2ZRAA

Msreca q196e atpgs
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
325
structure length
310
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGHVGLQARLMSQALRKMTGALNNSGTTAIFINELRTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 93
structure length 310
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zraA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zraA01
4BE7B 1G41A 2J0UB 4F4CA 1EFTA 1UEJA 2P65A 3CRW1 3AVUA 3BH0A 3PEUA 3CNNA 3QBTA 4AD8A 2EFDB 5L3QB 2ZJ5A 3V4FA 1OXTA 1E9BA 1G8HA 1QDEA 2KJQA 1KDOA 1J70A 1Z5ZA 4KVAA 1KO4A 4KJZA 3S1AB 2ZETA 2E1RA 3M1IA 3LDAA 2GCPA 2Q9BA 3DM5A 3UWOA 4DIEA 2CVFA 3MJRA 4QHYA 1KK3A 1B0UA 2RGXA 3AGPA 1J8YF 1TPZA 3MSXA 3PV0A 5DYIA 2YC4C 3K0SA 4QFMA 1QHIA 2H18A 4ESHA 2DFLA 2LWIA 2ZU6A 1KDPA 4YMTA 2C9OA 4FMDF 1G8YA 1Q12A 4G5SA 3GJ3A 1S0UA 1II8A 4QGGA 3AV0B 1CR4A 5A5GA 3I3SR 4UNNA 2CCKA 3CWZA 2AR7A 2XTZA 1CBUA 1KKMA 2DFNA 3NHAA 5KSYA 1QVAA 4NKRA 3LVRE 3DZ8A 4ZDJA 1SXJE 3RSOA 2V6IA 1KHTA 4DZZA 2XZLA 3Q85A 2OSBA 3GLFA 3RRYA 1KZ7B 4HAXA 2GEVA 4OI0A 3GP8A 2FN4A 3D6TB 1N6LA 1G3MA 3GEIA 721PA 3HPRA 1D9XA 3EZ2A 1H8EA 4P32A 3MUFA 1X8JA 2ZRIA 821PA 1WCV1 3OAAD 2WWHA 4PC3A 1Z0DA 2JASA 3CPJB 2OT3B 4TTQA 2ODEA 4BUJA 5M04A 4EJSB 2IYQA 1ZBDA 4GZLA 1QHGA 1Z2CA 4QJ5A 4U5XA 2WOJA 5TDHA 4URXR 2FGJA 1CJTC 1E2QA 1X8KA 1H65A 1YZQA 2GXSA 3CR8A 4TLDA 4US0R 3TW8B 4C7OA 1G8PA 3O8RA 2LCFA 4B3CA 2X2EA 4JLPA 2HF9A 2BMDA 2ZRHA 2P5SA 4HB3A 4KFRA 5EE5B 3ZS8A 2QU8A 1F2TB 1EFHA 2HXYA 2HYDA 3TR0A 1YR6A 1J90A 1A2BA 1FP6A 4R2IA 3T1TA 3B9QA 1SQ5A 2J0SA 3U7EB 3EXAA 1HUQA 4TSFD 1G6OA 1WRBA 1HT2E 2C98A 3E2IA 2G6BA 1YVDA 2A5GA 2NZJA 5EXTA 5BXQC 2NO9A 5IDVA 3GJ7A 4PPFA 5BWMA 3BFXA 3QE0A 1IQPA 4IEEA 1X1RA 4Q1AA 1TF2A 3VKGA 2O5VA 2XTNA 2PZEA 3LV8A 4O2RA 4QHSA 2WVJA 2H1LA 4JS0A 5H68A 4DC9A 5EJEA 1N6OA 2R6CA 1AQUA 4LJ7A 5CK5A 5CM8B 3SS8A 5JS7A 3GLGE 3A58B 5CDFE 2H7VA 3D7MA 3NHBA 2XSZA 4KU4A 1KSJA 2GHIA 4LBYA 1EWRA 3X1DA 2JLUA 3MCAA 2OAP1 4ERNA 3TJZA 2WJGA 2AK3A 3CO5A 4US2R 1XMJA 2DWPA 2PLFA 3PFIA 4XH9B 4C0HA 3L0PA 1HT1E 1E9RA 1YZNA 3CW2A 1GVNB 2QMUA 2ZU0C 4URUR 5IHPA 1R8QA 1EGAA 2ZUDA 4Q1CA 1P4SA 3U3MA 1Z0AA 1COWD 4IFBA 4OQLA 3BWDD 3OESA 4L9WA 4KAXA 4OQMA 2G1JA 2ZYVX 3K70C 2V1XA 2W83A 1UKEA 1W0JD 5AK0A 1QG4A 4Q4HA 5C46F 1DAIA 2W6JD 2HLDD 621PA 1IJEA 1W0KA 4ZPXA 3GFPA 2DY1A 3OFNA 3CNLA 3T12A 4GMXA 1XB2A 1BS1A 2Z43A 3A1TA 2DBYA 5GVSA 5C1BA 3QJYA 4Q18A 4URVR 2VH5R 2REBA 1SKQA 4EJSC 4A2QA 4J0QA 4PSVA 4HUQA 4TLEA 4B33A 4CRWB 1E79A 2A9KA 3A37A 4P31A 4TLCA 1G21E 1PUJA 2HJGA 1FNNA 2BHRA 3H1TA 3RANA 3ADDA 2CHGA 4BASA 5KTYA 2P0EA 1CRQA 4M1WA 3X1XA 2H17A 2CL6X 2QROA 5IRCD 5DNYB 2V8OA 2GEDA 4FWTA 1QHHB 3WRXC 1Z6GA 3Q7QA 5FPTA 1JR6A 1BYIA 1UADA 1UKZA 2MSDB 5KO2A 1SHKA 1D2EA 1ZU5A 4LSGA 5TV2A 1XTKA 2A78A 2IF0A 1XCMA 1T6NA 3JZMA 2ZQ5A 4FMDB 3RS5A 4C0SA 2F43B 2PEZA 2EQBA 4GL2A 2IXEA 3LLMA 4NYJR 2NO6A 5IK2A 4Q9LA 5AJWA 1XXHB 1VKJA 3RWMB 4Q1DA 3VX3A 1ZD1A 3UK6A 4XSGA 2WJYA 5EXXA 8OHMA 1CLUA 1XRJA 5BYJA 4BLSA 3NXSA 3T5DA 4NYIR 1ZAKA 3ZZ0A 2PZFA 2VYFA 1B23P 4HB2A 1ZNZA 4JBWA 4GRAA 4UJ3A 3SFVA 4FD2A 4DB2A 2NGRA 4LI0A 2QE7D 4X8HA 4PHTA 2ZITA 4MRVA 2GVZC 3RC3A 4M8NE 3PVSA 1FL9A 2GZDA 4Q9HA 4V0KA 3VHXA 3VR3A 1GNRA 4FN5A 4LGMA 1Q3HA 4YLGA 3RSLA 2XJ9A 1PUIA 3RRZA 2WV9A 2HCBA 4PC1A 4ASUD 4PSKA 2FJUA 2R6FA 1KMHA 1OH7A 3LX5A 4WZAE 4ESVA 2ZR9A 3BK7A 2C2HA 2QP4A 2J45A 4H9GA 1TTTA 1OF1A 3KKQA 4KODA 5EUQB 1E9AA 1CR1A 1FUKA 1YR8A 3TUJC 4C0KA 2N1BA 4YMVA 4NCIA 1DE0A 1XZQA 2Q9AA 1BMFD 1XCPA 4P4SB 1PLKA 3B1VA 1VDZA 3DO6A 2GAOA 2H57A 1W5SA 4Q7LA 4QBIA 3ZDQA 3U6BA 2FZLA 4Q00A 4IVRA 2ZRDA 3BS4A 3FKSD 3AF4A 1RW4A 3NKVA 1CP2A 4AK9A 4GOKA 1W48A 2IF2A 5F2EA 2GBLA 2A5YB 1T3SA 5BN4A 1NSFA 1FP7A 2PZGA 4IHQA 3B82A 1GOTA 4QG7A 1DS6A 2NG1A 1R4AA 4MYUA 1GRNA 2WOOA 1SULA 2YKGA 3CB4A 3FMOB 3FGNA 1E0AA 1RYFA 3QBVA 4QJ3A 2RGCA 2AXPA 4G5GA 1XPOA 3TGPA 4EQ6A 1Z07A 1SZPA 2F9LA 3W9YA 1P2VA 4GSYA 2HCJB 3BH6A 3EARA 4UXHA 4A8JC 4BWYA 5ANRB 4TZ0A 1ZU4A 3SZRA 1XX6A 3CRQA 4FMCB 4LV5B 1Q20A 3EZ7A 4N0EA 4D4KA 4DDTA 1RIFA 1M34E 3SJCA 2J59A 2BKUA 2B6HA 1P2TA 1F6BA 2F1RA 3LO5A 4M9ZA 1N6NA 4Q4LA 4R2HA 4XWAA 4BFYA 3WHKA 1YJ5A 1E0JA 2BC9A 4DB4A 1W4CA 3REFA 1XPUA 1E2JA 1E94E 3PG5A 2ZR7A 1OW3B 1ELOA 2H92A 3IGFA 3QIAA 3K09C 4L4UA 5HZKA 1N6HA 3FHOA 1ZUIA 2F1JA 2IXGA 1YQTA 2OCPA 2ZRLA 1EX6A 3ZZTA 4C0JA 1T3LA 4Q4AB 4D25A 4URYR 3T34A 5JJKA 1X86B 2V3CC 3M4YA 1AQYA 1IONA 3EPJA 4IRUB 5E95A 5HR5A 3X1ZA 1RRGA 1C1YA 2W0SA 5KDDA 1P5ZB 4G5QA 5H8WA 1PLJA 4HB0A 1DBSA 1MV5A 5G41A 5CJPA 2A2ZA 2X8AA 3ADKA 2IYTA 4OJQA 2ZRAA 5CITA 2AK2A 4I99A 2NMVA 3W6OA 4BFVA 2RHDA 4LC0A 5KSPA 2V55B 3FDIA 1E3MA 4NZYA 4PTLA 2VRWA 4DSNA 3OEHA 1HEIA 1FTSA 1DAHA 1E98A 2JA1A 3RS7A 2O8BB 3TQFA 5FBRB 1GWNA 3SE0A 1R0WA 2A5DA 3BC1A 5FFMA 2F43A 3FMIA 3QKUA 4HLUA 2K5UA 5JECA 3VKHA 1TUIA 1NLYA 1RRPA 3KKMA 4IEIA 4QNRA 4RFSA 4D80A 1X3SA 4CDGA 5P21A 3VR2A 5AR1A 3A1WA 1TUEA 1F2UB 2PMDA 4EKDA 4OI4A 4Q7KA 3WMEA 1OHHA 1EX7A 4M1MA 2RGNA 2OXRA 2CHVA 2BMEA 1G6HA 2P5TB 1KJZA 4KFSA 4B43A 4NYJQ 1A5TA 4MYHA 4DJTA 5GJBA 4BQSA 2P6UA 4PQRA 1HE8B 3TUZC 3OEED 1LV7A 4TTPA 3P32A 2E9SA 1NVWQ 4RD6A 4EPTA 2D7DA 3AVQA 2SHKA 4BFTA 1QG2A 2HYIC 3M0EA 1X8LA 4HLQB 1I4LD 2QTHA 2YOGA 2HV8A 1KSHA 6Q21A 3GLGA 2CK3A 1P2UA 4PC6A 2GDJA 3GLHE 3IEUA 5TARA 1T3HA 2W6IA 2QAGA 2WWGA 4DCUA 2XXAB 3CLVA 3GLGB 1O3YA 1XEWY 2OG2A 2ERYA 5KDOA 3IO3A 1CJVC 4ZCMA 1LY1A 1Z47A 5DHFA 3R7WA 1VHTA 3AF0A 1XTSA 1AZSC 2QMEA 1YZGA 3O8BA 4JVMA 4WIAA 2ZRNA 3BORA 3FMFA 1N25A 2D06A 4ITRC 3WYFA 4BLPA 1CJMA 2CLCX 2QN6A 4P4TA 3TSZA 2IYXA 3PUWA 3AB3A 4LX0A 3W3AA 5FBLB 2FV8A 5JSZA 2NQ2C 3IKJA 4PZZA 4C0AC 5FI0B 3RLFA 1SKYE 1ESMA 1W46A 2KBEA 2NO7A 2WPDD 4PANA 4PC7A 4P0TA 1X6VA 3HPQA 2W00A 2W58A 3AKYA 3P4XA 4LJ4A 3THXB 2JLWA 1Z08A 2GVDC 3WYGA 1JNYA 3RYTC 2FMXA 4HSEA 3LY5A 4CYMA 4PPQA 2CMKA 4DLYA 1G291 4JT4A 2WWXA 4IOLA 4BLQA 5JBQA 2ZJOA 3HWSA 4QL3A 1JPNA 1P62B 3F8TA 2O8FA 4MITA 1AGPA 4ZI3A 4NTZA 4AKIA 1E1QD 2XNDA 3V00A 3FHTA 2D3WA 1JJVA 5KSZA 4AY2A 2ZSAA 4DRZA 2QAJA 2HXSA 2OAQ1 4I1UA 3N5CA 1ZM4A 4I1VA 4FI3C 3K8YA 2BOVA 3HR7A 3EZ9A 4OKSA 3EAQA 2A3RA 3TMKA 4TYPA 1U8YA 4RD3A 2KE5A 4LHXA 3B60A 3DKPA 4Y0AA 1QHSA 5EE1A 5A4JA 2B21A 5FBVB 3IUYA 1VPLA 1T8TA 3ZQ6A 2GEUA 4DLVA 5FL3A 5E7JA 4FCVA 3H4MA 3RRMA 1JAHA 3I72A 3W90A 3EA5A 1AS0A 1GRRA 2QP9X 3ZYCA 1ZNXA 2BBWA 4ZDWA 4M53A 1E99A 3UMSA 5BQ5A 1AA9A 2C77A 1KJWA 4IVQA 5FPSA 3EWAA 4A0HA 5B30A 5JEEA 2PX0A 1JJ7A 3EC2A 2ZSBA 3K70B 1IN6A 2UKDA 1NG1A 2J7PD 3ZJYA 5AJVB 3RDPA 4ZDIA 1EESA 2Q3FA 1N3BA 1W49A 3SEAA 3K0CC 4BECA 1KO8A 4AKHA 2BIFA 1VTKA 1KSFX 5AJXA 3QSYA 1NI3A 5JEDA 3EPKA 1H8HD 3W5IA 1RC8A 2CNWA 4Z1MD 3PCRB 1N6RA 3K0FA 1UKVY 1GKYA 1ZIPA 5J4KA 2VHUA 4Y0VA 4ZI2A 2PX3A 3GFOA 5AUNB 1GZSA 2G88A 4Q4JA 2QPOA 2DFTA 3A8TA 5LD2C 2Q0HA 3NH9A 5SZKB 1W44A 5BN5A 2YNMA 1KI1A 1QBKC 4LYHA 1YU9A 2X19A 3C14C 1J8MF 2B7BA 4MRPA 4A0FA 1W7AA 4HAVA 1XMSA 1D2NA 2BEKA 1QHYA 5CIWA 4DLTA 3B6EA 2C5LA 5KNBA 3S1AA 3CPHA 2IXFA 5B2ZA 3LA6A 4MKGA 4LZZA 2AX4A 3KJHA 5E3HA 1W36B 1KY2A 1S1MA 3SFZA 4IOJA 2V1UA 2L0XA 4PPGA 2WHXA 4IW3B 3NIBA 4IFEA 1NMXA 1RKBA 4MRNA 2ANCA 1OIWA 2WJVA 4QBFA 3AVXA 1Q44A 4F91B 3CX7A 2G9NA 1G64A 2PH1A 3NEJA 2YHSA 2CXXA 4B6FA 5F3WB 2O8BA 2GJ8A 1RPZA 3MLEA 2VO1A 4LYAA 1G7SA 3VNVA 3R7WB 3BGWA 3ZD7A 5B58C 4S2EA 1BOFA 2NTYC 1KY3A 3GJXC 1G3IA 3NBYC 4E07A 4Q48A 4XVUA 2ONKA 5CM9C 2J0QA 3U4QA 5GJVC 3SQXA 1OFUX 1TQ2A 3SJBA 3AM1A 1P9WA 2YC2C 1L7VC 2UVQA 5FUVA 3ZH9B 5KU1A 4M9QA 1KI7A 2OCBA 3CX6A 1NIJA 3ZIAA 1FUUA 3GEEA 4RFSB 3PENA 2WZQA 4QOSA 1Z3IX 2GAAA 3MJHA 1KI9A 2Z6VA 2GXAA 4EJSA 4A36A 3R8FA 2FFQA 3AUXA 3PXGA 1E32A 1SXJD 5AJZA 2OM2A 5F9HA 1KI3A 2FWRA 2YOFA 3AKDA 3T35A 1KO1A 4W5WA 3SN6A 1QF9A 2G0TA 4C30A 1VG9B 4ARZB 4ZKDA 1NVUQ 4JLMA 2PMKA 1S8FA 1XDBA 1T8UA 2QI9C 4JLKA 4AYTA 2O8CB 5C18A 4AYXA 3U4QB 3IIJA 3HR8A 4JL6A 4HDQB 1Z83A 4OQXA 3L0OA 3VX4A 4HUQB 4R71A 4POAA 2ASEA 1EK0A 2KB0A 4TL8A 1LB1B 4Q9JA 5DYGA 1YRAA 1HV8A 4Q19A 4OL0A 4B44A 1GTVA 3OEEA 2FPKA 3DM9B 2OZEA 3BOSA 4EUNA 3UIEA 1N5KA 1GG2A 1FX0A 1TEVA 3QXSA 1M2OB 4Q7MB 5FOUA 2D74A 4R7ZA 4DCSA 3AVVA 2FFBA 2O8EA 4B3BA 1XD2A 1G8FA 2BDTA 1OH5A 1G7RA 3B1YA 4GI7A 4MGKR 3MWJA 2OFWA 2ZRKA 3EW9A 4JKIA 2YWEA 3SHWA 1WBBA 3I1FA 4AWXA 2GF9A 2JLSA 1NY6A 2IYWA 4UXIA 4BFXA 1XCGB 1KO5A 3QG1A 2CEAA 4NPHA 2IEZA 2JCSA 3A1VA 4RD4A 1NMZA 1FNMA 1ZRHA 3SHFA 3Q5EA 5CLQA 4E5UA 1WBDA 1R0ZA 1DELA 4RCYA 1KJYA 2XOKD 3FVQA 2C8VA 4C0LA 5LDDC 2W2VA 1K6MA 4B75A 3BE4A 3IO5A 3BAFA 2AHOA 3NH6A 2QGZA 5FL7A 1F5NA 4L8GA 1NMYA 4TMXA 1XJ0A 1OPXA 3K0FB 4Q7JB 1RJ9B 3VAAA 3K9LA 2PT5A 3BBPA 4TN1A 3AQ4A 1BH2A 1TX4B 3K9NA 4D26A 2ZRPA 1CJKC 1GAJA 2ATXA 2IS2A 1W0KD 2VIIA 5CDFA 1VCNA 3RAPR 4QRHA 3R20A 2XB4A 3C16C 2AXNA 3AP2A 4NE2A 2FG5A 3H84A 1U0LA 1U8AA 1WP9A 4P3YA 1Z63A 1P75A 1NKTA 5CK4A 1E2IA 2BJVA 3DDCA 2NIPA 1W4RA 3PQCA 3WNBA 4G5RA 1N5IA 1E2NA 4US1R 2ZYTX 3KXIA 4C2TA 3I8SA 4W5HA 4YONB 5EP3A 2R6GA 3LH5A 5ELXA 1IN8A 2OFXA 4AKEA 3ASYA 2WAYA 4O0MA 4RD1A 3GJ5A 1CR2A 2WBLC 2GA8A 2DWQA 1Q22A 3QG5A 3O47A 2IK8A 3A1SA 4GDFA 4IXNA 5KOYA 1R0XA 4GPTA 2C78A 1AN0A 2I3BA 2ORIA 3U60B 1XMVA 2GETA 1TNDA 5CJ2A 4WOPA 3CPEA 1C4OA 3B13B 3TVTA 4ZDKA 2QUZA 4O2LA 4ARZA 5HKKA 4N0DA 4OHYA 3LQQA 2O8EB 4LOAA 4V02A 1OKKA 1W0JA 1E9SA 5AWFC 3QOFA 1NN5A 3ASZA 4Q01A 3AVOA 2GK6A 2QGNA 4YXWD 1MKYA 1PLLA 1MRNA 2FH5B 1KAGA 3SNHA 3OFND 1TQDA 1JQJC 3I8XA 3MD0A 4WXRA 3RVBA 5KNCA 4NONA 3WNDA 1QVRA 1IAQA 2P2LA 4GFDA 3THYA 1WE2A 1A2KC 1XWIA 3KFXA 3TNFA 3AEZA 1E2MA 4DEXA 1NN0A 5JRJA 2GCOB 3LNCA 3PUYA 4TTRA 3WHLA 2IUSA 1ONBA 2DYKA 1OXUA 2N46A 3THWA 4NCKA 4R9UC 3IPYA 4NBSA 1VG1A 4NU0A 5DLQC 5JCZA 3G82C 2X77A 3KQUA 2JDID 4D0GA 4LHYA 3BRWD 3LWNA 2PLRA 3V4RA 1XP8A 1LFDB 3NTUA 2Q6TA 4KVGA 3AKEA 3B1WA 5L3VA 3AP3A 1PVOA 5B64A 3TSWA 4CT5A 3Q9LA 1UDWA 1VECA 1NRJB 2YVUA 3WP0A 5L3SA 4Q4JB 1NKSA 2RGNC 3M6AA 4QXAA 3NBFA 1N6PA 5KDLA 2WIBA 4JKYA 3DMDA 1SVOA 2IA5A 1P73A 1KAOA 3WXMA 3FFBA 3PR1A 1U98A 3IPXA 4M9XA 2ZJZA 1DO0A 5JFGA 2V9PA 1Q21A 1OH6A 3HP1A 4PHFA 4IJMA 4HUTA 1HE1C 2ZJ2A 3MAAC 1R5BA 1I2MA 2ZVPX 5AJYA 3IHWA 2W6ID 1E4YA 4A2WA 2PJRA 2F7SA 3B5JA 5FUWA 1KIMA 1BKDR 4PXAA 1AKYA 4Z54A 4ZIRB 3L8ZA 1I2DA 3QXCA 3ND8A 1TU4A 1ZP6A 3A4MA 2IS1A 1TADA 3QKSB 2O8DB 4Q4AA 1E9CA 4X8OA 1SVIA 3L8YA 3NBZC 1OYYA 1LF5A 1GDDA 4RZ2A 4EAQA 3R9XA 3UATA 1G18A 1KKLA 3QENA 2GXUA 3I73A 5EE9A 3WYAA 4WBSA 4QM6A 1G17A 2CBZA 1COWA 4I1SA 3ADBA 1M1YE 5DIFA 1WMSA 5FI1B 2WSSD 5FPYA 2XEXA 3A6PC 4A6PA 1GUAA 1EXMA 1M8PA 2LKDA 1P61B 3T61A 4RZUA 4Q21A 3R9WA 5HTKA 3U3KA 1KK1A 4JVNA 4QM7A 3TAUA 1YZTA 1DAFA 4FW9A 2OCYC 5FR1A 3U6KA 1ZD9A 3Q72A 4DSUA 2JLYA 4KLNA 4A1FA 2EFEB 1E6CA 4RZ3A 1YZUA 5EP2A 2Y8EA 3KKPA 3QKTA 2A7QA 2WKPA 3LW7A 5FPKA 4AIIA 1DAKA 1NL3A 2ZVQX 4TL7A 2I1VB 3AF1A 3P26A 2O0JA 5EE3A 4ACAA 2B92A 3F3YA 1N6KA 1S9HA 2QENA 4GP6A 1XJQA 4C7OB 2WJHA 5DE3A 4EPVA 2ZUCA 1KTVA 4LPSA 2WKQA 3MWYW 5K8UA 2HF8A 2CE7A 4CVNA 1AJEA 2FSGA 1SXJB 2VP2A 4ZCLA 2GKSA 3P20A 4E22A 1N2CE 4KV9A 3I92A 5SZHB 3GJ0A 3ZQJA 3KQHA 4HZIA 3PUVA 1FPMA 1DVRA 1E9FA 4LYFA 1NIPA 2FF7A 4TT3A 3CRMA 5E7IA 2JGNA 1TAGA 1YE8A 2G1KA 1U94A 1P2SA 2ZE7A 4B76A 5HZHA 1AM4D 1F3OA 1GL6A 2AKYA 2WWIA 2DCUA 4FMCF 1G3UA 1KMHB 2D4HA 1A4RA 1W47A 3CBQA 3U3JA 1ZNWA 5HE8A 3T1OA 3CNOA 1RRFA 2VQSA 4A8JB 2QE7A 3K0CA 4Q02A 3OF5A 2QNRA 3I61A 2CLSA 4NCNA 4I4LA 5FH9A 1E69A 4GT1A 2UZIR 4M1SA 2ECKA 4OHZA 2QPTA 4Q9KA 1I4TD 1KI6B 3E5HA 3GJ6A 4LV8B 2CHQA 4V0LA 3IEVA 4QJ4A 4AYWA 1T0HB 1XMIA 1UAAA 3Q8XB 3GJ4A 3FKQA 2CJWA 4TYNA 1XXHA 2WAXA 2ZS9A 5KPJA 4YDSA 4A82A 3NWJA 3B8HA 2IS6A 1OFHA 4PQYA 2IHBA 2BMJA 1D8TA 2JAQA 2R6AA 3REGA 1ZCAA 2PCLA 1DOAA 2IW3A 5K8LA 1LW7A 3EA0A 3K9HA 1DARA 2QEQA 2IT1A 4TL6A 2VSOA 1ZMXA 4K81B 5L3QA 2IEYA 3KTAA 1GL9B 3TE6A 2W6JA 4JBYA 1NBMA 2RCNA 4UQOA 2FNAA 1XF9A 1T0JB 3CF0A 1NN1A 2IX3A 4HAWA 3K0AB 3AUYA 4Q03A 5F9FA 1XD2B 1L4UA 2XJ4A 2JLZA 1IXSB 2H8KA 1E2FA 2ZRBA 1SGWA 1W2HA 3LBNA 1DADA 2IS4A 1AIPA 4MDFA 1UBCA 2ZRJA 3GFTA 4JJZA 2ZROA 1OB2A 2B8WA 4PQFA 5DI3B 3W8NA 1L2TA 5KPDA 1WQ1R 4FIDA 4NCJA 4G5OA 3ZVLA 4QGHA 3AKCA 1SXJC 4P4UA 4UJ5A 1MABA 3DVLA 4NYMQ 4U00A 1Z6XA 2VHCA 1DAMA 2J7KA 5K8IA 3CIOA 1G4UR 4JMPA 3CR7A 2BM1A 1D2MA 1I4DD 4GZMA 4RSGA 1Q1BA 3H86A 1OT3A 2WWWA 4O3MA 2EWVA 1ZUNB 4QC2A 1FW6A 2MMCA 3ZIAD 4KSBA 1XTQA 3CF2A 3KJIA 4DLSA 1IY0A 4DSOA 1QZXA 1Z28A 2RGBA 1Q3TA 3WRYC 1A7JA 1JEEA 3DL0A 4F4IA 4RJLA 1BO6A 4HAUA 2FSIA 3BERA 3X2SA 3ZVMA 1OSNA 4DDVA 3GLFE 3SYLA 2OO7A 2FA9A 3KXKA 3VKWA 1PV4A 3NC0C 4WW0A 4NH0A 3EIEA 1U9IC 4PZLA 4LHZA 2F6RA 5DISB 2IYLD 2JDIA 3CRRA 4OQNA 3VR6A 4JLNA 5D3QA 4ACBA 4D0LB 2JEOA 2ATVA 3OIUA 1QHHA 1XTJA 3AVPA 4V0OA 1ZD8A 2AWOA 1QHXA 2F9MA 1RE0A 4B35A 4EQ6B 1Z0FA 5DI9A 5JCPA 3KFVA 3C15C 3N2IA 4DUGA 4CEJB 2P6NA 3BD9A 2EYUA 5D3MB 2CNWD 2DR3A 2BBTA 3GQBA 4BRWA 1KI4A 1NBME 2FPMA 2ZYUX 4KYIB 2RGGA 5G3ZA 1GM5A 4HAYA 1J99A 1JR3E 2R9VA 2VHJA 2FX3A 2F3TA 3KL4A 4JL8A 4HZUA 1YR7A 4RZXA 2CLDX 4TLAA 1VYTA 1ZNYA 3LW8A 3LQRA 2WJIA 4GNKA 4JT2A 4OHVA 2D2EA 2VP0A 1NVVQ 1ZM7A 4LBZA 4B47A 1UM8A 4X8MA 5FTMA 1JB1A 4ZKEA 4URWR 3IBYA 4LUCA 3KUDA 4ZV4A 1PZNA 5TY0A 4A15A 2XZOA 2GNOA 2ODBA 5JSZB 1BMFA 2DPXA 1XD9A 3B9PA 3BIFA 2ZI5A 5JLJA 4M1YA 3OAAA 1EFRD 4EFNA 5FUYA 1KK0A 3TRFA 3R8CA 3QXJA 4TQUS 1G5TA 4JZKA 3UG6A 3JVVA 1HTWA 4B3GA 2GJAA 3D3QA 3FKSA 3SDZA 4EFLA 3AVYA 2ZSDA 2NO0A 1KI8A 1FFHA 2QBYB 4GP7A 4D81A 2ZAOA 1Q1QA 5FL7D 4TQAA 1NP6A 1N0UA 1XFAA 2I1QA 3A4LA 3N70A 4DCVA 3D8BA 2J9RA 1P60A 2ZPTX 2IYUA 3SI7A 1VHLA 3QPVA 1Z0KA 2JJ2A 2Q3HA 1ZC4A 3KDSE 4L16A 4TLBA 4BLRA 2R8RA 3L43A 2OUKA 3CRVA 5E7MA 1FX0B 4TSFA 1OE0A 2J87A 4OHXA 1UJ2A 1ANKA 1MABB 2JATA 3Q5DA 4PAOA 3TUIC 4BFWA 4UKDA 4BLOA 3LX8A 421PA 2IHYA 4PO9A 3FMPB 3VMFA 2Z83A 4B3DA 3EIQA 2IBMA 4IDHA 2ZANA 1MT0A 4A0RA 4EPRA 3AF3A 3U7HB 4MDEA 4AC9A 2BVNA 2EW1A 3U3RA 1EWQA 2XSZD 1Z8FA 2XTMA 5AUPB 2EFGA 4GMDA 1E2PA 4D0NA 4AI6A 2DHRA 4O25A 4HDOB 2BBSA 1HQYE 2C9YA 1H8ED 1U8ZA 2QRNA 3RS0A 2O8FB 1R7RA 3PJRA 3WBJA 4BFSA 2IUTA 3FYHA 4MGIR 2QORA 2QSZA 3GLIA 2KBFA 5E4FA 3QF7A 2VA8A 4MUAA 4XTRA 2RH5A 1S3SA 1UPTA 2J5XA 2ORVA 3QKSA 5DI3A 1KI2A 1G3QA 1E1RD 1SHZA 3RS4A 2CE2X 2VHQA 3GEHA 3MMPA 2CDNA 2XXAA 1N5JA 1G1MA 1KK2A 4MQBA 1HY3A 4L9SA 1X1SA 5JHGB 5JMTA 3UMFA 3KUCA 2BM0A 4G0NA 3DOEA 4HB4A 2N42A 2GCOA 3KB2A 2ANBA 2VLIA 4JBXA 2B7CA 2KI5A 5DH9A 4HAZA 3X1YA 5FPHA 3Q3JB 4XD7A 1RFLA 2AD1A 1GIAA 4CIDA 2JIZD 4KHZA 4LJAA 1GITA 1E79D 4W5JA 2QZ4A 1JALA 1XTRA 5SZIA 2CK3D 1IXZA 4OBEA 4BGDA 1OIXA 4B2LA 2ZJBA 3B1ZA 1AGRA 4Q1EA 3PEWA 3PIRA 1G5RA 3CX8A 1RJ9A 1Q0UA 2WM9B 2EFCB 1R5NA 3KTAB 1ZM2A 2QY9A 3FPAA 5J40A 4KI0A 1Z6AA 3UMRA 4LJYA 2ZR0A 4K8OA 1E2KA 4CF7A 4FCTA 1HYQA 1LVGA 4L15A 1OH8A 5CLLA 3SBEA 4A4DA 3DMNA 2YWHA 2PCJA 2CJWB 4NL4H 1Z2AA 1U0HC 5BN3A 1E0SA 2P3SA 4Z8YA 2WPDA 3P27A 4M4SA 4MUBA 1DG1G 2R44A 2XNSA 1AA3A 1U81A 5LBIA 3QXHA 3DHWC 3IHLA 5HE9A 2V6JA 3IDQA 2VPPA 3E1SA 4KO8A 2W0MA 5JWRA 1A1VA 2YV5A 3AVWA 4F4JA 3KQNA 5FOXA 4F92B 1W5TA 3QKRB 3QVVA 4LHVA 5FBQB 4RY2A 1QRAA 2KWIA 3TK1A 2FGKA 1JAIA 3LVQE 1D5CA 1E2HA 3THOA 2XITA 4XWKA 2YZ2A 3D31A 2J3EA 3QEJA 4DLUA 3BFVA 4IDNA 3RC8A 3CWQA 3DEFA 4DCTA 4HZUB 3UPUA 2IUUA 4YQFA 2IYSA 3C5HA 1VIAA 2XX3A 4JVSB 4C0BA 2ZE8A 3UG7A 5G53C 1NSTA 2V54A 3EIHA 4RCZA 2OILA 4PHGA 3WP1B 4PO1A 2CCJA 1KGDA 3KZ1E 4N3NA 4LPKA 3C41J 4MKFA 4P33A 4B34A 3N2EA 4WXPA 1LNZA 2OBLA 2VBCA 2PBRA 3PUZA 4LJ9A 2DWOA 4CW7A 5KSOA 2OFOA 4QNMA 5JI3E 1HH4A 2D2FA 1P9RA 2ZJAA 1UDXA 2EU8A 5B57C 3ZZUA 1NVXQ 3KX2A 1T9HA 1MR3F 4JIMA 5J4HA 5TMPA 4LDJA 1DEKA 1T5IA 2J7PA 1N0VC 2QTVB 3OE7A 2WJJA 3T15A 5EZ6B 4OK5A 5J4YA 1M7BA 2PJZA 2BEJA 3IBGA 4DWJA 3WBKA 3RNLA 3ZGXA 5EE0A 4LRWA 1U99A 1UBEA 1IN7A 2IL1A 5FTNA 2ZIAA 3Q7PA 1Z6YA 4IDPA 1XEWX 4LJ5A 2C9CA 3JZAA 3J81k 4ABYA 4BZXA 4NCHA 4MGZR 4A9AA 2OBMA 1CR0A 1E4VA 3OZXA 3VQTA 1GSIA 4DCNA 3IILA 2J0VA 2ODNA 1CJUC 1XD8A 3QQ5A 2O8DA 3C8UA 1BIFA 1CIPA 1VYVA 1Z0IA 1Z22A 1II8B 2JLVA 4TZ6A 1V43A 1JBKA 1N6IA 5EXPA 3THXA 5G3YA 1VIYA 4LC1A 5J47A 1FZQA 3TR5A 4RVCA 4RFVA 5H1YA 3SU8A 1U0JA 4LV6A 2FDCA 2QA5A 1NN3A 4JLJA 2E87A 3P1JA 5JHHB 3A4NA 4HLDA 4LHWA 3KKOA 2VP6A 3UXMA 2HEIA 2ZEJA 1XNJA 3F0TA 4LWZA 1UKYA 4OJKA 2GF0A 2EWWA 2HLDA 2WIAA 1DPFA 4KXFB 3UWKA 4W9MC 3CONA 4TT3D 4H1VA 2ZSEA 3QI2A 3K9GA 3G5UA 3LBIA 4KBFA 3W34A 4DKXA 4URZR 1G3RA 4TYWA 2PEYA 3LBHA 4Q47A 3SR0A 4DDWA 1AS2A 2XZPA 2GTPA 4TL9A 1YZLA 4KITB 3ZVNA 3W8RA 5LD2B 2GZHA 1MRSA 4NP6A 1ETUA 2GRJA 5TXGA 4V0MA 2WWYA 3GLIE 1P3JA 4UNQA 1US8A 3GLHA 4YDHB 5AUOB 4JLDA 3I32A 1IY1A 2HT1A 2NPFA 2WSMA 1UFQA 2IYVA 1S4QA 4MKIA 1Q1ZA 4HYYA 3TVDA 4TYYA 1UBGA 4CT4B 3NDBB 2FOLA 4LJ8A 5DGXA 1IHUA 3FFAA 1NF3A 4LJ6A 1CF4A 3HYTA 2ZRCA 2A5FA 5LB4A 4AKGA 1E9DA 2QRZA 4B74A 1IXRC 4EFMA 2ZE5A 3CKLA 3VR5A 5IK2D 1Y63A 1YZKA 2RAPA 2OLKA 2RB4A 3EZ6A 4M0LA 2Q9CA 2QTFA 1ZW6A 2VSFA 5J5CA 1YKSA 4Q1FA 1II9A 1VCOA 1K5DA 2NPIA 1XEXA 1T5LA 1VMAA 1L4YA 2J46A 2O0KA 3EASA 4PFSA 4R98A 4XJXA 4YMSA 4WVFA 2XAUA 4MRSA 2VP4A 4IDOA 3EG5A 4BFUA 1OV4A 1NJGA 1K5GA 2ZUBA 4GBMA 4MYCA 4CEIB 2QG6A 2HUPA 4GOJA 1ZM3A 1KSGA 4XSHA 2FEMA 3T06B 1XTIA 1XPRA 5GJWC 1ZC3A 2BCGY 1R8SA 4IOMA 5KNDA 2WTUA 4B71A 3U5ZB 5FR2A 3L2OB 1NG9A 5JWOA 3FOZA 2C03A 2YOHA 2RMKA 1OB5A 4ASUA 4LCBA 4KBGA 1FMJA 2JLXA 3EX7C 2O0HA 2GESA 4D4MA 1NJFA 3OEHD 3QEOA 4YMWA 4II7A 3TBKA 1OLOA 3MGCA 3OIYA 3B85A 4NYIQ 2CL7X 1M6NA 4V0ME 1ZUHA 2R62A 5C4GB 1SXJA 5EUMA 1FQJA 1O87A 2Q3MA 3GMTA 3DZDA 2ERXA 1P7CA 3FB4A 3KKNA 1SVSA 4PC2A 4LBWA 2C96A 5CB8A 4JYBA 1ZINA 4OYHA 4UNPA 4IKEA 3HU2A 4EIWA 1JEDA 2W2XA 3VU9B 5JS8A 3OIVA 5FOVA 3PEYA 1XBTA 3ECCA 3U7FB 1C9KA 1NVVR 2G77B 1L8QA 3BFKA 1CRPA 1R5OA 2REOA 3TLXA 1VG0B 2QL6A 3WNCA 2DB3A 2GJSA 4IVPA 4DVGA 3DKVA 2C95A 1Z6TA 4XVQA 1DO2A 4DEYA 2ZE6A 5FOTA 3I62A 1F60A 1E1QA 2XNDD 1MOZA 1U9IA 2GWHA 3QKRA 3VR4A 4DT1A 1TEXA 4OHWA 1G5PA 3KJEA 4CZ2A 1S9DA 2JJ1D 2ZYWX 4PX9A 1F2TA 3T5GA 4FINA 2OEPA 2J1LA 2QPAA 3AF2A 4AG5A 2NOAA 4LY6A 2G0NA 4HLCA 2HDNB 1TF7A 2ZI3A 4DXAA 1M7GA 1IN4A 4RD2A 1SKYB 1Q57A 3TW4A 5FOWA 1TMKA 2QSYA 1HURA 4M1KA 1U2RA 3UANA 4HDCA 2IYYA 3L0IB 5EZ5A 4I1OA 1Z06A 2OV2A 1ZCBA 3PITA 2J41A 5EXSA 2XOKA 3RWOA 2W2TA 2GK7A 3LFUA 2F1IA 2QP3A 4IXMA 2VL7A 3C4JA 4MA4A 4B2IA 3NVAA 3W6NA 1FMLA 2D62A 1CU1A 3LXXA 2QQ0A 5JRZA 4DDUA 3IQXA 2ZRFA 3VR1A 4I81A 1AKEA 2VTKA 3MFYA 3G0HA 1EFRA 1P9NA 3U61B 4TYQA 1WA5A 1AZTA 4KSCA 3V9PA 2DFKB 1KMQA 3NEYA 2WMNB 4C2UA 1U90A 3CF6R 1GFIA 5IF9A 1IM2A 4HI0E 5JZVA 3SC3A 2BWJA 2AL7A 4DSTA 3B7GA 3T1QA 1OYWA 1YHNA 4Z8XA 3U44B 3SYKA 2ZM5A 4XVRA 3LRPA 2Q21A 2F55A 2YYZA 4L5BA 4CGZA 3BB4A 4B3XA 1VG8A 2JJ2D 5HPYB 1ZIOA 4HEJA 1G9XA 1ZM9A 2WMOB 3OIWA 1XXHE 2B8TA 3B1XA 1R6BX 1G19A 1V5WA 2OESA 4BRUA 1CS4C 4EPYA 2FSFA 2V7QD 4JSTA 4QHTA 1YRBA 3SJAA 2BMFA 2XGJA 5CYOA 3LD9A 2RGDA 2QT0A 5EP4A 3MWLA 1WXQA 5CYPA 5CIQA 4EDHA 1G7CA 1T91A 4BEBA 4UNRA 1FOEB 3B78A 3I5YA 3I5XA 1UF9A 2JLQA 2AFHE 1UEIA 3CH5A 1SVLA 1DAGA 1JR3A 1OXVA 4M2LA 1QHNA 4QGFA 1VCMA 2VF8A 4Q66C 3FE2A 2ZTSA 4JLBA 4TMKA 5DN6A 1LS1A 2PT7A 2VP9A 4WAUA 4WZ6A 1E96A 2MMGA 3CH4B 1F2UA 5JWHA 3FWYA 2FPLA 4AURA 2YINC 3NDPA 1ZVQA 3THYB 2WICA 1J2JA 2X2FA 3C7KA 3U3OA 1E1RA 4ZCIA 2FEOA 3QPWA 3LAWA 1NLFA 3SJZA 2A5JA 4MH0R 1US8B 3GLHB 3T1VA 2LKCA 4M9SA 2WWFA 3EWSA 4ZO4A 3RHFA 1WDTA 1KDRA 4NMMA 4D82A 1NNEA 2BBOA 3LXRA 5JI2E 3LLUA 1AK2A 2GXQA 1E2DA 5GADl 4DBLC 3TH5A 1TF5A 4XD7D 4DT1B 4RD0A 4B3FX 3QUSA 5LB2A 2H16A 5FTJA 5J4VA 2UZ3A 1VCIA 2P6RA 1CXZA 3GCGA 2FU5C 4KFUA 1RYHA 3K09A 3AVTA 1FTNA 4BEJA 1LTQA 1W4BA 2QT1A 1RRCA 4JYCA 4PR0A 3A36A 1D9ZA 4F93B 4JLAA 2YJTD 2A30A 3SYNA 3VU9A 1OFIA 2FZ4A 4U7DA 3B2EA 3MRSA 3BH7A 2ZJ8A 2ZI6A 5BW8A 1NY5A 4B32A 3WY9A 1TQ4A 2AD5A 4IDQA 4DIDA 3ICEA 3CUEF 4QKQA 3KQKA 3E70C 4PAMA 5FTLA 1DAEA 2ZJYA 3AGQA 1GP2A 3NG1A 1ODFA 2JLRA 4LBVA 3WMFA 1W36D 121PA 1G7TA 3R9IA 2OCAA 3QPUA 3F5FA 1G4AE 3P4YA 4FXPA 2OLJA 2ORWA 2R65A 2VF7A 1YR9A 4ON9A 521PA 3ZVRA 1E0KA 1EFCA 2ZS7A 3QF4B 2GJKA 1CTQA 2QMOA 5UKDA 5J4LA 3C5CA 3U2QA 5IT5A 3VHLB 3JVUA 1WB9A 3CZPA 3OHMA 1OKKD 1S3GA 2VEDA 4G1UC 3QNUA 5A0FA 3HYRA 2OHFA 1OFTA 2AFIE 5DHAA 4D4LA 4CEHB 1OIVA 4F38A 3CM0A 1KZGB 1OXSC 2FFHA 1PJRA 4XWOA 3HDTA 5FOSA 1R2QA 1G20E 2JJ8A 4JVLA 2O8CA 3ZLJA 3MG9A 3HU1A 4K46A 1Y3AA 5HCIA 3VFDA 3WMGA 4QBHA 2RKOA 1IN5A 2VSXA 4JLVA 5SZJA 1JXMA 2BKEA 2MSEB 2EYQA 1XEXB 3RS3A 3KXLA 1W2GA 4RKFA 1MO3A 2CVHA 4Q9IA 1K8RA 4Q5IA 4DLRA 1JECA 5GJCA 1JXOA 1OXXK 2GZAA 2CCGA 4M1TA 4WA7A 2F3RA 4M1OA 5C2JB 5GVRA 3PEVA 2EVWX 2I4IA 4FMBB 4Q1BA 1E2LA 2H5EA 2FSHA 4E09A 4KYUA 3BB1A 4XTCS 5FUXA 2ZI7A 2BCJQ 4CEIA 4D2IA 1NBMD 4PPNA 2FFAA 4B48A 2HJVA 4PZYA 4NYMR 1W4AA 3HU3A 5FBWB 1XU4A 1HQCA 2ONJA 3OE7D 1II0A 2BJWA 4D6PA 4A0GA 2OE2A 3ND9A 5L3SB 2C99A 3K0AA 2ODWA 4FCWA 2JIZA 2AWNA 2HT6A 1HA3A 1VYUA 1JI0A 4DHEA 3K0EA 5DO9A 2ZRGA 1GKUB 5AUQA 3W6PA 3RS2A 1MH1A 1F48A 1SVWA 4JJKA 5FTKA 2MSCB 1ESNA 5L3RA 4IOKA 1TQ6A 3GD7A 2OXCA 3H0KA 3BJIC 4DLWA 5JJLA 1GKIA 5KYKA 2ZS8A 1AS3A 4KFTA 4A6XA 2IC5A 1W36C 1SVKA 2GILA 5HCNA 1TL7C 2IWRA 2KSQA 3BXZA 4MGYR 2GBLC 5C4MA 3ETLA 4JL5A 3U44A 3CZQA 1KDTA 1FQKA 4G01B 4Z51A 4ZIRA 4XOIA 3TSOA 4S35A 3KJGA 4P4SA 2RHMA 1CULC 4RKEA 4F7WA 2AN9A 5DSZA 2CL0X 3K1JA 1MO5A 5HKKD 1MO6A 3PUXA 4V0NA 1LF0A 2IYZA 1M7HA 2YWGA 3MWKA 1KNQA 3TAHA 3TQCA 2D7CA 4C0QC 3L82B 1DTSA 4A92A 4UNSA 1E2GA 3DPUA 1KI6A 4A8JA 4Q4HB 2Z4RA 1Z0JA 3NC1C 2ZREA 2F1HA 4DLXA 3X1WA 4EPXA 2WKRA 2TMKA 1P6XA 4TMZA 4DUGD 5CB6A 3THWB 3GPLA 3U7GA 3FHCB 4UXJA 4TWZA 1ZJ6A 3QF4A 4KCGA 1A82A 1E9EA 1GRQA 3FTQA 1XJCA 1IBRA 4NDZA 4OI2A 1S2MA 1ZYUA 2V7QA 3L0SA 3W3ZB 3SBDA 4M21A 3ICQB 4B2PA 3VTKA 4X8LA 2PL3A 3EPHA 1IOZA 5TVKA 4BPBA 4NHOA 1BYUA 1S1CA 1T4GA 3ZS9A 1EG7A 4M22A 5KUTA 1GL7A 3GLIB 2QM8A 3I4LA 4YMUA 4TMWA 2QBYA 3EZFA 1JPJA 3QVUA 4YC7A 3ADCA 1JR3D 3QY0A 4MKHA 2G3YA 3VNUA 1N5LA 4OK6A 2FE4A 2RGEA 5DN6D 4CEJA 3ONWA 4LYJA 1RZ3A 3SOPA 3H2YA 1IY2A 3K53A 2QM7A 1EFUA 3IIKA 4TQ9A 4H1UA 2NZ8A 2IYRA 4C3ZA 2YWFA 1DG3A 5K8TA 2ZXUA 4PO8A 2NO1A 2Z5FA 3O8DA 5F98A 4PAQA 4HATA 1KNXA 4XIGS 1J7KA 2QQEA 4W7SA 2ZAMA 2ZSFA 4D4JA 4B73A 4BZQA 1GNQA 4HLUC 2ZI4A 4N1AA 4FWIB 2RGAA 5D3MA 1IJFA 1KOFA 5BYKA 3IQWA 1XEFA 5LPNA 3IIMA 2EFHB 3ZD6A 3W5JA 1R10A 4PSAA 1D6JA 4JSYA 1R0YA 1OHHD 1W1WA 2BV3A 4C4PA 1NLZA 3GJ8A 5H70A 2REXB 4KLZA 1KYIA 2VHTA 3KQLA 1OJLA 1UBFA 3RABA 2IWHA 4BFZA 1M74A 4AG6A 3UKDA 4C9BA 4A2PA 1CEEA 2AKAB 5TB5A 1KO7A 4G3XA 3BB3A 2Z4SA 2X1VA 3QXXA 5L8VA 3K70D 4PHHA 4E03A 2O52A 5EQTA 1RVDA 2XB2A 2WSSA 1XZPA 2R2AA 2ZRMA 2Z0MA 3HJNA 1G8GA 3TIFA 2J0UA 5JJIA 4QGAA 4OK3A 3A1UA 1P72A 2OBNA 5KHOC 4B6EA 4MYTA 4EPWA 2QAGC 1WF3A 3AH8A 5G40A 1GILA 2R6DA 4U02A 4YXWA 1H8HA 4DLZA 3TKLA 4BLTA 4CEHA 4Z1MA 4V03A 4OI1A 1JQLB 3KB1A 2C04A 1N0WA 4GOXA 1GNPA 3RRNA 3GLFB 1TU3A 4BZPA 3SQWA 2GJ9A 1G16A 2ZI9A 2QMHA 3DOFA 4WZBE 1E2EA 4ILEA 1Q1EA 1S96A 3NBXX 1SVMA 3EC1A 4LK2A 4TMVA 2V4ZA 4QBGB 2JJ1A 2G83A 3EPLA 1LS6A 2GCNA 2P67A 4JLOA 1MO4A 4MRRA 221PA 5EP1A 4OQFA 1CKEA 2QAGB 3O8CA 3AP1A 1Z29A 4TMTA 2VP5A
chains in the Genus database with same CATH superfamily
5EWMB 5JCJD 2ID7A 1U31A 2J0UB 4F4CA 1GTJ1 1K08A 2C3OA 3BH0A 1XO1A 3PDUA 3AHCA 5JDCA 3I9JA 2G76A 5G0UA 2EFDB 2JA2A 3GVXA 4NIMA 5D85A 4RWZA 3H5TA 5L3QB 1G8HA 1L5WA 2GSDA 5CVVA 3DFFA 2GASA 2IGBA 1KOGA 3EXIA 3DA8A 4LNUA 3R3XA 1RPJA 1V6SA 2ZYGA 5JCOC 1JILA 5GGYA 2GCPA 2FKAA 4UCWA 2HGZA 5KTPA 3AOEA 2JIBA 2QJOA 1I4WA 3UWOA 4EECA 3OBBA 3EGDB 1PYOA 3E1GA 3LRTA 4E11A 1B0UA 1A4IA 1WM1A 2JI9A 3VU8A 1TPZA 3PGKA 1BCRA 2ZVDA 2G0AA 1JXAA 2WF9A 1N7IA 1OCEA 2GO1A 7REQB 1H3FA 4K9MA 3TTVA 2PH3A 1FFXA 4UU1A 4IWYA 3WHIA 2EC5A 3WGNA 3B38A 3BD8A 1KDPA 2ZULA 3BPSA 4FMDF 2C20A 1G8YA 4PNPA 2PR2A 3IRVA 4XR9A 5DGCA 3ZV6A 5KNCD 1CR4A 3I3SR 3CWZA 4I08A 4NBVA 3H5IA 3OMWA 1C0LA 4FX5A 4XYMA 1A5SB 1WUKS 3VPBA 3PHBE 4NKRA 3AFIA 2VDRB 4ZDJA 3T0FA 1U7OA 3FPHA 2M9MA 3NHWA 5G1NA 3RRYA 3GLFA 2BZ0A 1VXRA 2GEVA 1P9LA 2FK8A 1QE0A 5CB4F 1H42A 1N6LA 2VTDA 4BU0A 4MUJA 2PUTA 1QFXA 4F86A 5DX1A 3HPRA 3EZ2A 3HUUA 3BXPA 4NOKA 3L7LA 1H6BA 1H8EA 1GUYA 1Z62A 2QVXX 2VZLA 3NWPA 4UNIA 4ZPJA 1Z9BA 4CKWA 3LCVB 5K8TA 1I8TA 4AJ1A 2LIVA 2ZWMA 4UBOA 5HIAA 1XDUA 3HP7A 2PRZA 3OAAD 4J7CA 2AI1A 2YHIB 1IY8A 4OHPA 1YZFA 3S8EA 1MA0A 1ZBDA 3B2NA 4MQ5A 3U7JA 1QHGA 3QE4A 3U1VA 1LRLA 1E3DA 4M49A 4WINA 3R3WA 4ZT7A 4EB0A 1SXIA 4C7OA 1G8PA 1SRQA 5MFPA 1ZEJA 3M4JA 3STVA 3I34X 2PPVA 5B5SA 4JLPA 4HB3A 2ZRHA 3ZS8A 3WAKA 1JJAA 3OECA 3IPRA 5BWOA 5I4KA 3P9CA 1H1LB 1J90A 1QPBA 2I8LA 2WLTA 3B9QA 4HT3B 1SQ5A 3HU5A 5FJJA 4S3MA 2Y0PA 1WRBA 1G8JA 3FPGA 3PFBA 3E2IA 2G6BA 4JOSA 3LGAA 5EJGA 1YVDA 3P0RA 5EXTA 2C7BA 2Y1LA 2NO9A 1X2BA 1XVTA 4HRVA 1CUAA 2OV8A 1I6KA 3QE0A 1X1RA 3EJ6A 3H4VA 3LY7A 1M1UA 1TF2A 3O8NA 2XTNA 2D13A 4O2RA 1M75A 1JVSA 4DC9A 1JLMA 4M9CA 3EXHB 4PGGA 5H68A 5AVKA 1N6OA 1DFIA 3NM6B 1U4OA 4X63A 5CK5A 4ZT6A 1UQTA 4WCDA 4WKGA 4HNUA 3R5SA 3WL4A 5I7OA 1AKNA 5F4BA 4OHOA 3VR2D 4QXMA 2JLUA 3IP1A 4OB7A 1QANA 4JX9A 4LN1A 5C53B 2ZPAA 5SYNA 1KVTA 3G5TA 4R2KA 1J49A 3E23A 1XMJA 4X71A 1TZ2A 3N2NA 1FS5A 3PWTA 1NQVA 1DO8A 1N2ZA 2WHPB 3CZ9A 4WY2A 4HVAA 3RYHA 4AL4A 1R8QA 2ZUDA 4RF4A 1HFKA 3U3MA 1Z0AA 5GOZA 1FNBA 4IFBA 4OQLA 2VT2A 3E7FA 2X2PA 3F7MA 3JYLA 5AW7A 1NBAA 4OQMA 1V5IA 4ML3A 1XJ5A 2J9FB 3USCS 1UKEA 5AVWA 3AZPA 5AK0A 1K6JA 2W6JD 621PA 1IJEA 2UYHA 2GJ4A 1U5CA 2M98A 2W8BA 2EZ9A 4GSLA 1QUEA 4GWGA 3GFPA 1CVRA 3K9QO 1IM8A 4GMXA 1PWEA 2XGOA 1BS1A 4JXKA 5INTA 4S2UA 3FPLA 2QTLA 3HV2A 2G4VA 4EZIA 3IXQA 5GVSA 4MLPA 3T4UA 3E8SA 1C7JA 3HCRA 4MS4B 5IBCA 1SKQA 1ADCA 4HUQA 3E5NA 2PPLA 4CRWB 3PX7A 1E89A 3A4TA 4RZHA 4X60A 1T6BY 4V38A 4OFWA 1IPHA 1PUJA 2C7VA 3PJEA 3H1TA 4WNYA 3RC1A 3ADDA 4ZVQA 2CHGA 2LUOA 3GRYA 3HVIA 2P0EA 1CRQA 3LCRA 4NEGA 3X1XA 2RHTA 2CL6X 5IRCD 4OYRA 3V46A 5DNYB 3P2YA 4P8RA 3A25A 4QLOA 3FPJA 3NPAA 3WRXC 2PE5A 3QWAA 1JLLB 3BJEA 4UHJA 1PW7A 4BE9A 2HNAA 1ML4A 4YR9A 1EJBA 4LSGA 3TFQA 4YECA 4AJ4A 4YWJA 2QMZA 3DOIA 4HRXA 2X8LA 3RS5A 1T6NA 3JZMA 4FMDB 3T3MB 2GPJA 1SUEA 2PEZA 3FY4A 3L5KA 3OSUA 2DJ5A 1RS0A 1KJNA 5ESWA 4GL2A 2VDWB 1VKJA 2RG1A 3C1AA 3O21A 4Q1DA 1H5QA 1I1NA 1XROA 1E4OA 1FRQA 1XQ1A 3K2IA 1CLUA 3RF6A 3GU3A 5DZSA 5C7OO 3D6AA 3PIDA 3P2EA 3DDSA 4M54A 4AM8A 3HR4A 2PZFA 4D43A 1B23P 5KYUA 2VUHB 3OPVA 1DAOA 1SQ0A 3WA7A 1Y5LA 4KNYA 1DQRA 4GRAA 4UJ3A 2O50A 3SFVA 5IAAA 4DB2A 2NGRA 3IEIA 3HTXA 2DBRA 2A35A 2QE7D 4X8HA 1GGHA 5C37A 1QRRA 3F5DA 4EVQA 3ZDBA 1F2DA 1ETHA 1K4MA 1XZAA 2GVZC 4JBNA 1OILA 5EZSA 4M8NE 1YS6A 3TSCA 3K71B 2YVQA 1DTWA 3P0JA 4V0KA 1W4ZA 3TOZA 5DBGA 3UJ9A 3VHXA 2GM4A 1PQYA 4BZWA 1YK1A 2JD2A 2J09A 5BW4A 1PUIA 1F4VA 5K3FB 2HCBA 1NUQA 4P92A 1LPSA 3N8KA 1PR4A 3U13A 1KMHA 4ZYYA 2WC1A 2XPCA 3LX5A 3COJA 2HRZA 3JQGA 3F2VA 2OHVA 2QP4A 3QPDA 5GM1A 4C2BA 4I36A 2VF2A 1YR8A 2UUBB 1TECE 5B3JC 3JR3A 5I4IA 4YFYA 4YS6A 1NYLA 4OOFA 3B6KA 5ERXA 2B30A 2K2WA 3ROEA 4DQ0A 6ADHA 4X65B 1S89A 1T2VA 2GN8A 4N65A 4CEIA 2G5PA 1LPBB 5DWVA 4CM5A 3QLUA 3UJNA 1F5SA 4G0YA 3DO6A 1UBKS 3RKSA 1E62A 1W9HA 4IDEA 1UJ5A 2H57A 4Q7LA 4QBIA 3ZDQA 4IY1A 5IEJA 1PJZA 2FZLA 4FT2A 3VTAA 5CA1A 3I5AA 4B17A 4X92A 5LZ5A 2ZRDA 2X15A 3FKSD 5A06A 3AF4A 3R6LA 3UGJA 5MHTA 4HVLA 4MCIA 1V7PC 3IR7A 4LXYA 3ZY3A 3F9IA 1PJ4A 1WHSB 2PWYA 2A5YB 1T3SA 1Z6ZA 5BN4A 1NSFA 1DQYA 4E2WA 3B82A 1DIHA 3W2FA 3DE2X 5FKJA 1VJ1A 2XUJA 1R4AA 4W5TA 2XB8A 3AINA 4JA2A 2YKGA 4MGHA 2BJHA 1L1RA 4U7JA 2AEEA 3KYDB 3IQGX 4JEIA 4MMYB 4G6ZA 4BNUA 5TF0A 1SZPA 2BM8A 4J9UE 3K2QA 2JBWA 3UK1A 2E82A 2HSGA 2Y67A 2W8BB 3ON5A 4CCYB 1PYGA 1K98A 3WGHA 2X23A 2C1XA 1ZXXA 2D1QA 2BH9A 3KOOA 3SZRA 1XX6A 4HWSA 2DR2A 3CRQA 1Q20A 4N0EA 1U0TA 4A10A 1M8GA 4XIYA 4O4HA 5JDIA 1M34E 2J59A 2I6UA 1P2TA 2DAPA 3MTGA 3OPNA 2UYCA 3OY2A 2EDCA 3GLFB 2B2XA 2SICE 1PTKA 3M6XA 3O2JA 3TWOA 4BFYA 4RDXA 2ZTHA 2EKDA 1E0JA 1P3Y1 4OHRA 4DB4A 2QU7A 2X42A 3RLIA 3KT3A 4WMLA 3ROGA 1MFZA 1E2JA 2ECQA 4X7MA 2HNBA 3MS4A 1E94E 1Y1QA 3PG5A 3KR9A 4E6PA 3C87A 5ETJA 3AW9A 4LF5B 5D8DA 5SY6A 1ELOA 5FLXA 3K09C 3H5OA 1C3VA 2BEUB 2O7QA 1N6HA 4UDYX 1ZUIA 2F1JA 1D1TA 2PGNA 1QOPB 4YUYA 1Q7CA 5DNWA 4Q4AB 3BMNA 3T9CA 3OUTA 2VCEA 4RJ2A 3VZBA 2Q5CA 5D6OA 1EFVB 1RZVA 2R1VA 2V3CC 3PRYA 4J91A 4GIBA 4C5AA 5TEVA 1RHJA 1VSTA 3BF7A 1AMNA 3U4AA 3WGUA 3EPJA 5HR5A 1E61A 3X1ZA 4HEA6 1RRGA 1MQAA 5KDDA 2GLXA 5HFNA 4OIMA 4M9UA 1A3CA 4FFLA 1Y82A 4HB0A 4QUAA 4H3SA 5CJPA 5CITA 3G88A 2IYTA 2COEA 4L76A 1PX2A 4UUNA 1HORA 4QSHA 2AK2A 5LNK6 1YDWA 4CXMA 1IM5A 1YT5A 1I7PA 5HCUA 5I48A 2I5PO 1TE2A 4R4JA 1GT91 2FSPA 3JQ9A 1E3IA 4KAAA 4WXHA 3ZDZB 1KYWA 4BAUA 2B2NA 2VRWA 4DSNA 2IYAA 1K7XB 1AD2A 1HEIA 2E5FA 1FTSA 2GHRA 1SCNE 1FJ2A 4I1IA 3LVBA 3WO1A 2A5DA 2GNAA 2QK4A 5F5XA 3PD1A 3QKUA 3STUA 4X7PA 1PAUA 1QGDA 1QYRA 3HDVA 5JISA 2WJ3A 3SXUB 2E6KA 3SGLA 4Y9DA 3Q5GA 4MLDA 5CURA 1RRPA 3M6LA 3V1NA 1PJSA 4IEIA 4MUXA 2O3TA 2CNBA 3BRWA 3SOPA 1J9GA 3TCNA 2BLNA 3VR2A 1X1BA 2P0AA 3R24A 4CDGA 1TUEA 4UDXX 2O3SA 4XLZA 1N8KA 3B6JA 3NCHA 3STHA 4PR3A 2ERCA 4F11A 4CKZA 3SP1A 1GQ2A 2YXPX 3A4VA 1BDHA 4JP2A 3DOOA 2VAWA 4CLOA 1U1DA 1N9GA 4QRIA 4ZRNA 4RX1A 2HA7A 1EMDA 1KJZA 1YR2A 2VDPB 3D9QX 4B43A 1YVEI 1A5TA 3ZCUA 4DJTA 2ZTMA 5B7QA 5GJBA 2UVPB 4BQSA 2IIPA 3RB8A 2DXIA 4M1QA 2XWJI 4PQRA 1YCFA 4WVLA 4UTZA 1LI7A 1REQB 3VPFA 1L0BA 1K2VN 1T0IA 2FRDC 4YRJA 4EI2A 4PVDA 4K3VA 4EPTA 2XDYA 2UDPA 3SQDA 1W4LA 3Q10A 3V4ZA 2GS9A 4QU9A 1Z45A 3VNQA 2YOGA 4BQRA 1GLVA 1KMMA 4MHTA 2HV8A 3H5VA 4FBGA 3BBLA 3ILSA 6Q21A 1LBQA 2IKSA 1TA0A 2Q46A 2YRXA 3WL7A 5BOSB 2QUJA 3WLAA 3TTYA 1ZY2A 3ZI7A 2W6IA 2QAGA 3KLOA 4DCUA 1V11B 1I7QB 2CDRA 3CLVA 3A6ZA 4ODIA 4ZVPA 1XEWY 3UO8B 2PDAA 3T7DA 3S70A 2OG2A 5EQJB 2P6OA 3GEGA 1LY1A 3ROTA 4HNVA 4NY1A 3R7WA 3LUGA 4NV0A 1AZSC 2PJUA 3LUFA 4NZ9A 5DOZA 5CLJA 3TQIA 3JQFC 3A0UA 1FXUA 2INGX 1KMNA 3JAKA 2J0EA 4S05A 4JUBA 1A5AB 2D06A 4TQGA 2A58A 1NTRA 5IMBA 4JBIA 3TSZA 2YYSA 1PQUA 3AB3A 3E48A 1NMQA 1XF1A 2H4WA 1FTWA 4H18A 4LX0A 4YJFA 5KYUB 4PZZA 4ZAVA 1QP4A 2C4VA 4C0AC 1P2DA 3UM9A 5FI0B 1SVNA 4C01A 1W46A 4EL5A 1CNEA 1ZDMA 2A4MA 2WPDD 4PANA 2BI8A 4GKVA 4J03A 4UQPA 1ZSVA 3ZDRA 2O7SA 4BYGA 1JNYA 1ULUA 4H31A 2FMXA 3DOCA 1HSOA 2ABWA 3EGCA 4RXMA 1XCBA 2HPAA 1C7IA 2I7CA 3P45A 1ISSA 3GT4A 4MS4A 4AN4A 4EG0A 1MOQA 3HWSA 4M86A 4ER7A 1JPNA 2DPYA 2LPMA 4L9AA 4DN6A 1XWWA 4F46A 4YPVA 2X1MA 1EWKA 4MITA 1EBBA 2XNDA 3ZHCA 4Y7DA 2H7XA 1E2BA 4DPMA 2D3WA 1JJVA 2JI7A 4GBGA 3ZZNA 2YN2A 2ZSAA 4BQQA 3IC5A 4D6YA 2HXSA 4I1UA 5KTKA 1PI3A 4GOOD 2ZR8A 3JPYA 3DDHA 5KEIA 2BOVA 2C8KA 2NM0A 4HNHA 4BQNA 4E5VA 3Q9SA 2P9CA 2A3RA 2OVBA 1J00A 5A4IS 3NC4A 3AR9A 1U8YA 4RD3A 4RA9B 3I9OA 4M8IA 4K1LA 4F3KA 2PV0A 3NRBA 5L4LA 5A4JA 4FZRA 1HFWA 1JTEA 1Z4LA 3GBPA 1FMFA 5FBVB 5JNUA 4XUEA 1YTUA 5EIFA 2GM3A 4ZO8A 1T8TA 2Y9PB 4DDHA 1ZZEA 1V8ZA 2ZTLA 3RF7A 3ABOB 1C9JA 3L8CA 2P2DA 1NQWA 3KQQA 4GUAA 1OOEA 3PX3A 2ZBEA 1OVGA 4OAQA 1YC5A 3AF6A 1E99A 1E58A 1KJWA 3EWAA 3SAJA 2WLSA 3EXHC 4HP8A 5DM4A 3EC2A 5AJHA 3K70B 1PVVA 1IN6A 3LLSA 4N5IX 5BO5A 1EFLA 3MJVA 4Q93A 4YWHA 3JTEA 2ZXEA 3K0CC 3GG2A 2YZNA 4LRUA 3R6GA 2DPHA 4BECA 3E5RA 5ES3A 5KTTA 1VTKA 4KRGA 4PZCA 1G20B 3QVXA 2JFNA 3QSYA 4M36A 3HSYA 3OM9A 3R5FA 1QLJA 2BP7A 3F67A 1H8HD 2RJ3A 4LAFA 3UFXB 3W5IA 5KYTA 3EPKA 3K0FA 3M33A 1ZIPA 5J4KA 3QEKA 4CCWA 4QDTA 3WWYA 4RV9A 3GNTA 3K92A 4WESA 5H4HA 2CLFB 2LGJA 2HWXA 2WSYB 3NH9A 2C29D 3DO5A 5IABA 4C14A 1SBHA 3NNDA 1RYDA 3DLTA 5E0OA 1X7ZA 5IKXA 1QBKC 3N2YA 1NW9B 1YU9A 2AG6A 2X19A 1I80A 4PG7A 4OH7A 1XAHA 5LA6F 3O9MA 1J22A 2PRJA 5EN4A 1XMSA 3BFJA 4BKUA 1LK5A 4DLTA 5A71A 1L5RA 2IPOA 3LA6A 3A4IA 4BKOA 1R6UA 2FW9A 4UAUA 4LZZA 2AX4A 3CVWA 2R5NA 3K9CA 3KJHA 1Y5NA 3TLZA 5L51A 3OT5A 1KY2A 3KJNA 2B37A 1FRZA 1XMOB 5HOEA 1XHEA 3AEKA 1KP3A 3E2MA 2V1UA 2QUAA 2R8ZA 4IW3B 4OU5A 3CNEA 4IH4A 4CN9A 3FCEA 1Y5RA 4L5JA 4IFEA 4X66B 1NMXA 2ORED 1RKBA 3OX2A 2ANCA 1GGMA 2CBXA 3ZHSA 4TROA 1U02A 4QBFA 4HEQA 3TE7A 3DL4A 1SUDA 2D1RA 2G9NA 1JEJA 1XDZA 2EZ4A 4FS3A 2H1VA 5BWCA 1PHPA 2JFHA 3LYLA 3KEFA 4U3JA 1XN4A 3BGIA 1EP2B 2O8BA 3LYUA 1RTTA 1RPZA 1LW6E 4PYOA 3OF3A 3R7WB 1BN6A 3Q7IA 1LLUA 4LY0A 1XCJA 3Q40A 1OWLA 4V1CA 1OMOA 1RYMA 4NMWA 4DXDA 1KY3A 2NTYC 3WI7A 4YRKA 1G3IA 4E07A 4Q48A 2ILTA 5CM9C 4GP9A 3U4QA 2J0QA 4GPIB 4Y2XA 1SKMA 1S2NA 3G8CA 3UV6A 4ZI7F 2J3QA 4FD3A 1P9WA 4K9SA 5FBKA 3ZH9B 4CDRA 5EY5B 4ITUA 3IHTA 1KI7A 4TZKA 2PXXA 2OCBA 3CX6A 2SNIE 4UUQA 5EMLA 1SOVA 3WLJA 5IXJA 5JNRA 1S7GA 1DIOB 1FUUA 2CY0A 3EJWA 5DYNA 1P80A 1K6IA 3PENA 1MOSA 2WZQA 1GR1A 1TQHA 4P93A 1BXRB 3HY4A 3L4EA 3MJHA 2IZ6A 4OLHA 3GEBA 3SWWA 1K97A 4JHXA 5DIZA 3JQBA 2ECOA 3UXYA 1Y7IA 1FQOA 3HQ4O 4OKNA 1VYHA 5TS2A 2OM2A 3ASVA 4R3UC 5F9HA 2FWRA 1C7FA 2YOFA 3PKJA 1VPVA 4G86A 5ALMA 5IBQA 5K2OA 1M1NA 3N3AC 4W5WA 5F1KA 3LPNA 3B3JA 3D0QA 3I4CA 4RJIA 3T35A 2H54A 5FUMA 1U7XA 4HNSA 3WIOA 1NVUQ 5DF1A 3DXYA 2BDUA 5KTNA 2QI9C 4JLKA 3LWDA 4F12A 1F14A 5C18A 4KV7A 1XYYA 2J6IA 1K8QA 3Q3GE 2RKWA 1BGXT 2PR7A 4HDQB 3L84A 2V6GA 4QDKA 5DB4A 1NRWA 4XFKA 1PDOA 2FMIA 5AI0A 5JCOA 1OV6A 2G9VA 2UV8A 3QUCA 1YFKA 1MENA 4HX2A 4TL8A 4HLNA 1HV8A 3QTBA 1GTVA 4OXNA 3EF0A 2FZ5A 1HLFA 4OSOA 3MAJA 2BI7A 1GG2A 3BWBA 1M2OB 5FOUA 2D74A 1HK7A 1IIRA 5E4YA 4DCSA 2Z2YA 3A9VA 4B3BA 7MHTA 1SWVA 3UK7A 4UFPA 2DKFA 3D3WB 4GI7A 1Z0UA 2I71A 4A3SA 1F8FA 2PUGA 1O94C 1GPUA 1EP1B 2JI6A 2HU8A 5DTRA 3SHWA 1YJBA 1ZJZA 3O8QA 1ISMA 2IYWA 4KSYA 2YW2A 1K9SA 3INRA 5CA1F 4RD4A 4YP9A 4NPHA 2JCSA 3X1MA 3A1VA 4D5EA 1EGQA 1JJFA 1O95A 2NWQA 3Q5EA 2ZUFA 1CHDA 2P5YA 4Y3UA 5B1IA 3EMKA 3DCIA 1RE1A 4KN9S 4Q3CA 3RBXA 1EA5A 1YJQA 4JP8A 1EFVA 2P2CA 4RHCA 5IU6A 3GROA 2DPGA 1JHOA 1K6MA 1YB5A 3GAAA 4IZOA 2PK3A 4TVOA 4DJ5X 1Q91A 1V9SA 3RC9A 3RTCA 4HTAA 5FL7A 3QGMA 1CQIB 1JMVA 7ADHA 2PVSA 2NXWA 2V65A 4HD8A 1SUBA 1EDDA 4L8GA 4HDRB 2AFRA 4XGKA 4EK9A 1P2BA 4CPDA 4KNVA 1J0XO 4AMGA 3VAAA 4YJ2B 3BL8A 4NK5A 3TLKA 5K8CA 3QBEA 5LFAA 2HQOA 4PO3X 4ER0A 1ZISA 1N1EA 1TX4B 2FPOA 1P45A 3MJCA 2Z95A 3NUQA 3UWMA 3ZI4A 1PE0A 1Z7GA 2ZB2A 1W0KD 2PFKA 3HWWA 3QE9Y 1Z2DA 5G0SA 4NFSA 1U0OC 1YDHA 1Z7WA 2VYCA 2XAAA 3D4OA 3NRCA 3PQ4A 3M1YA 4HH0A 2UZ1B 4MKXA 5CDFA 3RAPR 2BFBA 4QRHA 1T8PA 3FR8A 1C81A 5MFZA 3WL8A 2NUPB 3H84A 1BA2A 4AS2A 2Z2XA 1W87A 5H81A 1QGUA 3K1AB 4F6RB 3WOHA 2WKWA 2WM2A 4TVSA 3O2QB 1FNSA 2QVGA 2ID9A 4KDFA 2NIPA 3PQCA 1MC8A 4G2TA 3WNBA 1YJCA 3HKEA 4XX0A 1N5IA 3UB4A 3WSWA 4KWCA 1KYTA 4NMHA 3ZE7A 1IL0A 1KY4A 3KXIA 4QUGA 5AIBA 3MS7A 4L6AA 3HA3A 1AQNA 4C78A 1ZICA 1A7UA 1ZI8A 4CKYA 3OPMA 1JU4A 4YV7A 1NW3A 2PKCA 3N7AA 4HPWA 1IN8A 3TVYA 3T95A 1DX6A 4P0PB 2WAYA 3FKJA 4O0MA 3J7AC 2WBLC 1R15A 1R3DA 4MQ6A 4QRDA 2O4UX 3O47A 4FLEA 4L3WA 3UMGA 5CA1B 4OD0A 3UJ8A 3FWNA 3UENA 1R0XA 1L5OA 4GPTA 5JNSA 1UMBA 4YDQA 3K9BA 5JR3A 1WXXA 3DNMA 1BDMA 1TNDA 1NR5A 2ZYHA 2HR1A 2XQFA 3QUQA 4WOPA 1E6WA 3N2KB 1DRJA 3CZAA 4A0QA 4EJ0A 2ZT8A 4O2LA 3WLSA 1P81A 4FDAA 5JATA 3D0KA 3LQQA 2LV8A 4ZOLB 2F8TA 4LOAA 4XGIA 2O8EB 4GBJA 1D5WA 4QYWA 4X44A 2F48A 2PSHA 5ABPA 1XTPA 1BVUA 1NN5A 1YE5A 2GDZA 1PUXA 3ASZA 1C7ZA 3DG9A 4Q01A 4ALLA 3RIHA 4ZZ3A 1DUSA 1KA9H 4AJ2A 4YXWD 2V4UA 1MRNA 3DEZA 4DABA 3LF2A 3I8XA 2VPIA 5KNCA 4WXRA 1SBYA 4ZYZA 2WU4A 3DBOB 4O2BB 3I2FA 5DXAA 1TYBE 4K1XA 4EYKA 3AVWA 2PWZA 1XA4A 2P2LA 3MCWA 3S27A 5LMCA 1FSFA 3BL5A 4NQRA 4EVSA 1A2KC 3KFXA 3BKWA 3TNFA 3AEZA 4FYMA 1XRMA 3NX4A 4DEXA 2GCOB 2OA0A 2GO7A 3PUYA 2HJSA 3PEFA 4GLBA 4TTRA 3U4GA 3WHLA 2OYSA 1ONBA 1TDJA 3H2IA 4RFLA 4I1YA 3WGJA 5DYYA 4R9UC 4Q9NA 3FCUB 3CINA 2UVPA 3A4YA 3DEAA 4Y6PA 4YY3B 4EG7A 4XW2A 2A92A 1E7WA 3A11A 3DBIA 1JXQA 2GSWA 3G82C 3GH3A 2F67A 4I1RA 5AKYA 4ZHQA 3LXUX 1QO0A 4U3JB 1E59A 4LHYA 2R1ZA 3DBHB 2E0IA 3CLTD 4QQNA 4XB1A 5D5QA 1KH1A 1LPPA 3I42A 1OTXA 1CY6A 4OLAA 2YJ3A 3V4RA 3M5DA 2Q6TA 4F4UA 2YV4A 1KARA 1UKBA 3QU5A 1BHSA 3WRXA 2ACVA 1B16A 2CLIB 1PVOA 3DNFA 5B64A 3TSYA 4P4NA 2XV1A 3GEPA 3Q9LA 3JQAA 1MH9A 4YK7A 4DLNA 3CUYA 3FTDA 4DQVA 4WCVA 4FGSA 3OWHA 1C9DB 3HO1A 2DT5A 3M6AA 3KOZA 4LXHA 1U3VA 2BGRA 2K6GA 1JG4A 1HRKA 3OQHA 5GZ1A 2H0QA 5BXYA 4EHHA 3M6MD 4JKYA 4L28A 1E7RA 5C81A 3EYAA 1KAOA 1WW3A 1HDIA 4ZXPA 3ZHQA 3FFBA 5JQGF 3ZQKA 3W2GA 4M9XA 4F3CA 2NUAA 2V9PA 1Q21A 3R41A 2IBSA 4O29A 4MW0A 4K8RB 4MWCA 1XHFA 2O2YA 3IEKA 4EG4A 3MOSA 5CBPA 2GX6A 2XA1A 1R5BA 4EY8A 3IE2A 1PF7E 2Z1NA 4MAFA 3FGOA 5LYYA 4YYZA 4DMRA 1GTZA 1FXWA 2OGUA 4A2WA 4ID3A 3RJTA 1Y81A 1YRWA 1PK8A 2IX3A 3ERCA 3ELUA 5DX8A 1QGZA 3L8ZA 1G21A 3WNQA 5JS2A 3QXCA 2VOJA 2IS1A 2R1VB 4Q7EA 4EGQA 1T2FA 1U2TA 3GDGA 3OU2A 1P1FA 3QKSB 4N3CA 2P4SA 2UYQA 2LE0A 4QAQA 4Q4AA 3QEAZ 4O4IF 2IZ7A 3GAZA 3NBZC 2PYDA 1LF5A 2Q2WA 3GI1A 3JYPA 3PDHA 4J2HA 4RZ2A 2V7GA 3S2YA 3SPXA 1MMFB 4EEXA 2AZXA 1HSZA 4XDYA 3DF9A 3QENA 4JB8A 3I73A 4FFBB 4ZQEA 5DN9A 2PMFA 3G02A 4MX8A 5C5IA 3JW8A 4MW4A 4XKJA 4ZV9A 1PZEA 1FY2A 3DLPX 3PFHA 3V7WA 3IERA 3JQDA 4EH1A 2FW8A 2XEXA 3U0BA 4J16C 3Q0IA 5IWAB 3N0WA 2V0GA 1EXMA 1C0EA 1C1XB 1U5AA 1P61B 2J8ZA 2WA1A 1V37A 1QAOA 5L4SA 5A5VA 1H2ZA 2NO4A 2VBGA 2ZB4A 2HC9A 3CFYA 4MV7A 1P1CA 1IC6A 3EQ2A 1JDTA 1VP3A 4JVNA 4P08A 4C7XA 4PGFA 5ALKA 1SXPA 1CUIA 4TRNA 2HQBA 3VNBA 1DAFA 1DRUA 5CGQB 2C31A 1OGYA 1HM5A 4FYKA 5FR1A 4LFCB 1ZD9A 3Q72A 3RJZA 3SX0A 4EVRA 3UGKA 3ANNA 5EWLA 1ST3A 1V9CA 1SH7A 1YKGA 1YZUA 2PD6A 1TAHA 3LF1A 3GJYA 5FA5A 5IAOA 5IJ0B 2V03A 1HETA 2PXAA 2OCGA 3IMCA 2WKPA 1OXMA 4TTAA 5ALZA 4ZEWA 2D1SA 2ID4A 1Q17A 3FDZB 3H19A 1B93A 3GZ4A 2W98A 2ISSD 3O4GA 4TL7A 2I1VB 3AF1A 1NC3A 2I55A 3GVPA 3KWFA 1PT9A 3QTLA 1HLGA 4OHCA 1FU7A 1W0CA 2VJNA 5EKTA 1T2CA 3ABQB 4GP6A 4L02A 1XJQA 4ND8A 1T9BA 5EINA 2NNWB 4C7OB 2ZUCA 3UUEA 3BSSA 2VHVA 3IOEA 1V16A 2CE7A 4CVNA 1PR3A 1AJEA 2JFGA 3BWEA 3KJFA 3O8LA 3KB6A 4ZCLA 4F71A 2V3VA 2GKSA 3HNRA 4DGSA 4ETNA 2QNIA 5SZHB 3ZQJA 2J5BA 5AK6A 4C3VA 1JQEA 4QBTA 5HVNA 1I7DA 3DZBA 1FPMA 1QQBA 4LYFA 1MJ5A 4BP9A 1NIPA 1X0XA 3L6RA 4KN6A 2Y3IA 1V11A 1AM4D 3V8BA 5HZHA 1BAPA 3FNRA 3OD1A 3PUJA 4G0WA 3EVTA 1WL8A 2I0FA 4YP5A 3ZWVA 1KMHB 1UBSB 1ZK3A 4U39A 1CFJA 3CBQA 1KWKA 1ZNWA 3T1OA 1XDSA 3USZA 3CNOA 2YH2A 1ZH0A 5JYCA 1RRFA 2VQSA 2VHXA 1R8YA 4NZMA 3RADC 2EIHA 4Q02A 1LV8A 5G1PA 1N2JA 2QNRA 3LX6A 1E5DA 1ZCFA 4YV0A 2CLSA 4NCNA 4WPGA 4EHKA 4IDDA 4JELA 1THMA 4I55B 4TOIA 4Z2YA 2A14A 4ZARA 1O58A 4OHZA 2QPTA 1Q1AA 3UV3A 3BWMA 4KVFA 2MHCA 1OZ0A 3FVVA 4WV3A 4DNFA 2ZZKA 2BGNA 1Z13A 2DSTA 2V7UA 3KR1A 2X7HA 2CHQA 2ZYRA 3DW1X 4BNKA 2BFOA 2FSSA 2JGJA 3B53X 4GF5A 5MN5A 1L4HA 1VP9A 3JQ9C 2PAFA 1TZCA 1OX6A 1UAAA 4UMDA 1WKBA 5IVDA 4K6OA 4HFRA 2VDWA 4TYNA 5YASA 1DAPA 2NSJA 5KPJA 4MUEA 4X3CA 3NWJA 3U7QB 2CMHA 5CFRA 1OFHA 2HMUA 2IHBA 3N53A 2FB9A 3M1LA 4PLCA 2EJTA 2IW3A 1DOAA 2PCLA 1X15A 3GYGA 3KIPA 3NAGA 4X1IA 5BSMA 3TPFA 4F4HA 2KW5A 3OD5A 3K9HA 2Z2ZA 4TTJA 1DARA 1CRLA 2QRVB 4YJ3B 2AE1A 4TL6A 4PSUA 5IC5A 2VSOA 5K05A 5L3QA 3ZGZA 4X54A 1C1HA 3L93A 3M70A 3KTAA 5CW2A 1GFSA 2AOTA 4JBYA 5JD4A 1NBMA 1FYWA 4LF6B 2G07A 1NN1A 5HRUA 4HAWA 1A9OA 1AK9A 3AUYA 3K0AB 4KP7A 1XD2B 1TIBA 2A9JA 1RQPA 3MTJA 3RR2A 2A0UA 3M4ZA 5HNKA 1DKMA 1ZMRA 5GV7A 1SGWA 4JNCA 1DADA 2BKXA 4U2DA 5CVDA 2C92A 1UFOA 4MVXA 4JJZA 4AUKA 2QXTA 2CYCA 4PQFA 4D4HA 3PKZA 5F2NA 3TPCA 5JJBA 3W8NA 1QS0A 4DE5A 4DRXB 5KC8A 3WV4A 3E03A 1I2BA 3NYRA 2QLTA 5EJ5A 1NW6A 2C3UA 2WPNA 3AKCA 5EIBC 1SXJC 1Q50A 2FWBA 1KJJA 3DVLA 2HRRA 3KK0A 4P5PA 5EYPA 2VHCA 2XNKA 4CKXA 5BUZA 3I09A 1A0OA 2O2ZA 3WIBA 1G4UR 2P79A 4Z4CA 3HXQA 1YL6A 3H8SA 5A03A 1DKLA 1SFRA 3EUAA 2WWWA 3C6KA 1ZUNB 4QC2A 5HTOA 2NVOA 3ZIAD 4BZZA 1YZ3A 1B1CA 4R1PA 3I39X 4IYRA 1JEEA 3DL0A 1KQ3A 1M2WA 3G85A 3PNVA 1Y8RB 1BO6A 4P3OA 4RJLA 4YASA 3IP6A 4CDMA 1GPH1 3BERA 1QC5B 3SYLA 3PHCA 1T0UA 3JQFA 3VKWA 2HU2A 1BRMA 1C80A 2X3YA 5CP8A 4MI3A 3G79A 3HBMA 1KYXA 4HNAA 5ALLA 4CHTA 1XG5A 5TJHA 2ATVA 3DONA 3AVPA 2AWOA 5KNCH 2J48A 1QHXA 4TTTS 4C4SA 1IWPB 5DCYA 2H7YA 3K73O 1EGMB 2ZLBA 3JARB 5JCPA 3SXJA 4UEQA 1PL7A 1QH8A 3AHEA 1FS6A 3BD9A 5D3MB 3VU0A 4L73A 1IEXA 2HZBA 3HG7A 2BBTA 3MILA 4OHUA 1KI4A 1NBME 4BRWA 4CQMA 3RYCA 2DUJA 2FP4B 2H6EA 2WFMA 5EIEA 4BX0A 5EJ6A 2HRBA 2R9VA 2X5NA 2QTAA 4PYIA 4JL8A 5AHXA 3AERB 2QT9A 4OJMX 1YR7A 3AUAA 4PE5B 2PKXA 1M2VA 2Z5VA 1P0MA 2SBTA 4RZXA 1VYTA 3F1LA 4JA0A 4JT2A 4MPJA 1OA0A 1XZGA 4UZEA 4AMZA 2D2EA 1XXLA 1ZM7A 2VKQA 4LBZA 3ZY2A 1JHVA 3DULA 4X8MA 5ALDA 4L5IA 2FEAA 4K87A 3G2MA 2FSVA 3IBYA 4LYEA 2OFFA 4DC1A 3SR3A 2C7RA 4FB5A 1PVDA 4EKNB 1P0CA 4S0ZA 1U65A 5FD8A 4OB6A 3N2GA 3WLIA 2ODBA 4ETIA 5JSZB 4QPPA 5IEBA 1RI4A 2VDVE 2VT7A 3PS9A 3B9PA 3BIFA 4XPIA 3BILA 3OQJA 5IVKA 4I5IA 4EFNA 5LR6A 4DCMA 3CXRA 3GVIA 3W2IA 5AFSA 3DPSA 3EOAI 4B5KA 3PUHA 2JF0A 3ZCXA 5EJ8A 2I33A 4MAAA 4OYLA 5IBPA 4BV8A 4JZKA 2ZP1A 4GE0A 4B3GA 1K2WA 2ZSDA 2RARA 1BE6A 3Q7EA 2WVGA 5F23A 2QBYB 4CKWB 1FLVA 1Q7EA 5GZ6A 4BBPA 1UBHS 5BUQA 4B45A 5AIAA 4D81A 1AURA 1YIAA 4Q05A 4AX8A 3A4LA 1N0UA 4DCVA 5H82A 5ES4B 4U9IS 2C2GA 3D8BA 2J9RA 4Z2AA 1NNSA 4L16A 5AVRA 2P3LA 4R40A 1I7SB 4TLBA 1C30A 2EP8A 3WB2A 2JCXA 2OUKA 4ZO7A 3ZWXA 5E7MA 1FX0B 2A4KA 3NHYA 3VYVA 4HAOA 5HKLA 3Q5DA 3DDUA 4IZ6A 4Y30A 2Q6OA 4PO9A 2H52A 4YEDA 1Y8CA 2P7HA 4PLVA 3VMFA 4DDMA 1LSSA 2Z83A 3OHPA 4GPD1 4K86A 3EIQA 1QKKA 2JG3A 4J4HA 2CVQA 2IBMA 2ZANA 5L53A 4EF4A 3AF3A 5FNVB 5K0LA 4ND3A 2IH5A 4W7HA 1Y8RA 4ZQFA 5E4TA