2ZRBA

Msreca q196e form ii'
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
325
structure length
306
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEVGLQARLMSQALRKMTGALNNSGTTAIFINELTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 81
structure length 306
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrbA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrbA01
1G5TA 1R5BA 3FGNA 1VMAA 4HYYA 4DLTA 4QC2A 3A1WA 2MSDB 1XFAA 2YWHA 3SJZA 4B2IA 5KPJA 1KI7A 1SXJC 4HB0A 3ICEA 2EFHB 4LJ7A 4DCVA 4MITA 3AF1A 3KJIA 3CM0A 5JZVA 5GADl 2ZSEA 3FHTA 1Z6XA 3EWSA 4L16A 2O8EB 1U8ZA 2Z43A 4NZYA 4V0OA 2O8DB 1HV8A 4BUJA 2ZR0A 4EFMA 1A82A 1Q1BA 1AS2A 1FNMA 2B8TA 4W5HA 2EFGA 2IYWA 4GP7A 1S9HA 5LD2B 2GCOA 2QAGA 3ND9A 5K8LA 2ZVQX 2YINC 2GJ9A 3UKDA 3WY9A 5DI3A 4IOLA 3SS8A 4M1MA 5HKKA 5KHOC 3THWA 1Y3AA 1ZAKA 2IEYA 2FFQA 3VU9A 2BIFA 1G19A 4Q1FA 3M4YA 2BC9A 3D7MA 4EPVA 3REFA 3OEHD 2J41A 4XVQA 4EFNA 4OK5A 4JLAA 2VLIA 4HSEA 4PC7A 3LXRA 4JLNA 4C0JA 4CW7A 5BQ5A 1G18A 4ARZA 1WXQA 1Q20A 1H8ED 3IIKA 2CNWD 2CE2X 3ZIAD 4B73A 3C16C 4LBWA 2R9VA 2OZEA 4CVNA 4GMXA 1JR3D 4RCYA 1HYQA 5DI9A 5DNYB 3MGCA 4BLQA 3IKJA 2IUSA 1EX7A 3K0AB 3DKPA 4LV8B 4Q1CA 2BMDA 4FW9A 1KMHB 2WWIA 3AH8A 2ZR7A 1VCOA 3BB1A 4GNKA 1E9BA 4RCZA 1RJ9B 3THXB 4KVAA 4Q4HA 5G40A 3AF2A 4US1R 2J9RA 4NDZA 5FL3A 1AQUA 1P60A 1J8YF 1IHUA 1MO4A 1Q1EA 2JLZA 3W6OA 1KZ7B 1FTSA 2ATXA 2WMNB 3Q7PA 4H1UA 4PZYA 3B8HA 3PITA 3RDPA 3AUXA 2IK8A 2G0NA 1E96A 1EFCA 1E99A 5JJLA 1P4SA 5CYPA 3HU2A 5FOTA 2DB3A 4C4PA 1X1RA 2LKDA 1DTSA 3CLVA 2QP4A 2WAXA 1KK0A 4DBLC 2DHRA 3KX2A 1DOAA 5E7JA 3K9NA 3DOFA 3K70D 1KDOA 1EFTA 3WRYC 4URUR 1U0HC 2ZRKA 4URXR 1IXRC 3BK7A 3RS0A 3K9GA 1W4RA 5KDLA 3IUYA 2R6AA 1XMJA 4EJSC 2AKAB 4LC1A 1MH1A 1Z2AA 1G21E 2FFAA 2WWFA 3HWSA 2G9NA 3SJCA 2GHIA 1AM4D 2JA1A 4DZZA 2O8BB 2ZUCA 2NMVA 1W4AA 2Q0HA 4KFSA 1HE1C 1G1MA 1HE8B 1RRGA 4QFMA 1S8FA 3ZZ0A 3R7WB 4BFZA 4D80A 4KFTA 5JFGA 2QMOA 1QVAA 4UNRA 2XOKA 1A2KC 1AZSC 2XAUA 3Q72A 4QHYA 3AVYA 3Q8XB 3T5GA 4ERNA 5FPTA 3MFYA 1VCIA 4LHZA 3RRMA 1Z0KA 3OHMA 4LRWA 1GITA 4H1VA 4U00A 1XD9A 2ZE5A 4JYBA 2QSZA 2P6NA 3WNCA 4V02A 1I2DA 4QNRA 2WSMA 4M8NE 4C7OA 1TQ6A 5E3HA 1WE2A 2ASEA 3CW2A 1IM2A 2ZJ2A 2P5TB 4W9MC 3ASZA 4DC9A 5IHPA 1JR3E 4RD1A 3U44B 1OIWA 3OIVA 4PC1A 2FNAA 1WP9A 1LS1A 1TF7A 2UKDA 3CPHA 4IKEA 3ZS8A 1MABB 2C2HA 4XVRA 2B92A 2H7VA 3ZQ6A 3SYLA 1NLYA 4KBGA 1TQ2A 4MRNA 3QEOA 4BEJA 2ZS7A 2VYFA 5FUVA 5LB4A 2P5SA 1FMLA 2ZJ5A 3EZ6A 1SKQA 3OIYA 4RD4A 3V4RA 4DDTA 5BN5A 1D9XA 4IDPA 3VX3A 2CHGA 2B7BA 4PTLA 1T4GA 4G01B 3KTAB 2GBLC 1E98A 4PPQA 4TLBA 4EPWA 4LJ6A 5KDOA 1OFHA 2BEKA 3Q5DA 1H8HA 3THYB 2DWPA 1QG2A 2GVZC 2ZJAA 4N0EA 4EKDA 3BAFA 3NC1C 4AYTA 1KYIA 2BMJA 4O0MA 2QMUA 5J4HA 5FOWA 1J7KA 3DMDA 5L3QB 4D4LA 2PZGA 4XH9B 1Z83A 2OEPA 1N5IA 1NN5A 2MMGA 3C14C 4MRRA 3OIWA 4LI0A 3R9XA 4PQYA 2AWNA 4V0LA 4BWYA 4YC7A 2VP9A 1XTJA 5EE3A 3QY0A 3CX8A 2Z6VA 4M21A 2QBYB 2GCPA 1OH6A 3NEYA 1ZD8A 1OPXA 2R65A 3LLUA 2WAYA 4IHQA 1WCV1 3WMFA 5JCZA 3U3MA 3B1VA 3RSLA 3KJHA 2IYQA 3W3ZB 3EIHA 4AKIA 2ERXA 3RLFA 1R8SA 3QOFA 1G3UA 1AA9A 4KITB 1JAHA 2NPFA 3T12A 4A2WA 4RZUA 1N5JA 2C98A 4IFEA 2G88A 1G16A 2P6RA 1DAHA 2CDNA 2J3EA 3OEEA 3BH0A 1NY5A 4Q66C 1UDXA 3CNLA 4FCTA 2HV8A 2IYSA 2IUTA 3ADBA 1SZPA 3AVXA 4F4IA 4EPXA 2RGBA 3GJ8A 3ADKA 2IA5A 3GLHA 3C41J 3IIJA 4L4UA 1IY2A 4RD3A 4WZ6A 1NSTA 4NYJQ 4Q4LA 2CEAA 4JLBA 3U60B 4IXMA 1KTVA 1GWNA 3B85A 4LSGA 4WOPA 3L8ZA 2QSYA 1E2IA 1KZGB 1VYVA 4Q1BA 1KGDA 4BLOA 4ZDKA 1VIYA 4Q02A 1AQYA 4TMTA 1KSJA 2C99A 3O8BA 1M7BA 1DS6A 4W5JA 4A4DA 5IK2D 5C18A 4LHWA 1RC8A 3AVUA 3UG6A 4CYMA 2G0TA 3W8RA 1II8A 2RGEA 4ZV4A 1G7CA 4ZO4A 2ZRLA 3TR0A 3D3QA 121PA 4HUQB 2DWOA 4DLXA 2WWHA 2XTMA 1Q3TA 1Q22A 4ILEA 1GP2A 1CR1A 3CONA 3ZYCA 1CJVC 4URZR 1FZQA 5AJWA 3TAUA 2BM1A 3W90A 1CJTC 3EX7C 4EAQA 1W1WA 5LBIA 5H1YA 1E94E 4Q5IA 3BH7A 3KKQA 1GRQA 4V0NA 5EE1A 4CEIB 1D6JA 5K8UA 4RZ3A 3BE4A 4A6XA 1RKBA 1VG8A 4GDFA 4DT1B 4HLCA 1OLOA 4YONB 4FWIB 1E0SA 3Q85A 2G1JA 4TLCA 4MRPA 2WVJA 3VKGA 4TYQA 5SZHB 4US2R 1ANKA 4MDEA 1E2DA 2XZLA 3B1WA 4UXJA 2YOHA 1E2FA 1RFLA 3CO5A 1R8QA 4LYAA 4YMSA 4A2QA 4A1FA 3ONWA 4LJ4A 3GLIA 2OXCA 2LWIA 4WIAA 3SN6A 2IYUA 4Z8YA 4UQOA 1X86B 1KHTA 1XXHA 3H84A 2FE4A 5HCIA 3KB1A 1ZM7A 1VECA 1W36B 3SQXA 1PV4A 3TIFA 1OJLA 1XCPA 4C0LA 3IILA 1W0KD 3TSOA 1S3GA 3B1XA 2FJUA 1ZM2A 5CJPA 3U2QA 1P61B 1L4YA 1S1MA 3FHOA 2GZDA 3GLGA 2GF0A 1NJFA 5IDVA 1DPFA 1LB1B 5J47A 5C1BA 2J0UA 1T6NA 3TVTA 4PANA 1XBTA 3QXJA 4BGDA 4D0GA 5HTKA 2JDIA 5J4VA 1P2TA 1AK2A 1FX0A 3AKYA 4MYUA 1I4TD 2FMXA 4K46A 3HDTA 5DHFA 5AJXA 2BBSA 1II0A 3ZZTA 4KODA 2AK3A 2BVNA 4KFUA 4B3GA 4U5XA 2VO1A 3QXHA 5G3ZA 3B5JA 2OCBA 5HR5A 2Z83A 4PR0A 5F9HA 5F9FA 2ZIAA 1E79A 3C15C 3EW9A 1ZD9A 1DG1G 3PR1A 5E95A 3T1VA 4TYNA 1MO6A 3ADDA 1JXMA 4TLEA 2LCFA 1MR3F 1ZNXA 3SJBA 4V0ME 1OIXA 3HP1A 5FR2A 2IS1A 5BYKA 1DVRA 1OFUX 1U94A 1ZW6A 2WSSA 1VCNA 1FTNA 2BMEA 3PIRA 3LVRE 1OXUA 3AVWA 5B64A 4GOXA 1NF3A 4L9WA 4OHXA 5AUOB 1Z6YA 3MAAC 4Z8XA 2NTYC 5FOSA 2O8FB 2ORWA 1NVWQ 1XJCA 3I8SA 3IQXA 3REGA 1E1QD 5TARA 1U81A 2QRNA 3E5HA 4YMWA 1TUIA 1L2TA 1TQ4A 2SHKA 3BERA 5TB5A 2EWWA 4BZPA 1CR4A 1KJWA 4AYXA 2VSOA 1BOFA 3ZVRA 4G5RA 3FOZA 5AWFC 2VSXA 1UKYA 3VR2A 3C7KA 4Q19A 1Z28A 4ESVA 3UMFA 5FOXA 3A37A 3EZ9A 3QPUA 3RC3A 2NO1A 2WJVA 3BIFA 2WOJA 2GXSA 5CB6A 2F43A 3EA5A 2ZEJA 1Q12A 2JATA 1G4AE 1X3SA 5AR1A 3EPLA 1JJVA 4U7DA 3QBTA 4A15A 1XTQA 1Q57A 4TYPA 4Q47A 1VTKA 2WBLC 4ASUA 2V3CC 1PZNA 5CJ2A 1EG7A 1ZJ6A 2QA5A 3KB2A 5CB8A 1GUAA 1XWIA 1XU4A 3RS3A 3S1AB 1G5RA 2DPXA 2C78A 4BE7B 4LBYA 2GA8A 5JLJA 1VPLA 2E1RA 2GETA 2RGAA 4I99A 4NH0A 1OHHA 5FPHA 1FMJA 2ZI6A 3VR3A 2VA8A 2FEMA 3THOA 4KLNA 5DISB 4DVGA 5AUNB 4BLRA 2J59A 1W2HA 2NPIA 2YC2C 4M9QA 3QKUA 4IDQA 4DLWA 1E2KA 1U8YA 3B13B 2F1IA 1VYUA 3LQQA 2ANBA 2PX0A 1N3BA 1R5OA 1ELOA 2PT7A 2BV3A 2PCJA 3KJEA 4RFVA 5GJBA 1Z06A 3IPXA 4Q4JB 1HUQA 2VL7A 3W5JA 4P4SB 2I3BA 3E2IA 4Q7MB 821PA 3H1TA 2F7SA 4TYYA 2HXSA 1NBMD 2PJZA 2XSZA 3PENA 3MWLA 3AKEA 3ZVMA 1SXJA 2E9SA 4B35A 1K6MA 5C4MA 1SGWA 2IL1A 4R98A 4UNPA 3BB4A 4Z51A 4DUGD 2F1RA 2HF9A 1KDPA 4TL6A 3F3YA 2V4ZA 1OH8A 5L8VA 4TLAA 5DN6D 4KU4A 4D4JA 2EQBA 4AIIA 2QE7A 4DSNA 2GILA 4RFSA 1W47A 4YMTA 1W4CA 1WQ1R 4CRWB 1KO7A 221PA 4B34A 3BJIC 4Q4AA 1F2TA 2AFHE 4D4KA 3QXCA 4TMWA 3OE7A 3BWDD 5BW8A 4HB2A 4HZUB 3HJNA 3QXXA 2WICA 2O5VA 1ZNZA 4F91B 4XJXA 2MSCB 3FFBA 5ELXA 2AWOA 2F9LA 4DB4A 3AGPA 2HYIC 1FW6A 1YE8A 4DDWA 2JLWA 1E1RD 1DAMA 4MKHA 3L0PA 2VH5R 3MLEA 1C1YA 4HAXA 5TV2A 4D2IA 2WHXA 2H92A 4ACBA 6Q21A 4M53A 2W0SA 4AD8A 1S9DA 2F3RA 4Z1MD 3EPJA 2OCPA 2G6BA 2J7PD 5TXGA 1BYUA 2QTHA 1EFRD 1YZQA 3WRXC 1N6NA 1NNEA 1IN4A 2ZE6A 3I4LA 2J45A 5JI2E 2G77B 2GXAA 2F55A 2Q9CA 4HLQB 4LV5B 2P65A 3PEWA 1D9ZA 2Q9BA 3VR4A 3NC0C 2H1LA 1XEXA 3AKCA 1R10A 2QM7A 4PC3A 1FP7A 1W46A 4MRSA 1BMFD 3SOPA 5J4LA 1CJUC 4CEJB 4Q9HA 4AKEA 2WOOA 3AQ4A 4IRUB 2H5EA 1QHHB 1SVMA 2JIZA 2KB0A 3X1ZA 3LFUA 4O25A 2WZQA 4EQ6B 3LO5A 3U4QB 3EPHA 1IY0A 1GL9B 1GIAA 1CLUA 1NVUQ 1BYIA 1J8MF 1UADA 1T0JB 2B7CA 4BZXA 4D26A 3GFTA 2FSGA 3ADCA 1NMYA 3B1ZA 3CF2A 3H0KA 1L7VC 3L8YA 2IXFA 1NN1A 2FU5C 4HAWA 4LPKA 3T1TA 1IY1A 1AKEA 4PHGA 5DLQC 3ZLJA 4WXPA 1UKVY 2I1VB 1N5KA 1NBME 4L15A 1P7CA 5FI1B 1DO2A 1A1VA 2J0QA 2OBLA 3QNUA 1AS0A 5G3YA 2ZREA 1WBBA 1J70A 4LY6A 2ZR9A 2RB4A 2CMKA 3SNHA 1LVGA 1WF3A 3FE2A 4BFYA 2RGDA 2PLRA 3U5ZB 1PJRA 5FUXA 2NO6A 4P32A 4DSOA 2UZIR 2AL7A 4Y0AA 4HDOB 4A6PA 3SFVA 4EJSA 2ZYUX 2OBNA 4FMDF 4TTQA 3NHBA 4EFLA 2FWRA 2CLCX 3RWOA 4B2LA 3RHFA 4QGAA 2QORA 4Q03A 2FX3A 2GCOB 2QAGB 1W44A 3HU1A 2NIPA 4U02A 1NKTA 5EE9A 4MGYR 5DI3B 3FPAA 3THWB 3FMIA 4NCKA 4ZI3A 4D4MA 2W2XA 5EXTA 4URVR 4TZ0A 3VU9B 1CP2A 4II7A 4ABYA 1W48A 1ZC4A 4R2HA 1CEEA 1UBCA 5HCNA 1ETUA 1KI4A 2ANCA 4HB4A 4DLYA 1G8YA 2ZANA 4B74A 4YMVA 1YRBA 1R5NA 4ARZB 3A58B 1F60A 2BDTA 5DE3A 3WXMA 5FPKA 1Q0UA 1U9IC 1KSHA 2YZ2A 3JZMA 2IW3A 2ZYVX 2A5DA 1JBKA 5AJYA 3E1SA 4A92A 1AKYA 3K0FB 4QRHA 2WKPA 5CDFE 4C30A 3PUXA 2H8KA 1CKEA 2VHQA 4P3YA 1Q21A 1SVKA 2BHRA 2V55B 5L3RA 1UEIA 2PH1A 1NJGA 2OCAA 4NYMQ 1ZIPA 2ZI3A 2FPKA 4Q4HB 1XPRA 2GK6A 5JS8A 1OKKD 1D8TA 3KQKA 1ZUNB 1K5GA 2XEXA 3P20A 4GI7A 3P26A 2ZRPA 3HPRA 1L4UA 1JXOA 4MQBA 5FTKA 3SBEA 1QG4A 2WPDA 3UMRA 2VRWA 3Q5EA 1CJKC 1JQLB 2GBLA 2OFXA 4AI6A 4Q9JA 1BKDR 1MRSA 2ZROA 1OXXK 3FB4A 4DCNA 4QL3A 4TZ6A 4WA7A 4FN5A 3Q3JB 2ZSDA 5BWMA 2RGNA 4PFSA 2GWHA 1RW4A 2GNOA 2V7QA 2P67A 3I5YA 2CCGA 2QRZA 1OFTA 1AJEA 1CRQA 5CIWA 1AGPA 2CCJA 1DADA 2YC4C 4A0RA 2JLVA 1OYWA 3EIEA 3VNUA 1P3JA 3W34A 1Z8FA 2D4HA 4BLSA 1TL7C 2GEVA 1TNDA 2AFIE 2ZPTX 4TWZA 4NCNA 4L9SA 4D0LB 5H8WA 4YXWD 1G64A 2VHTA 3BD9A 3L2OB 2VHUA 2HCJB 4WVFA 3A6PC 2KE5A 1DO0A 1G3IA 1OF1A 4B6EA 3IBYA 2NZJA 1QHIA 1IQPA 4TSFD 2EFCB 4KO8A 4JLKA 2HLDD 2W58A 3AF3A 5CLLA 2J46A 4OI0A 1R0WA 4JLJA 3ZGXA 4E09A 3GEIA 2F3TA 4UXIA 4QGFA 1P75A 2ZQ5A 5CK5A 4C7OB 3RYTC 5A4JA 2K5UA 4RKFA 1T8UA 1WRBA 1V5WA 1ZRHA 1QDEA 2ZYTX 1G5PA 3KKMA 1RIFA 1ZINA 2ODWA 1UKEA 4ZCLA 3TSZA 1M2OB 3C5CA 4JLDA 2OM2A 1M7GA 2AD5A 4HEJA 4OK3A 1TMKA 2HXYA 4Q21A 4PPFA 1EFUA 3WHKA 4R71A 1W36D 4KI0A 4OHWA 1OXTA 2BKEA 3BC1A 2P6UA 3AF4A 3E70C 4JLPA 3SHFA 4FXPA 2ZUDA 4YMUA 3P32A 2QN6A 1KI2A 2QROA 4CIDA 2O8EA 1F2UA 4W5WA 3HPQA 4ZI2A 4DXAA 4AG5A 3GLIE 1DG3A 1OB2A 3OAAD 3BGWA 3HR8A 4GMDA 4OKSA 3G5UA 3V9PA 5A5GA 2A5FA 3FKSA 4PSKA 1SVWA 4XOIA 3TSWA 3T61A 4C0BA 4DHEA 2FN4A 1XXHE 4TMXA 3ZD6A 1QHSA 2ZRIA 2PBRA 5EZ6B 4BQSA 4GBMA 4NONA 4ZIRA 4FMCB 3SJAA 2GEUA 4NHOA 3NXSA 3MUFA 4JVLA 4OQLA 4WZBE 3SHWA 5FL7A 3GJ4A 4L5BA 4OI2A 3U7HB 4KYUA 3WP1B 1KI3A 3AP2A 1QHGA 1ZC3A 1HURA 3GLGE 3PG5A 4NKRA 3M1IA 1ZU4A 4X8MA 3FKQA 1G7RA 4OL0A 5FUWA 2ZRDA 2YWFA 2W6ID 3MJRA 1GFIA 2FSIA 3CF6R 3L0SA 4KHZA 2YNMA 5B2ZA 3TGPA 3EZ7A 2GK7A 4WW0A 1OB5A 1IN8A 4FCVA 4LCBA 2BBWA 4NYMR 1X1SA 3K0AA 4OHVA 1G6OA 2GJAA 2H57A 1NLFA 4W7SA 2V6JA 4K81B 1ZYUA 1RJ9A 1YHNA 2G3YA 4ON9A 2XZOA 4IVPA 5DO9A 5KU1A 2PJRA 3U7GA 3K1JA 1G20E 2R2AA 4M2LA 2VP2A 2VP5A 3P4YA 4JL8A 2WJYA 3GLFA 3A4MA 1J90A 2GCNA 5FFMA 2R6CA 1KKLA 4XTRA 5FR1A 5JWHA 4LHYA 4RD2A 3GLHB 4PAMA 3GJ7A 1SQ5A 1U2RA 2O8CA 2DR3A 1FOEB 3KKOA 1XMVA 1VDZA 1VHLA 1XF9A 3I1FA 5H70A 4A0GA 1KAOA 1TADA 1IJFA 1B0UA 4UXHA 3OZXA 5CM8B 2FZ4A 3RC8A 2NZ8A 2OFOA 2NQ2C 1E9DA 2FSFA 4JVMA 4O2LA 4M22A 4B33A 1E0AA 3AVPA 1N6IA 1II8B 1MO5A 2WWXA 2ZRCA 3QF4A 3FDIA 2VF8A 1LNZA 4LJYA 4M4SA 5KSZA 4TT3D 4O3MA 1YZUA 3FHCB 4IDNA 2AK2A 1IN6A 1EESA 4MA4A 3QIAA 2QQ0A 4TN1A 1XPOA 3K53A 4LPSA 2ZRFA 1KY3A 1NMZA 1PLLA 2ATVA 5LPNA 2WKRA 2A3RA 3PEUA 5JS7A 4ZCIA 5GJVC 3WYAA 1IJEA 3FVQA 4XWKA 1KAGA 2HUPA 3NIBA 5EUMA 1SVSA 5KTYA 3SQWA 1DARA 2OSBA 4IEEA 1Z47A 1VG1A 2YYZA 1PUJA 1KO8A 3DMNA 3WNBA 1COWA 2GJ8A 4HAZA 1GZSA 4BRWA 4Z54A 1ODFA 4DIEA 4IVQA 3GPLA 3QVUA 2XB4A 3U44A 4YDHB 3B9PA 2GJSA 1Z29A 5LDDC 1M1YE 2XNDD 4KBFA 3I3SR 3HYRA 3IHLA 1XD8A 2X8AA 3FTQA 3TUZC 2VP6A 4TL7A 2QEQA 5FOUA 2ZITA 3GLIB 1G8HA 2R8RA 2E87A 1F5NA 2WV9A 1JPJA 1U0LA 4UNNA 1KDRA 3WHLA 1N0WA 2BEJA 1GNRA 1N5LA 3FMFA 3H4MA 1G8FA 2XGJA 1XXHB 1E9AA 2QP9X 5P21A 3SU8A 3T5DA 1R7RA 3IO3A 1HEIA 3MJHA 1XJ0A 3BBPA 4EIWA 4MGKR 1RZ3A 4NYIQ 3RNLA 1LFDB 2OAP1 1CULC 3GD7A 1GTVA 2UZ3A 2Z4RA 5KUTA 3MWYW 3MRSA 1P2UA 3I73A 4I1VA 4OBEA 2Q6TA 4R7ZA 3GLGB 1WMSA 2QG6A 5HPYB 3R9WA 1KKMA 2IF2A 2OT3B 2F6RA 5LD2C 4PO9A 2W6JA 3RSOA 3EZFA 4ACAA 2J0UB 1M8PA 3TBKA 2F1HA 1XNJA 5BN4A 3VR1A 3W9YA 3I72A 2CK3D 1UKZA 3OFND 2Q9AA 2IYLD 2X19A 3LH5A 2XJ4A 4JJKA 4DCTA 5L3QA 4GZLA 4ESHA 3LVQE 3A36A 1FX0B 3Q9LA 3CB4A 4WBSA 4MGZR 2GVDC 5HE9A 1UBGA 3TE6A 2JJ1D 3ZH9B 4S35A 3ZQJA 2N42A 3NWJA 1QHXA 3KJGA 2HCBA 3U3OA 1U0JA 4CT5A 3WYFA 3BS4A 1G8GA 3PXGA 5JHGB 3KFVA 4A9AA 4DLSA 1XTSA 1BO6A 4F4JA 1KI8A 1VCMA 4UNQA 2V54A 3UATA 1U99A 2CHQA 2CVHA 4Q1AA 1W2GA 4BZQA 4DRZA 4LZZA 3FYHA 4A8JA 2REBA 3B78A 2XXAA 2ORVA 1T3HA 2OUKA 5JSZA 3GCGA 2OAQ1 3EASA 4P31A 3OESA 4PZZA 3QEJA 1CBUA 2Q3FA 2C04A 2BCJQ 3PUZA 3W8NA 4OQFA 3CRW1 1E6CA 2VIIA 1UBEA 5JJIA 3NH6A 2RGCA 3SI7A 2IYZA 3B82A 2J0SA 1W0JD 1QRAA 2CHVA 2VSFA 4LYHA 4LWZA 1KO1A 1XZQA 3N70A 5TY0A 5FPSA 2ZRBA 1NRJB 3SFZA 1D2MA 5J40A 1G3MA 2R6GA 1CF4A 2ZAOA 4NTZA 2X1VA 3N2EA 4XVUA 2C9YA 2WJIA 2CBZA 1Y63A 3K09C 2C95A 1N0VC 1Q1ZA 2VHCA 1W7AA 1P72A 3D8BA 3P1JA 3L43A 5JI3E 4Q1DA 2ZRJA 3OEHA 1GKIA 1OXSC 4G5SA 5JMTA 3CZQA 1DAEA 5AK0A 1YR7A 2F43B 1Q3HA 4Q7LA 4PC2A 5HZKA 3SC3A 4CF7A 3T35A 1H8EA 1Z6TA 1OW3B 2C8VA 2CNWA 3LW8A 5CITA 5KPDA 1FNNA 1QZXA 1P73A 3EAQA 3ZIAA 5HKKD 3X2SA 4PSAA 3IEUA 3OF5A 5AJVB 2JEOA 1JEEA 1IBRA 1JR3A 3QKRA 1U98A 1XCGB 3MCAA 3ND8A 1DEKA 4JSTA 3DL0A 2FV8A 5DSZA 3UPUA 3OIUA 2WIBA 4P33A 3EZ2A 2ZVPX 2QAJA 3BXZA 1Q44A 5FTLA 2GXUA 1HQCA 1GDDA 2ZE7A 3LX8A 3UWKA 3VX4A 2JLYA 2ZJZA 3CUEF 1QHYA 4N3NA 2PMDA 4NYJR 4PAQA 3KQLA 1OH7A 1XTKA 2ZS9A 2BBTA 3ZS9A 3LXXA 3QQ5A 3RRZA 4PO1A 4ZDWA 3BRWD 1M7HA 4L8GA 1Z0IA 4URYR 3CIOA 4A0FA 4Y0VA 3QPWA 4NYIR 2WWWA 1GNPA 1VHTA 421PA 4X8LA 2IUUA 2XX3A 4N0DA 4TTRA 2DFLA 1SXJB 3QKSA 4BFWA 4QJ4A 5BN3A 3ASYA 5DYGA 2IWHA 4DSTA 4DDVA 3IBGA 2FG5A 2CLSA 2ZI9A 4HLUC 5FBRB 1GRRA 1N6OA 4RFSB 1WBDA 2AN9A 2RKOA 4WZAE 1ZP6A 2ONJA 2QP3A 2OCYC 1TF2A 2RMKA 4Q4AB 1F2TB 4LHXA 4C2TA 3EG5A 1X8LA 2BOVA 4RZXA 4IOKA 1T3SA 1TF5A 3CR8A 5KDDA 3SYKA 2GJKA 4LUCA 4IDOA 4OHZA 3RWMB 2OESA 1ZCBA 2W2TA 2XJ9A 3MD0A 1N2CE 1HTWA 3AEZA 3MSXA 2C03A 2DYKA 1ZM4A 4ZKDA 4A0HA 1YRAA 4M9SA 3RS5A 1ESMA 1E2HA 3CRMA 5TDHA 1R0YA 2D2EA 2PMKA 4PC6A 5C46F 2CL0X 2QENA 3KUDA 1E4YA 5EP1A 3NBYC 1U9IA 1PLJA 2J0VA 2ZM5A 3SE0A 1YR8A 4M1WA 5FI0B 3QSYA 3UMSA 1OH5A 3W6NA 4JYCA 2X2FA 3AVQA 4BFUA 2XOKD 2BCGY 2JLRA 1XEXB 5KNCA 2JAQA 1DAGA 4B44A 1YR6A 3CX6A 2QMEA 4MKFA 4CEHA 2EFDB 4OI1A 1T5IA 1KNQA 3WBJA 2Z5FA 4QM6A 2D3WA 2FPLA 2G1KA 1P9RA 3QBVA 3P4XA 2YJTD 3TH5A 2BJWA 1NKSA 2W83A 1M6NA 2OV2A 5L3SA 1TU3A 1OE0A 2JLUA 3EPKA 4QGHA 1CS4C 2EYUA 2GDJA 3JZAA 4JSYA 4XSGA 4B32A 3GFPA 1DELA 2OE2A 2IX3A 2IYYA 4LBZA 4A82A 3WMGA 4HDQB 5IRCD 2ZRGA 1J99A 4Q9KA 1W5TA 1T5LA 1VG0B 4JJZA 4G3XA 3R20A 3AGQA 3C8UA 1BIFA 1GILA 4AG6A 2EWVA 3T15A 4JVNA 1EK0A 1XDBA 4PXAA 1W5SA 1G4UR 3K9HA 3QVVA 3P27A 5FBVB 3VR5A 4UJ5A 1UM8A 4D6PA 1GL7A 2IC5A 3U3JA 1DAKA 3LLMA 4RD0A 1YU9A 3CZPA 2JJ8A 2RCNA 1UPTA 4HAUA 4B43A 5JECA 3VHXA 4V0KA 3QG5A 2IS2A 3CRRA 2WMOB 1K8RA 4ZCMA 2IT1A 1RRPA 1NI3A 1KK1A 2G83A 1EFHA 2DBYA 2GTPA 3CPEA 1DAIA 1KI6A 4DLVA 1E69A 1X8KA 2QL6A 5H68A 3AM1A 2AX4A 4OHYA 4QBGB 5DYIA 3KQUA 5JEDA 1KY2A 1R0XA 4MRVA 1YQTA 1U8AA 3BORA 2FA9A 2WM9B 1OFIA 3DKVA 5EZ5A 1R2QA 2DFNA 5FBWB 2XNDA 2I1QA 1YJ5A 1N0UA 5CYOA 1F6BA 4P0TA 4HDCA 3CX7A 3N2IA 4B3DA 4MKIA 4D0NA 3DVLA 3AP1A 3F0TA 2R44A 3L0IB 3IEVA 1DAFA 1W36C 2IBMA 2O0KA 3CNOA 1JALA 3DM5A 3QG1A 5IK2A 4TL9A 3RS4A 1Z0AA 3X1WA 3V4FA 2C5LA 3U61B 3LDAA 3SDZA 1UF9A 1UAAA 2CVFA 4NL4H 2O52A 1Z07A 4MH0R 4RKEA 3SR0A 1NMXA 3UWOA 1G8PA 2A78A 3KKNA 4GL2A 4PQRA 5EJEA 3ZD7A 3AF0A 2Q3HA 1US8A 1XPUA 1N6HA 4PZLA 4PHHA 1KOFA 4Q9LA 5EXPA 2JJ2D 5JRJA 2PX3A 2CJWA 4IDHA 4QHTA 3RRNA 3QE0A 3L82B 3N5CA 3SEAA 1UDWA 4C3ZA 3DOEA 3M6AA 3TNFA 2QT1A 2OLJA 4JKYA 4PSVA 3U7EB 1QVRA 2PZEA 4KSBA 3D31A 2WTUA 1B23P 2A5YB 5HE8A 4AK9A 1KMQA 4OQMA 4D81A 1YZGA 2IEZA 3T1QA 2HDNB 4E22A 1ZCAA 5EUQB 2N1BA 1JQJC 3FMPB 4QJ3A 2O0JA 2PL3A 1XMIA 2FOLA 1KSFX 3Q7QA 2QPTA 4PPNA 1HT1E 1O87A 2F9MA 2KBEA 1GKUB 4I81A 5HZHA 4BECA 5SZIA 1C9KA 1Z6GA 4AC9A 5B30A 2D7CA 1EWRA 3KXLA 1NL3A 3TW8B 3SYNA 1E9RA 1YKSA 5CK4A 3VAAA 1NG1A 4HI0E 1W0KA 3ETLA 3FFAA 1CTQA 1E2GA 2RGXA 3KQHA 3NDPA 3NH9A 2DY1A 3FWYA 1ZBDA 1ZM9A 3M0EA 2PT5A 3VKWA 5K8TA 2IS4A 5CIQA 4B2PA 3ZVLA 4PO8A 2H16A 1OV4A 2P3SA 2ZRMA 2B6HA 5ANRB 2A5GA 4DLRA 2ZI7A 1XD2A 2ZSBA 2JLXA 1ESNA 5SZKB 3LY5A 2ZSAA 4NBSA 4ZKEA 1D2EA 4GZMA 2REXB 3A1UA 3HU3A 1FQJA 3CBQA 2QQEA 2OFWA 1LW7A 1S96A 3NTUA 4EPRA 3GLHE 3NBXX 2QTVB 4PHFA 3GEHA 4CDGA 3HR7A 4E07A 2FSHA 5D3MA 1II9A 1F2UB 2NO7A 3K0CC 5FUYA 2ERYA 2D7DA 2BKUA 3LNCA 1RYFA 2AHOA 2QGNA 3GEEA 3G82C 4DEXA 1UEJA 2JDID 4DCUA 3TQCA 4ZIRB 2PCLA 4DJTA 3TR5A 1M74A 2FPMA 1VG9B 3DZDA 3AP3A 1KJYA 4DB2A 4KCGA 1AN0A 1SVIA 1NVVQ 2HEIA 1C4OA 4MUBA 1E2QA 1ZNYA 5G41A 2ODNA 1E79D 1ZUHA 1ZUIA 3IDQA 721PA 4GFDA 4LHVA 3NVAA 4LJ8A 2A30A 4JVSB 2YKGA 3R8CA 1E1QA 5E4FA 1UJ2A 1YZTA 3K0FA 4LK2A 4JLOA 2WSSD 3J81k 2VEDA 1O3YA 3PCRB 4A2PA 1HA3A 2XNSA 1S4QA 3C4JA 1AGRA 1P6XA 1GVNB 2AXNA 2ZE8A 3EWAA 4LJ5A 1FFHA 3O47A 3TQFA 2CCKA 4R9UC 1Z22A 1Z2CA 4ZDIA 3B60A 3EC2A 4YQFA 4NU0A 3AVVA 1LF5A 2RHMA 3GLFB 3RVBA 4A36A 2O8DA 4B75A 5JEEA 4UNSA 4NCJA 4NCIA 3NEJA 2FGJA 5JWOA 2O8CB 2HYDA 1I4DD 2QT0A 1KDTA 4PPGA 2BMFA 1TTTA 3VKHA 4DEYA 3QUSA 1F48A 4C9BA 1WDTA 4OI4A 2QZ4A 4I4LA 5CLQA 3KXIA 2J87A 1KO5A 1QBKC 3LBNA 2OBMA 2AXPA 4B3CA 2BBOA 3LD9A 4LX0A 1E9CA 3A4LA 4C0KA 1NVXQ 1MOZA 3VMFA 4G5QA 4K8OA 5L3VA 3GMTA 2EU8A 1JEDA 3GFOA 4B6FA 1E3MA 2FH5B 1XEWX 3QF4B 2V1XA 4CGZA 4GRAA 2DCUA 2VQSA 2WJHA 4FCWA 4QBFA 3RS2A 3GJ0A 1T91A 1LY1A 5JWRA 5UKDA 4ASUD 1RE0A 4IXNA 2ZXUA 1GSIA 2W0MA 1CR0A 1A5TA 2OG2A 4JKIA 3I62A 1NLZA 3GP8A 3T06B 4BASA 5EXXA 4HATA 5E7IA 1KMHA 4B71A 1OHHD 2ZYWX 1U90A 4X8OA 621PA 4F92B 4GSYA 4DWJA 1G291 4C0SA 4XIGS 3THXA 1NBMA 2HT1A 3CH5A 2HJGA 2X2EA 3QXSA 2VF7A 4OQNA 4TLDA 3O8CA 4Q7JB 4FIDA 4JBXA 2QGZA 2VP0A 4DUGA 4XD7D 5FTMA 4JBYA 4I1OA 3X1XA 5DN6A 1KK3A 3A1SA 1I4LD 3NKVA 1CJMA 4TL8A 1Z08A 3HYTA 1ZVQA 3RABA 1IXZA 1G41A 2WJGA 1NY6A 4URWR 1OYYA 2CL6X 3LA6A 4M1YA 3QPVA 2XSZD 2X77A 2WWYA 3KFXA 2FEOA 4B76A 1SXJD 1PLKA 4AKGA 3CR7A 3B2EA 3K09A 4WAUA 3C5HA 3VHLB 1JI0A 3IHWA 4LOAA 3DM9B 1QHNA 5EP4A 1E1RA 1MRNA 2EFEB 2NO0A 4RJLA 4DDUA 3F5FA 4ITRC 1T8TA 3EARA 2QE7D 3RAPR 1KI1A 1MV5A 3CRQA 5EP3A 1E0JA 4MUAA 3ZVNA 2IYVA 4Z1MA 3RANA 5JCPA 3A8TA 1HH4A 2J7PA 3OE7D 5JRZA 3G0HA 2C9CA 1EFRA 2IYXA 2OO7A 2ZJBA 4TYWA 2O8BA 2QAGC 5A0FA 1SVLA 1NVVR 1SVOA 2EVWX 2FZLA 2YOGA 3W5IA 3GJXC 1AIPA 1XTRA 2JGNA 2RGNC 3DPUA 1E4VA 3R7WA 3NHAA 4B47A 4BLPA 1FL9A 5EE0A 2GXQA 5CDFA 5KO2A 1BMFA 1XRJA 1PUIA 3KZ1E 1BH2A 3KQNA 5J4YA 3O8DA 4TTPA 1S0UA 2KJQA 3SBDA 2J5XA 1YR9A 4LDJA 4M1SA 2BM0A 2YWEA 1PVOA 4KAXA 3U3KA 5KSOA 4BFXA 2EYQA 4IOMA 4ZPXA 4JBWA 1NSFA 3PQCA 1GM5A 1N6KA 4NMMA 3EIQA 1E2NA 2IXGA 3AB3A 4MDFA 4S2EA 1V43A 4C0AC 3BFKA 4A8JB 2XXAB 5SZJA 2PEZA 4OK6A 1MABA 5JSZB 1XB2A 2A9KA 5FPYA 5C4GB 1NIJA 5KNDA 1ZD1A 4OJKA 3LBIA 1Z0JA 4X8HA 1R4AA 2JIZD 5GVRA 2YVUA 5B58C 3DZ8A 4EDHA 1SKYE 3KKPA 3VNVA 1TEXA 1VKJA 5IT5A 3KTAA 3AKDA 4HLUA 3LW7A 5FH9A 1BS1A 4R2IA 3QI2A 1LS6A 3WBKA 2QU8A 4C2UA 4POAA 2VBCA 1G7SA 4LV6A 1N6LA 4OJQA 1GG2A 3ECCA 3THYA 1G7TA 1IAQA 1SXJE 2QY9A 3DEFA 5FOVA 1JECA 2YOFA 2KI5A 5F2EA 2WIAA 2D2FA 2JJ2A 4M9XA 3QKTA 1SHKA 2LKCA 2RHDA 4B3BA 4F4CA 1CRPA 5K8IA 1IN5A 4GOKA 1GL6A 2TMKA 4LJ9A 3NBZC 4FWTA 3MWKA 2QBYA 1XJQA 3K9LA 2IF0A 3DDCA 1UBFA 3H2YA 3K8YA 1MT0A 3A1TA 3IGFA 3DHWC 1XEWY 4QHSA 2ZRAA 1KSGA 3ICQB 4MYCA 1NG9A 4XTCS 2REOA 2R6DA 2NG1A 3BOSA 3QKRB 1MKYA 2B8WA 5FTNA 3W6PA 4E5UA 1CR2A 3TW4A 4Q18A 4D25A 4HAVA 4MKGA 3WNDA 4PQFA 1EGAA 4M1TA 3B7GA 5FBQB 2C77A 3I32A 1LV7A 2JLQA 521PA 2C96A 1OXVA 1ZU5A 4JL5A 5F98A 3RRYA 4RSGA 1OKKA 1QF9A 1RRFA 1E2EA 1CXZA 1TQDA 3CKLA 5EXSA 2QUZA 5KOYA 2FFBA 3MWJA 1IONA 5DH9A 3T1OA 2B21A 4CT4B 3NDBB 4QGGA 3TMKA 3TUJC 4DLZA 1K5DA 4QBHA 1XP8A 2HJVA 2J7KA 3I8XA 1T0HB 1TAGA 3PUVA 1GOTA 3QJYA 2JLSA 1YZNA 2VTKA 1P9WA 4B48A 3U6BA 3MG9A 2IXEA 4UJ3A 3QKSB 3VFDA 3TKLA 1HT2E 1NP6A 4QXAA 4TQUS 3AVTA 5AJZA 4B3XA 1P2SA 4JL6A 4XSHA 4HUQA 4FMDB 2KWIA 2RH5A 2WPDD 3KXKA 3WMEA 2JASA 1NN0A 3K70B 3VR6A 1GRNA 2YWGA 2V1UA 4GT1A 1FPMA 1RYHA 4CZ2A 1N6PA 2N46A 3VTKA 4M1KA 1P62B 5JBQA 3U7FB 2FF7A 1KI9A 4E03A 1CIPA 4YXWA 4TMKA 2DFKB 5CM9C 3TVDA 3IPYA 1P2VA 1JR6A 4NE2A 4QM7A 4IW3B 2XTZA 2NGRA 4LJAA 1GAJA 3WP0A 1VIAA 4EPYA 1T3LA 2FGKA 2QI9C 1JAIA 2QPOA 2P2LA 2OILA 2V7QD 4FMCF 5F3WB 4DSUA 4CEIA 4MGIR 4Q7KA 1RRCA 5KNBA 4KSCA 4DT1A 2A2ZA 2V8OA 1J2JA 1AZTA 3TLXA 1A4RA 4TSFA 3I5XA 1ONBA 3EXAA 2VP4A 4WXRA 2HLDA 4H9GA 4P4TA 4C0HA 3K0SA 3CF0A 3TUIC 1W4BA 3UANA 3PUWA 1IOZA 2YV5A 3T34A 4FMBB 2XITA 2CLDX 1SKYB 5KYKA 5GVSA 1TEVA 4QJ5A 3IIMA 2MMCA 4F93B 2GF9A 2UVQA 3CRVA 3PUYA 1YVDA 4BRUA 4P4UA 3LRPA 4FD2A 4KFRA 4B3FX 4JMPA 4V03A 1E2MA 4CEHB 4YLGA 1Z0DA 3VQTA 1HQYE 1E2JA 1M34E 1XZPA 1XCMA 2VPPA 1N6RA 4TMVA 4TQAA 2FDCA 2YHSA 4JT4A 5EQTA 3V00A 4QNMA 2H17A 3CNNA 3RS7A 3GJ5A 3EC1A 3OAAA 1GKYA 2PLFA 3BFXA 5L3SB 5D3QA 4AY2A 5KSPA 1P9NA 1G3RA 1A2BA 4Q9IA 4BFVA 2XZPA 5JJKA 1LTQA 2OXRA 1F3OA 4RVCA 3B6EA 4XWOA 4OYHA 4QBIA 1OT3A 1VYTA 1NIPA 1S2MA 2CXXA 3KL4A 3BH6A 2ZJYA 1R0ZA 3F8TA 4HZIA 4JLMA 5J4KA 1E9FA 3AUYA 2DWQA 1LF0A 1H65A 2A5JA 1E32A 3FKSD 2VHJA 2ODBA 1S1CA 2W6IA 1YZLA 2ZI4A 3CWZA 4IVRA 2Y8EA 2ZJ8A 4LC0A 4MYTA 4BPBA 2OHFA 4TQ9A 2GAAA 1P5ZB 2HT6A 4ZDJA 1T9HA 4JZKA 4AWXA 2NOAA 4N1AA 5TVKA 3TJZA 1XMSA 1SHZA 1XTIA 1EX6A 4KJZA 3FMOB 2MSEB 5FL7D 1KIMA 1W49A 1EXMA 1ZMXA 4QG7A 3BFVA 4HLDA 8OHMA 4KV9A 4IFBA 2KSQA 2ZTSA 1KI6B 2PZFA 5GJWC 3NG1A 3JVUA 4TMZA 2XB2A 1JB1A 1JPNA 4Q48A 5AUPB 4XD7A 3LQRA 3BB3A 2O8FA 1I2MA 4D82A 2ZI5A 2I4IA 2V6IA 1KJZA 3H86A 2Z4SA 1GNQA 2W00A 1Z3IX 4DKXA 3IO5A 4A8JC 2ZU0C 4Q1EA 3QENA 4G5OA 2JCSA 5IF9A 4PX9A 1Q1QA 2QMHA 2Z0MA 3U6KA 1FUUA 3B9QA 4KYIB 3AVOA 1HY3A 4QOSA 2J1LA 4DLUA 2QM8A 1G6HA 2CE7A 3UIEA 2ONKA 4GP6A 3U3RA 3I61A 1JJ7A 2XTNA 2ZRHA 4BFTA 4US0R 3UK6A 4HAYA 3CH4B 5BXQC 1NN3A 2D06A 2GZHA 3K0CA 4XWAA 2V9PA 1X6VA 4F38A 1DE0A 3EA0A 4EJSB 4FI3C 4UKDA 4TT3A 1RPZA 3O8RA 4OQXA 5DGXA 4I1SA 2AR7A 1H8HD 3GJ6A 4AURA 2ODEA 3KDSE 1IXSB 1KK2A 1US8B 2H18A 2QTFA 3B1YA 2P0EA 3D6TB 3L0OA 4G1UC 4RZ2A 3PFIA 3S1AA 3PEYA 2C9OA 2IHYA 2QNRA 2CJWB 1FUKA 3MMPA 2ORIA 2Q3MA 3LV8A 1E2LA 4LGMA 4KXFB 4G0NA 3R8FA 3I92A 2WKQA 3JVVA 2BWJA 1TUEA 5FTJA 5BYJA 1L8QA 1Z63A 1TU4A 4LYJA 5GJCA 2AD1A 3UXMA 3DO6A 4JLVA 5G53C 4Q4JA 4P4SA 1KNXA 1N25A 4M0LA 1UFQA 1S3SA 4IOJA 3LBHA 3ZDQA 2QPAA 4GPTA 4QKQA 2ZRNA 2RAPA 3CPJB 4BLTA 1AS3A 4LYFA 3UG7A 2IYTA 2IYRA 1E9SA 1YZKA 3CWQA 5C2JB 3X1YA 4YDSA 4I1UA 2ZAMA 4EPTA 3OEED 1SULA 4IEIA 4Q01A 2WJJA 1COWD 4M9ZA 4RD6A 2RGGA 3LX5A 2R62A 4G5GA 2WWGA 4J0QA 5B57C 2NO9A 1D5CA 4NCHA 2EW1A 3KUCA 1WB9A 1G9XA 3A4NA 4GOJA 2IHBA 5KSYA 2R6FA 2BJVA 4KVGA 2HF8A 1RVDA 1IN7A 2OLKA 3PV0A 4DIDA 3QF7A 1Z6AA 4Q00A 4M1OA 4DCSA 1ZIOA 4HZUA 1DBSA 4NP6A 2AKYA 1TPZA 4NPHA 1R6BX 1XD2B 4HB3A 2DFTA 5LB2A 1XX6A 2CK3A 3OFNA 1AA3A 4FINA 1FQKA 5AUQA 3LAWA 4V0MA 2A7QA 3TAHA 3GLFE 2GRJA 4F7WA 1CU1A 1WA5A 3X1DA 2Q21A 3K70C 5EE5B 2JJ1A 2CL7X 1ZNWA 3SZRA 5D3MB 1X8JA 5EP2A 5DIFA 1TX4B 3A1VA 5M04A 2GESA 2W6JD 1G17A 2D74A 4C0QC 4IJMA 2GEDA 2ZJOA 3R9IA 1G3QA 2ZU6A 4BFSA 4HUTA 1Z0FA 3GQBA 1D2NA 2PEYA 2GKSA 1EWQA 3IQWA 3PEVA 3TRFA 2W2VA 2F1JA 1E9EA 1FP6A 3LWNA 2KBFA 4LBVA 5JHHB 3GJ3A 2ZSFA 1Z5ZA 4AYWA 4CEJA 4AKHA 5E7MA 3TK1A 4KLZA 4PAOA 3W3AA 1A7JA 1QHHA 3PVSA 5J5CA 4EQ6A 5TMPA 4JIMA 2GZAA 3U4QA 3AV0B 2L0XA 1KO4A 2GAOA 1JNYA 4BEBA 2D62A 3ZZUA 2O0HA 5DHAA 1ZM3A 1E0KA 1OSNA 2ECKA 1OIVA 1W0JA 3K0EA 1E2PA 4JS0A 2IS6A 1MO3A 4O2RA 3WYGA 1XEFA 2FFHA 2ZETA 4MYHA 2IWRA 4RY2A 3ZJYA 3NBFA 4EUNA 5FBLB 3PJRA 2ZUBA 2ZS8A 4PHTA 4JT2A
chains in the Genus database with same CATH superfamily
3IALA 1KBOA 1PZGA 2PS0A 2ZKIA 1V4BA 3HMKA 3KCQA 3NRCA 3SJZA 5EKUA 1QE3A 4CTMA 3RC2A 1GPWB 3S2ZA 4AWAA 5MDHA 4L02A 4UW9A 4HXGA 5KWSA 3G7NA 1TTQB 2VQ3A 4MITA 1GN8A 3SM9A 2DFVA 5GADl 2ZSEA 5D1HA 3WKBA 3FHTA 1Z6XA 7GPBA 3H16A 5EMKA 3V1MA 2RK4A 3GGJA 4XAQA 2O8DB 4D4GA 2IPXA 1A82A 3WJ1A 3FHLA 4BNJA 5BWCA 4UPVA 3K1YA 4WFIA 1ZUWA 3DZJA 4X9XA 4LXGA 3NGLA 5T4FA 3OHSX 2GCOA 2R79A 4A8HA 4JWTA 4AY4A 4P34A 3A4TA 1J1ZA 1EGVB 2ZVQX 2B2NA 2GJ9A 3MLAA 3NIDB 3GA0A 3SMQA 1JL3A 1QCDA 4M1MA 5EJIA 3SS8A 2HSJA 1SELA 1SU8A 1K7EB 1Y3AA 3HBMA 2WYUA 5AM0A 1ZAKA 2OPBA 1QO9A 3VU9A 1G19A 1Q0ZA 4EPVA 5IKPA 4G0UA 1NR1A 2FSVA 1I3KA 4G85A 5BQFA 1E0DA 2VLIA 3A0UA 4HXYA 1ND6A 1X7YA 3INYA 5ALIA 1S2LA 2Q1SA 3NALA 4C0JA 1JU3A 2CGEA 3ABSB 5BQ5A 5MF6A 1JAXA 4Z4HA 3A11A 1G4HA 5LZ8A 2CE2X 4MVWA 3B9BA 3FSJX 3G8BA 1JGTA 1ZK0A 4PU0A 4K6HA 3NVMB 2R9VA 1C9MA 3D8SA 4OXIA 1HL3A 1TEHA 5DI9A 3GDOA 2H9IA 1DCKA 4MAFA 3RJ9A 3BJEA 3BA6A 4DSAA 1QH8B 2TMGA 4MPDA 4M0MA 4CDNA 4E11A 1MX9A 4FW9A 2MSWA 2WWIA 2JGAA 3AEUA 2ZUFA 2FWNA 3ESAA 4GNKA 3R3YA 4JB3A 2Q6IA 4L28A 1RJ9B 4K9PA 5JYBA 3ADOA 3JASB 4HTFB 1GZVA 1JLLB 4KVAA 3V55A 2HRQA 4J0FA 1Q7TA 3H1GA 5JTUA 2E7ZA 1AQUA 1P60A 1Y1TA 5A0TA 3GRUA 2E5WA 1LNQA 3G5MA 4WXHA 3W2GA 4IMJB 4I3HA 5IJ0B 3AJAA 3LOQA 3WO1A 1Q1EA 2ATXA 1FB5A 1FTSA 1RAAA 2WMNB 2AJBA 2VSNA 3I04M 2PLWA 3MZ0A 1V8OA 1L5MA 2FPRA 2IK8A 2PGDA 2XUAA 3AUXA 2EZUA 3GFFA 3SFTA 5CDSA 4I4TF 2C7OA 4KV7A 3WLJA 5JE8A 1R88A 3I23A 1E99A 1Y80A 2V7TA 2YFYA 1P4SA 3MOIA 3SIXA 2HA2A 5G4KA 1YB4A 1C81A 2VTBA 1PTJC 1USVA 2JFBA 2ISSD 3ANXA 3FZNA 2DB3A 3PTAA 1K0UA 1QS0B 1WDWB 2VPXA 3D4OA 3KAKA 4MW2A 4Y2QA 3RYIA 1DTSA 2JKYA 3V8VA 1IVNA 2QP4A 1DUSA 1EWVA 1PR1A 2HK7A 4DV3B 3ZE9A 2DHRA 2BGKA 1DOAA 2PV7A 5E7JA 3GXBA 4BN4A 3K9NA 2CZGA 2YWXA 3K70D 5BNIA 1QJ4A 3F9RA 3WRYC 1IXRC 3K9GA 4U2CA 5KDLA 1RLJA 1CUUA 2AKAB 3UUWA 2XUHA 5IVHA 2IDKA 1J7JA 4UUMA 1UJ6A 2FFAA 5ICGA 1ZD5A 4NK5A 2G9NA 4IGFA 2TECE 5JAUA 4Y1RA 4KFSA 4MVJD 2ZATA 4N6GA 1FC0A 2HNBA 3ZZ0A 3L1HA 4QLOA 3R7WB 4KFTA 3MHTA 1EGMB 2QMOA 1QVAA 2BM9A 2MOKA 2XOKA 1N1GA 3C7TA 4RHFA 2VRBA 5IDYA 3WFIA 4F5DA 1FDOA 3HY4A 4XM2A 3MFYA 3OHMA 5HKBA 1UFKA 4LRWA 2ZK7A 1UMKA 2QTWB 5DNEA 1XD9A 4HWGA 3WGKA 3G0CA 3SF0A 1Y6FA 4CG2A 4JC4A 1W85A 4N48A 2WA1A 5C5IA 2HLNA 1CUGA 3MTAA 5E3HA 4ISBA 2YV4A 3WNVA 2YXBA 3C6YA 4F6LA 2ZJ2A 5FWDA 1BRMA 1M2GA 3JVEA 3D3EA 1AU9A 1KFJB 1VLHA 3ASZA 4V39A 4RK5A 4RD1A 4OH1A 2YY5A 4GRIA 4X44A 1DXHA 1NI4A 2QM0A 3NBAA 1WVMA 1RRVA 4AJEA 1B73A 1QC5B 5KAMA 4COKA 3FTFA 3NAMA 5I4CA 4IKEA 2QG9A 5LOVA 1VGRA 1MABB 4EOGA 2H7VA 2VSYA 1FA9A 2WUGA 1NLYA 4ID9A 4KBGA 4R0VA 3SYLA 5CHEA 5KNLA 2BKVA 1GHTA 1ZQ9A 5EEHA 5FUVA 4K05A 5HZMA 2IP4A 1UXHA 3PFWO 3V4RA 2B4KA 2DEUA 3VX3A 2PUDA 3ACBA 4DIKA 4JUAA 1MH9A 4EG3A 4PTLA 1UMBB 2JZOA 2E4YA 3KKEA 1QIKA 3ENKA 4PPQA 2DX7A 4QTYA 1YE3A 3RK0A 1M2HA 3IODA 4X95A 4QFCA 2EX4A 2JGEA 4BCCA 1O8BA 4LK3A 1VPDA 2I6XA 2BFOA 4N7JA 3UOWA 2X14A 2JFGA 4QFBA 5C9ZA 5F2NA 1XZGA 1KYIA 1GJRA 2HPZA 2RH4A 2VDWB 4P3OA 4AJ2A 4AP6A 3UKJA 5J4HA 5FOWA 2JJMA 1XKQA 3DMDA 3PHCA 2B8NA 4FSXA 5E1DA 5L3QB 4TV9B 3WL4A 4D4LA 2MMGA 3C14C 1OVMA 2F1OA 2AE1A 2PNFA 3QVXA 1W93A 1WCIB 5CH8A 1XZIA 4V0LA 1T5HX 4YPFA 3VR5D 4AJHA 2XB6A 4X41A 3CX8A 3IUJA 4GI2A 4U39A 2GCPA 4FZJA 1NUUA 1ZD8A 1MB2A 2H7CA 1OPXA 2PL5A 4I8DA 1H1LB 2BM8A 16PKA 4WZZA 1ENOA 2BE7A 4IXTA 3WMFA 3MXOA 3OTGA 3T8YA 3B1VA 3U3MA 3TR6A 3RSLA 3GJZA 4X24A 4DR6B 5AVXA 4AKIA 2ERXA 2Y76A 1A9YA 1TIBA 3KTFA 4F3KA 1R8SA 5IVPA 3QOFA 5IH3A 3QNMA 1I24A 1FYXA 3QVGA 4GM4A 2NPFA 1DZIA 2H4WA 1LPBB 2EIXA 2P2ZA 4PYRA 5DBGA 5DM1A 1W5EA 4PBRA 4AJ1A 4QWMA 2CDNA 1JWLA 5NLLA 3G0IA 3LZ6A 4MB0A 4Q66C 4TZTA 2QRUA 5EHNA 3SVZA 2C00A 4FCTA 2B25A 4K3UA 2QMQA 4BBAA 1IHOA 5BR1A 3RF7A 3ZGOA 3ADBA 4TV8F 5DYNA 4F4IA 4RVDA 1D0SA 1LLQA 3QV2A 3IIJA 4E46A 1FX1A 1T13A 1YQDA 3AB7A 4QAQA 3MINA 1E66A 1PWEA 1FDRA 4BZZA 2GD1O 4IXMA 1XLTC 4N39A 1K3UB 2AG8A 2FPXA 1OXBB 4DANA 3LQYA 2VOJA 5I5GA 4BJ1A 4RTMA 4J3NA 1P33A 3KD2A 4V1CA 4JUIA 4PLWA 5DM4A 3M3DA 1VIYA 4HVCA 1AQYA 2C99A 3OJWA 4W5JA 5A6SB 5EHGA 1X39A 4WCFC 2XVZA 2CY0A 1D07A 1L8LA 1Y1QA 2OZKA 2RH8A 4IWYA 3W8RA 1QFZA 3ZNNA 4DXDA 5BWOA 3WLTA 2QUHA 4ZO4A 1Q0SA 3TR0A 3W7BA 2LCQA 3D3QA 1TA0A 2TRSB 4HMOA 4LQLA 3DBHA 1RFGE 2XMRA 3M6MD 3JRWA 4CQLA 2CV0A 5I48A 4Z4IA 1Q3TA 2CBGA 3KQQA 1PNRA 5IAJA 1WUTA 1Q22A 2JEZA 4NRDA 1HDOA 3GLQA 1KDZA 1QFSA 4MVCA 3CONA 4UVEA 4KQHA 4MW9A 5LWQA 2W5UA 4PLHA 4NCAA 5FQNA 4AY3A 4E33A 2IRWA 3VR5H 1CJTC 3EX7C 1KJJA 1SUSA 1I7NA 1W1WA 4OAOA 4KO2S 3D6MA 2CMHA 3IX7A 5FOQA 2XIJA 5EE1A 4WTOA 2OV8A 3QYPA 2ENUA 2PTHA 2Z30A 5JD6A 5HFNA 2J3LA 5EIAA 1VKOA 3DP9A 1RKBA 4YONB 1DFIA 4FWIB 3WLFA 1E0SA 1YVEI 2G1JA 4MUGA 3BT7A 2BUCA 1DINA 5JCXA 2ATEA 4MRPA 5SZHB 4MDEA 4NEQA 2YNMC 3PXCX 4UXJA 5COQA 4C7JA 2YOHA 4Y2VA 4K9OA 1R8QA 4IIJA 4GVPA 1HBJA 4RK0A 4LVOA 4YMSA 1XAJA 5I5EA 3OQMA 3GG9A 1DC7A 4V0RA 1L4MA 3SF8A 1DLIA 2D1SA 2QD5A 3ZDAA 1BU5A 4QOIA 4H27A 5BMOA 4Z8YA 3U1VA 1T1EA 4LDAA 3ZI7A 1V4VA 3BPSA 4ZHQB 1LKZA 4X65B 4IICA 4MQFB 5HGXA 3KQOA 4EECA 2CLHB 1VECA 1W36B 3QVMA 3KHKA 3SQXA 1DFHA 1SIBE 2ZAYA 3VJRA 5A06A 3PRHA 4F5ZA 3ZYZA 1W5FA 3TSOA 5JMOA 3ZH2A 2GZ1A 2G7ZA 1ZM2A 5TGZA 4JENA 1SG9A 4IH1A 3FWKA 3NTOA 1P61B 1SEVA 2XWSA 3JQGB 3QLVC 2ZUWA 1S3FA 3HWWA 4GE3A 1OOEA 3VJKA 2QRJA 3HDHA 1DPFA 1JFFB 1GLVA 4KKXB 3KOUA 3L8DA 4DOMA 1E7WA 5AW0A 3BXXA 5DXFA 1CE8A 3DVRX 4HX9A 4HQNA 3K71B 3RVOA 3AEQB 3RBZA 3OJXA 3IQGX 2OTCA 2ZIGA 2BGTA 3F6SA 1EB9A 4N0PA 3VTFA 3RHTA 3DT9A 5DXJA 2R25B 1W29A 3L0BA 1B6GA 3MCVA 4FX2A 3TL6A 1P2TA 1AK2A 3JZDA 3MVEA 4K46A 3ZDRA 3AFMA 3HDTA 3STUA 5AJXA 1ITZA 5K2MA 4NXMB 2BBSA 2IE8A 3ZZTA 2C7QA 4KFUA 4RJIA 1F2VA 4U5XA 3R0ZA 5ETJA 1ZXBA 4MLZA 4MJLA 4DMRA 2H1RA 2Z83A 4BQQA 5F9HA 2O19A 5DM0A 4W5NA 3C15C 2A1IA 2H4XA 1IU9A 2VJBA 4HH0A 4B46A 3KYDA 4QT0A 2ZSUA 3DFIA 3TQTA 3K2QA 1TCVA 3ADDA 3OCWA 4KH1A 3B6IA 1MR3F 3FH0A 1TZMA 3BYZA 2XB9A 4JC0A 4Q3EA 2D00A 3W78A 4F46A 1EIWA 1CWUA 3TSCA 3EDYA 2NT3A 5BYKA 1OFUX 1ZW6A 4TX1A 5CT8A 1FTNA 2BMEA 3PIRA 3QOWA 4MWGA 5JSYA 4HV4A 1XWFA 2GN1A 4Z4GA 1NQOA 1D2GA 4RTQA 3ONVA 3AVWA 4GOXA 4MPJA 2XMQA 2G5GX 3PGVA 1J0EA 1BKYA 1T9KA 3AI7A 4NU6A 5EAIA 2M98A 1DEAA 4CPDA 5I47A 5DLYA 5BWNA 5EA2A 3I6BA 3DTVB 3T1NA 4LF6B 2XUDA 2O8FB 1XJCA 1N7HA 1NUPA 3REGA 3WYBA 1SU6A 2GEBA 3BIXA 1K6EA 1P0QA 5DBOA 1Q15A 5ARBA 2B78A 1SO8A 3PT9A 4LGVA 5CCBA 1RRMA 1FJXA 3G88A 4MKXA 4N8EA 5TB5A 1GQQA 3RJZA 1CZNA 2Z1NA 4K9NA 4C5AA 5IVKA 3E03A 1KJWA 1NW4A 2XCIA 4OU5A 2WD8A 2VK8A 4W1SA 3AXTA 3F7TA 1UJ5A 1U0NA 3ZVRA 3EXHC 4EVSA 3OUZA 5AWFC 1Q7GA 2RGRA 1X80A 2DRIA 2VSXA 3I1JA 3KO8A 1Y9JA 3H0CA 3BXPA 2OZVA 5A2GA 5HTOA 3S68A 3L8CA 4YGXB 3LCJA 2IV7A 5BUQA 3A37A 3QPUA 3CVVA 2F64A 5CB6A 1JNXX 1LQ2A 4HEA6 1EEHA 1DOZA 2JATA 3PX2A 2HWUA 5F1OA 5HILA 2VT2A 1RWKA 3KZMA 2OV6A 1Z26A 4IQ0A 2XF8A 3VTZA 2DY0A 2GRAA 4BTEA 3L4KA 4A15A 1XTQA 1BEUB 1U8EA 3L6UA 4HTAA 2WLTA 4Q47A 3KT8A 4XM0A 2HQRA 1YFLA 4MR9A 1ZRSA 5CGZA 3D59A 3ONDA 2DPXA 2GA8A 2CLOB 2GETA 4I99A 4NH0A 1OHHA 3MTGA 4ZT4A 4PLPA 4R3UC 2J33A 3R3JA 1OC2A 4MICA 1GAQA 2PGNA 4EMUA 5EXEA 4UTZA 5F7ZA 4J9VA 3ABZA 2R6R1 3IPLA 2NPIA 5J1TB 3ZU4A 3X3HA 1JHPA 3CY6A 3IJEB 1X1TA 4DLWA 1DEXA 5DCWA 4ZCTA 1U8YA 1I8TA 3LQQA 3UAYA 3ER9A 3H8JA 3IPRA 1TIKA 5H3HA 4ZFNA 5E6RA 3VTAA 1JEAA 4AROA 3MRXA 1TYAE 3LHKA 2YASA 1P8AA 3LE8A 2WHPA 5GJBA 1Z06A 3UW1A 3WWZA 4P4SB 2I3BA 4PLGA 5DM2A 2AH5A 1QG0A 3E2IA 3O2JA 2W22A 3BWEA 3H1TA 4JDPA 1HSOA 1TGVA 2PZAA 2FWAA 1V71A 2PJZA 3PENA 4FK8A 3ZVMA 2I2XB 2HA4A 5C4MA 3O21A 2P7HA 4MO2A 4UNPA 3SLGA 4AF6A 5JJBA 3O8NA 1UM9B 4R8MA 1TLFA 1FY2A 3RADC 1I1OA 3B7WA 2A59A 3MBKA 1XOIA 2C5EA 4KU4A 4BLUA 2EQBA 4BBJA 1G5FA 1UH5A 3PKZA 3RYHA 2X7JA 2F9FA 3PNOA 4Y2XA 4Q7EA 1I0LA 221PA 4TRNA 5HBRA 1L7AA 4AMBA 3QXCA 5KYXA 2BFBA 5CFNA 3I4CA 1DIRA 2H6EA 1DIGA 3A05A 3DH0A 3TB4A 4N65A 3V1UA 2OB2A 3QELB 3EBLA 2HWXA 1KPGA 2XGMA 3JTEA 1DMRA 2WICA 3NJ4A 3QXXA 4Q3OA 5LQRA 1Y5IA 1ONOA 7YASA 3CC8A 5CBPA 3WJ2A 4PG6A 2JJQA 4DB4A 4ZQEA 1URPA 4OFWA 2X1HA 5LXTF 4DDWA 2X0FA 1E1RD 3ICCA 3KE8A 4KQFA 1DAMA 3KHSA 3L0PA 4X1IA 3OTOB 3KT6A 1A7UA 4IQFA 4WNYA 1QGOA 2JHCA 2HEGA 1C1YA 4FDMA 4G1MB 4HAXA 4OMCA 3FR8A 3LTEA 4PSUA 2C3UA 2H92A 6Q21A 1KEWA 1T34A 2W0SA 4LG1A 1S9DA 4YA6A 1ZEJA 3F73A 1QGUA 3TLBA 4K5QA 1YO6A 1EFRD 3LIIA 3ZWBA 1YZQA 4Q3LA 1NNEA 1JR2A 1IN4A 5EYPB 1TVKA 2EV9A 5K8CA 1V5IA 2MSKA 2Q4RA 2IHKA 3I4LA 4R2MA 4NI5A 2F55A 1KARA 1YQ9A 2O8VA 4M7RA 5C3MA 4TUYA 1D9ZA 4BE9A 3GFSA 2H1LA 5EMLA 1R10A 1MEEA 2EBWA 2G72A 4YJ3A 1FP7A 2V8BA 4PWYA 4MRSA 5EWLA 3SOPA 1H2FA 2QHXA 1C1DA 1CJUC 4NDNE 3RFFA 5J4LA 4CEJB 1UK6A 2PL9A 1UT6A 2DBVO 2RGUA 4X61A 1ZW1A 2WF5A 1QHHB 2JIZA 3X1ZA 2AW5A 4HX2A 1VBMA 3K1AB 2P2SA 2WZQA 3DAOA 3LO5A 4S24A 1R0SA 2Q9UA 3U4QB 4ZRNA 3P4UA 1CVRA 1MPTA 1NVUQ 1BYIA 3O4HA 1XI2A 3MMXA 4D26A 1R6VA 4EO9A 3ADCA 3B1ZA 3RV4A 4GXNA 3JQAB 4OYRA 3EGWA 1NN1A 3T1TA 3S4YA 4DMUB 3TFOA 5EIWA 1BN6A 5DGHA 2ACKA 4PHGA 5ALLA 2PX5A 5A62A 4J1SA 2IY8A 1QTIA 2ARKA 1NBME 3QEAZ 3ZHCA 5KNDD 4JBHA 5AJHA 1DO2A 2FEKA 4WCDA 3B7PA 2J0QA 1L1QA 2NPOA 1ONPA 2C9DA 2OBLA 4M8IA 4UVDA 1PL7A 2ZREA 2RB4A 4Q05A 1LVGA 1WF3A 4MP6A 4BFYA 1E8NA 2DETA 2UXDB 2PLRA 3JWHA 1PJRA 4D99A 5FUXA 3DLBA 4G0XA 5HJ5A 4AS2A 4OHUA 2Q1WA 4EZIA 3UJ8A 2PJDA 3DW1X 3WRYA 4IHJB 2I2FA 2XUKA 1BVHA 1OPRA 3T99A 1CUIA 3TO5A 2BHTA 3DGFC 3ROTA 2V3VA 4EX7A 3TD9A 4FMDF 3V8QA 1J9ZA 4J75A 2F67A 3AESA 4BP3A 3PHBE 5IJAA 2QJWA 2CLCX 2ZZMA 2YZKA 4IM7A 4XYBA 4B2LA 3L4BA 3GNQA 1Y0BA 2QORA 2FX3A 3OKFA 4UM7A 4ENRA 5LR6A 2PUBA 4IINA 3U7IA 4L3OA 3NORA 1JQDA 1NKTA 2ZUUA 4MGYR 3NGMA 5DI3B 3THWB 3CA8A 4RMIA 1K88A 4AIRA 3BILA 2V9ZA 4HDAA 2Y27A 4QT4A 5TT1A 4Z4QA 4IIBA 3EMBA 4ABYA 5IZ4A 3U31A 4O0LA 2IHZA 1T2FA 1BXRA 1ZC4A 2C4VA 5HCNA 3S3TA 4HB4A 2ANCA 3L06A 3TFWA 4EHAA 2JBHA 4JUFA 3HB0A 4BIIA 2CVQA 2H2WA 2ZANA 3GF4A 6REQA 3F7NA 1SOWA 3AUFA 1YRBA 3G2PA 1R5NA 1YR2A 2HBYA 4IVNA 4ARZB 5HQ3A 2WWRA 2YWDA 1YRQA 3FB1A 3REFA 2QX4A 2QB5A 3UAXA 1Q0UA 1U9IC 3IP1A 4FEGA 1SHLA 1E4OA 4UFPA 1OBVA 3H42B 3PDIA 1JQBA 4GBGA 2IY7A 1FMTA 4LYDA 1VP3A 2NXJA 1BMDA 2PAAA 3JATA 4W9RA 4Q0MA 1EK1A 4MR7B 1Y5RA 2C2YA 3PUXA 4XDGA 1CEXA 1CKEA 5CB4B 1GL3A 2PRZA 5IYZB 2HHHB 4YK7A 2BHRA 2Y1EA 1MA0A 3DDOA 4JLSA 1DHRA 3JPYA 4G86A 3AU9A 1I80A 2OCAA 1YK1A 1ZIPA 1VIVA 2VTEA 2P91A 4GXTA 1JIKA 1OKKD 1TKAA 1N2CA 1OMOA 2DM6A 2HRCA 4IBOA 4UD2A 4XFDA 3R5XA 1QKIA 1ZUNB 2G5TA 1D03A 5FTKA 1XR3A 2XRYA 3HPRA 1L4UA 1Q7EA 1TYCA 3HP7A 3UMRA 2VRWA 3I2GA 3Q7SA 4YI3A 4UNRA 1ZOLA 1KKUA 1MHPA 1NW7A 3M3HA 1QMGA 5EJ8A 4EY8A 3QHPA 1AKWA 1OA0A 2YDYA 5FIUA 1MRSA 1CLEA 1E5QA 2ZROA 3FB4A 2DR2A 2CMGA 4TZ6A 1X0VA 4M6WA 1ACJA 3OZ7A 1EXWA 5REQB 3RSQA 3BGSA 1J4AA 1HT0A 1WB6A 1X7DA 1QXSA 1L7QA 3FNHA 4WWHA 1L4GA 2GNOA 3WLAA 1SD2A 3A26A 1ZY2A 5CM2Z 4QUAA 3Q12A 3KOZA 5B1HA 1DQYA 2GCGA 2A14A 2VQDA 2CCJA 1DADA 2YC4C 4A0RA 3AF6A 2B99A 2JLVA 3I09A 2GLXA 4F84A 4PX3A 1PG0A 4JC8A 2HMVA 1QRDA 3T7DA 3C97A 2G76A 3PQ3A 3RVQA 5E0OA 1L8OA 1JDVA 3B52X 4FSDA 5K05A 3ZIDA 4NS4A 2H85A 1G5HA 5EGSA 2E89A 2UYGA 1GQSA 3DQZA 4J9UE 5FX2A 3PB3A 5GINE 1WSWA 1RP7A 1M2KA 4ARIA 4AZVA 1D6SA 2RBGA 2VHUA 4RAOA 4GLJA 4G67A 1BGWA 2XCTB 1L5YA 2KE5A 2RG1A 5KVQA 3VISA 1GCGA 1ULTA 1G3IA 3QVOA 4TUYF 2R8EA 2LCIA 1ODLA 4RA9A 1RLOA 4RKWA 5WRFA 1O97C 3AJ9A 3OY2A 4JLKA 4L27A 3QU7A 4JBNA 4FONA 5CLLA 2J46A 4PTYA 3R8XA 4OI0A 1R0WA 4EY4A 1YCFA 4UXIA 1WMEA 5CK5A 2R60A 3M2PA 5I4KA 1KC3A 4C7OB 4BMYA 2OVFA 5A02A 4QQNA 3UHAA 2ZYTX 4EUEA 1RIFA 4CBVA 4EB6B 1OLXB 1UKEA 1XLTA 2VF5X 3TSZA 1M2OB 3C5CA 4JLDA 4UATA 3T0IA 4OK3A 4UD6A 4P98A 1TMKA 1EFUA 2IU4A 3FFWA 3WHKA 1K9SA 4F3YA 4FLEA 4F71A 4KI0A 5AD1A 1R6TA 3F5DA 4RIIA 2E6UX 4ZOLA 4JLPA 4ZQIA 4DAEA 3UPTA 4M55A 4FXPA 3SHFA 4YMUA 5AYVA 4WCFA 1PGOA 4FN4A 3P32A 3UF0A 1P91A 5BN5B 1H22A 4ARVA 4AF8A 1KI2A 3LHSA 1D0IA 5GGYA 1GT91 2B36A 3SGLA 4C3UA 1YOVB 1MC1A 1NYLA 2LBPA 5GTDA 3FZEA 4S1WA 3WYEA 1DEOA 4HH3C 4GMDA 5CG1A 2FJPA 1O03A 3D1VA 5AVJA 4IIGA 4NNJA 4D57A 1O9GA 2OFPA 1XA0A 2JFHA 3Q9SA 2VBGA 5AXBA 3C7DB 4AUEA 4PSDA 5EKTA 3R3XA 3MW8A 4TMXA 4V24A 5EZ6B 5B7PA 4RUKA 4JLUA 4IJ5A 3VH4A 2LDYA 1BX0A 4NONA 4CMKA 2C4TA 1ATZA 2JAPA 3EGXA 1XHEA 5LN1A 1BA3A 3NXSA 4LQCA 5IT0A 2YIDA 1QWOA 2A1UA 2FI1A 3G13A 1GFSA 3D0KA 4OQLA 4WZBE 3H5RA 2ZRQA 4L5BA 2GEFA 1FRZA 5ALFA 1W34A 1KI3A 3OHPA 4KIUA 1WZUA 3PNKA 2JGDB 3G2MA 1ZU4A 5K3CA 1QO7A 1GR0A 1S8AA 1ZGGA 2IDZA 2NT4A 3LM8A 4U0KA 3UAVA 1G7RA 4OL0A 3KR2A 4OA5A 1W581 3KEFA 5ICFA 4B4KA 2W6ID 4X64B 1IZ7A 2FSIA 3ZWKA 4KHZA 2YNMA 4NX2A 4YJDA 3GLTA 4N5IX 3TPZA 3GAFA 4WW0A 1IN8A 4FCVA 1OB5A 4Y9DA 3EVCA 4XR4A 4DFDA 1GAWA 4NYMR 4AJPA 1X1SA 4OHVA 3VZQA 4H1TA 2H57A 4BHTA 2I6FA 2OHHA 1TZ2A 2V6JA 3PC7A 5GY7A 4EYEA 1A8HA 1BHO1 5DO9A 2WG1A 3EZGA 4Z3DA 2QRVA 1H23A 2R84A 2Z2IA 3TYXA 5LLSA 4EA6A 3ZTWA 3VNRA 4ZGBA 4ZXPA 1G20E 3PLNA 4M2LA 5H9WA 2VP2A 2VP5A 4XWTA 5JJCA 2GO1A 1EXDA 3FDJA 2WJYA 1IBSA 1D5WA 1J90A 3O26A 3O9ZA 4JP2A 3BFPA 5FFMA 3PP8A 1O77A 3QLVA 1HLPA 4XTRA 5FR1A 4CQMB 4BO8A 5JO0A 4LHYA 3W06A 1WVGA 4CUJA 2YS7A 1SQ5A 1U2RA 2DR3A 2C54A 4RY8A 3FCSB 3KKOA 1V1MB 3OF2A 2XKAA 4UBKA 1XF9A 2CV1A 2YFQA 3PDHA 5C5DA 3TCKA 3VPHA 2AI2A 1V96A 4GMHA 4UXHA 1TADA 1ODCA 3OZXA 2W71A 2NQ2C 2HIGA 2V59A 1L3BA 2BKAA 4B5KA 2PWPA 2F90A 4M22A 4B33A 4KI7A 4B8WA 4YP1A 1N6IA 1OY1A 3AFIA 4HFMA 2Z5VA 2WWXA 5BSWA 1UOOA 1W25A 3DBRB 2PFKA 4CF4A 3TTSA 4G0MA 3UMMA 3DCYA 2ZVDA 4QVKA 5KSZA 2O3QA 2G04A 4O3MA 2QZSA 3PI6A 4BNWA 4DWOA 1UWLA 1N34B 3N2GA 1LQUA 1YNOA 3C3CA 2XA9A 3O0TA 1AGYA 5ENDA 2QQ0A 1Y5NA 4YDQA 3CEAA 2W2QA 4DWVA 1WV1A 1UDRA 4PYMA 3EG9A 3PC6A 4EYOA 2R8OA 2A3RA 5JS7A 1Q2XA 2IPMA 2O7NA 3CUKA 3WYAA 4KQWA 1Y37A 1ZHOA 2HUPA 3DDWA 3UGTA 1A95A 3NIBA 1BE6A 1LPAB 3CZCA 3OY7A 3VC7A 5KTYA 1VBFA 1C8BA 5FORA 3SQWA 4EUKA 3RVPA 2WSYB 3FX2A 5I9NA 3QEMB 2ODTX 3SYRA 1EFVB 1PUJA 2DPMA 2YYZA 3A25A 4UHJA 1COWA 2HQBA 4HAZA 1ZRNA 4HG2A 4MDHA 3T7JA 4BO7A 4BRWA 5F2OA 4BUCA 1RXVA 3PKJA 4IVQA 4FB4A 5B4TA 4O3FA 4C0WA 1U80A 2XB4A 2J6IA 3ANNA 3PZRA 5K3DA 3B9PA 3FPKA 5K1ZA 4RTLA 2XNDD 2P0YA 3G2LA 3PHLA 2X9QA 5T6MA 3STVA 3DD5A 2H1HA 2VP6A 4TL7A 3TUZC 3T1YB 4AUKA 1DKQA 1CS0A 3PTLA 4IDCA 3E8SA 2WV9A 1QTQA 3NU1A 1JPJA 1J42A 3UB2A 4Q37A 5AM2A 5DEIA 1N0WA 3H4MA 1GNRA 2PX4A 2OAEA 5P21A 4JK3A 3EXHA 3O1HB 4FPXA 3H2ZA 5LU9A 5MGBA 3DE4X 1HEIA 2FW0A 3MJHA 3ELUA 2A0KA 1XJ0A 3BBPA 3PBKA 3RNLA 2WQZA 4PR3A 2H2IA 2O9JA 5JV5A 5GONB 1SUDA 3UUEA 1GPH1 1PT7A 4ND7A 3QHQA 4OBBA 3MWYW 4ZOLF 3ZOZA 3HO6A 1MFPA 3NTQA 3DBVO 1U4OA 1CPYA 4R7ZA 1AQLA 1S02A 1WMSA 2BT4A 3V7FA 1LWNA 5BMVB 1TW2A 5D7NA 4CKCB 2E18A 1EUQA 3ZDEA 1XU7A 4JASB 4LF7B 2W6JA 3DOIA 3EZFA 3RSOA 2J0UB 4ACAA 1QJCA 3TBKA 1FMFA 3QXGA 1XNJA 3IKTA 3A70A 5BN4A 3LCMA 1WDLA 2W11A 4A8PA 4IJQA 1OU4A 1K2WA 1DTEA 1E62A 2H9YA 3LH5A 2P69A 3NHMA 4DCTA 2YYSA 4GZLA 4DMLA 3JAMA 1I3LA 1FX0B 2QX8A 3OJ0A 1ISGA 3Q9LA 5TJ9A 4WBSA 5AMXA 1K8ZB 4TXHA 5E38A 1JTEA 4ZVTA 1EYZA 1SRRA 2GVDC 1SCUB 2HA3A 3I9NA 1AHHA 2JJ1D 4LTDA 4MEJA 4S35A 5SYAA 3ZH9B 1PVDA 3NWJA 2HRRA 5TF4A 1Q0TA 4E7PA 1X7ZA 3VSBA 4XIYA 3HBNA 4YAFA 2YIJA 1R12A 4V2IA 3GO4A 3ELYA 2NU8A 2Q2OA 4MUIA 5K3AA 1G20B 1U3VA 1XTSA 2HZBA 2VBFA 1B1CA 2QMYA 3CNEA 3K0KA 3D2CA 3WICA 4GM1A 4AJKA 3UATA 3WGQA 3M1YA 1W2GA 4LZZA 4A8JA 3NHZA 4TKUB 1EMDA 1DBWA 4FIZA 4UHCA 1QUFA 3CJTA 3ZQ4A 2EW2A 4FS3A 3QEJA 1RCTE 1TM5E 2VA9A 1MRZA 2SICE 3W3AD 3EN0A 1A9RA 1E6CA 1HE2A 3VYUB 2JF0A 2I6SA 2DFDA 2FPUA 3W0LB 5DTEA 3SI7A 3V80A 3EXIA 2PA0A 2J3HA 4W82A 5FNVA 2IYZA 2J0SA 1RSZA 1RS0A 5JQGB 1QRAA 4LYHA 3LSTA 1WV0A 3T54A 3QX9A 3EFBA 5KKNB 3FDZB 3MCUA 4RVHA 2GN0A 1YXMA 3DXXA 3OMWA 4G09A 1EB8A 1GPKA 1RPNA 5DJ5A 4OUKX 4B4OA 3H2HA 3SOZA 2R6GA 4HH4A 2YXLA 3HCDA 4JI8B 2WVHA 1C3OB 5E3IA 2W42A 4ADSG 4UQPA 3N2EA 2C9YA 3FZYA 2WFZA 2WJIA 3DMGA 2CBZA 1Y63A 2Y1FA 2C95A 3KRTA 1SC9A 2JIMA 3MBOA 2VHCA 3N8IA 2BONA 2IEIA 3IAXA 5FLYA 3ZJTA 3D8BA 3FMGA 2XI4A 3O6VA 2DERA 2JKZA 4XCVA 2ZRJA 1YS1X 3BWYA 4OHOA 1OXSC 1BE1A 3EVBA 4M9RA 3V32A 3ON5A 4G1VA 1Q3HA 4N18A 2O3JA 4PC2A 4Q7LA 3SC3A 4DEVA 3T35A 4ZV9A 1WSAA 4CQNA 3LW8A 3H99A 4X84A 2P9JA 1FNNA 3A6HA 1QZXA 5H82A 5KPDA 4GECA 2YN0A 3EAQA 4J1QA 4QNNA 2ADMA 1VIMA 2K6GA 3SJUA 5HKKD 3D8HA 3A7EA 1T9GR 5CH3A 4YT2A 4I1PA 1CY1A 3SBOA 4JA2A 1BA2A 2Z04A 5TQ0B 1LW6E 3ND8A 4C43A 1DEKA 5KTKA 2ZQZA 1PK9A 3DL0A 3HCOA 2HV9A 5TLSA 2FOXA 3PCTA 2W4QA 4DPLA 3DLHA 2WIBA 3E9CA 2OD7A 3EZ2A 3K31A 5DM70 4BLWA 4H7PA 4G97A 5BUZA 4JP8A 5FTLA 1I5EA 2FPGB 2GXUA 2P2GA 3HVRA 2JLYA 1O96A 5ITSA 2A7XA 3AIMA 2PMDA 3HZOA 4M76B 4PAQA 4CFYA 3KQLA 2RE8A 5DTQA 5EZSA 4ZT6A 4B7CA 5FA5A 3PD0A 3TKAA 3H04A 1PGQA 5FAKA 2OYSA 4GKVA 3GFGA 3SZUA 4ZDWA 1Z4PX 3BRWD 5JPIA 4L8GA 5HW0A 2HTFA 4LRUA 5JATA 1GGMA 1TAQA 3QP9A 1O6FA 3PE4A 3U7QB 3JAKA 4OHRA 1H3FA 2H2HA 3HWX1 1U0GA 5JNTA 2XX3A 3B20A 3ONNA 2DFLA 2PUCA 1MJNA 2G1UA 3BX1A 3GXOA 3ZWPA 3L7KA 1SKBA 4RS3A 4BFWA 1MAUA 3ASYA 2PHZA 4ZT2A 3KD3A 4DSTA 3NVKI 3DBLA 4HYQA 1GV1A 4OMDA 2FW6A 2J67A 3F71A 4MAAA 1PT5A 3ZI0A 3A9VA 2ZPUA 2G80A 3KQPA 4IMRA 4RFSB 5EGNA 2NAFA 2RKOA 4ALNA 2JFQA 4WZAE 3U5TA 2ZCUA 1X7XA 1TZJA 2OCYC 3NGXA 4EELA 1TF2A 4Q4AB 1OD6A 4C2TA 1X42A 2E0IA 3EG5A 4RZXA 2O4CA 3KSDO 1T3SA 1TF5A 4F96A 5KDDA 2VH1A 5E8RA 1E3JA 2GJKA 5BQ3A 3GEPA 2P77A 2RHWA 4MVJA 2OESA 1L7OA 2W2TA 2FZEA 2XJ9A 1FFBA 4IDEA 3RSSA 4KPYA 3MWDB 3DLPX 4ALIA 4RXTA 4PLTA 1JVBA 2IUYA 3IA7A 3NKFA 4B9EA 1XRMA 4EHNA 1PD0A 1EIZA 2PKEA 3REQA 3K4QA 5B58T 2ZIEA 4MCJA 2RAUA 3RRFA 3CRMA 1V5EA 5TDHA 1CNFA 3T52A 4EY5A 4CIWA 5KEIA 2QQFA 4C04A 2MIIA 2PMKA 1ZG3A 4H35A 2ZIWB 3KUDA 5AM5A 3SSAA 5LQMA 9MHTA 1HRKA 1U9IA 2GYYA 1QH9A 1R18A 1NMQA 3B36A 3E9YA 3PDUA 1Z12A 3N05A 1F51E 5FLXA 1ZJZA 2R8XA 4M1WA 1OH5A 3UMSA 3W6NA 1R74A 1AG9A 3AVQA 3G8DA 3DGEC 4ESOA 3H9CA 4D45A 3K32A 5TT0A 5HM8A 1AZLA 4QEKA 1H05A 3FOBA 4RPHA 1F8FA 1UMDB 1DRVA 3EZNA 3ZLVA 4GLFA 4HNRA 3RG8A 4R4JA 1TEZA 3JYHA 4IIEA 4CEHA 3AIKA 1BG6A 1RNLA 1JWAB 1YFKA 3P0JA 4PG7A 5IMBA 3Q3EA 1PJTA 1A8PA 1QIHA 2CYCA