A 4Z1MA 4IVPA 4H1UA 3SHFA 4MKFA 2ZRFA 3Q7PA 2BM1A 2OXRA 3AVYA 2B7BA 4BLPA 1DVRA 2WTUA 4D80A 5K8TA 3SS8A 3EX7C 1NBME 1ESMA 4HDQB 4U02A 2ZVQX 2PCLA 1Q1EA 1SVKA 1XWIA 4YDSA 1FL9A 4UNSA 4ILEA 3TUJC 3HYRA 4BUJA 3ONWA 1BOFA 4ZDWA 5JRZA 1Z6GA 4OK6A 3OE7D 1XF9A 3TKLA 3GQBA 2CCJA 4PC3A 2AHOA 3EWSA 3AF2A 2J41A 2VYFA 1Y63A 2FF7A 3H86A 2NO7A 1COWA 3ICQB 1LY1A 2D62A 4DRZA 1X8LA 3MWLA 1P2SA 1Z2CA 3QEJA 2X2FA 4NP6A 4QM6A 4KI0A 2GEDA 2FPKA 3QENA 1NMYA 5FL3A 1A7JA 1SVMA 2BMJA 1JEDA 3QF4A 3X1WA 2XITA 1Z2AA 1DBSA 2VBCA 4Q1BA 4YXWA 3A58B 2IYXA 3AM1A 1TEVA 1E2MA 3I8SA 4X8OA 1CRPA 1JBKA 2CVFA 3Q72A 4OI0A 2QORA 1L4UA 4A0GA 2QP9X 4AY2A 3K09C 5E4FA 2GETA 1NN0A 1WF3A 2EFGA 4A9AA 3I61A 4A2PA 3LDAA 5FI1B 4IFBA 4CGZA 3GLFA 2JJ1D 5GJBA 3KB2A 2IUSA 4AWXA 1N6PA 3OEHD 1JXOA 1X6VA 2DFNA 4KVGA 2AFIE 2FSFA 4MGYR 3IGFA 3EPKA 2WWWA 1YKSA 2ZUCA 3KKPA 4KITB 4BE7B 1KI7A 4P31A 4M9QA 1M1YE 5ANRB 1OH6A 3GLIB 2XXAA 4TL9A 1HY3A 4KHZA 4KSCA 1GP2A 2ZIAA 4M4SA 2X8AA 1T0HB 4TSFA 1UFQA 1IQPA 3KKQA 4JLJA 3TQFA 4JT2A 1F2UA 1GRQA 1L8QA 2PJZA 3U6BA 2IA5A 3RRYA 4L9SA 1EWQA 1TQ2A 4BPBA 1DAIA 2QNRA 1D8TA 4H1VA 4HAWA 3U3RA 1E79D 2MSEB 4R98A 3GFOA 3O8RA 5FOVA 2P5SA 4IRUB 5CK4A 1J8MF 1LNZA 2OFXA 1QHGA 2YOFA 1EX6A 1YZKA 2WJVA 1P6XA 3CX7A 3BS4A 4AKEA 4NE2A 2IT1A 1NLYA 4D25A 1WCV1 2PZGA 1U98A 4URVR 3LW7A 3KL4A 4OQXA 2WOOA 1RRFA 1M7BA 4ZKDA 2GF0A 4EIWA 1UF9A 1EFRD 3IO5A 5M04A 5KPDA 3QJYA 1I4LD 1G8PA 4B33A 1U0HC 2C03A 1G5RA 2V6JA 3NEYA 4NYJR 3T1VA 4LOAA 4BLTA 4Q1AA 1KY2A 1JQLB 1II0A 2GBLA 4ZO4A 2PX0A 1WBDA 3G82C 1PVOA 4FMDF 1NIPA 3RAPR 2GTPA 5K8IA 4JLVA 2D06A 1FX0B 2V9PA 3DZ8A 2CBZA 4KV9A 4LPSA 2A5JA 1XDBA 4V0KA 2GJSA 4DDVA 3X1YA 3CRW1 4L4UA 5EXSA 3BRWD 3K9LA 2GXUA 3PENA 4DUGA 1G20E 3SYLA 2KWIA 2CJWB 3F0TA 4ZIRA 2FNAA 3DMNA 1ZD9A 1IY0A 1ANKA 3PFIA 5JI3E 4PQFA 4LJ7A 4JL5A 4XH9B 3ADBA 2R6DA 4OYHA 1KO8A 3NG1A 1T9HA 4Q1CA 4A2QA 5AUQA 4LBYA 1OPXA 2CLDX 3NIBA 3EIHA 3VX3A 4XOIA 4JBXA 2ZJ2A 3FGNA 1UBFA 2C8VA 4PHTA 3SR0A 1JR3A 5FBWB 2FZ4A 4Q4JB 3P26A 5JEEA 4MYUA 3NHBA 2YKGA 2R8RA 1PLKA 3S1AB 1E2HA 3VQTA 4LZZA 1N0WA 2REBA 3MWKA 4Q7JB 4HAVA 4OHXA 4GT1A 3W6OA 3C16C 1S4QA 4F4IA 1XTIA 4B3FX 2WWGA 4PSVA 1H8ED 4KCGA 2ZI7A 4QG7A 2D4HA 1CR4A 5JJKA 1P75A 1BIFA 1OT3A 1JQJC 1E2JA 1HE8B 3B85A 1UKYA 1YZQA 2GVDC 3GEEA 4OQNA 2BCJQ 4UQOA 4XTCS 2CVHA 3O8CA 1AN0A 5EP4A 1G3MA 4DHEA 1UADA 4LI0A 1U99A 2FE4A 1WBBA 5F3WB 3P4YA 2AWNA 4GDFA 4DEXA 4JVNA 4QBFA 5IRCD 3ZS9A 1QHSA 4JJZA 4KLZA 4HAXA 4KXFB 1E9RA 1EFHA 3C8UA 1RJ9A 2GK7A 3CX8A 1CJMA 3SOPA 4DCTA 1VKJA 1TEXA 3GJXC 1Z5ZA 1RYFA 1KSGA 3W6NA 4JJKA 4XSHA 1W36D 4CEHB 3LD9A 2RGGA 4K8OA 4PAOA 1JPNA 3EZFA 1Z83A 4QGAA 3VR3A 4A1FA 5KO2A 5TY0A 1CULC 2X19A 2ZE8A 4RD3A 3U7EB 1OV4A 4NU0A 3QI2A 1B0UA 2B8TA 4TT3A 4F93B 4PO1A 2O8FA 3GEIA 4FCVA 1B23P 5FBLB 4PXAA 2PLRA 4Q1FA 4U7DA 4XIGS 2WSSD 4LWZA 2BBWA 2NO6A 3FVQA 1ZUNB 1G7RA 3JVUA 3VR6A 5L3SB 1Z28A 3RC8A 1Q20A 1SHZA 3DMDA 3E70C 1ESNA 1GKIA 4LX0A 3C15C 4XVUA 1E3MA 3SFZA 1KI9A 2W6IA 1QBKC 2VEDA 2BCGY 2BEJA 4RD2A 1DPFA 2E9SA 1OYYA 2JLSA 2JAQA 3AGPA 3D7MA 3QKSB 2OILA 5FL7D 4DVGA 3IPXA 4LGMA 5BWMA 1SXJA 5EJEA 1FUUA 2CK3D 3KFXA 1Z0AA 4JSYA 4Q02A 1XEXA 1Z3IX 1Z29A 2IUUA 4ABYA 3KJGA 1R4AA 5F9FA 3M0EA 2FU5C 2XJ9A 1AZSC 3AVVA 3L43A 2F1JA 4C0BA 5DNYB 4A8JA 3NDPA 2VLIA 4O2RA 4KBGA 5JWOA 1TAGA 1P2TA 1W47A 1GVNB 5BQ5A 4PC6A 4C30A 1UPTA 2H16A 4RZUA 1GM5A 3GLFE 1NMXA 2PZEA 5LPNA 5EP2A 3BIFA 2DB3A 2LWIA 1G8HA 4XJXA 4NHOA 3LVRE 1AKYA 1IBRA 3B1VA 2P3SA 2OUKA 2RGNA 3IQWA 1SKQA 3QBTA 2ZYTX 3AKYA 1UM8A 3SYNA 2ANBA 3W8RA 5JWRA 4EPTA 2BBTA 1G8GA 3R9XA 5DI3A 4YMWA 4BFXA 3ZZ0A 1UDWA 3IBGA 3PV0A 2YC2C 2OLKA 4LHWA 2KJQA 1ZMXA 3BXZA 5JRJA 1FQJA 3KJIA 5J4HA 3RWOA 4W9MC 4JLBA 4E03A 4TMXA 1OXTA 3BJIC 3TSWA 4E22A 2PBRA 4RY2A 3FE2A 2BM0A 2QQ0A 2OSBA 4QGFA 2BOVA 3L82B 5BN5A 1D2NA 3IKJA 2IXEA 1FNMA 2F7SA 2YOHA 1XCPA 2DYKA 3FFAA 5DGXA 5E7MA 5HPYB 4RD6A 5L8VA 1M2OB 3ZD7A 1V43A 1DO2A 3KXIA 2ZTSA 3U61B 3P1JA 1JB1A 1X3SA 8OHMA 2ZUBA 3CWZA 1OW3B 1AGRA 4NCHA 3NBZC 2WWXA 2NGRA 4BFYA 1N25A 1TADA 3TUZC 2QZ4A 4OHYA 1OFIA 4HYYA 4N1AA 4TMWA 4POAA 2ZPTX 3AP3A 5KOYA 1R2QA 4G5OA 1CBUA 3DZDA 2PL3A 1KDTA 1AK2A 1KJZA 4WVFA 2QENA 1W36B 4WXRA 5FPSA 3C5HA 2KE5A 1P2UA 4PHHA 3B1XA 2XX3A 5HE9A 4IDQA 3CWQA 2GBLC 2IYSA 2B21A 2FGKA 1SQ5A 5BW8A 3AVXA 1YR9A 2FSIA 4PQYA 1YR8A 4ZCLA 5LD2B 2P0EA 3HP1A 5JS7A 3RS7A 2D2EA 4Y0VA 1MKYA 4S2EA 5JSZB 1G21E 3KDSE 4LBWA 3K70B 2TMKA 2H8KA 3EA5A 4WA7A 3FB4A 3A1WA 3TSOA 2BMFA 1DEKA 4R9UC 3FHCB 2FGJA 2A78A 1JR3E 2ZRDA 3FDIA 1RRCA 1YE8A 4ZDKA 4K46A 2ZR0A 1VCIA 2C99A 4BLOA 1R5BA 3OIVA 2WOJA 4JYCA 4QBIA 2ZRHA 2FEMA 3VU9A 3AF0A 2QBYB 5AUNB 2ZYUX 3QE0A 4DJTA 1NI3A 1A2BA 5IK2A 1W0JA 2ZJOA 2ZJAA 3N2IA 4RZ3A 3PCRB 4WZAE 2WJIA 5P21A 2PH1A 4C3ZA 1OFHA 2J3EA 3DKPA 4B6EA 2ONKA 3U4QA 2CHQA 2J0QA 1G7SA 3BERA 3QVVA 2EQBA 4R2HA 4Q00A 2F43B 2V3CC 4PSKA 3SHWA 2PEZA 4P33A 3WYFA 1LS1A 1ZU5A 4EJSA 4LJ6A 1YHNA 5EE5B 2XZOA 2G6BA 2HEIA 1IN8A 1G3IA 1GZSA 1SKYB 4DIDA 3FMIA 5EE1A 1G7TA 2WAXA 3KFVA 3VMFA 1CXZA 2F55A 2XSZA 2IYUA 4N3NA 2VHCA 3A1TA 2W00A 2OT3B 2W83A 3AKEA 2ZITA 3OF5A 3F8TA 4HDOB 3RS2A 3AGQA 3ZIAD 1FNNA 4OHVA 2WPDD 4MKIA 1OH5A 1OXXK 1N2CE 4RJLA 4I4LA 5AJVB 5EXPA 4PPFA 2Q9BA 1X8KA 1Q1QA 1DAKA 3BFVA 2C2HA 5KSYA 4Q03A 4QRHA 1NMZA 3LAWA 4GPTA 4TL6A 4YONB 4RCZA 2R2AA 1W2HA 1JI0A 3ZYCA 1E96A 1YQTA 5FFMA 2RHDA 2O8DA 2DWPA 1W44A 2W6JA 4V03A 2EWVA 2UKDA 4MYTA 3B2EA 3FHTA 4DLZA 1ZD1A 1P9NA 5LDDC 1XCGB 1II8B 4WZ6A 2QPAA 4OK3A 4QBHA 4L15A 4RCYA 1RE0A 1II9A 3W6PA 4F4JA 1IY2A 2VRWA 2R44A 2ZS8A 1VHLA 1Q0UA 2FZLA 2IYRA 4LYJA 1NG1A 1SXJE 1ZM3A 1KTVA 1NVVQ 4C0QC 1E9SA 1M34E 5DN6D 3DM9B 3I5XA 3BFXA 2RAPA 4GSYA 3JZMA 4XD7A 1HQCA 1KK1A 4NYIQ 1SVIA 1BH2A 2NPIA 4V0MA 1OKKA 1S1CA 1T5LA 3RRNA 3ADCA 2AWOA 2ERXA 3LQQA 5KUTA 1SXJC 4Q01A 5AK0A 1WB9A 1E99A 1QHYA 3PUXA 3IIKA 2ZS9A 4IJMA 1IN6A 5B57C 4LUCA 4AURA 5DE3A 4XWOA 1QZXA 4HUQA 1VYTA 4HLUC 3B7GA 4M1SA 1BS1A 4FINA 4KU4A 4A8JC 1KAGA 1NVXQ 2WSMA 4BZPA 3AVUA 1VCMA 3ZGXA 2Z4RA 4NCNA 3J81k 4U5XA 1TUEA 4HSEA 3OIUA 1UBEA 5AJZA 2QGZA 3BH0A 3OFND 2OG2A 5D3MA 4Q9HA 1Z06A 1IXSB 4Q19A 4GP7A 4CEJA 3EZ2A 2ZI4A 2CLSA 3LRPA 4CT4B 3K0AA 3ZS8A 1TL7C 1TF7A 5HKKA 3LY5A 4E5UA 2RGNC 5FPKA 3MLEA 1EWRA 4IDHA 1M7GA 4NYMQ 4OBEA 1EK0A 4WZBE 3RWMB 2QA5A 4FMCB 1T3LA 1XXHB 2DFTA 4PANA 1TQ4A 3PUYA 2JLRA 2X1VA 2YVUA 5HE8A 5CJPA 5HTKA 1NN1A 4GMDA 5SZKB 4D4KA 3IEVA 3VKGA 4A0RA 1KSFX 2AR7A 2REOA 1WDTA 2QAGB 1U0JA 4URXR 3OAAA 1G18A 3TJZA 5JCPA 4QGHA 1GDDA 3KKNA 3NC1C 1AA9A 4LV8B 5KNDA 1CJKC 1CJTC 1VG8A 3CRRA 4FCTA 1ZM4A 3THWA 1F48A 2GVZC 2NO9A 3TAHA 4Z1MD 3QKRA 5BN4A 3A8TA 1ZRHA 4AKGA 1E0JA 1A5TA 2GAOA 2ZE7A 4A6PA 1IN7A 2HCBA 1UKVY 4LBZA 4N0EA 2IYQA 4PFSA 5JFGA 3H2YA 4OK5A 1MO4A 4GZMA 3P20A 1KYIA 2G1JA 1WE2A 1M74A 3CNNA 1Z0KA 4M1KA 4DLSA 4OI4A 3WNCA 2WKQA 1KJWA 2GAAA 1XD2B 5ELXA 1A82A 4Q4AA 2QMOA 1RRPA 3CX6A 1HQYE 4TYYA 1E2EA 4QJ4A 1XZPA 1I4TD 1AIPA 4OI1A 1F3OA 3GMTA 1MRNA 1ZC3A 1E2GA 2VHJA 3AP2A 2V8OA 3GJ3A 3SDZA 1GAJA 1E9CA 3QUSA 3CIOA 2VPPA 2ASEA 2DR3A 3HR7A 2ZRCA 2JA1A 4P4SB 1COWD 1QHNA 4DLUA 4LJ8A 3CPEA 1G6OA 2XTZA 4PSAA 3L8YA 2WBLC 3ADKA 1E1RA 2ZREA 1ZU4A 4ACBA 1G8YA 1XB2A 2FSGA 4OQLA 5KDOA 5KYKA 2CCGA 2HUPA 4MA4A 2ZU0C 5C18A 3AVWA 5KSOA 1XCMA 1UEIA 3B1ZA 4YXWD 2V6IA 2GCOB 3SJCA 1Z0DA 3PUVA 1PLJA 1KGDA 1U0LA 2FJUA 1SHKA 3WY9A 4ESHA 3SBEA 5FPHA 3CRMA 1UEJA 2AL7A 3NEJA 4Q7KA 5KU1A 1UKEA 1KNQA 2ZXUA 5HCIA 3GJ7A 4Q48A 2H17A 5FBQB 3I32A 1G9XA 2BIFA 3P4XA 4D81A 3UIEA 1QHHB 1SZPA 2GKSA 4HAUA 3REGA 3ZH9B 3GLGB 2BKUA 3ASYA 1XMIA 1GSIA 2I4IA 2VA8A 2F9LA 4GP6A 1GNQA 1OFUX 4KFSA 2DFLA 2IUTA 4B71A 1XD8A 3PEUA 4IOJA 4PC7A 2GJAA 4TSFD 4ZI2A 4JVLA 2QMEA 1YRBA 2IYWA 3N70A 5JCZA 4MUAA 3W5IA 1CJVC 4RZXA 1E0AA 3GLIA 3WP0A 5SZHB 3TAUA 4EJSC 3AH8A 1KMHB 3GCGA 2VQSA 2ZSAA 3A4NA 3CUEF 2HLDA 2IF2A 1XP8A 1GIAA 5GVSA 1N0VC 2OAP1 3AF4A 3BOSA 1UDXA 2R6CA 3UG7A 3MFYA 4TTPA 5DYGA 3UK6A 4LC0A 3DKVA 3C7KA 3X1ZA 1VIYA 1O87A 2ZROA 1L4YA 3I4LA 4O0MA 4IOMA 5E7IA 1KAOA 1W5SA 2CDNA 1AS2A 1EX7A 3C4JA 4QJ3A 2HJVA 2OBMA 1ZW6A 1G3QA 2MMGA 2GF9A 5FOSA 2Q21A 1D2MA 1E9EA 1U9IA 2QP3A 3O47A 1ZINA 2OCAA 4TLDA 3FHOA 4UNPA 1WA5A 2GHIA 1JALA 5TV2A 3Q3JB 5FUXA 3HR8A 2P5TB 2XOKA 4X8MA 5EUMA 2FA9A 4JIMA 1Q57A 1AS0A 2QTFA 1N5IA 5KNBA 4WIAA 3SC3A 2I3BA 2IXGA 1CKEA 4TZ0A 5CM8B 1N5JA 3AF1A 4HLDA 2PX3A 4DUGD 2CMKA 5G3ZA 2EYQA 1E0SA 4IXNA 3NTUA 3VR4A 4M1MA 1BYUA 2GRJA 3HU3A 1FX0A 4BZXA 4JBYA 3B82A 2IEYA 3U3JA 4V0ME 3Q9LA 4TTQA 2AD5A 2CJWA 1N0UA 4NZYA 3QPWA 3TR5A 3MRSA 2JJ8A 1X1RA 2IL1A 1A2KC 2FN4A 4JYBA 1W4BA 2YJTD 2ZU6A 3QPVA 4P3YA 3PVSA 4ZKEA 5L3VA 1S2MA 3VFDA 3OE7A 1QHIA 4GRAA 3LH5A 1L7VC 3M1IA 4MUBA 1KIMA 4D26A 4UJ3A 5J40A 3CNLA 3UANA 4US0R 3T12A 2G0NA 1VG1A 1XU4A 2QL6A 1XMJA 4DLYA 4Q9LA 2QM7A 4YMSA 4HAYA 5IT5A 5EUQB 4V02A 1P3JA 3WNBA 1W0KD 4LV6A 1KHTA 1YRAA 4Q4JA 4RFSB 3Q5DA 1EESA 3UMRA 2WJYA 5IHPA 4BGDA 2ZSBA 3V4RA 2IYVA 1KI3A 2OFOA 1QVRA 4C4PA 3S1AA 2Z5FA 1ZNYA 3QF7A 2YWEA 2Z6VA 5FR1A 2WMOB 3N2EA 4OL0A 4DSUA 4JSTA 4BLQA 2V7QA 3B1WA 3SE0A 4G1UC 3AVTA 3CZQA 1J7KA 1P62B 1R5OA 1G4AE 4BLSA 1RYHA 2H92A 4TYNA 3DL0A 2JLUA 4J0QA 2CHGA 3K0FB 2RCNA 3UG6A 3U7GA 1PUIA 3CKLA 5AR1A 1NKSA 2VO1A 4URUR 2B6HA 1Z0IA 5TDHA 2ZJ8A 3VKWA 2RGEA 3VR2A 4E07A 1CF4A 4CEIA 4C7OA 2J59A 1JAIA 2XZLA 2YV5A 2VTKA 2PZFA 4BFSA 1YU9A 1T3HA 1GNRA 4LJ4A 4B3DA 2CL0X 4CVNA 3L0OA 4ON9A 3NBYC 1TU4A 1ZM7A 4X8LA 1HUQA 2O8EA 2GEVA 3VKHA 4AYTA 3ZJYA 1ODFA 4JLNA 1BMFA 4TT3D 2ZRNA 3GLHB 1QF9A 4G0NA 1DO0A 5G40A 2ODWA 5L3QB 4CEHA 1WP9A 3R8CA 2VIIA 1IN4A 1TTTA 2REXB 3LBHA 3ZLJA 1Z6AA 1D5CA 2ZR7A 1GRNA 2OZEA 1KI8A 3UMSA 4EDHA 1U2RA 3T5DA 5CYPA 3ETLA 1CTQA 5CIQA 2O8CB 3RRZA 3SBDA 2C5LA 2H1LA 4GNKA 2YWHA 3D6TB 1NVWQ 3H84A 3R7WB 4KJZA 1AS3A 2IS4A 1RFLA 4PR0A 2QE7A 3BH7A 2XNDA 4IW3B 4RD1A 4QHSA 4W5HA 5JJIA 4O25A 3W3AA 3OHMA 1YZUA 1SXJD 4MH0R 4DDTA 3LX8A 3QNUA 4UKDA 2RKOA 4NL4H 2ORIA 1T8UA 3I72A 3ASZA 3EW9A 2JEOA 1NRJB 2OE2A 2DBYA 3QKSA 4QNMA 5H8WA 1XTSA 2DY1A 5EXTA 3U6KA 1JPJA 4BFTA 3OIYA 2IYZA 4MKHA 4XWAA 4QGGA 2B7CA 3L0PA 1HURA 1KKLA 3CONA 2YYZA 3I8XA 2BDTA 1OB2A 1LFDB 1OSNA 1ZBDA 1FP6A 1WQ1R 1N6OA 1VCNA 5E3HA 4Q1EA 4PZYA 4US2R 4Q7LA 1F6BA 2J0VA 1DE0A 2HCJB 2L0XA 3G5UA 3KJHA 4IVQA 4DKXA 1MV5A 4P0TA 4OHWA 4OJKA 2QQEA 4A0FA 1E0KA 1OHHA 5JBQA 3I62A 2A5GA 1Y3AA 5GADl 4R71A 2H5EA 3ZD6A 1E2PA 4OJQA 4Q9JA 3GLIE 1P9WA 1KI6B 2ZJBA 3MWJA 4HUTA 4OKSA 1E32A 4G3XA 2GXSA 3AUXA 3THXB 4ZCMA 1CJUC 2H57A 1MOZA 2GESA 2F3TA 3V9PA 1OE0A 3K1JA 3GP8A 1T5IA 2FOLA 2FFBA 4UXHA 1GILA 4HLUA 1D6JA 1G3RA 4M9ZA 3CRVA 5B30A 4P32A 2R65A 1J90A 2R9VA 2YOGA 1XEWY 3T61A 4DCSA 2C9YA 2YHSA 1XFAA 3PJRA 4BFVA 3EA0A 1RJ9B 2ZJZA 1NLFA 1G5TA 1TQ6A 3HU1A 4GOXA 4A4DA 4DCNA 1ZNXA 1AGPA 1U8ZA 1CR0A 1NY5A 2CHVA 5JI2E 3B5JA 4QXAA 3THYB 4TLBA 2XB2A 4PO9A 3M4YA 2ZI6A 1NVUQ 1U9IC 3I5YA 4M9SA 3R8FA 1HTWA 3TRFA 4JLPA 4MYCA 1G5PA 2WKPA 1CS4C 2F9MA 3CH5A 3QY0A 3RYTC 3EPHA 3QBVA 3IILA 5D3QA 2ZS7A 4PAQA 4GI7A 2ZSDA 1VIAA 1IJEA 1EXMA 3VNUA 2OCBA 2YINC 3Q8XB 4PTLA 2BVNA 4PO8A 3DOFA 1LVGA 3BBPA 1HT1E 4BQSA 5BN3A 1P7CA 2Q3MA 1YJ5A 2WICA 3QXCA 3ZVLA 4AYWA 4LBVA 2VP9A 1WMSA 2JGNA 2B92A 1D9XA 4D6PA 1JEEA 3PR1A 4CIDA 1W2GA 3TK1A 3ZZUA 3GFTA 4CDGA 4BASA 2N46A 5FTMA 3MWYW 4O3MA 3FWYA 3V00A 2Q3FA 4AI6A 5DH9A 2OXCA 2VP0A 5FUVA 5JSZA 1GUAA 1KO4A 4IDNA 4LRWA 3KQKA 3HWSA 1XEXB 3I3SR 1KJYA 2BJVA 4FI3C 4B34A 1XEFA 4CZ2A 1N6RA 1D2EA 2OAQ1 2N1BA 1YZNA 1W0JD 1ZCBA 3KKMA 5IK2D 2IS6A 3W34A 2ZI3A 3ZVNA 2MMCA 1I4DD 4Z54A 4ARZB 2ZM5A 4Q9IA 5KDDA 2WWHA 2LCFA 2ZYWX 5BYJA 4S35A 3X2SA 2IWHA 1NJFA 2ZVPX 3VR1A 4I99A 1NBMD 2VP5A 4D82A 5JHHB 1WRBA 2QG6A 4C0LA 2FDCA 2JLWA 2EFEB 1LF0A 3UATA 1VPLA 3BK7A 2ZAMA 2HDNB 1UBGA 2O5VA 3IEUA 4MRRA 2Z0MA 4DLXA 4GOJA 3U44B 1GRRA 2F43A 2FH5B 2J7KA 2VH5R 2Z4SA 3A1VA 3A1SA 4KVAA 4LJAA 4TMTA 1EFTA 4NCJA 3U60B 1SVWA 3BB4A 5TARA 4HLCA 2FEOA 1OJLA 3U2QA 1AJEA 2XSZD 1TUIA 1I2MA 1CR2A 2HYIC 4ZDIA 4F7WA 3OEEA 4B32A 3RS3A 2CNWA 2Y8EA 3MSXA 2O0KA 4LSGA 1Q3HA 1C9KA 3WMGA 1P72A 1E1QD 2CL7X 2YWGA 2WJHA 2XTMA 2ZE5A 1QG4A 3BB1A 5DI9A 1T6NA 3U7FB 5EP1A 4M0LA 3AQ4A 2AKYA 2BHRA 1DARA 4EAQA 1TX4B 3QG5A 1KSHA 2PMKA 2I1QA 4EKDA 3U3OA 5GJCA 4A82A 4WW0A 1R8QA 1UKZA 3KX2A 4IDOA 4B2IA 4O2LA 4QHTA 1N6IA 3AF3A 2NTYC 3AKCA 2V1UA 3LXXA 4G01B 1ZNWA 3EZ6A 1KDOA 3VTKA 5JLJA 4XD7D 3CRQA 4JKYA 1E9FA 3EZ7A 2YZ2A 3B1YA 1W7AA 2ORVA 4BECA 1BYIA 1OKKD 1KZ7B 1E9DA 2QUZA 1F2TB 3QXXA 4A0HA 3R9IA 1P73A 1KDPA 2NZJA 4WAUA 3UWKA 521PA 1R5NA 2XZPA 2OBNA
chains in the Genus database with same CATH superfamily
2VF8A 2RKWA 3MJTA 5GP1A 4RACA 2NU9B 1I7PA 2BF4A 2W43A 3BWCA 4FJ2A 3V48A 1CJBA 1JHOA 1XRQA 4FMPA 3V1TC 3ZV5A 2G1KA 4NAHA 2AZ4A 2O2GA 2WUFA 4LDAA 5JISA 4FBMA 2F4VB 1JR4A 5AVJA 4B3IA 5HQ3B 4TLEA 4R51A 4UU0A 1S01A 5LLTA 2FEPA 3PC6A 4MPDA 4UD2A 5LZ2A 4NE7A 1F9AA 1CB7A 3A36A 2J0SA 1I2CA 3FSEA 1HETA 4LZOA 3QKTA 1MP0A 3LRTA 1LD3A 1KE1A 4EG3A 4PX9A 2DY0A 2X7JA 3ERCA 2Y1OA 5A4KA 3ANYB 1OH8A 3TQQA 1ZCAA 2UUCB 1BDJA 2YIDA 2MWMA 2HWXA 3FZQA 1CIPA 4MJXA 4DZZA 3OOSA 3CS3A 2BYTA 4TV9B 5HF9A 3W06A 4DWWA 4JI2B 3EXFB 2VK1A 4H6VA 4C0XA 1G2QA 2ILTA 1XPOA 5G1NA 2MSKA 1ZVQA 4XDZA 2IF0A 5HFAA 1U02A 4J0HA 5B37A 4EYSA 5KVCA 1LDYA 1W4AA 3EODA 1XNRB 1UPCA 4QYIA 4IF6A 1Y4AE 3K5IA 3DMYA 5EJGA 1WKBA 4HRXA 4KYTA 4O2AB 3WHLA 1IATA 3QMVA 3RI3A 1MRSA 2VAPA 1A7AA 1TVMA 2C4NA 1Q7BA 3AB3A 2HF8A 2Y99A 1M0SA 3GZTB 1P2DA 3L0IB 3LV8A 4PCVA 4PQRA 1YJCA 4QYMA 1XE3A 1V8FA 2CDCA 1R12A 4GH5A 1N2GA 2PLFA 2R3SA 4OKIA 4R8KA 4R2IA 4RXTA 2ZETA 3HFSA 1BXRA 4GVLA 4IBOA 4DT1B 3DEJA 2CZGA 3KQMA 5AKKA 3ND8A 1C9YA 2XHEA 3KCNA 3QFRA 4INZA 3CNBA 1M8KA 1V5WA 2HHHB 1RCUA 2Q5FA 4BGEA 2LGJA 1EXWA 3O3CA 3W7VA 4EVQA 1RKUA 1FXWA 3SQWA 3QWFA 1P61B 4LJ9A 1KXZA 4HDAA 2ZSFA 2LDYA 3L9XA 1PZXA 3W5JA 1T1SA 1HT3A 4C2BA 4QLAA 1K86A 3AY0A 4YP6A 5JY6A 1VP3A 1DC7A 4MW6A 3EFOA 2NUTA 4UHBA 4ARBA 1ZH6A 1WSBA 2D2XA 2VA9A 3BA1A 4ACAA 4EF6A 4I81A 2Q3CA 2VAVA 1WW2A 1BWRA 2IHBA 1H42A 4GMHA 3RU7A 1I2ZA 1CJSA 1OFVA 1E2QA 1NHGA 2ERYA 2Z2ZA 3QWHA 4PS0A 4RO0A 1N92A 3R75A 2B8JA 2XVXA 4EARA 2CB0A 4PV7A 1E2FA 1IC6A 3O8DA 4GXQA 1VIMA 2YX1A 3P0HA 3QWIA 4EQ6B 1T2DA 2I2BA 1OXVA 4H27A 3GH3A 3L05A 3DAGA 4MMXB 1OLSA 3T9AA 4V1CA 5IHXA 1P4SA 5GGXA 3O92A 2BDEA 2OXFA 4MS1A 3GUCA 3SK0A 4EPWA 2AOWA 3BWMA 4OCZA 3UJCA 1Q95A 3CLRD 3ZK7A 1A4RA 3EUWA 3WIOA 1JHYA 4OIFA 1M1YB 3N2GB 1EGVB 1R0CA 2WKRA 4N3GA 2I80A 2Z43A 4YN3A 4GZ5A 1E5XA 4KYIB 4R2XA 3WK4A 4E1VA 3MN1A 4NEQA 4LE2A 2OM2A 2RHOA 4GIBA 4B6RA 2C7GA 3PA8A 1DTEA 2I4NA 1OH5A 2G5TA 3F49S 2GNOA 1P1KA 4I1SA 2QLNA 4IF4A 2J9RA 1GPMA 2G4LA 2QAJA 5EE9A 4RADA 4LY9A 3AMVA 5CVVA 2UZ4A 1XPUA 4J03A 4LZAA 4FR0A 4CCYA 1RWVA 1DELA 2F9FA 1L1QA 3H7AA 4INPA 4MB6A 4QTUB 4PZLA 4P7KA 1EDDA 1I3CA 1P6QA 2VHUA 1ECJA 1GZ6A 3D0KA 3GVPA 3JALB 3LHFA 3QXSA 4TRJA 4A6XA 4BO5A 3IUBA 2OCLA 3GPDG 3MJVA 1QV6A 4KXWA 1RNLA 3V2HA 4EJMA 2GXAA 4YS6A 2IEZA 2RHBA 3LT4A 3H1PA 5C32A 1YFZA 1ZNZA 2HNBA 1ICIA 4JUCA 1MOSA 1WPXA 1GA6A 5E4JA 1W76A 2GK3A 3G8BA 3NYIA 4RF5A 2X8LA 3CE6A 5CM9C 1SEPA 2XQJA 1PQUA 3T06B 2PUVA 5IAKA 4U00A 4UEJA 1WCIA 1VHDA 1ZMRA 4GWLA 4YRRA 5JO0A 3LSTA 4EFLA 4ZT3A 1ZJ6A 4X71A 3UVEA 2GT1A 4IGEA 1SBYA 3ZNPA 1L7EA 1TM2A 1RD4A 2ZSUA 3MRVA 3QQ5A 1LPBB 5LOVF 3S27A 1A1SA 1KJIA 5I7HA 5K03A 3A9VA 4TUYB 4WDRA 1SUBA 1Z0JA 1XKXA 4PCLA 4RNDB 3E3LA 4EB8A 3T1HB 1X1SA 4B3TB 4NPHA 4L22A 4Q1DA 4R0NA 3K71B 1TMKA 2PK3A 4Q4LA 1FUKA 1ZOOA 3G13A 3WOHA 1FTWA 1OC2A 1YFJA 2JGLA 1NW8A 2YWFA 1RHMA 3TOCA 4DAOA 5H9WA 3MBOA 3TRHA 1FSGA 2IOQA 2Z6AA 4W1PA 2X4DA 3U1BA 2PH7A 4YRAA 2XYHA 2AZTA 4F6CA 1SG0A 1LDMA 4EHIA 1E69A 4ZEOA 4DLAA 1NKTA 1ORDA 1PG0A 4JEHA 4JVSB 4KQFA 1I7LA 1HC7A 2EF0A 4I50A 4AN1A 3DYVA 3A4YA 2IBMA 3IQFA 3T9CA 3SJZA 1R4NB 5K8LA 1EVEA 4EA9A 3MC1A 5E4TA 3D6AA 1AGNA 4NBUA 1TZBA 3GN1A 2YIVX 3TPFA 3KSRA 2I6TA 3BGWA 4CCWA 5CBPB 1I6LA 1CRQA 1SHJA 2HJHA 2NUPB 2QZSA 3GJ5A 1SIUA 3KTAB 3OIWA 4DBLC 3S8EA 1UDBA 4LK2A 4YMGA 5JXJA 2GAFA 1TDJA 2Y6UA 4W6ZA 4R8MA 1DAGA 1NW4A 1ZIOA 3BZBA 3MEQA 3PI7A 1RW4A 1VFPA 3PFFA 4G5SA 4HMPA 4B79A 1XMSA 3ESYA 5T4FA 4B5KA 3AKDA 4LE0A 2HT6A 3GP3A 4MAFA 3FOZA 1QJCA 1U4OA 1VHTA 4P36A 4PLTA 4Z0HO 1SJ9A 2EFDB 2FZEA 2IC5A 1DTWA 4GF5A 5TXGA 4JLOA 3R0QA 1PHRA 3COZA 4PBSA 4BB6A 4CMJA 1J06A 4A23A 3B12A 3RYIB 3ZCQA 5FYQA 1CUBA 1N2SA 3TRDA 1S8OA 3W2EA 3H13A 5KSPA 1EHIA 3A2MA 4IGIA 4PCUA 4IS3A 2XGGA 3TUIC 4EJ0A 1HTTA 4AO7A 2HA2A 3IL2A 3HPQA 3QXJA 4Q18A 1Y8AA 4O1HA 4YJ3A 2WD7B 2J5XA 3IEXA 3OCVA 2JASA 3U0BA 2NO0A 3W1VA 3VSEA 2Q0QA 1SD5A 4MKZA 2EZ9A 1N5KA 5F2EA 5FHQA 4BVKA 2YBEA 3QW2A 3DDWA 2J3KA 2ETVA 1GHTA 3WSWA 3MAAC 1G6HA 3ZHSA 4EPXA 1R9MA 3HPRA 4ZAVA 1K27A 1EPUA 3PQCA 1M6VA 5F35A 5BRAA 2QY9A 3TINA 4CM8B 3AJDA 2ZRIA 1W30A 4GGMX 3RU2A 3TLEA 4B09A 3F7NA 2XT0A 2VPXA 3ELDA 1CS0A 2Q49A 3AVOA 3ZWAA 4S0ZA 4WY2A 3GDGA 1HL3A 2QN6A 3RSZA 4RTQA 1G3UA 2F59A 3LCVB 1RHUA 2NZYA 5JC1A 1IY1A 3GCZA 3PEWA 1M73E 4QT0A 1M2WA 4OB8A 2W2MA 3G7NA 5H7XA 3VR2D 3HI4A 3L0SA 2VHZA 5I8WA 4Q4CA 4NS4A 4P34A 3FKQA 4RC9A 5T7BA 1DIHA 3T1TA 1PUJA 4D4IA 3BAZA 3TOZA 3EAQA 4XWGA 1Z6XA 3Q7RA 2NV2B 2JRLA 4D9IA 1MRZA 5CA0B 3N87A 2WNHA 4B3BA 1PU2A 4ER6A 1ADJA 3D1VA 3M34A 4BO8A 4MYHA 5BQOA 3ZBUA 4EBFA 1O4WA 4FKBA 4JUAA 2XMDA 3F8WA 3L0CA 1HDOA 2D3WA 1T6BY 2HBRA 3KT8A 4UM9D 4E2YA 3Q8MA 1BMFD 1BVHA 2Q07A 6LDHA 3CX4A 4BNIA 5H1YA 4P82A 4FSHA 1NNI1 1KEPA 3H8VA 2HB6A 4QQRA 5JROA 3F6PA 4DLRA 3VO8A 4WL0A 1GLGA 1PJRA 1XZFA 1RAAA 3DUWA 1YB7A 5DNEA 3GLHA 3N8IA 4DSTA 1KYWA 3DEIA 4PSCA 1YRYE 4LCJA 2PUGA 3GLFB 1Z26A 2PKQO 3MZ0A 2NMVA 4JB8A 5FYDA 4JK3A 1D03A 3F7MA 4KRGA 3V4PB 3W8DA 2BL4A 3C3PA 3ZR4B 2ZJYA 4CIXA 5MFPA 3BMCB 4MW9A 3Q7TA 3MD0A 5I8ZA 2XNDD 2IQIA 2VUTA 3LQRA 4FT2A 3E35A 5ADHA 4FSXA 2HQ1A 3CLHA 2JJ1A 1YQXA 4CLRA 1O94D 4HDCA 2H18A 3BORA 5HF6A 4UD6A 3EPRA 4BMOB 3PITA 2WU4A 2PUEA 5B3KA 3QM1A 3LK7A 3EQ2A 4GPD1 5KIAA 1XALA 3ESAA 3G2QA 1BU5A 4LOHA 2V7VA 1O0SA 3FR7A 5A9RA 1BXGB 2PGXA 3TZEA 4PSDA 1U0OC 1X86B 1EFDN 1XX6A 3CF6R 3PNPA 1M76A 4XIJA 4EY4A 4YI5A 1B14A 3M8KA 5IZCA 1F2UB 1N3BA 4GFDA 4LCEA 4L2IA 1GZ5A 2Z2KA 3BE4A 2FSHA 4UHJA 4ISCA 3HB7A 4EM6A 2OLJA 3HHEA 2YCBA 4KYUA 3MT9A 5CA1B 4Z4QA 4KFTA 4KQGA 3P2IA 5AYVA 2DG2A 5YASA 1D2HA 2ZT5A 1NF8A 2IP2A 5DSXA 1VLZA 3DXZA 3OESA 3RW9A 1NNLA 2TYSB 1GPDG 2A5FA 2OV2A 3HY4A 3X0DA 2VJKA 3SU8A 4AP5A 3W5BA 1B6TA 5SZJA 1UJMA 4LXGA 1E9VA 1HQKA 4RPGA 3II6X 2NSHA 5I01A 4LJLA 2ISQA 1T8RA 2P4HX 4FHEA 4U2EA 1T26A 3G0BA 5EWMA 2QUAA 5DU2A 3RSGA 3MM4A 3CA8A 3ZXYA 1FSPA 3S0JA 1ZL0A 2W0SA 4G9BA 4RV5A 4DABA 1JPUA 2FWPA 1M7HA 3FNHA 4N7JA 2A33A 4DG8A 3HVJA 1IJKA 2AXPA 2ESRA 3DCIA 4XVQA 1G291 1RI4A 2A6PA 5D3KA 4HJRA 1M8PA 5L3SA 4B35A 4B48A 4UXJA 1DV1A 2A57A 1RBMA 4H60A 1JS1X 3KJZA 1M6YA 4G8BA 3E2MA 2HD4A 5DFAA 4E5PA 4G37A 1WZCA 5KNCA 5B3LA 1J5EB 4K5QA 2VSQA 4RM3A 4EB6A 2CYBA 2OO3A 2R87A 2TECE 4GP9A 3PVCA 1Y8CA 3EPJA 1EE1A 4FCWA 1ZKDA 6GPBA 5JNTA 1KOLA 2WD8A 1LVHA 3PTZA 4H7IA 5F78A 4WUVA 5J59A 1DBQA 3WV4A 1SHLA 2COKA 4RVCA 2EXXA 2JGAA 5LWQA 1W4RA 2MYNA 4JL6A 4OLJA 3DFFA 1FFHA 1M2VB 4QX6A 3D0RA 4B43A 2SHKA 3KSAC 2P0YA 4MVJH 2Z3WA 4DR3B 1OFUA 5EJ9A 2V59A 3E22A 2AFHE 2IHNA 1PJBA 5K0BA 2C78A 4YPVA 5LYJA 1KFCB 4CQMA 1IUNA 3PUZA 5CLQA 4L9RA 5EERA 4PYQA 4J2HA 3NORA 4L5YA 3SNHA 3HYLA 4ZVOA 3VR6H 1VBMA 1OC4A 3KP1A 4I3FA 5A6VA 2RIRA 1OBFO 1OBVA 1JLRA 3G1WA 4XKJA 4XSGA 1FSSA 3ZGLA 2F1RA 3RO7A 2P9ZA 3PEVA 4HJXA 3WLHA 3P27A 3TAXA 1E62A 3KPVA 1A5AB 3LCRA 4PICA 1YUMA 5DPMA 5IDVA 3PGVA 2JFNA 2BMVA 2NTNA 4KIWA 5T8KA 3OE1A 3V33A 1K63A 3A6FA 4BU0A 1AXEA 4OO3A 3T7DA 4C3UA 5LQRA 4GLJA 4MHTA 4H59A 1QK3A 1IQUA 1PKEA 1W9HA 4JKIA 4QUAA 2XDQA 5CFOA 5JSFA 4RVHA 3DLIA 3GGOA 5AESA 1VKHA 2XRFA 1XZQA 3I9LA 4YGYA 5DLQC 1EJ0A 1ZHHA 2Q5JA 4RDHA 1KA9H 3OVMA 4G5XA 2WIDA 3NHRA 4YLGA 1EIWA 2P9EA 4LW8A 4JASB 5DTEA 3TI7A 3K70D 2IHZA 1LB1B 1NUAA 4IL5A 4B85A 4DCCA 1UOPA 2JLYA 4Q9KA 1FVOA 3C41J 4GL2A 4BEJA 3K9HA 3U1VA 2MT9A 1A1VA 1FJGB 2P41A 3UV7A 5CFZA 2O5CA 1JHRA 1KARA 3ZJ4A 1AHPA 4MSUA 4Z7NB 1HKUA 2L42A 4RK6A 2UDPA 4PYRA 4ZCQA 2GK6A 4B8ZA 3GMIA 1E60A 4G0PA 4A2CA 1HZJA 1K68A 1XZEA 3BBLA 1Z8FA 2CUKA 3GDOA 2RAVA 3K0KA 4J3JA 3RRJA 4ETIA 1PFVA 1T2AA 1I13A 3KXKA 4PRZA 5DDIP 1PL6A 3ENNA 1N6HA 4K9MA 2R86A 3VOAA 2QX7A 3MFQA 3LBAA 4D9NA 2C2XA 1S9DA 3VSBA 1J0EA 4TX1A 4NV3A 2Q0HA 1T0PA 3CNOA 3FUXA 4MUFA 4V2IA 5IP5A 3VHXA 4DWJA 3D5EA 4X54A 3WYDA 3TECE 1ZLXA 5LQSA 1TKAA 1H6CA 2BWJA 4WFKA 4YUVA 4F96A 2XA9A 4MI6A 4W5TA 1HE1C 3DFZA 2G8LA 2Y4NA 2WRZA 2JLZA 1MDFA 2AXEA 2ZBVA 3COYA 4EWLA 4MJ3A 5IAJA 1UT8A 3FTNA 3KEQA 3CZCA 2YRFA 3L8ZA 1NSYA 4LS3A 1M83A 2HU5A 4B3HA 4P7BA 1UMCA 2YNMA 3U44A 1RJGA 3FZYA 4B3XA 5JH7A 1RU3A 4D4LA 3J7AC 2VDWA 5FV4A 4IRXA 1EYZA 2XGSA 4UBIA 4C06A 3PUKA 5L6MB 2D5CA 2IYEA 4EPRA 3U19A 4QNRA 1ZHOA 5ERXA 1SXJB 4AC9A 4AVYA 1ZRSA 1I7NA 4F38A 3NC0C 1IQ0A 1DC5A 1KYYA 3WA7A 1FYEA 4U8GA 4MX8A 4RF3A 4Q5IA 1R1DA 2BC9A 5ITSA 1USVA 4KJXA 1RWNA 1TEHA 1A9TA 3ZKWA 5TEWA 2YICA 4L4RA 2GK4A 1FTGA 1IB0A 2DKFA 4D43A 5ADVA 5A0FA 1UXKA 1ZX1A 3ZGYA 5EC8A 5BYKA 3GROA 2QBYA 1SB9A 5GAJA 5KOHA 4UEWA 4L50A 3TCKA 1DRUA 3H1GA 2QRZA 3L07A 4NH0A 4AG5A 1Q1BA 4PC2A 1AQJA 4D0NA 1O95A 4W1SA 1W5EA 4Q93A 5CH3A 5DYIA 5D1NA 4DREA 4UHEA 5AW6A 2RGBA 1TYDE 1XRMA 3CF2A 3K2BA 4DCJA 4TXHA 4KQ2A 1EK2A 5DXFA 5C7LO 3JQ8B 5TE9A 8AT1A 1N9GB 1ZM9A 2JLXA 4BX2A 2HA4A 2BBOA 3AVPA 1HDEA 3N05A 4LKRA 2CKDA 4AMBA 5AKEA 5IEJA 3HRKA 3M6IA 5DASA 4I50F 1N4AA 3NFYA 2NACA 1C50A 4LZJA 2QVXX 5AJWA 1MW8X 2J3MA 4N8EA 4QEDA 3W2GA 5HA5A 3WWYA 1EM8A 4X7BA 3IB6A 3AVQA 3MGAA 5AW2A 1SHUX 5LFAA 4J4TA 4KXLA 2O0MA 4L8GA 5ALHA 2IYPA 2GYVA 2J3HA 3GELA 2DWQA 1F5SA 4IHQA 3NBAA 2WVGA 3SLRA 1GNPA 5DCLA 1VL8A 3HSSA 3BEDA 3M2TA 1J2RA 3MCAA 3WNDA 1QORA 5IX8A 1NL3A 2RGDA 3LX4A 4KGXA 5FOXA 3WRXC 1JDPA 4U7PB 1WW8A 3H9UA 2G1UA 2GAJA 5HEKA 5BN5B 2ZRAA 4IYJA 3R7NA 1MT3A 3HKDB 1F2TA 3TZ6A 1JN0A 3VSCA 3PB3A 3O73A 2TMDA 4TXLA 3D6JA 4DV0B 5HYVA 2OORC 2V03A 4OOFA 5FPYA 5HQJA 4BQQA 1PT9A 1OB2A 1KYXA 3T0GA 2DWUA 2NU9A 4MGKR 4Q05A 4V3CA 3UXHA 4MV1A 2Q7XA 2EZTA 4M1TA 3KTOA 3ILYA 3DXYA 2PTHA 2QVZX 3PX3A 5E0KB 4MYRA 4BX3A 3BE5A 1EZZA 3WYBA 4ILKA 1THTA 4JUBA 1WABA 3PQ6A 2QV7A 4OREX 4UU7A 5K6AA 4AD8A 5HQ3A 1VYUA 5C7YA 4OD0A 5KYNA 1H65A 3UTCA 3KQNA 4H6PA 5LB4A 3UMFA 4AJOA 2JI4A 1GL3A 1PN3A 3BVPA 2QDXA 2FOXA 3H87A 5K0JA 1GZHB 1QZZA 1UOQA 2BMEA 2WWVD 3RT1A 1MEOA 3OI7A 1HYQA 4HEJA 3FOBA 1DQNA 4L5IA 4YJ3F 1MMFB 2QR2A 1P1RA 2K2WA 4YFYA 4EMSA 4Q15A 4YMTA 4M8NE 1LX7A 4LHVA 4C7VA 1G8KA 3DLTA 4KE9A 2GWHA 2K4MA 3CY6A 4B3CA 4J6EA 1DKMA 1RKBA 3EY9A 5ALYA 1NPYA 1EWVA 4TV9A 2JDID 5BVHA 2G04A 5G41A 3EXFA 4O5AA 3T35A 2Q8NA 5ILQA 4UC0A 1YCDA 2ZUDA 3JASA 3HDVA 1PFKA 2E5FA 2F1HA 5E38A 4MYSA 3KHUA 2NZUG 2CC2A 5FFFA 4CTMA 4A0QA 4KQMA 5AK4A 2WQZA 3O4HA 1TA9A 1VSBA 3I2YX 3IDQA 3FNRA 4AO6A 2BW0A 2V54A 4JT4A 2IXFA 1YB6A 3H97A 4JB0A 2XMCA 5EMMA 2V6BA 4LXIA 2Y66A 3IMCA 2CCKA 2C20A 2HWUA 1P7PA 5FUWA 1SNYA 3DV0B 2V3VA 4HDNB 4DT1A 1HQDA 1M2KA 2H7VA 2HHAA 2YFYA 3VXKA 4ZGWA 4LHSA 3PCTA 1GZVA 1CR6A 2CFRA 1O3YA 1R0YA 2XYPA 2NO1A 4ZOEA 4Z4IA 4UVGA 4XLZA 3SS7X 1TU3A 3M1AA 2GSDA 4WT7A 2JJ2D 2NO5A 4H7FA 5HKKD 1EP3B 3FYHA 3SMVA 4M1WA 5G53C 4P3NA 1BN7A 2B30A 3FRHA 4IEIA 3BXHA 2GX6A 5DHTA 4B7XA 4HXEB 4RQBA 1QCCA 4Y18A 1SBNE 1B0AA 1SVNA 5K5EA 1AZTA 1XTQA 3DYBA 3L8MA 1Q7CA 4WOBA 4YMUA 3OHPA 5JXGA 1DKLA 2VNIA 4CMIA 4ONEA 2IE0A 1VG0B 1L4MA 3TVDA 2DMRA 5FPTA 4BMYA 5CLJA 3Q6MA 3D59A 5DSTA 2D2FA 2QVYX 3RBZA 4EQ6A 1G6Q1 2D1YA 2DVMA 4AF8A 3SBOA 1T5OA 3LLUA 4LY3A 3P0EA 5T8KC 2IEIA 2WFZA 4QTXA 3B13B 5J2TB 1PZFA 2B9VA 2R48A 2ATIA 4GYJA 2E87A 3A37A 3U4IA 4EATA 5LIPA 2PXHA 4EJFA 4KRFA 4YCAA 1EH5A 3OQ6A 1KPHA 2PPLA 4D6YA 3TE6A 1RLOA 1Y6QA 1M1YA 1PZNA 4UMVA 1PJSA 2AIRA 2FR8A 3ED5A 1CR1A 3N2GA 1VDZA 2QAGA 2H4XA 2QMUA 4FOPA 4MCAA 3UK1A 5DK6A 2D7DA 3R3HA 2VP2A 3A31A 4C4OA 4FFOA 1YQDA 4IFEA 3IAEA 1Y33E 1XXLA 4BS9A 1YZVA 4I0WB 1TZKA 1LVUA 2IS2A 4B44A 1JHZA 1IHYA 1QE0A 2E1RA 5KTSA 3WFZA 1OZ0A 1N1MA 3OZXA 4MV8A 2C61A 4XW2A 2J1LA 3L4EA 1UFVA 4FDMA 1SAYA 3Q9NA 5KAMA 3I1YA 2B5WA 3JALA 4RFVA 5LMNB 3UJNA 1PE0A 4BRWA 4D9HA 2JIZD 3DZBA 1C8KA 1GOTA 4NMWA 5HF8A 4B3MB 3NBMA 4W7HA 3WXMA 5DB4A 1Q22A 1IONA 3LI2A 2FRDA 1AVTA 3L02A 3ILHA 4RHFA 3SFTA 1QANA 2ATXA 4YV7A 2Q62A 5ITVA 3B8EA 3IH5A 3MMPA 5DM0A 3UAZA 2IIBA 3FDZB 4I55B 2O8DB 3CF4G 4GUDA 2ZYVX 1F1BA 2VZLA 4MCHA 3ZW7A 4DXAA 3B6EA 1FRVA 3ESQA 4ECAA 3KZ1E 5GVRA 1N0IA 1XNJA 3R3VA 3CLVA 2RB4A 3WMFA 1RVV1 2CHEA 2HMVA 3AI3A 3BC1A 4RK0A 2Q50A 1H9BA 3K16A 4FZRA 1QK5A 2AG5A 4TLCA 3WLNA 2FR0A 3I76A 3SGLA 2PT5A 1WEKA 4MS3B 4YAJA 3DOOA 3ND9A 3NEPX 4M54A 3QU9A 2NPFA 5I7RA 2V1XA 2VF5X 1IL0A 1MX9A 2Q9UA 1JILA 3B6IA 5IKEA 3E5HA 3TIXB 3IHLA 2SCUB 2ZCJA 2JLBA 4N3AA 5CGZA 3DKKA 3DS8A 1E2DA 1ZFNA 1EG7A 4EA6A 3RS5A 4CG3A 4IO1A 1B0PA 2MHCA 4W5RA 2EFCB 1MAHA 1E2NA 4ARCA 3DTTA 4MRNA 2Y93A 3MCWA 3UWOA 4BAUA 1ULHA 4QRIA 4BJ5A 3K2IA 3C39A 2WYHA 5U1PA 3TSZA 5G4KB 2OCGA 2W0MA 1YIDA 1ESEA 2JI7A 3U5ZB 3T34A 3GLKA 5DISB 4FMBB 5K05A 2G0TA 4IIYA 3U49A 2WF6A 5HZKA 4FOOA 1RTTA 3NNNA 1R4ZA 1NULA 3GFGA 2HA0A 3IAHA 5F4BA 5HK8A 4E6EA 4F9GA 4MWBA 1M8FA 4HFJA 1YONA 3FIJA 3HEAA 5ICEA 1R4NA 2C9CA 4EGCB 4PWYA 1XQYA 1CE8B 5F1PA 2JZOA 1J2YA 3E3NA 4EUKA 1ADCA 4P4TA 3I64A 1ZM2A 4ZEWA 5HX7A 2I65A 5M7EA 1XT6A 4XWWA 4WCFB 5CBPA 2EV9A 3FFBA 1XJ5A 1MC4A 2IEBA 2QUBA 3JZAA 1VJ1A 4FNAA 4NMXB 5C1OA 3MJHA 4M9CA 1UJNA 2B20A 2NUPA 2PV7A 3CPJB 3KTAA 1EAMA 4KQJA 4MB0A 4OHBA 1E1KA 2QU8A 3CBQA 3LA8A 4FFLA 5GJVC 3GPIA 5KWSA 3TZCA 4X3CA 4CLEA 2Q3HA 1ZVMA 3N1UA 4TQUS 3LXUX 4UFOA 1X87A 1T91A 3ILXA 3DF7A 5KU7A 1N2IA 3IHTA 3FKSA 3UOAB 3A14A 4BYMA 1VJTA 1HDCA 2ARKA 3V7WA 3NQ41 1Z6QA 2WHPB 3NHJA 2OHFA 2Y6VA 2EBWA 4Z9BA 4BCCA 3SEFA 3K2EA 5JYDA 2CXHA 5LBTA 4M53A 4UREA 4GKBA 1S2GA 3RYIA 3VGPA 1OROA 3PXUA 3UWPA 2A2ZA 4RL4A 2C9OA 1T8TA 4FHDA 5U9CA 1FYXA 2GVNA 2DKOA 2FPOA 2VSFA 1JHXA 4H4CA 4M1OA 4YWHA 3WLFA 3HJGA 4E1AA 1DC6A 5KNBD 3I04A 3R76A 3QLJA 2OOKA 1YI1A 2MSDB 4HQFA 4IVPA 2HA7A 3MLAA 4H1UA 5HRUA 3MXOA 1DBWA 2VK2A 4MKFA 3UHJA 4QG3A 5JADA 3Q7PA 3VPBA 3FXAA 4IWYA 2VRBA 2VSYA 3U37A 2IP4A 4RPLA 3W5UA 2BM1A 1NLMA 2CHFA 3V1MA 4ZVSA 2AW3A 4CM8A 5IMSA 1QIGA 1M8GA 3CMMA 1ZESA 3NTVA 3EX7C 1VKRA 2BUAA 3EGOA 4E2ZA 5ICSA 4KO3S 4O4LB 3VDNB 5AD1A 1FLNA 3UHAA 1Q1EA 2BGLA 1Z39A 1E1CB 2PZLA 2VXYA 3QI7A 1YU6A 4FS8A 4FB4A 1HNWB 4MZDA 1FL9A 4R2JA 2O2EA 1RI3A 4WA8A 1O97D 1T8YA 4QPNA 4G0ZA 5DHRA 5B53A 1P4JA 1Y4UA 1K6XA 4TKLA 4BUJA 1J49A 3AT1A 3DSRA 1XF9A 2WTNA 4ZT2A 1IK6A 1KERA 4PC3A 2AHOA 4JQZA 3G0CA 4BVEA 1L7QA 1Y63A 2ODQA 3KB6A 2WY2D 1TIKA 3HCOA 2NO7A 4CCAA 2IYOA 4MROA 5TX7A 3KEOA 1B00A 4BUCA 5CB4F 5HXAA 1P2FA 1LY1A 5JH7F 1Q7RA 3RSSA 4DRZA 3FB1A 2FCRA 3LGAA 1P2SA 2CWWA 3H6HA 3GMSA 3MB8A 3MTQA 4H3KB 1C0KA 3F2IA 3QEJA 2X2FA 4NP6A 5FL3A 5EJ7A 1NMYA 2BEVA 4N5HX 1JEAA 4CBVA 1XHEA 4XCVA 3E7PA 3HBJA 4YXWA 1DBSA 1XLUA 3CJTA 2IYXA 3L01A 3A6ZA 1E2MA 1QXSA 1CRPA 3JAKB 1WXFA 2CVFA 4HN2A 4HX2A 5C53B 2KMLA 2H65A 4OI0A 1SA0B 5DM1A 4DY6A 2QP9X 2ZUEA 4AY2A 4GAEA 1GT6A 1ORIA 2XYRA 4MIYA 4NK4A 3LDAA 4A27A 3GLFA 2C4HA 3P97A 1YJXA 3WZLA 2NW6A 2DLNA 2KHZA 1C80A 1N6PA 3OEHD 5LU8A 3BMCA 2B4YA 2DFNA 4KVGA 3OG9A 4MGYR 1N33B 4MRMB 2BGKA 3KDAA 3WDSA 5BOVA 1HMYA 1E3WB 3LYUA 1KI7A 4M9QA 4UAVA 3ENKA 4XQ9A 1DP4A 4FYWA 2DUUA 5ANRB 2FWAA 3VNRA 4F2GA 4H7EA 2YXDA 4F5YA 1NNUA 3GLIB 3SIPA 1HY3A 2ZIAA 2X8AA 2Q1UA 4TSFA 2IBSA 1BXGA 3A6LA 1P31A 4NOLA 4CNQA 3KKQA 3PGMA 4IEFB 2Z1NA 4Y2UA 5TPZD 4BNYA 4CPDA 3L49A 1F2UA 4JT2A 3FWKA 4X95A 3EFBA 2FR8C 3PDCA 4ENWA 3ROKA 2PS3A 5GY7A 1EWQA 4HDRB 4HMQA 4Y6LA 3ROPA 4BPBA 2QNRA 4HAWA 1YZ3A 2Z2IA 1NP7A 1WZEA 1N3IA 2EERA 3I0MA 1BKYA 4JQYA 1YHYA 4R98A 3RG8A 3RTDA 5FOVA 3OLQA 1CZUA 2OFXA 1K6JA 1EX6A 2YOFA 2WJVA 3BS4A 1FVXA 3HLKA 1Y9ZA 1PUXA 2YWBA 3UMGA 4CETA 4MWCA 1H1TA 2B7LA 3KL4A 2WOOA 4BIMA 4YCBA 4YJDA 2ON6A 5TQJA 1KEZA 1JYEA 3GFFA 4YRIA 4ZKDA 2GF0A 1RHQA 2FRDC 2CD9A 5KQGA 5M04A 1XA0A 1L3IA 4LHEA 3WLLA 4B33A 1Y1PA 1AZLA 4KZKA 5B5SA 2JHFA 1G5RA 2NYUA 3K8QA 2R8BA 1T9CA 1ESDA 4NYJR 2Z57A 4BLTA 2PUJA 3D02A 1AO0A 4O4IB 2Q41A 4H16A 2X0NA 3P5BA 4E46A 3D7NA 2VNJA 2PGJA 3HS3A 3RU9A 2V0CA 2ZLBA 1XA3A 4R1MA 2JIRA 2A5JA 3JPYA 2GJSA 1BA3A 1VE3A 2G82A 3C1TA 3O1IC 1DCTA 3EY4A 1PFUA 3K9LA 4KWEA 4OGFA 1G20E 3OICA 1FMFA 3SYLA 1U2TA 2KWIA 4ZQBA 4LECA 4DC1A 1ZJ5A 1NX9A 4FILA 3UB4A 4D96A 1L7PA 1J39A 4F71A 1ZD9A 4TV9F 1L5QA 3BXXA 1FP1D 1PT5A 1QM5A 5JI3E 1AMNA 2OZKA 3QP9A 4LJ7A 4CV1A 4ZYLA 1WHSA 3T4EA 3WDKA 2Z5VA 3OO0A 4XH9B 2IV3A 4EVIA 3ADBA 2H63A 4P2GA 2HTEA 5A2QA 5AK3A 5F5XA 1T9HA 4Q1CA 3ZHQA 4A2QA 2OYRA 5AUQA 1AUPA 2PZBA 3H3JA 4BO0A 1OPXA 4RTOA 2CLDX 3H9CA 4M37A 3NIBA 2AYZA 2HBYA 1M2VA 2GEJA 1J23A 1RMTA 2VSNA 4ME6A 2I4MA 1IULA 1WSDA 3ORQA 4QDZA 1JR3A 2PSDA 1JDBB 1X1BA 5CH5A 5LYYA 3CU5A 3COSA 1NJ2A 5FBWB 2PGAA 4KG7A 4Q4JB 3GA7A 4ESOA 4Z2YA 5JEEA 4YRLA 4MYUA 3D3EA 4QBKA 3EDYA 4RA6B 3TLBA 1I8TA 1KYVA 1T9GR 3OUUA 4NNOA 5ALNA 4Z3DA 3WO1A 5F2NA 5CLIA 3UJ8A 3GRUA 3VQTA 3KWFA 4LZZA 3LX6A 3M9WA 5AIBA 4Q7JB 1N7HA 3F6RA 3ISVA 4FGWA 3OWXA 5C18A 1S4QA 2Z8XA 4KRYA 3UWSA 1HFJA 3W77A 4B3FX 1QF6A 1NJSA 2CDAA 4PSVA 4L3WA 1H8ED 1DCKA 4ZP1A 5I9MA 1CR4A 1P77A 2JAPA 4K2AA 1GA4A 2OGTA 2YDYA 3G9QA 1OGJA 3HZRA 3B85A 3IT0A 2ZUTA 3UHOA 2Y0CA 3EVBA 4KNWA 3CZRA 4EB0A 3SZUA 4F06A 4QGBA 2IOHA 3H0EA 1JP7A 5CXXA 3C1AA 1KJ8A 3F73A 4RVGA 1Z12A 4B9EA 1W5FA 3ROGA 1G3MA 2W2NA 1U99A 2OV4A 1SXHA 3WFIA 3S40A 5CDSA 2ISCA 2AWNA 1XUOA 5NLLA 1ZEJA 2OHVA 4DEXA 4JVNA 5IRCD 2DHEA 3ZE2B 1AKNA 1U80A 1V39A 2CBGA 5IWAB 4XGNA 3KLPX 2DFDA 1O03A 3CX8A 3SOPA 3DGFC 3FCOA 3ET4A 1PWXA 1VKJA 4XUCA 1E1NA 1TEXA 2ZBPA 2NV0A 3GJXC 1Z5ZA 1KSGA 4RY0A 3SICE 3W6NA 4CT0A 2JVKA 4L6AA 5T5QA 4WXEA 3HEBA 1IZ7A 4CEHB 1SFRA 3DQPA 2RGGA 2R5NA 1BTOA 5FLKA 1Z83A 5BYBA 2I1WA 1HX7A 3KVNA 3OTIA 5DF1A 3S70A 4BJ1A 5CDGA 3E03A 4M8SA 5IUJC 1GQRA 4TT3A 4F93B 3OQIA 2J4DA 3DXFA 3GEIA 4YR7A 4JOSA 1WNFA 1B23P 1KMMA 5FBLB 2PLRA 2DOKA 4LSZA 4ZREA 4KWTA 5IKOA 3LRXA 2C3YA 3WFJA 5KVQA 1BSVA 2ERCA 3FCAA 3GW8A 4YA6A 5BXQC 2NO6A 1L4LA 2M98A 3FVQA 1CUCA 1ZUNB 3R6WA 1FP2A 4G4GA 3A1CA 3GCWA 4M0PA 4CGYA 4DVJA 5DTRA 4KDEA 2QLFA 4XVUA 1TA0A 3N2KB 1E3MA 1DUVG 3O4RA 1KI9A 3KAQA 1QBKC 4DGSA 2BEJA 4H6WA 2OHXA 2ZULA 3O7MA 1OYYA 5AHOA 2WM8A 4Q3LA 1UZLA 2PRYA 3D7MA 3R77A 5B1IA 2WAAA 3DC2A 1C41A 1NMQA 4C3VA 2P90A 3IPXA 4DVGA 1SXJA 1P7WA 1V2HE 4M1EA 1RXEA 1L7RA 1U0SY 2IHJA 1Z0AA 1JKJB 3KFXA 1D4ZA 1TJ3A 3ORFA 3QVGA 1Z29A 4JSYA 4L3OA 5C4MA 3MHTA 1FJ2A 5HM8A 4CHTA 2XUIA 3UV3A 2FRVA 1XTZA 3MT7A 3EEFA 5CURA 4K9OA 2XJ9A