2ZRBA

Msreca q196e form ii'
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
325
structure length
306
Chain Sequence
b'PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEVGLQARLMSQALRKMTGALNNSGTTAIFINELTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 81
structure length 306
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrbA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrbA01
2O0JA 1P62B 3UMRA 4EPTA 1AS3A 1ZP6A 2IL1A 2RGXA 5KSOA 1FW6A 1CJVC 2EYUA 3LV8A 1UKYA 4URZR 3P4YA 2B7BA 4PZZA 3TW8B 1OIVA 3LBNA 1D8TA 1XXHE 1Z28A 4HATA 2H8KA 2LCFA 3REGA 4EQ6A 2J0VA 4QBFA 5AUQA 5FL7A 4IXNA 1Z6YA 2C99A 4JLNA 4A36A 2OM2A 1VKJA 3GLIB 1TU4A 3L82B 4RY2A 2P0EA 3K9LA 3QVVA 4KITB 2ZR0A 3EIHA 4CF7A 2AKYA 4GI7A 721PA 1OB2A 3GJ5A 3QENA 3THXA 4LC0A 1DAKA 2BVNA 2QG6A 5KSYA 1RFLA 1N6RA 1W4AA 2VEDA 4D0NA 4A82A 1KZGB 3EWAA 1N6KA 2QPAA 1RC8A 4G01B 2Q9BA 2OG2A 3QVUA 5D3MA 4F92B 1R7RA 1CTQA 2QTFA 1OXSC 4YC7A 4A8JB 1N5JA 1ZM7A 4KFUA 2VYFA 2IYVA 2IYSA 4QGGA 4EIWA 1NY6A 2A78A 1G20E 4DCVA 3ZVNA 4B32A 5JWRA 1XEFA 1Q1BA 1MV5A 4OYHA 4NKRA 1DAMA 4A0HA 5JEDA 5AJWA 1PUIA 1OV4A 3A1TA 3CF0A 2F1IA 3C5HA 2OE2A 2AWNA 3QQ5A 1Q20A 4JLJA 1A1VA 2NMVA 4LJ9A 1CLUA 4JLOA 1JEEA 5A4JA 1IBRA 2IS6A 1RZ3A 4BLPA 5L3VA 4DDWA 2EWWA 3GJXC 5KUTA 2VF8A 4QBGB 3W8NA 4TLAA 3GLGA 3O47A 2AX4A 3RHFA 2OLJA 4TT3A 2Z0MA 2P67A 3GMTA 3MRSA 1AGPA 3KFXA 4II7A 3RAPR 3MLEA 1E2FA 1SXJA 2B7CA 1XTJA 1P9RA 3TNFA 1CBUA 5DGXA 5KDDA 1RIFA 4JKIA 1M6NA 2OBLA 3S1AA 1WE2A 4DCNA 3VR4A 3R9XA 2J5XA 5FTNA 1G3QA 2JIZD 4P31A 4MYCA 5UKDA 1LVGA 3SOPA 4BLOA 3KKPA 4AURA 2H57A 1PUJA 3ZH9B 3T15A 5KNDA 3QSYA 4DT1A 3PEYA 1GNQA 3I4LA 3TR0A 5FI1B 3IHLA 4CW7A 4LJ5A 4JVMA 2KWIA 1I4LD 3ASZA 221PA 5KYKA 2D7DA 3GJ7A 3SDZA 3ZJYA 3WYFA 2ZS7A 2CL7X 2ECKA 2PLRA 1NN0A 3UATA 3A4LA 5LB2A 2ATVA 4JSYA 4DLWA 1SXJE 2FNAA 1G3RA 2Z5FA 4HZUA 4JLKA 4TLCA 4HAYA 2C78A 4Q66C 2A30A 5KPJA 3AV0B 3IDQA 3LBIA 3QEOA 4M1WA 3OZXA 4A9AA 4KLNA 5C4GB 1S0UA 4TYQA 3EA5A 3FMOB 1PLKA 3TMKA 1TAGA 2GCNA 4V0LA 1TEVA 3AVUA 1E2QA 4DEXA 3EC1A 1P5ZB 1E9RA 2B92A 5FBRB 2FGKA 5HE8A 1JAHA 3H2YA 4I1OA 4US2R 3VR1A 2ZRFA 4JL8A 4D26A 3AGPA 3A4MA 3DMNA 3CPJB 1YZUA 4Q4JB 3O8CA 4PR0A 4XIGS 1GP2A 4E03A 5BXQC 1EX6A 2F55A 1U90A 1LNZA 2YHSA 4CVNA 1KSJA 3IBGA 2EFCB 3AP2A 1OHHD 1S9HA 2W00A 3W3AA 5AK0A 2BM0A 2QSZA 2ZE5A 2CHQA 3L0SA 3NHAA 4FCWA 3W5JA 4EAQA 3UPUA 2H5EA 4D82A 1CRQA 3VAAA 2C98A 3BB3A 1OIWA 1GL7A 1NVWQ 2DYKA 3QXXA 2CLCX 1IJEA 4Z1MA 4C4PA 3BC1A 4W9MC 1AJEA 3I5YA 5L3SB 2ZI4A 1UBEA 5IK2D 2ZEJA 2RGNC 3SBDA 3HP1A 3AVOA 3EXAA 5FR2A 4MA4A 2ZUDA 3QXCA 4CEHA 1TTTA 1ELOA 1XJ0A 4TQAA 4W7SA 1ZNZA 1G7RA 2WMNB 5KHOC 4Q7LA 4TLBA 5KDOA 5B30A 5JJIA 1W2HA 4IOLA 1X8JA 2V3CC 3GLFE 4FINA 4RD3A 5F9HA 1OXUA 2XB2A 1EFHA 2N46A 2X1VA 1OFIA 2IUSA 5K8LA 1CRPA 1ZW6A 1W36B 2FGJA 1NIJA 1S3GA 1KK0A 2WWWA 1G6HA 1Y3AA 5DH9A 1NY5A 1K8RA 2V1XA 4B74A 4BFUA 3UMFA 2WWYA 3CUEF 3R7WB 1T3HA 1Q3HA 4DLRA 4A0RA 2A7QA 2JATA 2PZEA 2ZI3A 2ODWA 4F4IA 2FSFA 4B48A 3H1TA 3LX5A 3TAUA 3OAAA 4P4SB 1ZM3A 2EU8A 4RCYA 1EX7A 3A4NA 5DI3B 5HCIA 4EPXA 2G6BA 4HLUA 4X8OA 4IW3B 1ZVQA 3MCAA 4MKHA 2X8AA 2PJRA 4HUQB 4DRZA 2Z83A 2EVWX 2RGBA 1H8ED 2ZUCA 4U00A 1G5RA 3LLUA 1OF1A 1ZC4A 1ZNXA 2NOAA 1L4UA 4Q9HA 4OI4A 4G5GA 4RFSA 1NJFA 2BKUA 3BOSA 2BC9A 1JI0A 2CLSA 2XNDA 2DY1A 2GXQA 4QBIA 1E79D 4URXR 1T8UA 3X1DA 3SN6A 3VU9A 1UBGA 1XBTA 1YZGA 4HZIA 5EE9A 1FFHA 3LW7A 4L9SA 1BIFA 2JLSA 4C2UA 3VHXA 2W6JD 4HB2A 1G7TA 2ZJZA 2AFHE 2VHCA 3AH8A 4JLPA 4P0TA 2P3SA 4Q48A 4MDFA 1W0KA 1S2MA 4GMDA 4DSNA 2BHRA 3KQKA 3U6BA 4Q9KA 4HAZA 3DPUA 5EXPA 4LUCA 4PO9A 1HY3A 4PXAA 4D4JA 3I61A 2IYQA 4LPKA 4PAMA 2WTUA 1XDBA 3T61A 2FEOA 1KI2A 4P33A 2YC4C 3K70B 1ZYUA 3EX7C 4KVGA 3VTKA 4L15A 4QGAA 2FPKA 2YZ2A 2HLDD 4G5SA 1YR6A 1FMLA 1T3SA 4PC6A 4M1TA 5DN6D 4MGKR 5EP3A 1WXQA 4DLSA 1CR0A 4JS0A 1DE0A 3QI2A 5KTYA 2C9CA 2L0XA 5FBQB 2PX3A 1PJRA 4RD2A 4UNSA 3THWB 5E7IA 1TX4B 2ZRNA 3U3JA 1C9KA 2EFGA 3P1JA 1U9IA 1Z6XA 3DDCA 2RGDA 2W0SA 4URYR 4CDGA 1US8B 3TH5A 4UXIA 1Z0AA 2AD1A 2BBTA 3RC8A 4MITA 3FVQA 1VIYA 3HDTA 1J99A 3LH5A 2EYQA 3KJGA 2Q3MA 3I8SA 2ZRJA 1Z6GA 5AUNB 1M7GA 3EARA 3MG9A 1KDOA 4QNRA 3ZD7A 1MABA 3VKWA 3BXZA 3GCGA 3TK1A 2XGJA 3W34A 4KXFB 1XF9A 421PA 2O8BB 4WAUA 2FJUA 1E0KA 3OEED 4OHYA 4H9GA 4BWYA 1AQYA 4MRSA 2WIBA 5FPTA 4A1FA 1VG9B 4IOMA 4WVFA 2JA1A 4TLDA 3DOEA 2QT0A 1YR9A 3RRNA 1VG0B 2QZ4A 2YOHA 4NH0A 5K8UA 4EFNA 5A0FA 2XNSA 3CW2A 1FUUA 4RKEA 5CIWA 1UEIA 2ONKA 1Z29A 3MJHA 1CR2A 3VKGA 3H86A 1YKSA 1IHUA 3M1IA 4C9BA 1P2UA 3EA0A 4EFLA 4ARZB 4TMVA 1OT3A 1QHHB 3GLHA 4GFDA 4J0QA 4CIDA 3AVTA 4M22A 1NBMA 4DHEA 4LV5B 1FTNA 2VH5R 4A2PA 3AKCA 1ZUIA 4XOIA 1CJMA 1E1RA 1YHNA 5C1BA 2FZLA 2BDTA 1VIAA 3FFBA 1L4YA 2O8FA 3OEHD 4HAXA 1DTSA 2QMHA 2RGAA 4MRNA 4CEIA 1NKSA 3E70C 3I5XA 1CR4A 2REXB 3TUZC 1GWNA 2BMFA 1YJ5A 2OLKA 4Q1DA 4G5RA 1XPUA 4BFYA 5GJBA 4PSVA 3GJ3A 2JDIA 2W83A 2CK3A 1TQ2A 5DIFA 2VIIA 1N6LA 1G21E 1MR3F 4Q7KA 1Q44A 1U81A 2WKQA 1RYFA 4TTRA 2ZRPA 1TQ6A 4ACAA 1WDTA 4MGYR 1UJ2A 3T5DA 2IX3A 2FSGA 3GLHE 4MQBA 3GQBA 1OFTA 2RGGA 2UZ3A 3LVRE 1F2UA 2W2XA 3BS4A 3IHWA 1NBME 4TZ6A 2CJWA 2XAUA 3LVQE 1FP7A 1TEXA 2PCLA 3DKPA 1P4SA 4AD8A 4DDTA 3C15C 3C5CA 4IVPA 3HR8A 4HUTA 2HT6A 2LKDA 4OI0A 1IN6A 3ZZTA 2OCYC 4LJ4A 2AK2A 2OUKA 3CX8A 3KJHA 3KTAA 4OQLA 3CWZA 5JECA 5JCPA 1E2MA 4X8MA 2UZIR 1KI3A 1J90A 2IYWA 4TYNA 3NVAA 2A5DA 1EWRA 3PUXA 2IF0A 1BMFA 4RD1A 4PSAA 4GSYA 4IDHA 1G9XA 2HUPA 4EJSB 1GITA 3CO5A 2J87A 3MJRA 4QFMA 4FCTA 2O8DA 4TN1A 1KK3A 2VP0A 5JSZA 4LJ7A 2QGZA 4CYMA 3AKEA 1KMHA 4LPSA 1DOAA 1XTRA 1QVRA 2GJSA 5J4LA 5FOVA 3AVYA 621PA 4B3DA 4ERNA 1OH6A 2XXAB 2R6FA 3ICQB 5FUYA 3AVVA 1KJYA 3NWJA 3I8XA 1KDRA 5JEEA 2BWJA 3ZQJA 1X86B 3TQCA 1RRPA 1XTQA 2PX0A 2NIPA 3OE7A 5EXTA 3QKSB 1NSTA 2QAGB 2O8EB 2D62A 2NZJA 4IDQA 4A15A 4BFTA 1Z0KA 2WWHA 2FPLA 5JI2E 1AGRA 3EZ2A 4M8NE 2ZJAA 1QVAA 3FHCB 3M4YA 1FX0B 3GFOA 2IYZA 2QP9X 3GLIA 1E4VA 3NDPA 2OXCA 1ESMA 1XTKA 3HJNA 3LXXA 5J40A 3KQLA 3WHLA 5SZHB 1TUEA 3WRXC 3B1YA 2WSSA 4EUNA 1F2TB 2GILA 4ASUA 5BN5A 4NYIQ 2ODEA 2VP2A 1XMIA 1AN0A 4MYHA 2ONJA 5CITA 3W6OA 1CR1A 1SVKA 4WXRA 1NI3A 3LWNA 1RE0A 2FE4A 3HR7A 4URVR 1GSIA 2IK8A 4HB0A 4Y0VA 1J8MF 2Q9AA 4DIEA 4B71A 1O87A 4A8JA 1LTQA 1OYYA 3A1SA 5FOXA 3W9YA 2O5VA 4WIAA 1HURA 1HA3A 3F3YA 4AG6A 2WJIA 3D31A 1JQJC 1FTSA 4QOSA 3W5IA 1U99A 4M1YA 4BLTA 5JCZA 4B75A 1TUIA 2JLXA 1XTSA 1OH7A 1GRRA 5CLQA 1YZLA 1ZIPA 4LYAA 1E2JA 3SEAA 4ZKDA 4AK9A 3KQNA 3EASA 1T0HB 5TARA 2XZLA 1ZM9A 1JXOA 1Q3TA 2XSZA 3H4MA 4IRUB 1SQ5A 1GRQA 1G17A 2CL0X 4M0LA 4NCJA 2GJKA 2IBMA 3IEVA 2FH5B 3QE0A 3L2OB 5FBLB 4K46A 1NSFA 3K9GA 4L9WA 3GEIA 4XVRA 3CBQA 4C0HA 4UNQA 2Q21A 1Z0DA 1FP6A 2VF7A 2JJ8A 1WA5A 4MYUA 5FOUA 3PEVA 2O0HA 2YKGA 2PEYA 2QQ0A 2JLUA 3B6EA 1D2NA 4EPWA 3MWYW 3VKHA 2A5JA 1FZQA 3NG1A 5KNBA 3ICEA 3CM0A 4B3CA 1LS6A 3D8BA 5F9FA 2QY9A 3SNHA 2GVDC 1W0JA 3U4QB 1IY1A 4WOPA 3QXSA 2QRZA 3QBTA 4NHOA 3T1OA 1W46A 2C2HA 4FIDA 1BYIA 5EE0A 4G5OA 3MUFA 3H0KA 4KFRA 3PV0A 2G9NA 1WBDA 4BLQA 2JLRA 4ESVA 3AF4A 4GBMA 4KV9A 2ODNA 4JJZA 4WZBE 2R6GA 2Z6VA 3TE6A 4N1AA 4QRHA 1OFUX 2VA8A 4AKHA 2RHDA 1JECA 3CF2A 4YXWD 1COWA 2FSHA 2Q3HA 2R2AA 3T12A 2W6ID 4B6FA 4TT3D 4LV6A 3RS0A 4AI6A 2BIFA 2ZRLA 4P3YA 2IEZA 2FX3A 1JBKA 4N3NA 5HKKD 1IXSB 1SXJD 4F7WA 4IDNA 4DC9A 1ZAKA 4FWTA 2CNWA 2EWVA 1E0SA 2X19A 5BQ5A 1C4OA 1YE8A 2ZRIA 2X2FA 1YZQA 1MO6A 4CEJB 4U7DA 1P75A 1XJCA 2CBZA 4QM6A 5CJPA 1AZTA 4M4SA 5FPKA 1WCV1 3U3KA 2F1RA 3CNLA 1KO4A 2VPPA 4Q4JA 3IPXA 4JZKA 5DHAA 4QC2A 1NRJB 1SVMA 5CM8B 2WVJA 4A92A 2LKCA 2I3BA 3W8RA 1QRAA 3BB4A 3KXLA 2JCSA 1CIPA 3K0AB 2PLFA 3HPRA 3ZIAD 4EPVA 3E1SA 4V0MA 5FPHA 2HJGA 4LI0A 4POAA 3DZDA 2GF9A 5L3SA 4YLGA 1DAIA 3TUIC 2DHRA 1W7AA 1XD9A 1OH5A 2OAQ1 4R9UC 4Q18A 5AJXA 2GEDA 4MRRA 5FR1A 3BRWD 4RZUA 5GJWC 3MWKA 4HI0E 1G19A 2BBWA 3LY5A 1S96A 1W4BA 2G3YA 2IXGA 2GVZC 4WXPA 1BO6A 3LFUA 2KSQA 3UK6A 5FH9A 3UANA 2IS1A 1G41A 1PZNA 3PFIA 1G8PA 2ZJ8A 2X2EA 4JBWA 4IFEA 1DBSA 1IOZA 3LQQA 4V0ME 2ZYTX 2XZPA 2VHQA 3Q5EA 1LB1B 1CJTC 3EZ9A 1OKKA 4TL9A 2QN6A 1P60A 2D7CA 4JJKA 4HLQB 4Q03A 4XD7A 4DKXA 3SHFA 2YC2C 3R7WA 1P2TA 4KYIB 1JJ7A 3PENA 2FOLA 3PUVA 3HU1A 3DMDA 1EWQA 2VSOA 3GJ4A 5DLQC 3H84A 1ANKA 2GK6A 2OO7A 3KKOA 4P4SA 5CLLA 1UF9A 4Q47A 5DI3A 3WNDA 1SULA 2VP6A 1M74A 2HF8A 4LHVA 2H1LA 4W5HA 5EE5B 3QG5A 4LC1A 1A7JA 4US0R 3EPKA 3Q3JB 2DR3A 3QXHA 4HUQA 4S2EA 4OHZA 1Q12A 3L8ZA 4DCTA 3EZ7A 1G7SA 1EFUA 1NF3A 1IN7A 2ZU0C 5L8VA 3HYTA 3WP1B 3AVQA 1Q57A 3NC1C 4QBHA 4D80A 2FV8A 3WMEA 4UNRA 2HCBA 2NGRA 3AVWA 4Q7JB 3E2IA 1KJWA 3QF7A 2FSIA 4UNPA 2JLQA 3LD9A 1KSFX 1CXZA 3MAAC 1G64A 2F1JA 3B5JA 3NC0C 4MRVA 2C03A 1N6IA 2ANBA 2D74A 1NMZA 3CR8A 1TU3A 3BBPA 2BJVA 4JLAA 1JJVA 3HYRA 2DFNA 5AR1A 1XD8A 3GD7A 2GXSA 2OV2A 3EC2A 4JT2A 1DVRA 4Q4AB 1P9NA 3BH0A 2DFTA 2QRNA 2H7VA 4QJ4A 4C0QC 1ESNA 3K09A 4M1OA 4RD6A 3GJ0A 5ELXA 4MDEA 3VR6A 4IVRA 2QMEA 1F5NA 2Y8EA 3IQWA 4JMPA 3N5CA 1G16A 1JB1A 1E9CA 3JZAA 1GNPA 1SHZA 5CJ2A 4CZ2A 1NVUQ 3HU2A 2QGNA 5FPSA 4ZV4A 4JSTA 1MT0A 1T5IA 4URUR 1D6JA 4HLCA 2XNDD 4MH0R 1JR3A 2ERYA 1KZ7B 1OYWA 4QXAA 1AM4D 1VYTA 1TMKA 2VLIA 1XEXB 1GG2A 2IXEA 3GFTA 1Z3IX 4LYJA 4HDCA 2WBLC 2BJWA 1NVXQ 1VECA 4ZIRA 2IWRA 1D2EA 1US8A 4DVGA 4ZPXA 4LHXA 3FKSD 4PZYA 1RVDA 3AM1A 4KFSA 3RSLA 1X8KA 1NG1A 1IONA 3C4JA 3CIOA 4M9QA 2PMDA 4AY2A 1O3YA 4PC2A 2ZVQX 3IIJA 1U8YA 2YOGA 4B3XA 1KY2A 4Q1CA 1CJUC 1KO1A 4HSEA 5M04A 2WJGA 1DAFA 1JR3E 2FU5C 3M6AA 4ZO4A 1SVOA 2RCNA 4OL0A 3K53A 4LBZA 1TF2A 4H1UA 3NHBA 2CVFA 2GCPA 3NXSA 2GBLA 4DDUA 1E9EA 2O8BA 5TXGA 2R6AA 3FFAA 1Q21A 1E0JA 5B58C 1GKUB 5LB4A 1R10A 1W5TA 2W58A 3U44B 1EESA 5P21A 1W48A 1P6XA 4UQOA 3B82A 2IEYA 4TYWA 5CM9C 2ZSDA 1P2VA 1VPLA 2ZQ5A 4FD2A 5A5GA 2VO1A 3G0HA 4DB2A 4DSOA 4E5UA 4QJ3A 1CJKC 4RZXA 2BM1A 2IA5A 3GLFA 4Q4LA 3EZ6A 2P6NA 1QZXA 4PPNA 3NIBA 1FOEB 4ARZA 4BLSA 4PANA 4V03A 4AWXA 5H70A 3A58B 8OHMA 4LJ6A 4X8HA 2GK7A 2PH1A 5BWMA 4PHTA 3CZPA 3P32A 3FE2A 3L8YA 2V8OA 4YQFA 4IVQA 1KOFA 5J47A 1AS2A 2RB4A 3Q7PA 2QU8A 4US1R 4R2HA 1V5WA 4JYBA 4KO8A 1LFDB 1JEDA 4B44A 2XTNA 3EZFA 1SVSA 4XJXA 3UXMA 2YWGA 3AUXA 3BWDD 1BYUA 2ZYUX 4FMCB 4PHGA 2QORA 3OESA 1WBBA 1P9WA 3NBXX 1QBKC 1NMYA 3KKQA 3V4RA 4YMUA 4GZMA 3NEYA 3MFYA 2PBRA 4URWR 2QBYB 3ZYCA 3QG1A 1G3MA 3UKDA 3NBYC 4V0OA 4WW0A 1ODFA 2OT3B 1H65A 5JI3E 1T8TA 2PL3A 2WMOB 2WV9A 3BORA 1KK2A 1R2QA 5AUOB 1Z47A 1SGWA 4LOAA 4Q4HB 3B2EA 4QHTA 3U6KA 2E9SA 4CT5A 4DWJA 5FFMA 4G0NA 2IC5A 1P72A 3NKVA 5SZJA 2ORVA 2G0NA 3LA6A 2JJ2A 2AN9A 5JHHB 3X1WA 2GTPA 3THYB 5FTMA 2ZRDA 1AKYA 3PCRB 4AYWA 2C8VA 4HB4A 4LHWA 2RAPA 4N0DA 2ZRCA 1T91A 3L0IB 4GT1A 2W2VA 4EJSA 5EJEA 3AF2A 1H8HA 3B1WA 1NN1A 1V43A 2GXUA 3LAWA 4QHSA 3SHWA 2ZR7A 1R0XA 5DHFA 3B8HA 1WB9A 3BERA 1G3UA 3KKNA 3TW4A 2CK3D 3CF6R 3CH4B 2BEKA 4HLDA 4Q01A 1MO4A 1D9ZA 3F8TA 4K8OA 4XSGA 5KSZA 2CHVA 3T35A 1NMXA 4NCIA 3SJZA 5KOYA 1J8YF 5DISB 5EP4A 3K0CA 3I72A 2WHXA 1E2EA 1Z2AA 4H1VA 2XXAA 2GAOA 5FTJA 4NU0A 2KBEA 3WY9A 3ZQ6A 2DCUA 1RRCA 1KTVA 4MKIA 4LJ8A 4TZ0A 1G8HA 2AR7A 1R0YA 4BQSA 3QKSA 1II8B 2QAGA 3FOZA 2O8EA 4G5QA 3EIQA 1UADA 2GJAA 2PT5A 2QROA 4C0AC 4LDJA 5TB5A 2P6UA 3QPWA 1FX0A 1QG4A 3A1VA 4AC9A 4JL5A 1XB2A 3OFNA 3UWKA 2VSXA 1TL7C 4FMBB 3PXGA 3X1XA 2DB3A 4PZLA 3SFVA 4IOKA 2NG1A 4M21A 2JIZA 2WM9B 3FTQA 3VR2A 4OQXA 1FPMA 2AD5A 2XOKA 1OSNA 2J59A 4JYCA 2CCGA 1IJFA 2E1RA 2R65A 3P27A 2YINC 4GP6A 4LBYA 3ZZ0A 5B64A 5FPYA 2J7PA 2ZITA 3GEHA 4XTRA 3SC3A 3SS8A 1LS1A 5KPDA 4C3ZA 1T9HA 3G5UA 2QSYA 1ZJ6A 3MWLA 1G6OA 2VHJA 1J7KA 3ZVRA 4NMMA 3EAQA 2ZSBA 4ZCIA 2K5UA 2QPOA 3T34A 4LRWA 1P7CA 3AP3A 3ASYA 2BOVA 5HCNA 3TAHA 5AUPB 4FMDF 1W5SA 5FUWA 4O25A 2B21A 3L43A 4JVSB 2OFOA 1XEWX 1KI6B 1CKEA 2IHYA 4AG5A 3FHTA 1KDPA 1A4RA 1UKZA 2KE5A 1I4DD 3AUYA 3KKMA 1UKVY 3NBFA 2G88A 2Z4RA 4EPYA 1DEKA 1PVOA 4LHZA 5DE3A 4ASUD 3SYNA 3WBJA 1P73A 1EFCA 1X8LA 4NYMQ 4A4DA 1ZMXA 1ZU4A 5JJKA 4DT1B 4B2PA 4A6XA 2DWPA 3IBYA 2BV3A 1E1QA 3A6PC 2J45A 2VBCA 5FOSA 4RJLA 2JLVA 1CULC 3I1FA 4FN5A 3FKQA 2OBNA 1OHHA 2ZPTX 2VHUA 1KO5A 1SKQA 2XEXA 2Z4SA 1XZQA 4Q19A 4AYTA 1E9SA 1VG1A 1WRBA 1WP9A 3TGPA 3BD9A 1G4UR 1EFRA 2FFBA 2QE7D 4B73A 2DWOA 2GZDA 5FBVB 2FA9A 1Z63A 2ZE6A 1KKMA 3Q72A 1OW3B 3U4QA 4YMWA 4DUGD 5KNCA 2JLYA 3EPJA 4X8LA 4KLZA 3R9WA 2PJZA 5J5CA 2G83A 2IYLD 2ZJ2A 1NN5A 5KU1A 5FUXA 5CDFA 2H17A 3LO5A 2ZI7A 3VQTA 1DPFA 2A2ZA 2BCJQ 1VCMA 1DO2A 3B1VA 4MUBA 4QGHA 1E9BA 2ZE7A 1XZPA 3D6TB 2VP4A 3WXMA 1SXJC 4TSFA 2ZR9A 4C0KA 1N0VC 2ZVPX 3UG6A 3FDIA 2PT7A 4ZI3A 3OIVA 4OK5A 3QXJA 4MGIR 3ADBA 2WKRA 4MGZR 5GJVC 2FFHA 4GNKA 4NPHA 4KJZA 1J70A 4NP6A 2D3WA 1WQ1R 5TVKA 3TVTA 3RLFA 3B7GA 1GAJA 3TRFA 4BLRA 3IIKA 5G3YA 5SZIA 4BECA 3ZD6A 4D4LA 1GL9B 2DBYA 3FMPB 4CEJA 1KI1A 2DWQA 2WJYA 5CDFE 1K5DA 5IT5A 3UIEA 4PQFA 2CDNA 2EW1A 3V9PA 3IILA 4BUJA 4BPBA 1OE0A 2GEUA 2J41A 4I1VA 4UNNA 1Z6AA 1F60A 3A1WA 4KSCA 1OXVA 3K0SA 5CK5A 1IAQA 4AYXA 1K6MA 1L7VC 1H8EA 1FL9A 1KO8A 1JAIA 2Q9CA 3AF0A 3K0AA 5FBWB 3TKLA 1E2HA 4WBSA 1U94A 3U7FB 3C41J 2F1HA 3AP1A 3T1VA 1KMQA 4LHYA 4F91B 4TYPA 1EGAA 2WIAA 5LD2C 3O8RA 1U0HC 4XVQA 2BEJA 2F9MA 1E2GA 1E79A 2MSCB 4C2TA 4YDHB 2XX3A 3BGWA 2O52A 2ZSEA 4TMXA 5GJCA 4MYTA 2GKSA 1VYUA 2N42A 1EG7A 2AKAB 1TNDA 4V02A 2ZTSA 1FNNA 3DL0A 2GNOA 3QPUA 1S4QA 2BBSA 5L3RA 4OI1A 5EXSA 4QG7A 5TDHA 2ZM5A 4NYMR 1W49A 2AK3A 3JVVA 3KUDA 1F3OA 3CPHA 1YR7A 1P2SA 2G1JA 2OXRA 3C14C 4L5BA 2FPMA 2BCGY 4RVCA 2F7SA 2QL6A 4BFSA 3MGCA 4GRAA 4WZAE 1R6BX 4JVLA 4Q02A 3LRPA 2HLDA 4M9SA 5DN6A 3K8YA 5L3QB 3T06B 2AWOA 1EXMA 3OF5A 1E98A 3I62A 1M2OB 1UM8A 3LX8A 4EKDA 5IRCD 2A5FA 3SZRA 1UKEA 2WPDA 4NTZA 2J46A 2MMGA 3QJYA 1R0ZA 4BRUA 3VX3A 3GPLA 4QL3A 1PLLA 1R4AA 3B85A 4TMWA 3T5GA 5AJZA 5BW8A 2ZU6A 1IQPA 4TMTA 2B6HA 5C4MA 2FEMA 1M8PA 1G291 4GMXA 3QF4B 1HYQA 1XMSA 3DKVA 1E4YA 3AKDA 3SI7A 4TL6A 2J0QA 2IYTA 2ORWA 1VCOA 3ADDA 4HDOB 3F5FA 5JS7A 5HZHA 2ZRKA 2FFQA 3KZ1E 1ZM2A 4YMSA 5JFGA 2GHIA 2VP9A 1DARA 1JALA 2NO0A 2RMKA 3ND8A 5JBQA 1NNEA 1SVLA 4Q9LA 2IUUA 4HLUC 4DEYA 5FL7D 2WAXA 4XH9B 3VNUA 4I1SA 3CRRA 4HAWA 3TBKA 4Q4AA 1KY3A 1UBCA 4WZ6A 4C7OB 4DBLC 1ZNYA 2WWIA 1MRNA 3K9HA 1EK0A 1E69A 1B0UA 1Z5ZA 2V54A 3MSXA 2QMUA 1Z06A 3PUZA 1W1WA 5FI0B 3W3ZB 2IW3A 2OESA 5AJVB 4OBEA 3EW9A 5E3HA 1R5BA 1UFQA 4PC1A 3MMPA 3QY0A 4KBGA 1II0A 3IQXA 2QAGC 4QNMA 3WHKA 1XEXA 1FUKA 4ZCMA 1NJGA 2J7KA 1IN8A 2GCOB 2XB4A 3CRVA 4LYHA 4QJ5A 1MO5A 2JLWA 1RW4A 3OEHA 4UXJA 1T4GA 1HE8B 2H16A 3RS2A 3TQFA 4FMCF 5DNYB 4I4LA 2OCAA 3IO5A 4E09A 2Q0HA 3TJZA 4YONB 4A0GA 4PAOA 4DLTA 4M1SA 2XITA 1R5OA 5CYPA 1I4TD 4PPQA 1GVNB 3CNNA 2C04A 4R7ZA 4B2IA 1PV4A 4ILEA 2RGNA 2ORIA 1KI7A 1KSGA 3BIFA 4RFVA 4JKYA 4BFVA 821PA 1KJZA 4BFZA 2V4ZA 2YVUA 4P4UA 3K70D 4AKIA 2ATXA 4LJYA 3PUWA 1I2MA 5E4FA 3RS4A 4KCGA 2ZI9A 3B1XA 4PO8A 1DG1G 5B57C 2CEAA 4GPTA 4JL6A 2QI9C 4YDSA 1OIXA 2QA5A 3ONWA 3IEUA 1XD2B 1U9IC 2ZI6A 3RRZA 4DDVA 1XTIA 3RANA 4BFWA 1U8ZA 3NH9A 1ZD9A 3U44A 1FNMA 5CB8A 4JLVA 2DFKB 1S9DA 1HH4A 2MSEB 3GEEA 3SYKA 4XVUA 3DVLA 3Q7QA 5C2JB 2PMKA 2P5TB 2Z43A 5JMTA 2HXYA 2J0SA 4DLVA 2OILA 1HQYE 2GDJA 5J4VA 2C9OA 1U98A 2XZOA 1FQKA 2YJTD 1SKYB 1IY2A 3CPEA 2HCJB 1AK2A 2IS2A 4O0MA 2O0KA 3AEZA 2IHBA 3PEWA 1Y63A 1KHTA 3WP0A 3U60B 1L2TA 2ZSFA 2R8RA 3CRQA 3EG5A 4Q1BA 2JJ1A 3AB3A 3ZZUA 4TYYA 4FWIB 4JLBA 3SR0A 3WYAA 5J4YA 1VMAA 2IYXA 1GIAA 1TF7A 5HTKA 3G82C 1WF3A 4P4TA 1Z8FA 2KB0A 3ZVMA 3BFXA 1NL3A 4I99A 1IN5A 1D5CA 4R2IA 5TY0A 1DS6A 1N6NA 3Q8XB 1Z0JA 2QBYA 4PC7A 2NPFA 4PX9A 4IFBA 2A5GA 3FYHA 1XFAA 3VX4A 5DO9A 4V0KA 1XPRA 1JR6A 1ZCAA 3A1UA 2C9YA 4Q4HA 4YMVA 1E9DA 1HT1E 1GKIA 2B8TA 1GM5A 4G1UC 1KYIA 3CX7A 1Z0FA 5JSZB 5TV2A 3THYA 2Q6TA 1II9A 4Z1MD 1KMHB 3EWSA 3GJ8A 4UJ3A 2FZ4A 3KJEA 5GADl 2F6RA 4LSGA 3QBVA 3MWJA 2H18A 4IJMA 4KFTA 2OHFA 4R98A 2ZI5A 1N25A 2YWFA 2I1QA 2ZJOA 4M9XA 2A3RA 2EFDB 3TSZA 3KQUA 3O8DA 4EFMA 3GJ6A 3QKRB 2QEQA 4D0GA 4I1UA 4UKDA 5CYOA 1VCNA 4MUAA 4OHWA 2GAAA 4IEEA 2QP4A 4W5WA 5E7JA 1A5TA 2A5YB 4JLMA 5FL3A 4C0JA 3ZS9A 4NZYA 3WBKA 1GOTA 1T5LA 3ZGXA 1HQCA 1X1RA 4B76A 5CB6A 2WAYA 1MRSA 1ONBA 1P3JA 2D2FA 5G40A 3B9PA 2GRJA 4TL7A 3PR1A 5DSZA 1II8A 3OHMA 4OHVA 1R8SA 1IN4A 2CL6X 5CIQA 5CK4A 2JJ2D 3SJCA 3TLXA 5F2EA 3OAAD 5EE3A 3PG5A 2D2EA 3DEFA 2VP5A 2NPIA 4KVAA 5ANRB 4DCSA 2BMDA 2CVHA 4IDPA 1E3MA 2WOOA 1H8HD 1SVIA 3KL4A 2ZRMA 3BB1A 1Q1ZA 3QUSA 5KO2A 4M1KA 3X2SA 2JAQA 2CMKA 5KDLA 4OJQA 1D9XA 1KI9A 1Z22A 1YR8A 3CNOA 3QKUA 4IDOA 5DYIA 4GL2A 1QG2A 2J9RA 3O8BA 4V0NA 4LX0A 4PHHA 2F3RA 1ZINA 3RYTC 3GP8A 1T3LA 2NTYC 4R71A 2OSBA 3SU8A 4D25A 3LDAA 2HEIA 4D6PA 2V7QA 1J2JA 1W47A 3THWA 5J4KA 1YRAA 3AKYA 1XX6A 4Q5IA 2VTKA 4KAXA 4Y0AA 3TSOA 1ZUNB 4YXWA 5G53C 1G1MA 3U3MA 2GJ8A 2W6IA 5LPNA 2C96A 5G3ZA 3K0FB 2ASEA 2C95A 1W0KD 4NCNA 5K8IA 2O8CB 4PHFA 1WMSA 2ZJBA 5HKKA 2BMJA 3OFND 1KI6A 3PEUA 1C1YA 3U61B 1Q22A 2VHTA 5FTKA 4B3FX 1NLZA 2X77A 3RWMB 4MKGA 1JPNA 1N0UA 2KJQA 4A8JC 1TQDA 4KBFA 1E9FA 3AVPA 1IXRC 1GDDA 2XOKD 3GLIE 4OK3A 2CE7A 3KJIA 5E95A 3ZS8A 2HJVA 1Z6TA 2J7PD 4E22A 4JT4A 4LWZA 2HT1A 1F48A 2W0MA 1MH1A 5H68A 1MKYA 3GLGE 3R20A 4ESHA 3CONA 1ZIOA 3PUYA 4AKGA 3P26A 4LY6A 4QKQA 4TL8A 4LBVA 4B35A 2AXPA 2ZYWX 4TTPA 3ZIAA 4C0LA 3CKLA 2A9KA 1LV7A 3FMIA 3KXKA 4M2LA 5FOWA 1K5GA 4AIIA 1T0JB 1EFTA 1NLFA 2NO1A 5TMPA 2NO9A 3WRYC 1OH8A 1N0WA 4O2LA 4LJAA 5EXXA 2UKDA 4HYYA 1E2PA 4DLXA 1M7BA 4PTLA 3FHOA 2ZAMA 5F3WB 2FFAA 3UMSA 3TSWA 5HZKA 4ABYA 1M34E 2ZUBA 1QHHA 3QOFA 2WZQA 4A0FA 2F43B 3DOFA 2OZEA 4PFSA 3U7EB 4GDFA 2YYZA 5BYKA 2OEPA 2P6RA 1AA9A 1G7CA 5HR5A 1E1QD 2R6CA 2IUTA 2YWEA 2D06A 4BZXA 3PQCA 1SVWA 3BH6A 2XTZA 2XJ4A 4U02A 1HT2E 1EFRD 1N5LA 3CLVA 4Q21A 1XMVA 5H1YA 4Q9JA 3CZQA 1R5NA 3DM5A 2FDCA 3K0EA 3JZMA 3KB2A 2WICA 4ITRC 1E0AA 1KDTA 3D7MA 1XU4A 1XXHB 1YVDA 2PCJA 2GXAA 1N6PA 1RKBA 1GRNA 4JVNA 1XRJA 4JLDA 4NYJQ 5D3QA 1VHTA 5J4HA 1CEEA 2QM7A 3T1TA 2ANCA 4OHXA 4F4CA 4PPFA 3I32A 4NONA 5AJYA 5B2ZA 5JHGB 4TTQA 1ZU5A 5EZ5A 4OK6A 1ZC3A 2CE2X 4L16A 4NDZA 3FB4A 2EQBA 5SZKB 1NBMD 1W4RA 3U3OA 3VR3A 5IHPA 1RJ9B 1E2LA 1E1RD 1NVVQ 1QHYA 2YNMA 4TQUS 5K8TA 1N2CE 4U5XA 4BGDA 1GTVA 4TSFD 2W2TA 1RRGA 2J0UB 1QHSA 5JS8A 2HV8A 2ZRBA 2ZREA 5EP1A 5EZ6B 3KDSE 1VDZA 4B34A 1B23P 2OCPA 2QPTA 2RGEA 3LNCA 4LGMA 3PJRA 3IIMA 3CB4A 4LK2A 1Q0UA 4DCUA 2JDID 4FW9A 3RRMA 1G3IA 1GILA 1DAEA 1QF9A 4ZDJA 1KAOA 1Z83A 2TMKA 2CXXA 4GZLA 1MO3A 2YV5A 1DO0A 1UAAA 1XMJA 4TLEA 4EQ6B 4TMKA 3EPLA 2D4HA 3TR5A 1ZRHA 1RRFA 5IDVA 1IXZA 3U7GA 3UWOA 4OI2A 1OXTA 2QP3A 4PSKA 1RYHA 1JQLB 3THXB 2GETA 1U8AA 4KU4A 1W2GA 2ZIAA 2PZFA 3ECCA 3CR7A 3C8UA 6Q21A 4S35A 5KSPA 3CH5A 2J3EA 4B2LA 1G5PA 4TMZA 5D3MB 3IKJA 2ZYVX 3EIEA 2HDNB 3Q85A 1T6NA 1BMFD 2G77B 2NQ2C 4JIMA 1E96A 5L3QA 1P61B 1ZUHA 1QHGA 1X3SA 4ZCLA 4ON9A 1BH2A 2ODBA 521PA 1QHXA 5EQTA 4BASA 2NO6A 4JBYA 1F2TA 2HXSA 1NP6A 2I4IA 3QKTA 1E2KA 1KNXA 1SHKA 3CRW1 5JRZA 4PO1A 1N6OA 3KB1A 3BJIC 2CHGA 3SJAA 1W36C 3KFVA 1OLOA 4DXAA 3FKSA 4QGFA 1GFIA 3MD0A 3ADCA 3B60A 4KSBA 5EP2A 1FMJA 2VL7A 4BZPA 2GF0A 4CGZA 3KX2A 2NZ8A 3QF4A 1NLYA 1LW7A 1ZBDA 1Z0IA 2WJVA 3ND9A 4M9ZA 4A2QA 1YRBA 2JGNA 4D0LB 3SQWA 4KI0A 4C0BA 4D4MA 1Z07A 1KGDA 1GL6A 3WNBA 3RS3A 3OE7D 3GLGB 1M1YE 4FXPA 3N70A 1TADA 2QUZA 3AGQA 5BYJA 3RRYA 5HPYB 3OIYA 2IT1A 1XCGB 1IM2A 3IUYA 5IF9A 3BE4A 3WMFA 1SXJB 2MSDB 4Q1EA 1AIPA 1XCMA 2AHOA 2WWFA 3B9QA 3CRMA 4KHZA 3S1AB 3KUCA 4C7OA 2QMOA 2G1KA 2ZXUA 1KK1A 1HUQA 2V55B 2AL7A 4O2RA 1DELA 2WSSD 3OIUA 2V9PA 1NN3A 4NYJR 4RD4A 2LWIA 2JASA 2WPDD 1UBFA 4ZIRB 3SBEA 4RKFA 1KI8A 3P4XA 2ZS9A 3HPQA 1Z2CA 1NVVR 3LQRA 1E2NA 1NKTA 3ZDQA 4C30A 1S1MA 2AXNA 1XEWY 3L0OA 3ZLJA 3RSOA 1AQUA 1N3BA 2GCOA 1G5TA 4HZUB 3V00A 2GWHA 2PZGA 1X6VA 5JRJA 1N6HA 5IK2A 4XWOA 3RNLA 4NE2A 1HE1C 4RZ2A 4KODA 2XSZD 1VCIA 2ZSAA 3K09C 4DZZA 4OQFA 1S1CA 4L4UA 3TUJC 3K70C 5LD2B 4GOKA 1OJLA 2V6IA 3NH6A 4PPGA 4UXHA 2DPXA 4BEJA 1CF4A 1ETUA 1GUAA 2GESA 2ERXA 1TQ4A 4NCHA 4ZDIA 1OB5A 3ADKA 4A6PA 4EDHA 2QAJA 3NTUA 4FCVA 3SE0A 4B33A 5BN3A 1BOFA 2V1UA 3QPVA 2FN4A 4HAUA 3UG7A 3HWSA 1UPTA 3SYLA 3RC3A 1VHLA 3GLFB 2RGCA 1AS0A 2IYUA 3BK7A 4W5JA 4DLYA 1XD2A 4WA7A 1U2RA 3JVUA 3K1JA 3FWYA 4BRWA 3L0PA 4ZDWA 4LCBA 2QTHA 1W0JD 1U0JA 3KQHA 1Z08A 1XWIA 4IOJA 1BS1A 2JEOA 1YU9A 2R62A 2QQEA 3I3SR 3U3RA 3VMFA 1CS4C 3VR5A 4CEHB 2QNRA 3CWQA 1KSHA 4XWKA 3RDPA 3N2EA 2OFXA 1LF5A 4D2IA 2GBLC 1S8FA 5C18A 2REOA 1D2MA 3R8FA 4TQ9A 1COWD 1A2KC 2GJ9A 2HYIC 2B8WA 1KAGA 1XCPA 4QM7A 3NBZC 2GZHA 3DO6A 5JLJA 4OKSA 3RS7A 3QEJA 3WNCA 2V6JA 1QDEA 2WWGA 1LY1A 1VYVA 1X1SA 2CNWD 3U2QA 2W6JA 4E07A 4B43A 2PEZA 1A82A 3HU3A 1DG3A 4F4JA 3F0TA 1DAGA 2JLZA 4GOJA 1E2IA 4XSHA 1E32A 3M0EA 4Z51A 3ETLA 3BH7A 1KI4A 4B47A 4C0SA 1OXXK 1ZD8A 1OFHA 1SKYE 4DJTA 2ZAOA 2ZROA 4Q1AA 4I81A 4Q7MB 4B3GA 2CCJA 3AF1A 2C77A 3Q9LA 1TPZA 3BFVA 5GVRA 1VTKA 3PVSA 2N1BA 1G8GA 2ZS8A 2BMEA 4RFSB 4OQNA 3X1ZA 4LV8B 4BFXA 5EUMA 2WOJA 3TIFA 3LLMA 2RHMA 4O3MA 4ZDKA 3VU9B 1GKYA 1E99A 5LBIA 3T1QA 4EPRA 2JJ1D 2FG5A 1AA3A 5EE1A 3RS5A 4MKFA 5HE9A 3ZVLA 4BE7B 4UJ5A 1ZM4A 2R9VA 3AQ4A 1ZD1A 4LBWA 3BFKA 2IS4A 2ZRHA 3QKRA 5JJLA 4F38A 2NO7A 4DB4A 2REBA 4D81A 2IF2A 1YZNA 4NL4H 1CP2A 1W36D 5F98A 1TF5A 2ZRGA 2C5LA 2VSFA 3IGFA 2GZAA 2DFLA 1GNRA 1OKKD 3LW8A 4D4KA 3FGNA 4XD7D 3U7HB 2WSMA 3X1YA 4MRPA 3P20A 5G41A 3U5ZB 3AVXA 2OCBA 3RABA 5DI9A 4EJSC 1A2BA 1ZCBA 3OEEA 4DSUA 1W44A 3B78A 2ZETA 3NEJA 1HV8A 2F3TA 1Q1EA 1Q1QA 1BKDR 4DLUA 2F9LA 4GOXA 2OFWA 4IXMA 3C16C 3CX6A 3W90A 4F93B 3SQXA 2QE7A 3AF3A 2RH5A 2QTVB 4LYFA 4B3BA 3A8TA 1KNQA 1QHNA 1YZKA 3K0CC 3QNUA 4XTCS 1UDWA 5JWHA 1KKLA 2EFHB 2VQSA 4DUGA 3FMFA 1QHIA 4LZZA 4HEJA 3R8CA 4FI3C 1E94E 1KO7A 4QHYA 2ZANA 2R44A 2AFIE 4K81B 5EUQB 2QM8A 3LXRA 2ZJ5A 3W6PA 1OPXA 1G4AE 4CRWB 2WWXA 1I2DA 4HB3A 3TVDA 1N5KA 1MOZA 1S3SA 2E87A 4L8GA 4BEBA 2FMXA 3J81k 2RKOA 2FWRA 1MABB 3PIRA 2MMCA 1R8QA 3K0FA 3A37A 4AKEA 2KBFA 3WMGA 2O8CA 3WYGA 1JNYA 4Z8YA 4OJKA 2P5SA 4Z54A 2CLDX 4BZQA 3FPAA 3BAFA 1NG9A 3RVBA 2XJ9A 2P2LA 2CCKA 5DYGA 2YOFA 4GP7A 2GEVA 1G8YA 1JXMA 1VG8A 4RD0A 4NBSA 1ZNWA 4RCZA 5FTLA 1U0LA 2GA8A 4M53A 4G3XA 3QIAA 3RWOA 5E7MA 1JR3D 3W6NA 4RZ3A 4DLZA 1AZSC 1L8QA 3IO3A 3I73A 2V7QD 3B13B 1JPJA 3GLHB 5JWOA 2QT1A 3B1ZA 2XTMA 2ZJYA 3I92A 3REFA 1DADA 1XP8A 2BBOA 4CT4B 2WJJA 1W4CA 2KI5A 2IXFA 3R9IA 2O8FB 2R6DA 5FOTA 4Q1FA 4CEIB 1HEIA 2EFEB 1G8FA 2HF9A 3EPHA 4DSTA 5AWFC 1CU1A 1N5IA 4ZKEA 4PQRA 4Z8XA 1E9AA 1E2DA 4ZI2A 2G0TA 1M7HA 3N2IA 4IKEA 1LF0A 2ZE8A 2SHKA 4FMDB 4M1MA 2WJHA 3V4FA 1XNJA 2F43A 3D3QA 4ACBA 2ZRAA 2QENA 3IPYA 5GVSA 4NCKA 4NYIR 1G18A 3DZ8A 2IYYA 4PC3A 5LDDC 1F2UB 4KYUA 2IWHA 1KIMA 1PLJA 2CJWB 1YZTA 4IHQA 5H8WA 2WKPA 5FUVA 3DHWC 3Q5DA 5JZVA 2Q3FA 1R0WA 2OAP1 5C46F 3THOA 1F6BA 4YMTA 1HTWA 1NIPA 121PA 2FF7A 4DIDA 3KTAB 2HYDA 4PQYA 3VFDA 1AKEA 3KXIA 1XJQA 3C7KA 3DM9B 4OQMA 2BKEA 2VRWA 3K9NA 3OIWA 3SFZA 3LBHA 4RSGA 1UEJA 1GZSA 3GFPA 1SZPA 4B6EA 1XXHA 4A2WA 2I1VB 2P65A 5BN4A 3E5HA 2UVQA 1E6CA 2IYRA 4N0EA 1IY0A 4Q9IA 4HDQB 2O8DB 1UDXA 3PITA 1FQJA 4IEIA 2H92A 2J1LA 4JBXA 1RPZA 3A36A 4P32A 1YQTA 1DAHA 3VNVA 3SJBA 1RJ9A 3VHLB 3NDBB 2YWHA 4XWAA 4Q00A 4TWZA 2OBMA 4HAVA 2J0UA 4PAQA 1XPOA
chains in the Genus database with same CATH superfamily
3DT9A 1P62B 3V4SA 3VO8A 1AS3A 3CUSA 4YRIA 4CL2A 1DOZA 1GAWA 3PTAA 5KSOA 5HOEA 4URZR 2EYUA 1VSQA 3U4DA 3U39A 4XYBA 2B4KA 3LTEA 5T3YA 1OIVA 1D8TA 2VATA 4HATA 1C2YA 1ZONA 1Q15A 4MUJA 4RH3A 5M3BA 1FNDA 4CBVA 1R50A 4FB5A 2IOFK 5FL7A 5AUQA 3RAEC 5IN4A 1L5HB 2B7LA 1NFQA 1USVA 4JLNA 1UWLA 3FSGD 2VNAA 1NDQA 1VKJA 4ZA2A 3L82B 1K97A 1Q0LA 3KOXA 4YCJA 3JQ8B 5DLYA 2JI4A 5GV7A 5LMCA 1CJCA 5T64A 1NXSA 3GOQA 4CJXA 2W6ZA 1N8KA 1Q14A 4GBED 4CF7A 1U3TA 1RLTA 1SWVA 1OB2A 1D7OA 1DAKA 2YS7A 4GM1A 3TJMA 1RFLA 1W35A 4DG9A 3CVWA 5A0TA 2WWTA 1W4AA 2VEDA 4IS2A 4QUIA 4A82A 1QJ4A 1Y42X 5EHXA 5K7SA 3R2JA 2OSVA 2M32A 1GCIA 6ADHA 5D3MA 4F92B 4LQDA 1OXSC 2XTAA 4EABA 1JR2A 4FW8A 4RMNA 4YUVA 1ZM7A 3KOOA 4ZEOA 2VYFA 4C1BA 2A78A 1G20E 4B32A 3TS1A 4UARA 5JWRA 5IKOA 2HTFA 4OYHA 3NHYA 2IQIA 4R8MA 1D4ZA 2C84A 5D87A 2SKEA 2EKZA 3LK6A 1E7RA 2DH5A 1WIWA 3FVTA 1ZI8A 3A1TA 1VBKA 4ZOLF 5TPWB 3Q7RA 4XVHA 2J32A 5GM1A 1Q7BA 1FLDA 2HOQA 3E9YA 2PJUA 4N48A 1PFQA 4FGWA 2GCIA 3UKJA 1W73A 2HCRA 3K9WA 3QQ5A 1E18A 1JMVA 2NMVA 1TYZA 2FUG1 5K8CA 4O1MA 1E3SA 1RACA 1YBFA 4JLOA 4M86A 2P8JA 4R40A 4RUKA 1N78A 3UQZA 5I47A 1F1JA 1P5RA 1WW8A 1OA0A 4BLPA 5L3VA 1G5QA 6ABPA 3GJXC 5U9CA 2X0KA 4K3UA 4GUDA 4FZJA 4HGOA 2OZVA 2CJPA 3GLGA 2AX4A 4E7OA 4KAFA 4EJ0A 2A0WA 3QPCA 4IHJF 3L4JA 2OLJA 1DWPA 2IXBA 4TT3A 1VGRA 2F62A 2DKOA 3D8UA 3E23A 2WT9A 2CFRA 3PNOA 1DEOA 3PYLA 1GHTA 5LBTA 4N6GA 5F2NA 4X3OA 4UMEA 4MVJF 1ORVA 3RRXA 1E2FA 4ZQFA 2PR7A 1UC8A 1XTJA 3CVYA 1P9RA 4KX5A 5FWXB 3ZX4A 5DGXA 3V8BA 1JDUA 2PZJA 3VR4A 2RHTA 3VPDA 4R1OA 3KR1A 4P31A 4S1PA 2NTNA 3W2FA 5CDTA 1LVGA 5HKAA 2B2XA 1UBTS 3KKPA 3ESAA 3JD0A 4PLCA 1JX6A 2H57A 3T15A 1P3Y1 4TKVB 3QSYA 1RBYA 1SUBA 3PEYA 1KU6A 3WLKX 5CD1A 1DV1A 3IOEA 4LXUA 3SD7A 4ZJZA 5A3RA 2PRZA 1LBSA 3OUTA 3TYXA 1Y3IA 3OE4A 4B3MB 1R4MB 1V7ZA 3K0HA 3MC1A 3GFBA 3QKIA 3H5WA 4FS3A 2C2ZA 2XD9A 1JILA 4JBIA 2CL7X 2PLRA 5EZSA 1B6TA 5ECWA 4RDCA 1U1IA 2JD2A 3NBQA 3SEQA 5BPHA 4KQ6A 5KYVA 1MAVA 1E4EA 3B3GA 3E9NA 3AYZB 1D6MA 4BO1A 5DLPA 5ICGA 4DMGA 1W52X 4Q3EA 1G3RA 2H51A 4MW0A 1Y6FA 3SXJA 1WVGA 3H16A 3MCWA 1VPWA 4M54A 1A5SB 4Q66C 5I7UA 3WK9A 3ZQ4A 3EISA 1R18A 3IDQA 3QEOA 1OBOA 3OZXA 5EY5B 1M2NA 1S0UA 2ZB4A 3CEMA 3M6IA 1DBWA 2LTAA 3EA5A 3F6RA 3NIGB 4M1QA 3RRJA 4V0LA 3TMKA 3FYUA 3S3TA 3IALA 1P5ZB 3GRUA 4N6OA 4RKWA 1P3DA 3ZI0A 2B92A 4Y2UA 4FOLA 1JAHA 2GEJA 3OT1B 1EPUA 4MEBA 4US2R 4LNUB 1NDHA 2PQMA 4LDNA 4D26A 4OX9B 4R1MA 1JIVA 3A2LA 4IYJA 3N6XA 1CDOA 4Q4JB 4E03A 3TXXA 2BYTA 1LNZA 1DJNA 4ITVA 2XE7A 4CVNA 3A1FA 1KSJA 4BBAA 5FYQA 4EL5A 2BGNA 1Y9DA 4KVFA 3OOWA 4E5DA 3QOWA 8MHTA 1IEWA 2EFCB 1E63A 1B0ZA 1GQ2A 1OHHD 3R7SA 2VOJA 2QSZA 3LOUA 3W5JA 3NHAA 2NXJA 3CCBA 2QTZA 4FCWA 3ROXA 3T3IA 4MYSA 3ZJ5A 4AWAA 2HWUA 3FG9A 3BHIA 4BVBA 3C87A 1WSBA 2VQ6A 2HD4A 1W88A 2H3EA 4JN6B 4MV1A 3BC1A 3QFRA 1W6UA 4W9MC 3K0BA 5L3SB 1F9EA 1JHZA 2QLTA 4UMFA 4QICA 5DHRA 1TO6A 1T10A 5LJIA 4X9XA 3MYRA 2B34A 1P9LA 3URMA 5ALRA 3DW1X 3MMXA 5FF9A 2FLWA 5FR2A 1GPYA 3QXCA 4HWSA 4MA4A 1UMDB 1ZOOA 2H48A 1PHPA 2ZBGA 4CEHA 4R5MA 4TQAA 2C83A 1JS1X 1DAPA 1QQAA 4WBNF 3AFMA 5KHOC 3IAHA 4Q7LA 5KDOA 5B30A 1A88A 1PDVA 2WD7A 1VRVA 2QAIA 4RD3A 4X90A 3GLFE 3MGAA 1NYQA 1OXUA 1EFHA 5CBPB 2X1VA 2ESRA 3MJTA 3OEWA 4IJ6A 2JFZA 5K8LA 1ZW6A 1JVNA 2FGJA 3M83A 1J56A 3O3MB 4EY6A 3BFJA 2G1AA 2R25B 3W4IA 1HDRA 1QORA 1U0EA 1UWVA 1YFJA 3EZNA 3F98A 4LWPA 1GTMA 1X2EA 2J67A 2Q4RA 3IS3A 4BFUA 3BVPA 2WWYA 2R1VA 1E6UA 2YIDA 3R7WB 4BLUA 2LBPA 5KX5B 1Q3HA 4J49A 5IM4A 4RK7A 4B6SA 3VPHA 3TTXA 4B48A 4PIPA 3H1TA 3LX5A 2ZWIA 4O29A 1JDJA 1GPKA 3OAAA 1ZM3A 5G02A 3WGZA 4YAGA 1EX7A 2DBVO 3A4NA 3AF6A 2AFHA 1A69A 4EPXA 1KFKB 1D1QA 1I14A 1I5RA 1YO6A 1YI1A 2D1RA 2G6BA 2VG8A 3HWRA 3I2YX 4P3KA 1V1MA 3SR3A 3OQPA 3ZWKA 4MR8A 5KSWB 5M34A 1CE8A 2ASVA 4GC5A 2Z83A 2RGBA 3LP5A 3T5BA 4CM3A 4GLFA 4IIGA 2RHGB 2E82A 2Y71A 3KR2A 3OECA 1OF1A 3PGJA 1ULUA 3IJ5A 4AZ3B 1ZNXA 2WWRA 1DUVG 3R3WA 5IW8A 2I7VA 2IOFA 4JU8A 5BWLA 2IUFA 1TCBA 7ABPA 2CLSA 2HBRA 4BC1A 4DG5A 1SBCA 1S7GA 3C6ZA 3D2LA 3EDMA 3V7YA 3JQFA 3X1DA 3GLQA 1R0RE 1M33A 3VU9A 1HT0A 1XBTA 2KS6A 4G26A 1FS5A 1NV8A 5CNMA 2O9JA 3V8RA 4C88A 1FFHA 3VPAA 1QE5A 3RADC 4IR7A 1DXOA 3HR4A 5E6UB 4RGBA 5AVKA 2I6FA 2I8AA 4JLPA 3EH1A 1NW6A 1IJKA 2X4IA 4IJQA 1S2MA 3B3JA 4GMDA 4L5CA 2FSSA 1ZXLA 4G5XA 5JLAA 1ZZGA 1WXXA 2GMWA 2C3UA 1WSDA 3EGWA 4HQFA 4L4XA 1HY3A 4PLFA 4PXAA 3JARA 2DHCA 3DS8A 1FRNA 2IYQA 4U3JB 3GT0A 5GZ1A 1XDBA 1QZ3A 2Q5OA 1IVYA 2B1GA 2R47A 4JCOA 1CS0A 3BGOS 4WDRA 4R6WA 4YT5A 3UCXA 1AOXA 1BE6A 2UZ0A 2XMRA 1GSOA 3G2LA 4OCZA 3UJ6A 3ZV6A 3WJ2A 2Y9PB 3JD1A 3QX8A 4E11A 4F6RA 3OZBA 1ZRNA 2JFPA 4IIUA 2HSWA 2JVIA 2PX8A 3K9CA 3CPSA 4JS0A 1DE0A 3DBLA 4ID3A 1R6TA 3RSGA 4S3MA 3PCXA 2FWJA 1JFRA 3PR3A 4P1ZA 3AUTA 3THWB 1B41A 4MINA 5E7IA 3UA3A 1HFEL 3DFFA 3DWIA 2CNBA 3CN9A 3LYLA 3M3PA 2ZRNA 1OFGA 2YN0A 2O2GA 4GZ6A 1B2LA 3U3JA 1HETA 2EFGA 3PPWA 4FGJA 3ZDFA 2XCUA 2FRDC 3P1JA 3TCXB 4P35A 2XBMA 1U7UA 1JKXA 2RGDA 3DDCA 5KVCA 4IIFA 2BBTA 3RC8A 4KR9A 3NLLA 4EOGA 3HNPA 5HIIA 4LFCB 2PWAA 4BKOA 1O8CA 2EYQA 1A5AB 2QZZA 4OKNA 3FUCA 3I8SA 1OX4B 1Z6GA 3WFZA 4RACA 3RSFA 3AESB 1O95D 3DOUA 2AG0A 3EARA 3DQQA 1JZTA 1LTKA 3GLSA 3MG9A 4QNRA 1MABA 3VKWA 2P68A 4OJNA 2CNLA 4NK4A 1XDWA 421PA 2EKLA 1Q0RA 1P2FA 2GPJA 2VTVA 3OEED 4H9GA 3WIBA 1DFHA 3HVHA 4JHLA 2H0AA 3I30X 1CRZA 3IDSA 2P77A 2XGGA 4ZU6X 1IIBA 3RU7A 3VU0A 3PE6A 4A1FA 5E38A 1QZTA 5CP8A 1OREA 1P2GA 2O4UX 3M34A 2ZBEA 1RQ7A 1WULS 3WQQA 2H5JA 3GF4A 2YOHA 4NH0A 3NNSA 1XG5A 3HBMA 5A0FA 2AC7A 4C0WA 2PH3A 3HRKA 3VA7A 1CWUA 1HE4A 1G21A 2FYTA 3B53X 2WU0A 5CIWA 1SCAA 3Q8WA 1UEIA 1GUDA 3MJHA 1CR2A 3TQTA 3IKTA 3VKGA 3SFTA 4HF7A 1EP9A 1FFEA 2OHGA 2Y6UA 2HDHA 3M1IA 4JJFA 4C9BA 4YV2A 2HU7A 1U2TA 5AVVA 2V7EA 2I80A 3GLHA 4GFDA 4J0QA 1PWEA 4CIDA 4Y2QA 5BVHA 2UUAB 4LNAA 2VH5R 1M1ZA 5C1BA 3DTVA 1KE2A 3NALA 5B53A 1YGPA 2FZLA 3O1HB 4CG2A 2AT1A 1GRCA 4JQZA 4P83A 3RFVA 2OL4A 4OQZA 4C01A 3ZY3A 5HF5A 4QQKA 3B38A 4G37A 1PU2A 1YQQA 1GWNA 4CFSA 4MV7A 5A4IS 4P93A 1IU9A 3MMZA 2J9YB 3N87A 4G5RA 3TL6A 3VNRA 4PSVA 3GJ3A 1CUFA 2EARA 4QQFA 2JDIA 4OP3A 2HCFA 2CK3A 5GOZA 5DIFA 1E5DA 3I3OA 4Q7KA 1FCJA 1U81A 5JQGA 3HFGA 2WKQA 4GM0A 4B1FA 1IM8A 5EMLA 1NI5A 1CUHA 1TQ6A 3H97A 3IERA 4ACAA 5IS2A 1QTIA 3BXEA 4HWGA 2XE8A 4MGYR 4EHJA 3AJ9A 3GMSA 2RD2A 3D2BA 3VNQA 5BSKA 2C00A 5MN6A 3LVRE 3TSYA 2YKGA 2ZPUA 1NBME 3BG5A 1J6UA 4O4HA 3K2QA 1TEXA 2PCLA 3IBTA 3CIFA 2RH4A 3AEXA 4JA0A 3C15C 4IVPA 2LKDA 4OI0A 3WLAA 4UEJA 2OCYC 3LO8A 2OUKA 3MRTA 3KJHA 3KTAA 4R7TA 5F76A 2WB2A 5AW3A 4LF8B 3RREA 4L6AA 1E2UA 1E2MA 1N2GA 3UTDA 4LZJA 4ZGWA 3W8DA 2CZQA 4MVWA 3NVAA 3QWAA 1MGPA 1OGYA 2AZDA 1Y3CE 3PUXA 5ALYA 2EQAA 3E15A 4MS4B 3WG9A 4DRYA 1HPLA 3G7UA 2X4DA 2DR2A 2P91A 4OLFA 5H0IA 1ZVVA 2HUPA 4EJSB 4PNZA 4ROTA 2J87A 3QLTA 1BXGB 4FCTA 1NJ8A 4U2DA 1EJ0A 2FR1A 1BQ3A 4TN1A 1JMKC 3TLZA 4G5YA 1KC1A 1QANA 1TZCA 5JSZA 1C1XB 2AHRA 3RJTA 4XGIA 1LWNA 2FMHA 1YAHA 4RIHA 1WPGA 2AGVA 4EI9A 1C9JA 1IDN1 1QVRA 2X6RA 5J4LA 5FOVA 1YZ3A 2P2DA 3BMNB 4ERNA 1FK8A 4YHHB 5FUYA 2QTMA 4L4RA 3NWJA 2PRKA 3K1AB 4KDCA 2PH7A 3DAOA 3F5QA 4JJGA 1X86B 3E81A 5G1PA 5DCLA 1QG0A 1VHQA 3GUVA 5EXTA 1DX6A 3KWMA 1FNSA 4X24A 3A1EA 3LC1O 4LJLA 5IZCA 4TWJA 3OQ6A 4MMZB 2O8EB 3BHMA 3G2KA 1JDBB 1Z0KA 2F9FA 2WWHA 2FPLA 4O5AA 5JV5A 5D86A 1P9OA 2ZIXB 4NBNA 1AGRA 1JV2B 1Y34E 3SZOA 3VV2A 4Q15A 2YHIB 5JI2E 4BYMA 3GFOA 4W7IA 1TLFA 1U3UA 2IYZA 3BF8A 2OMKA 5ENDA 3VV3A 3FOWA 1RYBA 1ZK4A 3JQ8A 1ESMA 3LXXA 3CE6A 5J40A 3UHPA 3WHLA 2OCIA 4LZPA 1UBNA 3LC7O 4EUNA 1F2TB 1VPTA 3DR3A 4OQ4A 1F06A 1X1QA 1XMIA 3VDMA 2ONJA 3CEHA 3WGYA 4X44A 2E3JA 3W6OA 2VHZA 4YYZA 2YDYA 1HNNA 1V1RB 3GLTA 2ZIEA 4EA8A 5IC4A 5KTOA 3VZDA 1T8RA 3M5DA 4HB0A 1J8MF 3TTWA 4DIEA 1Y80A 9LDBA 1OYYA 4WIAA 3H1BA 2HMWA 4AG6A 1AGYA 3IEIA 3UJNA 3L5OA 1K6XA 3IUSA 1BNCA 3OMLA 1QVWA 2GZ1A 4ZTZB 1J5PA 4BLTA 2HQOA 2I6SA 5SY9A 3U48A 1R4NB 1A4IA 2JFHA 1SM4A 3LGXA 1XTSA 5BMVB 3AFHA 4UM7A 5TPWA 4GRIA 3SEAA 2PUVA 3KQMA 4UC0A 4IIXA 5AOBA 1T2CA 1KFBB 1L7QA 1QWSA 4L73A 2WB4A 3CT4A 3T7DA 4BY9E 3H4MA 1JVSA 2FUG6 1SQ5A 3E61A 3S55A 5IDWA 3TZ6A 1KVQA 2HMUA 3ZHSA 1KEVA 4RZQA 3E1KA 3G5LA 3KR9A 2QRGA 5LYJF 1UCFA 3F6PA 2RIPA 2ERCA 3L2OB 4LRUA 1ISMA 4K46A 3KLMX 1ECBA 2D5IA 2BTOA 4L9WA 1ZR2A 2LUOA 3AUKA 1SHUX 1N9GB 2O2YA 1J0DA 4IKOA 1VA4A 4C0HA 2AMVA 2P6MA 2D1QA 2FOXA 5CLGA 2R4QA 4KHPB 3MVEA 3HBLA 2I2WA 5ED0A 3PEVA 5F5NA 3DZIA 3HJCA 1MD9A 1UKAA 5CFPA 4Z7QB 1G1AA 2BGKA 2ZT5A 3ZU4A 1D2NA 4EPWA 1XAGA 3VKHA 5FWXA 4EY5A 2Y0DA 3A0UA 4JAVC 3CM0A 4HFJA 5EHIA 4D3FA 3CUUA 4X63A 4G9GA 5EG5A 5HQ3B 5DM60 1BA3A 5G0UA 5F9FA 2GVDC 1IY1A 4MROA 1DQRA 5A0VA 1SUEA 1VI5A 4TKVA 1W46A 4DWOA 4NNOA 1Z2OX 1NAHA 1BHQ1 1BYIA 5EE0A 5JSYA 3QJGA 2HU5A 4KFRA 1JPUA 4MB6A 1R4MA 3UAGA 2AG5A 3UJPA 3ASVA 2G9NA 2VSNA 1WBDA 2V65A 1XRRA 5FNVB 2YN2A 1E3IA 2O3JA 3AF4A 3P94A 4J8PA 4JJZA 4YMIA 3DE6X 4HQ6A 4I7EA 1BWSA 3W2GA 3C24A 4P53A 1ZMOA 2RHDA 1COWA 1YBMA 1IC6A 1PWXA 3KVOA 4C87A 4TT3D 3WADA 4LV6A 2YMMA 2X0EA 3U7QB 3ND7A 1QYWA 4I6GA 4K28A 4DMLA 4AI6A 3UB2A 1OI4A 2AZ4A 4P3YA 3W77A 4N3NA 2JEYA 3ZY6A 3TMAA 4DM4A 3BWMA 4PSCA 3E3AA 3SEZA 3I9OA 1ZAKA 4DC9A 4E7PA 4F3CA 5I3ZA 1JWAB 3HJHA 3M5WA 1VE1A 1GPH1 1QQ5A 1E0SA 4F3NA 1J06A 2Q1YA 4BVJA 1A5ZA 5DCUA 5FLKA 1IYZA 1MO6A 4D9MA 4F85A 2A1TS 3OT1A 4H1WA 4JFRA 3OT5A 1P75A 5LNK1 3ZDCA 2GD2A 3KYDB 4BBJA 2IP2A 4W1RA 3U3KA 4EY8A 5AK6A 4Q4JA 3L04A 4NI5A 3MPUA 5DHAA 1NRJB 4MQMA 1R27A 2A9PA 3KL2A 2WVJA 1E0DA 4B7UA 4TLMB 1TQHA 4FYKA 4HRYA 4JBNA 5LFAA 4OGLA 5THXA 1SHTX 4AJNA 4ENTA 2DQ4A 3C97A 3K0AB 2PLFA 5EKUA 5IXSA 1NUPA 2AZMA 1OGIA 1WY7A 2E48A 2PT6A 2HHLA 4V0MA 4ENQA 4Q39A 5AQEA 2Z58A 2PSFA 3IBCA 3ZUPA 4CQLB 4DMMA 4YRCA 3CO0S 4IYRA 4Y6RA 2WYWA 5FA8A 5L3SA 1JB9A 1ZK1A 4ND4A 5T7BA 2I3AA 1LJUA 2UVDA 2OV1A 3CSSA 1OH5A 1WZIA 2OAQ1 4ZOQI 3C3MA 4Q18A 4OB8A 3JALB 4JYPA 1ODIA 2GF2A 5FWDA 3NKLA 1UMDA 3S0JA 1UINA 3OD5A 3JYOA 4J1QA 2FSVA 3M70A 3R3ZA 1YF3A 5K6RA 3BRWD 2C3OA 1HKHA 3MWKA 3FI0A 1V11A 1G19A 2HHJA 3WQBA 4D9IA 2WTBA 5F4ZA 1ADFA 5LDGA 4IGAA 2OVFA 3BRSA 3OMWA 1NVFA 1SUSA 2G3YA 2IXGA 5CPFA 1GLGA 1H85A 2XQKA 5H82A 1BO6A 3BT7A 1UFOA 3GLKA 5CBPA 5FO0A 4X91A 2IS1A 1G41A 4NARA 3PFIA 4NBUA 2ZJ8A 3FLEA 4R05A 5HKLA 2A9VA 4J3FA 3IBSA 4J1NA 4JJ8A 4JXKA 4OJTA 2O14A 1DBSA 5LKRA 3EEBA 3KTOA 1GG8A 3LX6A 1Q17A 1OKKA 4UCFA 3ZHRA 4K05A 4Q03A 3DOIA 3KXDA 4XD7A 2YC2C 3R7WA 4DKXA 2W90A 4YLYA 5KX5A 4KK3A 1IUNA 2IITA 2FOLA 2W43A 3L7LA 3DMDA 4H4DA 5CVEA 4JYZA 3GFFA 3H9BA 1I7QB 1DDIA 3O8OB 1PX2A 3H84A 1ANKA 1YXMA 2OO7A 4KUHA 3WK7A 5JWOA 1X80B 4LDRA 3ZCVA 4YCMA 3R0ZA 4A8PA 1XWWA 4LHVA 3AHEA 4QDKA 3K5PA 2OXFA 1QGDA 3D54D 4US0R 2Z2JA 2ZUSA 1V45E 2DR3A 1J8QA 4S1TA 4WLNA 3NTQA 4ZAXA 1YRHA 4ZCSA 5JCOA 1Q12A 2JNWA 4OHZA 3SX0A 1X7YB 2OQ2A 3E05A 1NXVA 3EZ7A 3OC0A 4UMDA 5GGXA 1SBTA 4AZ3A 1CETA 5L8VA 2YNMD 1TYDE 1MF7A 3WP1B 1Z15A 1JXQA 3AVQA 4AJ9A 4X3CA 1IDOA 4D80A 3EBPA 2CSXA 3DZGA 2OZPA 4N03A 3AVWA 3ETCA 3LQ4A 3ORSA 3LJKA 2F67A 2O05A 5ALHA 1IVSA 4OJMX 1G64A 3U56A 3NC0C 4MRVA 3HVKA 1LDBA 1FQOA 1N6IA 1ZS9A 4W82A 2YIMA 3ES9A 2A4KA 4FBGA 3RHSA 5E6UA 3BL6A 2P75A 1NMZA 2WUEA 5BORA 4OOEA 3BBPA 3N2NA 2JGDB 5FPQA 1ZK2A 1P80A 2LXNA 5AR1A 1AB5A 1JTFA 1YHYA 4G4JA 4DFDA 4J2HA 2CF5A 2OV2A 4EUHA 2R87A 1CQIB 1TO1E 4A23A 3BH0A 3FTPA 3TLJA 1PQWA 4JC5A 4C7VA 2H7VA 4EY7A 4C0QC 4B3SB 4U3JA 4CL3A 5CG2A 3CH6A 2PSSA 3GJ0A 5ELXA 4N4AA 3AYXB 3VR6A 1ZESA 4IVRA 2QMEA 2I4TA 2Y8EA 4Y9UA 1UXJA 1CD5A 3TRKA 3TKAA 1Z6ZA 1EFLA 3QMWA 1JB1A 3JZAA 2V97A 5LLTA 5FLEX 3SLGA 4U2GA 5CJ2A 1CNMA 3ZCSA 2QGNA 3R24A 2HLNA 2NX2A 2CHFA 3HCDA 4DY4A 4RLHA 2WKSA 2CJXA 1ECCA 2XV1A 4K1LA 1ZLXA 1QTQA 1OYWA 3ANXA 2O7VA 1OOEA 4J0EA 1Q7CA 1EA7A 2OV8A 4NFLA 2IXEA 2GWRA 3BJZA 4LW8A 4YNBA 4EW2A 3HS3A 4HDCA 1OBHA 2WBLC 3AR3A 3ICCA 3I9MA 4ZIRA 4KRFA 2F3PA 2O7NA 2YVKA 3E7FA 3UHAA 3ELUA 2A88A 2GASA 4Q7QA 4PSUA 4BTLA 2X6TA 2ZWPA 1MUUA 2VWGA 1H42A 1R15A 3WL4A 4EGJA 4LA4A 2PQ2A 5A9TA 3T4XA 4LF9B 1NG1A 3D5TA 3C4JA 3I76A 2PMDA 4R68A 3IR5A 1NP3A 1OR8A 1KPGA 4B3XA 1OX4A 1ZISA 3B48A 3ZGNA 3ACBA 4L8VA 1JP7A 3AR4A 2IEDA 3AESA 2EW8A 4HSEA 1KR2A 3D6MA 3E3MA 4F04A 1JR3E 3M6AA 4OUDB 1ID1A 4OL0A 4XJTA 3UV7A 3K53A 2QUKA 2WNSA 4ZTBA 1TF2A 2X40A 4AZ0B 4ZQBA 2QTCA 3LWBA 3NTVA 1DUSA 3NXSA 2H1SA 2DBRA 1AO0A 3OZSA 5TXGA 4NAVA 1L5NA 4RTSA 13PKA 2I67A 1SCDA 1Z82A 4NABA 3CGWA 5CDHA 3HVRA 1LFAA 5ESXA 5B58C 3IR7A 2I2FA 3NI2A 1HI9A 3D6FA 1EUDB 5HM8A 2W58A 3ORFA 3IAFA 2CNOA 4ZVTA 5P21A 2XCRB 2CWDA 3D6JA 4O4LF 4UQOA 3UICA 1TU0A 1IUKA 2Y1CA 3FVVA 3OH8A 5CM9C 3TTTA 3ZDEA 2VKTA 4C4XA 4RKQA 1MORA 1JSZA 1EWYA 1V3UA 4DSOA 3O4VA 1D1SA 4J7CA 1CJKC 1BFUA 2DJ5A 3BMCB 1YB2A 3FLBA 2BM1A 1VJ5A 1AD2A 2FQYA 1UDBA 2J5QA 2Y2VA 4BFLA 5C7OO 9LDTA 2C92A 3DOJA 2ZIWB 1QQBA 4Q4LA 1WR8A 2OQRA 4KKVA 3DEIA 3NIBA 1KS9A 1FOEB 2YJ6A 1P6QA 4H1TA 2P4EA 2HN9A 3RRBA 4A0SA 5E7QA 1ECFA 4KG7A 8OHMA 3CY6A 4HNSA 4FI3F 1HL7A 2WAOA 1IIRA 2GM3A 4GM4A 1YR1A 3DNPA 3DXXA 4UD6A 3RAGA 4C03A 5KOIA 1Z0UA 4LF7B 3R7DA 3FCOA 2XMPA 4CR6A 1PGNA 4JENA 3VJRA 4PZUA 2HK8A 2I2BA 5C8YF 4KO8A 1JEDA 2NPOA 4U6QA 1J8DA 4X6LA 5CXQA 1DUIA 1SVSA 1EZ4A 1VE7A 4XJXA 3UXMA 4X6XA 1JIKA 3BWDD 4FMCB 2QORA 3DPSA 4P5EA 3HN7A 1M2JA 1QBKC 3OQ1A 5TE9A 1CUYA 3GJQA 4MQLA 4BNFA 2WFMA 1EJ6A 1NF9A 1YS2X 4B0PA 2QJFA 4URWR 5AP9A 2R4TA 1QQTA 3MGBA 4P5DA 1J1ZA 1XRQA 3QG1A 4BMDA 1T0PA 2C4TA 4OM8A 5BMOA 3BORA 3BQMB 3EIWA 3EF1A 4QYSA 3SIRA 5AUOB 3UMYA 4QUKA 2HADA 1RHUA 4RA9B 5DRTA 1TKAA 2HWXA 3AZQA 2YZKA 3FJOA 3WAKA 1M6EX 2P27A 1P72A 2QX4A 4XCVA 5C1OA 2DULA 1FSGA 5GZ3A 2G0NA 1YK0A 2N75A 1UP6A 3VC2A 1EB8A 1FU8A 2A58A 3G59A 2VNKA 3ZG6A 4NRDA 5DHSA 2ZRDA 4DF3A 1VL5A 2R6JA 2EBFX 4MS4A 1TQ8A 5EYPA 3WDLA 4LHWA 3FVWA 1U63A 3L0IB 3T1NA 3WGHA 5GIPE 4TRMA 4WLOA 4EJSA 1H8HA 4Z4CA 4C22A 1BXGA 1NN1A 3FA2A 3F74A 2VWPA 2GXUA 3SHWA 4HJXA 3V1NA 2ZR7A 5TMDA 1QSGA 2J30A 3B8HA 2F3QA 3BERA 3BJEA 1JU3A 3PFWO 2CK3D 3TW4A 1H2HA 5KJFA 1C1XA 4H3HB 4Q01A 4S1VA 1GGFA 4XSGA 4CM6A 2CHVA 1NMXA 3L8MA 1AXEA 1Q11A 1J2UA 2PFKA 4L4ZA 5CLIA 2I91A 2YDXA 4OAPA 4G5HA 2WHXA 5B2FA 2JHAA 4TS9A 3IHKA 2IUYA 3BDVA 4GX1A 3WFIA 5CEJA 1NFRA 5FTJA 5HS6A 5B58T 4BO4A 2EEZA 2XCIA 1POWA 2NAPA 3K1AA 3KT0A 3TZCA 4C5BA 4DR5B 4MKIA 4TKUB 1HDYA 4OQYA 2WMYA 1R0YA 3MB8A 5FADA 4MV9A 2WG1A 4I5GA 3FOZA 2GPBA 3FROA 3NC4A 2O8EA 2G28A 4NU6A 5K8VA 2UYHA 1U2SA 3LOPA 1X8XA 1WU7A 3G7NA 3NASA 5EIXA 3E22B 2HF7A 1BMDA 2O48X 2I71A 2ZIXA 4NC9A 5LP6C 4XDHA 2HJSA 2YHIA 1NV9A 2VSYA 3QPWA 1QG4A 4HQOA 3TDNA 1T9DA 3W78A 5CEEA 4IVNA 2VSXA 1TL7C 1OD6A 4FMBB 3PXGA 3IUBA 1D2AA 3FRHA 3JWJA 2HIHA 2OKGA 2RJNA 4ALMA 2JIZA 1D2CA 1YB6A 1Y4UA 2WT8A 2WM9B 4D8VA 4OQXA 1WUKS 4CU5A 4DQ0A 2FOIA 3A1CA 2CCGA 3GAZA 2AZTA 3PDCA 5DP1A 2VNIA 1M2HA 3ZZ0A 1V1RA 5A06A 5B64A 1JQAA 3V2UA 2B5VA 1LWOA 3DYBA 4JJ6A 4J91A 4MVJI 1LS1A 3RFCA 3SS8A 1H94A 4D4HA 3MAJA 1T9HA 3JAWB 3N58A 2P4HX 2O07A 3VM6A 3ZLUA 4ZPJA 1G6OA 4QAJA 2BDEA 1P77A 2JIRA 4KQEA 2H54A 4UTZA 5JSQA 3V46A 4MQUA 3QMVA 3OZIA 1YQEA 3KEGA 3WB9A 2HZ7A 1R4NA 2DT8A 4QEDA 1PG2A 5BMVA 4XYGA 2J9FB 5FYDA 3AP3A 3TI9A 3QH4A 4ETMA 1THTA 1AGXA 2J4DA 1U2PA 3VPXA 3N3AC 3ZOKA 5HCNA 3TAHA 4EB3A 5FUWA 4BMPB 4HNQA 3P9CA 3G9ZA 3K2IA 3UBTA 1RKXA 1TAHA 4UU8A 2ECPA 4JVSB 2OFOA 2IVZA 2B2NA 3DL4A 3HEMA 4AJLA 5BUCA 1D0VA 4A8TA 5GGYA 3NBFA 4YP1A 1I4DD 1O1YA 4R1TA 1G5FA 1C29B 1J0AA 1DEKA 4H7JA 2EGUA 4BNWA 4IG4A 3M6FA 1CYDA 4YACA 1PVOA 5I4IA 3I2KA 3LP6A 5DE3A 2PRJA 3SYNA 1N9GA 2PZAA 5FB3A 1P73A 5FAKA 1PFUA 1SXPA 4NIMA 3EHDA 2YZGA 2EC5A 4OXNA 4KFCA 2BV3A 4PIMA 4HAOA 2QRPA 3BXXA 1CULC 4OQEA 3H8SA 4KMOA 3VHQA 1G42A 1KO5A 1SKQA 2VHUA 5JEDA 1XZQA 2I2AA 3CVVA 1WP9A 1SH7A 3VVCA 4KUEA 2BE7A 2ZJ6A 2VRBA 4L78A 5ITVA 2FFBA 3GC6A 3H3XA 3NVDA 3JCZA 4N7JA 4XLTA 3ZI4A 4B73A 5HQ3A 3OQMA 1HSOA 1BXZA 1KKMA 1SCUB 1OW3B 1R16A 4AN0A 1FRVA 3GGPA 2C2WA 2G9QA 2D5BA 3I39X 4KLZA 4WOKA 5JNSA 2G83A 2V4MA 1Y1KE 1T1SA 4WRRA 1H0HA 4RQAA 5F1PA 5FUXA 4ZT4A 3LO5A 4UBKA 5CDFA 5FNVA 4WKCA 1C5KA 1DPFA 2EBHX 4BTVA 5I9NA 3GFSA 3VOBA 1DO2A 2I4NA 3I0NA 1NVDA 2V74B 4OGWA 4PTYA 4ZVPA 3N6RA 5TNXA 3RB8A 1Y8ZA 4HBGA 4L9AA 1XZPA 4KJXA 1SKBA 2G1PA 2ZR9A 3V55A 2JFWA 2ZVPX 3NT4A 2FR8C 3U7QA 3FDIA 5HQTA 1J8FA 1RP7A 4ZI3A 3LKDA 5EUCA 1PSZA 4KB5A 1XZKA 4OK5A 3QXJA 1E3LA 2PQ0A 2WKRA 1PKEA 1PEKE 4H60A 4LXTA 1BX0A 3GJRA 4MGZR 3ZNPA 1ZJ4A 2WF8A 2FFHA 4D6XA 3SVLA 1R8JA 4IHJB 2W70A 3WOVA 4NP6A 4RO0A 2FF5A 1UPXA 3JYLA 1VMEA 1WV0A 1GAJA 3B7GA 3CLRD 4BLRA 4E46A 3IIKA 3W9BA 4JV5B 4BECA 1LQTA 3ZD6A 4WXMA 1JDSA 4N01A 5LNK6 1QIIA 3OPVA 5K6AC 3VMMA 5TQJA 3KYDA 4PQFA 1W85B 1AV6A 3K6JA 1LK7A 3DFKA 4AWBA 1N9KA 3GPBA 5NULA 1OE0A 2GEUA 2J41A 4DNXA 4UNNA 1Z6AA 2HIAA 2P1DA 2VH2A 2AOWA 1QX4A 3A1WA 2J31A 5KNCH 1ZX1A 3K0SA 5HRCA 3GCWA 4UTPA 1TGVA 5BT9A 4AJIA 5L6MB 2BM9A 3OD1A 1L7AA 2IUEA 2FK7A 3K0AA 3CLKA 4KN5A 2F4VB 2X3UA 2UXBB 1DMSA 1CJSA 1V39A 3MCTA 2IU0A 2C7BA 2F1HA 4CQLA 1NC1A 5CDSA 1D4AA 2OCXA 2WIAA 1H6CA 3O8RA 5LD2C 2P3QA 4FE3A 2BEJA 3FHLA 3E7PA 3ZW9A 3MOSA 2D8MA 4B31A 2XUJA 4C2TA 5B7QA 2QJRA 3TZBA 4U5QA 3JALA 3LA8A 5AVTA 4L5YA 2XUZA 3AUFA 1DHTA 2R68A 1YQUA 5GJCA 2IGTA 2H29A 1TNDA 1FMTA 1YZYA 1FNNA 2CSUA 2GNOA 4I3FA 2WJ4A 1ICEA 3QPUA 1PR9A 1S4QA 2A0YA 3DBOB 1NU8A 2WSBA 1EKXA 3DJYA 5I5GA 5EXSA 3M9LA 3ZWAA 1AZWA 3R6LA 3KU4A 5IH3A 1NBOA 4OB7A 2ZM5A 1W49A 1UJ4A 2AK3A 3JVVA 2FLKA 3Q4GA 4G8DA 3C5WP 1X9IA 5C51B 1YR7A 4IZOA 2OXRA 2FG7C 3C14C 4QAQA 1BWQA 4ETNA 2BCGY 4AG3A 4FFSA 1XWFA 5EMMA 3TSAA 1CQXA 5DPMA 4WZAE 1JQ3A 3TTYA 3T9FA 4EYKA 1FVOA 1NRXA 1P33A 3VR5H 1U3WA 5AM5A 2BFBB 1VE9A 2HLDA 4M9SA 4QRIA 3W2HA 1YE3A 3GEMA 3O8OA 4MUGA 2FW1A 4C4YA 1FQWA 1X80A 2OYRA 3IMGA 5D6OA 1HDXA 5JARA 1P1JA 3OLCX 3OZCA 1E98A 3I62A 1M2OB 3WSWA 1UM8A 2GJ4A 2ZSJA 4K5QA 1F4LA 2NLOA 2A5FA 1MC8A 5JPDA 3G0BA 3TG8A 5IUNC 2Z8YA 1X7YA 4KIJA 4NENA 3K1ZA 3K7EA 2PD3A 1RP1A 3T5GA 1RSZA 1J1UA 1YS4A 5C4MA 2FEMA 3PKJA 1G291 2JCYA 2YW2A 4GMXA 4YT8A 1PQ4A 1E6LA 1E4YA 3DKVA 4LWQA 2J0QA 1N2XA 1TC2A 2ORWA 2B9VA 2O2CA