2ZRBA

Msreca q196e form ii'
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
325
structure length
306
Chain Sequence
b'PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEVGLQARLMSQALRKMTGALNNSGTTAIFINELTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
molecule tags Hydrolase
source organism Mycobacterium smegmatis str. mc2 155
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
total genus 81
structure length 306
sequence length 325
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrbA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrbA01
1NLFA 2ZUBA 3GJ5A 1KYIA 4TLCA 5DI3A 3UKDA 2C77A 2VP4A 4FN5A 4RFVA 1OFTA 4CT5A 1HH4A 2VO1A 2G88A 2AL7A 2C78A 1QG2A 3ETLA 1JXMA 2H57A 2G9NA 4TWZA 2WOOA 3TW8B 1ZCBA 1DS6A 2QP3A 1P9NA 2DFTA 1I4LD 2C8VA 4YDHB 4ASUD 2AX4A 4P4SA 2ZUDA 3VR5A 5JFGA 2YWFA 3U3JA 3EASA 5C46F 2ZYTX 1JEEA 3A1WA 4AKHA 2I3BA 2A5DA 1Z5ZA 3GJ6A 4EQ6A 1Q1QA 4HUQB 5SZIA 2QT0A 3LBHA 3U7FB 5AUNB 1G3IA 3KJIA 4HATA 1IXZA 4TMKA 3GFTA 2PT7A 4LYFA 4PPGA 3IEUA 1TF7A 4S2EA 4ACBA 5HKKA 1KKLA 3CX6A 3SN6A 2QBYB 1CP2A 5F9FA 3EA5A 5IF9A 1LNZA 4URVR 1J70A 3Q5EA 1P75A 3EZ6A 3WMEA 2ZU0C 1SXJE 4QBFA 2FU5C 4ARZB 2BWJA 2YVUA 4LOAA 3VNVA 2OAP1 2IWHA 1ZCAA 1X1RA 3BORA 2ATXA 3ZJYA 2ZSEA 4OI1A 4ON9A 4B3GA 3ASYA 3JVVA 3TJZA 1Z63A 3QF4A 1U0LA 3BFXA 3W8RA 2QA5A 3THWA 3U44B 2YWHA 1XXHB 2VEDA 4Q4AA 3VR6A 3O8RA 1Q20A 2GILA 3VKWA 4A0GA 2VA8A 2FX3A 1E4YA 1U0HC 3GJXC 4G1UC 4P4UA 5DN6A 5J4VA 1XPOA 5GADl 2RGNC 2HT6A 2DFLA 2F3RA 2Z5FA 2IL1A 2BBTA 3QXCA 4KO8A 2ORWA 4NP6A 2YINC 2BEJA 2YNMA 5FUXA 2OCAA 5FBLB 4HB4A 3AVWA 1N5JA 4L8GA 2EFDB 4QFMA 1TQ2A 1HEIA 1U9IC 4URZR 2ZJOA 4KXFB 3RDPA 1XTKA 4LV6A 1IN6A 5EE5B 2PZFA 2D74A 2UKDA 5FOWA 3IIMA 2HV8A 3TSOA 3K70C 4A4DA 3R9WA 5KYKA 4A15A 5L3VA 1S3SA 1OXVA 3QI2A 2C04A 3AGQA 3TMKA 4C0SA 2C98A 1MABB 3EG5A 2AXPA 3WHKA 2NZJA 3CX7A 3PV0A 2A5JA 2WJJA 2YZ2A 1DAEA 1TMKA 3DVLA 1QHHB 5DSZA 5C2JB 1KO5A 5GJWC 1MR3F 1XD2B 3L8YA 3B8HA 5FUWA 2Q0HA 1KJWA 4Z1MA 4HLCA 4LYHA 4TSFA 3RRMA 3B2EA 1E1QD 3W6NA 2OHFA 1XD2A 4BLOA 2BDTA 3CRW1 2IXEA 4TMZA 3MGCA 1MH1A 1OW3B 2KI5A 4EFMA 1H8EA 1U8AA 5FOTA 2FNAA 2QTFA 3GEEA 4MYHA 4CEIA 1SVKA 4LPKA 1OFUX 3AGPA 4BFWA 2VP0A 1A2BA 3ZVLA 5FOSA 5EXTA 4M1TA 4LDJA 5LDDC 3C16C 4B44A 2WSSD 1JAHA 2GXUA 1OSNA 3A1VA 3QKRA 3SJBA 1JALA 4DCVA 2WWFA 2V1XA 3LAWA 4AC9A 5J4KA 3EPJA 1NJGA 4HZUB 621PA 3EAQA 2QAJA 3T5GA 1SVLA 4NHOA 4D81A 4IEEA 1MRSA 5AJYA 3CRVA 1K6MA 2XZLA 5FI0B 4QHYA 5CB6A 4P3YA 5L3SB 1ETUA 1UADA 4MRVA 1IAQA 4JVMA 1GZSA 2ZITA 2WIAA 2IYQA 1XTJA 2I4IA 4KV9A 3TH5A 3ZH9B 3CX8A 3N2IA 5KDLA 1NBMD 4PO9A 3B78A 1SXJC 1CIPA 5EXXA 1VYTA 4G5RA 2GF0A 4QG7A 1RVDA 4WVFA 1YR6A 1FQKA 2GKSA 2JCSA 2KE5A 5HE9A 2ZE5A 4XIGS 2J59A 3R9IA 3ICEA 4TZ6A 3PCRB 5L3QB 2ZSDA 3F8TA 2NO0A 4M22A 1CF4A 1SVIA 3KDSE 4V0KA 1W4CA 2QRZA 3OIUA 3V00A 3W3ZB 4W5HA 1XDBA 1MOZA 4PPQA 2WSMA 3T1VA 121PA 4E03A 2F6RA 4B2PA 1AQUA 5AJVB 1EWQA 5KSYA 2AKAB 1AZSC 3EA0A 4NYIQ 4OK3A 2V54A 2C95A 2XB4A 2JLZA 1GKUB 4NL4H 1K5DA 3EX7C 3F5FA 1P7CA 1OXSC 4JL5A 3W9YA 2O8FB 3GP8A 3VKGA 3ZYCA 2LCFA 4MRSA 5JHGB 2IEYA 4GDFA 4Q9JA 4HAUA 1LY1A 1W36B 2GCOB 4O25A 4YMVA 2IUSA 3AF0A 2YYZA 1NSFA 5FOVA 3OEHD 2GK6A 3T06B 2O8BA 4Q4JB 4HEJA 5BYKA 2YOHA 3CB4A 4I1VA 3HR8A 2IYYA 4Z54A 3GLGB 4RSGA 4BQSA 5C1BA 2VYFA 4BRUA 2RHDA 2FEMA 2WOJA 3QKRB 1E9DA 1TAGA 1B0UA 3U3OA 3J81k 1Z0DA 3LA6A 4Q1FA 1KNQA 2ZEJA 4LJ9A 3RWOA 3SHWA 3K8YA 1N25A 2W0MA 3DZDA 3PUVA 3KXIA 3RLFA 3GQBA 4JBWA 2QP4A 3JZMA 4IVPA 4H9GA 4DT1A 5HZHA 2WJGA 1UPTA 3W5IA 2QQ0A 3K0AA 1Z6AA 4OQFA 2J7PA 4V03A 1CXZA 1TNDA 1QHHA 1US8A 4K46A 4V0NA 2Z43A 1E9RA 1R0WA 2ZS9A 2WWWA 5BW8A 5SZHB 3KJGA 2A5GA 1M7GA 2DWOA 4MKIA 3MSXA 1KDRA 2NPFA 1E69A 2MSEB 3TUZC 2IYUA 5L3QA 1NVVQ 3I8XA 5FBQB 5FPHA 3AEZA 4QC2A 2FPKA 4Q7MB 1KK0A 4Q9IA 3M0EA 1I2MA 1IXRC 1QVRA 1WF3A 2ZR9A 4TT3A 4ZI3A 1DADA 3AVTA 2JJ2D 3RRZA 4TZ0A 3TKLA 3GLHE 3QVUA 1TX4B 4A0RA 3VNUA 1E2LA 2ZETA 4J0QA 2JJ8A 4HAVA 3LO5A 1NI3A 2PMKA 3W3AA 2V4ZA 1MRNA 1VCNA 4DJTA 3GJ3A 4CW7A 5JWHA 4S35A 1BOFA 4O3MA 4DBLC 1N6KA 3AVVA 2GZAA 2YKGA 2MSCB 1MO5A 1VTKA 4DZZA 1OH7A 3A37A 4ZDWA 4DXAA 4URXR 3WRYC 1TQDA 4KVGA 2FE4A 1G1MA 1YVDA 3FHTA 1QHSA 3PEWA 1QVAA 3VR3A 1Z6TA 2QE7D 2RGNA 4ZDKA 3VR2A 1L2TA 4DSNA 5DNYB 4C7OB 5EXSA 1E96A 4B34A 4LYAA 1N6HA 1ZMXA 3EC1A 3MWKA 3DEFA 1VIAA 4B6EA 1MO4A 4M1WA 4KHZA 1QG4A 1BH2A 3UG7A 2OT3B 3WNDA 2JJ2A 2QN6A 4X8MA 4HLUA 4D4KA 5F9HA 2QMUA 4F4CA 5FTLA 4JLNA 1FW6A 5E4FA 2MSDB 3ZS9A 3GPLA 4IVRA 3GLIA 4XTRA 4YONB 4CRWB 2G83A 1CJMA 2G1KA 2QSZA 1FUUA 3NC1C 2WSSA 2AWOA 1UJ2A 4BFVA 4GT1A 5JSZA 1OIVA 3ZS8A 2EFHB 3U61B 4Q9LA 4JLBA 5DN6D 2ZJBA 3PENA 1DO2A 4RD0A 4W9MC 4A8JC 3KL4A 4JSTA 721PA 2ZJZA 4QGAA 5G41A 2QZ4A 2J0UA 1IN4A 2OBNA 6Q21A 3GJ4A 1HY3A 3IDQA 3TR0A 2EYUA 3QPVA 4Z1MD 1PUJA 2Q9BA 5A5GA 1IY2A 2REBA 4RD4A 2P0EA 5CIWA 2ANCA 2GEDA 2QY9A 2RGGA 5BN3A 1M7BA 3UIEA 2CL7X 4JBXA 1FMJA 4ZIRB 4IHQA 2ZPTX 5E7IA 3NDBB 2P65A 3Q72A 2AD1A 5FBVB 2H17A 1XJCA 2PZEA 5L3SA 1MABA 5HKKD 3OF5A 1NKSA 2VHCA 2NO1A 2QENA 1ZBDA 5FPTA 1FZQA 2RMKA 4TQUS 3VHXA 1S96A 4E09A 1JXOA 3UWKA 3THXA 4HLQB 5FL3A 3RS2A 3SI7A 5KO2A 3Q5DA 3A1SA 4EQ6B 3MJHA 4DCSA 3CPEA 3LV8A 3DOEA 3THXB 3DOFA 5FFMA 3PFIA 4JYBA 3THYA 2ZRLA 4JL8A 3QXHA 3QNUA 2XZOA 5JZVA 2OBLA 2CLDX 4ZDIA 1D2EA 1W0JA 1NVVR 1NLZA 1KO8A 2YJTD 2YC4C 3GLIE 3FKQA 4XJXA 2VSOA 1E2MA 5CDFE 1FUKA 1X8JA 3A1UA 5EP1A 4EAQA 1HA3A 4HB2A 2HLDA 4LCBA 3KKPA 3QKTA 1ZNYA 4NYMQ 4PSVA 3M6AA 4FCWA 1YZNA 5C4MA 5E7JA 1J8MF 1E2JA 4MITA 4MRNA 4HYYA 3BGWA 3P26A 2CL0X 1C9KA 2ZS7A 3K09A 3RSLA 4UNRA 4B32A 2ZE8A 1GM5A 1U9IA 3U3RA 4Q48A 1CR4A 3OEHA 1VYVA 1XX6A 3EZFA 3TSWA 3A58B 4JKYA 4NTZA 2FSGA 3SFZA 2AFHE 1D9ZA 1XB2A 2PEYA 3KZ1E 2GVDC 4MH0R 4BPBA 2ZAMA 2FV8A 3FMPB 1OXXK 4ZO4A 2GRJA 4Q9HA 1XTIA 1JPNA 1IY0A 2QM8A 4QNMA 3BB1A 3GEHA 3OESA 3X1YA 3EPHA 2Z0MA 1XMVA 3H0KA 1RRCA 3DL0A 4PXAA 4G01B 4Q9KA 1R8QA 1HYQA 3A4LA 4HLDA 1EX6A 4EPVA 1UAAA 2A2ZA 2JIZA 5TVKA 2F9MA 4M9QA 4GRAA 4OKSA 5SZJA 2VP2A 2HCJB 5CM9C 1J7KA 1IONA 1NIPA 1NN3A 4FINA 4G5QA 1FPMA 1W46A 1GITA 1QHGA 3Q9LA 2R2AA 4M9SA 4DC9A 4Y0VA 4ZKDA 1OYWA 2H16A 4TL9A 2VIIA 5UKDA 4YMTA 1T91A 1G8GA 5AUPB 1UBFA 2QTVB 3K9HA 3QF4B 1DAFA 3TSZA 3QE0A 5B2ZA 1O3YA 3TVDA 2JLYA 1XXHA 1IBRA 2QEQA 4JIMA 3FHCB 4M53A 5CDFA 1ZM3A 1M1YE 1BYIA 1XEWY 3RRNA 2RGBA 4GOXA 4EFLA 4NH0A 2YWEA 5K8TA 4G3XA 1TUEA 4QBHA 3N5CA 2O8BB 2GTPA 3H2YA 1KSHA 3GCGA 1Y3AA 2DFNA 5JSZB 3U7HB 2GZHA 4F93B 4Z8XA 3KB1A 1ZW6A 2UZ3A 2ZRJA 1XWIA 3PUYA 4C0KA 4Z51A 1AS0A 3KJEA 4TQ9A 4AKIA 1U81A 2R44A 1S1CA 2QORA 3FE2A 4OK6A 3WMFA 2P6RA 1H65A 4DUGD 2BMFA 2F43B 1XEXA 1G3QA 5AWFC 1LS6A 5HCNA 3SFVA 1PLKA 4ZI2A 4TYWA 4QGFA 2NPIA 3G0HA 1P72A 3SZRA 3NBFA 5JJLA 5K8LA 1UF9A 1HUQA 3QF7A 4HZUA 3AVYA 2WWIA 4I4LA 4OBEA 1T6NA 4AI6A 3FFAA 4PC1A 1IOZA 2WMNB 1TADA 2H8KA 2AK2A 1SVWA 1KMHB 2HXSA 2KSQA 4PHGA 1N5KA 4D82A 3AKYA 5TB5A 5BWMA 3I61A 4TTPA 5LD2C 3L0IB 3SHFA 1XEWX 2X19A 1W0JD 5L3RA 4OI4A 2NQ2C 4OHXA 1XF9A 4POAA 3P4XA 4CZ2A 4A8JA 1M8PA 1KDPA 3LW8A 1ODFA 4IDOA 1AN0A 3FMIA 1FP6A 3TUIC 2XXAB 2KJQA 1W4BA 4B73A 5DO9A 3CM0A 1BO6A 1UKVY 2O52A 2GESA 5E7MA 4DLXA 4RY2A 1BMFA 3QQ5A 2V6IA 4KYUA 3CONA 2C5LA 4PHFA 3GLIB 4OI0A 2KWIA 1W4RA 3ND8A 4DHEA 3LY5A 4AY2A 3HWSA 3C41J 1EGAA 1QF9A 3FWYA 3UPUA 1KI8A 4B6FA 2IS1A 1GRNA 2W0SA 1G8FA 1Q3TA 4R7ZA 1G7RA 5DYIA 1U94A 1DTSA 1YZLA 1QBKC 3TK1A 3DZ8A 3C8UA 4JVLA 4QJ4A 2O0HA 3BRWD 2RHMA 2XTNA 4ESHA 3OIWA 1YR8A 4TLBA 1NN1A 2ZYWX 1WQ1R 1YZGA 4P4SB 1N6LA 3CWZA 3ZDQA 1XD8A 1HQYE 2N46A 3SBDA 4D25A 1I4DD 3QBVA 3RVBA 1DAHA 3MWYW 3GFOA 4M21A 3ZD6A 5JWOA 2GF9A 1M2OB 4V02A 2EWVA 2AHOA 3TIFA 2ZRBA 1A2KC 4RD3A 2CMKA 4GZMA 4EPTA 1T5LA 3TGPA 3TVTA 3ZZ0A 2D7DA 2ORVA 2MMCA 3HYRA 4FXPA 3FHOA 4WBSA 4DLTA 5GVSA 4OK5A 2DCUA 4PQFA 3H84A 3FFBA 3B6EA 1TU3A 2GETA 2QAGC 2P6NA 2QMOA 1RRFA 3PXGA 1FQJA 1WE2A 4IDHA 1I2DA 1JR3D 2BMDA 1T4GA 1E2PA 2LWIA 1Z0FA 1OKKA 2OV2A 2C03A 2QSYA 3OEEA 3UMSA 3BE4A 4CIDA 4CF7A 2VL7A 1VDZA 1F2TB 3A4NA 1W2HA 2J0QA 2JLRA 4HAXA 3K9NA 4NE2A 4Q4HA 1KSGA 4URYR 5P21A 3TE6A 1U8ZA 3ZVMA 3RS5A 3QKUA 2HDNB 2IT1A 5D3MB 1A7JA 4NDZA 4ILEA 4BE7B 2L0XA 5TARA 4TN1A 3QIAA 4D0LB 3M1IA 4IFBA 4AG6A 3S1AA 1GRRA 4ASUA 4AIIA 3MG9A 1GWNA 3EZ2A 4C0QC 4DSUA 5K8IA 3MRSA 3RNLA 4NONA 3T5DA 1ZM7A 2ZE6A 3K1JA 2WTUA 4I1UA 1PUIA 1TQ6A 4V0OA 1GVNB 1G8YA 1RYHA 4KBFA 4Q1BA 1OJLA 2ZE7A 1R7RA 2WKQA 4BZQA 3T15A 2JEOA 5DIFA 4ZIRA 2CDNA 2RB4A 3Q85A 4PQRA 3A6PC 3CF6R 3IEVA 2GEUA 1UEJA 1CR1A 1DG3A 1KMHA 2CLCX 2W6JD 4L5BA 1S4QA 2D7CA 2WZQA 1F48A 4MGZR 1MT0A 4LJ5A 1VKJA 1ZM2A 1DAKA 2OXRA 3RC8A 4UNQA 2JJ1D 5JEDA 3R8CA 1Q1ZA 1L7VC 1PVOA 3SJZA 2ZJYA 3NH9A 3PJRA 5B30A 1OHHA 4B48A 2R65A 3NXSA 2W2VA 4P31A 4IFEA 1S1MA 3LXRA 4YXWD 3IO3A 4LBYA 3EIHA 4KI0A 4DLRA 4RD1A 4ZCMA 4UJ3A 5DH9A 2VP6A 3B60A 1G5PA 2YHSA 3OHMA 4HSEA 4UJ5A 1W36D 4JZKA 5JCZA 3KUCA 4CEIB 4QHSA 3JZAA 2BC9A 1KZ7B 3IO5A 3O47A 2GBLC 2B8WA 3LH5A 1II8A 4GL2A 2FZ4A 2ZI6A 2GCPA 2IEZA 1CS4C 1L8QA 3OIYA 4TSFD 3ONWA 4Q66C 5FTJA 4YMUA 5CIQA 1XP8A 2RKOA 1KTVA 1ZC4A 4P4TA 2CE7A 3NEJA 3LWNA 3VQTA 2YOFA 2IYZA 3BERA 2EWWA 4B47A 3CR8A 4XSGA 5EP4A 5FL7D 1RFLA 3GJ7A 5J47A 5KSPA 1E9BA 3P1JA 3C15C 2ZRKA 2R6GA 2J0UB 2V9PA 1Z8FA 3EWAA 3NG1A 5B64A 1WP9A 1FNNA 3K0SA 1NN0A 1N3BA 2ERYA 1NG9A 1R5OA 3SC3A 3EWSA 3LD9A 1YQTA 4QXAA 1FX0B 1OKKD 3V4RA 3CLVA 1SKYE 1E2NA 3IPXA 1W5TA 1XFAA 3RAPR 4DEXA 2DPXA 5CB8A 4FCTA 4DB2A 4LY6A 1OIWA 3CNLA 3ADKA 4L4UA 2PJRA 4M9XA 5D3QA 1ZC3A 3KQLA 4R9UC 3KFXA 4WZBE 4FI3C 4Q18A 2BM0A 2W00A 3U3KA 1J90A 3VAAA 1UBEA 1CJVC 1X3SA 3U2QA 5TXGA 4LSGA 1G41A 4N3NA 3UK6A 3UWOA 4EKDA 4XWOA 1GL9B 1WRBA 1XTSA 2V6JA 2ASEA 4R2IA 4BLRA 2Z4RA 3PEYA 5CLLA 3VR4A 1BS1A 3CF0A 1AS2A 4RZUA 4Y0AA 4B3CA 4WIAA 1P2TA 5J4YA 3DDCA 1Z29A 4LBWA 5EQTA 3FYHA 5B58C 3NEYA 3IIJA 3ZVNA 3HP1A 1E0JA 4M1YA 1ZUNB 2IYTA 4JLKA 5LB2A 2P6UA 4IDPA 3CRMA 4JLPA 4JLAA 3ND9A 4ESVA 4QJ3A 1P2UA 4HI0E 4YXWA 2V3CC 2DB3A 4DSOA 3LW7A 4IW3B 4QBGB 1JNYA 3AQ4A 1IJEA 1JJ7A 2JAQA 1E0KA 3CPHA 3KTAB 5HPYB 4FWTA 2PCJA 3W6PA 2H5EA 4O0MA 4TL8A 1DOAA 5EP3A 1ZUIA 2YWGA 1ZIOA 1CJTC 1T0JB 2W58A 1CKEA 2WMOB 3SYKA 1IN8A 1M74A 2IA5A 5EUMA 1E1RD 1JPJA 1VECA 2R62A 4AYWA 3LX5A 1GNQA 1G6OA 1AA3A 1W47A 3FMOB 3SJCA 1HE1C 2WM9B 5FTKA 2UVQA 5J4HA 3PEVA 4PAOA 1L4UA 3RC3A 1SHKA 3WRXC 2XZPA 3OFND 2GAOA 3KB2A 1SVMA 1OXUA 2ECKA 4GP7A 4BLTA 1FTSA 3BS4A 1G9XA 2PZGA 4E5UA 4KU4A 1ZP6A 1F60A 2HLDD 4KCGA 2V55B 1JQJC 3QBTA 4JLDA 1Q12A 2QG6A 2XITA 2Q21A 5GVRA 4UXIA 1PV4A 3ZQJA 1OF1A 1UKYA 4O2RA 4W5WA 1GFIA 1HT1E 1W2GA 4L9WA 1BIFA 2OESA 2RGDA 3HR7A 4IOKA 1FOEB 3CW2A 2DYKA 5JRJA 2NZ8A 4GP6A 2JIZD 4QM7A 4I1SA 3AKEA 5G3ZA 4GMDA 4OHZA 3TRFA 2QI9C 3AB3A 4NCKA 3GLFB 1RRGA 5AR1A 5B57C 4MYUA 5DYGA 4U00A 2QAGB 5JHHB 3B82A 1NMYA 4TLAA 1MO6A 2XB2A 4NYJR 1SHZA 3TW4A 3B1ZA 5FPSA 3FKSD 4JJZA 5GJVC 1RE0A 3REFA 3SU8A 3U6BA 2O8DA 1R0XA 2EFGA 4NMMA 5GJCA 4LJ4A 2FGKA 5BN4A 3LXXA 2G0NA 2ZJAA 2H18A 4Q5IA 5C18A 2WWXA 2WKRA 4JL6A 4RKFA 1GKYA 1DELA 2O0JA 3EIEA 4JJKA 4N0DA 4GZLA 4QM6A 2ZAOA 1ZD8A 3G5UA 3L43A 4LJ8A 3B13B 1XEXB 3K70B 4JT4A 4PZYA 1N6NA 4URWR 2IF2A 4QJ5A 3N2EA 3FOZA 4B71A 1KAOA 1P9WA 1JECA 4EFNA 2WWYA 4KSCA 4F4IA 2FPLA 1A82A 4WOPA 1FX0A 1KMQA 3PR1A 4DT1B 4ZDJA 5KNBA 1KI4A 1GKIA 1CRQA 1E32A 1M34E 1SXJB 2ONKA 2LKDA 3B85A 2IYXA 4V0LA 4DLUA 4DDVA 2A9KA 2Q9AA 3BBPA 2ZR0A 1ZNXA 3VU9B 5JWRA 1N5IA 1VG0B 3LQQA 3N70A 4YQFA 4LGMA 1F2UB 1NF3A 4I1OA 1XTRA 1G16A 4MGYR 2ZREA 1G4UR 4XWKA 2XNDA 4BLPA 4YMWA 3DHWC 3UMFA 1NSTA 4A2WA 2OE2A 5AJXA 2ZIAA 1TU4A 3PUWA 5GJBA 2P67A 3D8BA 3VR1A 3KKQA 2IC5A 4BASA 2GWHA 3WYFA 1QHNA 2W6JA 4D4LA 1N6OA 1G18A 2IXGA 3K0CC 3U3MA 3K0FA 5DI3B 3WHLA 3EIQA 3SNHA 1X1SA 2RH5A 2JASA 1Z0AA 1WA5A 3T1QA 3O8DA 1E9CA 1II8B 2HUPA 2BIFA 5E3HA 1XEFA 2CBZA 4TLEA 1IM2A 2GAAA 4OHVA 2QGZA 2F1IA 5FR2A 3KTAA 3TAUA 3PQCA 4QKQA 4ZCLA 1P60A 1Z6XA 3A8TA 1KDOA 3FDIA 1ANKA 4XD7D 4EDHA 3O8CA 3KKNA 2V1UA 3T12A 3KKMA 4PSKA 2ZVPX 2ZJ8A 2ODBA 3AUYA 2BJVA 2REOA 3NIBA 4U5XA 1Q1EA 1IXSB 3LVRE 5CK4A 5KPJA 2NO6A 5E95A 3BB3A 1VCIA 2AD5A 1E9SA 3ZLJA 5AJZA 2CJWB 1KGDA 3CKLA 5CJ2A 2GZDA 4RZ3A 4UNSA 1E1RA 3M4YA 4OYHA 2FZLA 4LPSA 1HT2E 2XXAA 2D2FA 4V0MA 4Q01A 2BBSA 5JBQA 1JR3E 4TT3D 2G6BA 3R9XA 4DDUA 3KFVA 3KXLA 4TYQA 1NVXQ 2X77A 2VHTA 4LJ7A 4M1OA 2F9LA 4BFZA 4K81B 1D2NA 3NBXX 4MKGA 4C9BA 4EIWA 2CHVA 1N6RA 1EK0A 3CBQA 3CR7A 4X8OA 4YC7A 5EP2A 3SS8A 3UANA 1N6PA 2GVZC 1A5TA 2HCBA 4LV8B 4BECA 4CT4B 2GCOA 3X1XA 3KQHA 1RIFA 1TPZA 3A36A 3BH7A 1E2IA 4L16A 1NVWQ 3THOA 2QMHA 1RW4A 2RGCA 3C4JA 3IHLA 1I4TD 2JLVA 5FTNA 2HYDA 2J45A 1DAIA 2XGJA 1ZD9A 2ZU6A 3H86A 2ZUCA 2B6HA 1KK2A 2ZRAA 1II9A 1LB1B 3U4QA 4HDOB 3OE7A 3L82B 1CRPA 1YZUA 1JQLB 2D62A 4PC6A 2IYLD 4OL0A 1KK1A 1ZM4A 3MWLA 4DCUA 2G1JA 1P2SA 2BBWA 4LRWA 3I5YA 4KLZA 3D31A 5LBIA 3PIRA 2JLWA 2OAQ1 3UMRA 1KHTA 3CWQA 4HB0A 3ADBA 4GOKA 3R8FA 3K53A 1HQCA 3IBGA 5DHFA 3I3SR 4UNNA 2WAYA 1BMFD 1XJQA 2RGXA 3LVQE 3ZZTA 4CEJB 4MYTA 4IOLA 3H4MA 1S2MA 1XZQA 3VU9A 1NRJB 1M7HA 2GJSA 2PLRA 1YE8A 2PMDA 5FL7A 5FPYA 4TYYA 3WBJA 4ITRC 4D26A 2BBOA 4B43A 1KKMA 1DE0A 2A5YB 3GLFE 1G6HA 2G0TA 4XD7A 2NTYC 2WAXA 3TQFA 2CE2X 3TAHA 1SKQA 4X8HA 4PHHA 4CGZA 1VHLA 1WCV1 1HV8A 1Z83A 2TMKA 4PR0A 3BFVA 1VG1A 3BK7A 4DWJA 1N0WA 5FBRB 2O8FA 3IGFA 3S1AB 1VMAA 3WBKA 2WKPA 4A6XA 3OFNA 3P27A 4ERNA 3BOSA 5EJEA 4KBGA 1P2VA 2IS6A 1P62B 2CCGA 3B7GA 4HLUC 4JMPA 4Z8YA 3ZIAA 3W90A 3CNNA 3PUXA 3I5XA 2VPPA 3NWJA 1UBGA 2J3EA 2OG2A 4IKEA 1J2JA 4JKIA 4YDSA 2WVJA 3NTUA 1YRAA 2CL6X 3BAFA 4JVNA 1AM4D 4MQBA 3THWB 2A30A 1CU1A 4F92B 5DISB 2JA1A 1KAGA 3RS3A 1TL7C 4Q4LA 2F1JA 1XU4A 1Z6YA 4OQNA 1DG1G 1OHHD 1G3MA 2CCJA 4D0GA 3DPUA 4HAYA 4WZAE 1P61B 3AVPA 4P33A 1LF0A 2ORIA 3AF4A 4A1FA 1Z0IA 1NN5A 2SHKA 2C99A 1G5RA 4MDEA 2C9OA 3WYAA 3AVQA 4LK2A 2GXSA 5FH9A 4G5SA 4JLOA 1COWD 1SZPA 1Z07A 3RANA 2FFBA 3SBEA 3A4MA 5BQ5A 2ZM5A 2XSZA 1PJRA 1EX7A 2W2XA 2ZI4A 4LJYA 1NJFA 2VBCA 3OAAA 1WBBA 3VKHA 2FFHA 1SQ5A 1K5GA 1KZGB 4HAZA 1NNEA 4ZKEA 3THYB 1A1VA 1EFTA 4HDCA 4EPWA 1XMSA 2QNRA 4BZXA 4ARZA 5BN5A 1T3LA 2P2LA 1ZNWA 1WDTA 2CNWA 4GNKA 2GXAA 1TF2A 1WMSA 1Z28A 2D06A 4A0FA 4WAUA 3SQXA 2A3RA 4F91B 1N6IA 4FMDF 3LDAA 2IYSA 2PLFA 3FPAA 2FGJA 1VHTA 2W83A 4LHWA 4RZ2A 3DKVA 4DDWA 4Q19A 3NHBA 1E98A 1KO1A 1MV5A 5H68A 3EZ7A 3V9PA 4YMSA 3I4LA 3O8BA 1XD9A 3E70C 3TR5A 1N2CE 1GTVA 1CJUC 4PQYA 2NO9A 2QL6A 4AD8A 1NLYA 3PVSA 4Q7KA 3U4QB 1E2HA 2F3TA 1P5ZB 2YOGA 3DO6A 1EESA 4IEIA 1J8YF 2CK3A 4GMXA 3Q7QA 1CBUA 2FSFA 2ODNA 4QOSA 2ANBA 2IYRA 4LC1A 2ZANA 2A7QA 2DWPA 1CLUA 4Q1CA 5G53C 1QZXA 2BCJQ 4HZIA 2HYIC 2X2FA 4IOJA 1WB9A 4B75A 2WICA 1ZU4A 3PUZA 1NG1A 1QHIA 4BFYA 5EXPA 2QPAA 1R0YA 2C9CA 2QGNA 2OILA 1EFRA 2QUZA 4BUJA 2O8CA 2JLUA 5L8VA 1N5LA 1T9HA 2V7QA 1NMZA 2I1VB 5DI9A 5DLQC 4CVNA 3Q8XB 5ELXA 4NCJA 1F6BA 1YZTA 3AVXA 2QU8A 3HU1A 1ZD1A 3DMNA 4Q03A 1H8HA 5EUQB 1EFRD 2ZRHA 3MUFA 4Q7JB 1KI7A 3CPJB 3TNFA 3MD0A 3PG5A 3CRRA 2QROA 2VSFA 5CYOA 2IUUA 4IXNA 1XMJA 3U5ZB 2PT5A 2YV5A 4RVCA 1T0HB 1E2QA 1IN7A 4G5GA 5JEEA 2REXB 3B9PA 2KBEA 3GJ0A 4DIEA 4BFXA 3IBYA 4XVRA 4I81A 1TUIA 3T61A 1GOTA 2NGRA 4OQXA 5A0FA 2DWQA 2WBLC 2ZQ5A 2ZRIA 4DLZA 3MCAA 2AR7A 3ADCA 2E87A 5FR1A 1V43A 5KOYA 3L8ZA 2ZRPA 4BGDA 1W44A 2GNOA 3C5HA 4WW0A 4KFTA 2XEXA 1UM8A 2HF8A 2WPDA 5C4GB 3SEAA 1II0A 4DVGA 5KPDA 1C4OA 2B7BA 3GLGE 3U7EB 4FMCF 1UDWA 2JDID 1AQYA 3B1YA 1YU9A 2X2EA 1TTTA 4L9SA 4RJLA 1H8ED 4CYMA 4XSHA 1ZYUA 2VLIA 1AKYA 2CVHA 5K8UA 4PPNA 4B76A 1D9XA 1ZVQA 4RFSB 2ZYVX 4C0HA 4A36A 1R2QA 3KJHA 4N0EA 1XMIA 1PZNA 2FN4A 1JB1A 1LVGA 4HUQA 4MRPA 5HCIA 2FFAA 4DSTA 4RCZA 3KQUA 2X1VA 3QPWA 4RCYA 1IQPA 1U2RA 3ZGXA 4LX0A 4BFUA 5KU1A 3AP2A 1Z22A 3MAAC 1R8SA 2O8CB 4M8NE 4NCNA 4A92A 5KNDA 2WWHA 4II7A 2XOKD 5JS7A 2Q3MA 3NBYC 4CEHB 5LD2B 2J87A 4JYCA 2A78A 1ZIPA 4PO8A 4JS0A 4NYIR 3F3YA 1KDTA 4BWYA 1SXJA 3CUEF 2NOAA 5JJKA 3Q3JB 2OM2A 4KSBA 2FMXA 2ZRMA 4UQOA 2FWRA 2IF0A 2FSIA 1E2EA 1G8HA 3GD7A 3LBNA 3G82C 1E0AA 1LW7A 4PAMA 5KUTA 3ASZA 3W34A 1QHXA 3WXMA 1D2MA 2FFQA 2H92A 2W6IA 3IPYA 3RWMB 4RKEA 1ZRHA 4D80A 1Z47A 3U7GA 3LLMA 1E99A 3B9QA 4N1AA 4UKDA 1DO0A 2OCPA 4TL6A 2C96A 2F55A 1GL7A 3GLGA 1UEIA 4OJQA 4Q47A 5CM8B 1R10A 1AS3A 1W48A 1P9RA 3IIKA 5AUQA 2HJGA 1JEDA 4M1KA 2JLXA 2W6ID 1W1WA 2GJ9A 1XTQA 5CLQA 1G7TA 2F7SA 3SDZA 1G64A 1NY5A 3BWDD 4R98A 3OAAD 1OFIA 2EQBA 4Q7LA 4X8LA 1O87A 4M4SA 1U90A 2IHBA 2WPDD 4MUAA 4LI0A 3K0AB 5TMPA 2AK3A 521PA 1LTQA 3DMDA 4JVSB 3SOPA 3I73A 1US8B 5H8WA 4IXMA 4UXHA 4A0HA 1V5WA 5FI1B 1GSIA 1NL3A 3T1OA 3E2IA 3LX8A 1IY1A 4Q1AA 1YZKA 4GSYA 1F2TA 2OLJA 4LBZA 1VCMA 1LV7A 1EG7A 4I99A 4WA7A 2O8EA 2OO7A 4ACAA 1P6XA 2PJZA 3D7MA 3X1WA 4CDGA 5IT5A 2FDCA 2J41A 3QEOA 2GDJA 3CZQA 4BEJA 2N42A 4P0TA 2R8RA 3KKOA 3UG6A 5IRCD 3PITA 5M04A 2G77B 1AZTA 1XRJA 2CHGA 2IW3A 221PA 1ZUHA 3KQNA 3T1TA 5KTYA 5IHPA 2XJ4A 2ATVA 1FL9A 1RJ9A 2GJ8A 2IXFA 3NDPA 1E79D 1R6BX 1VG8A 4TL7A 3HPRA 4AYXA 3FMFA 5BXQC 1P4SA 5F2EA 1ZAKA 4QGHA 5BYJA 1OLOA 4KFUA 1OH5A 1T3HA 4PC7A 3QVVA 5JECA 4BLQA 4Q4AB 1Q22A 1XPRA 5G3YA 3BH6A 1OFHA 2CK3D 4A2PA 1TEVA 4GPTA 4C4PA 2VQSA 4H1VA 4M9ZA 4NPHA 1ZJ6A 4C0BA 1MO3A 1Z0KA 4Q21A 1GP2A 3WNCA 3AM1A 2ZI9A 3BXZA 1RZ3A 2IYVA 4PZLA 3VFDA 4O2LA 1JBKA 2PX3A 1KI6B 1U8YA 2XOKA 4QL3A 1WXQA 2CJWA 3X1DA 3IILA 4Q00A 1G7CA 2WIBA 1KSFX 3QXJA 4KITB 3L0SA 3W5JA 1YJ5A 2AFIE 2R6DA 3QOFA 3JVUA 3QG1A 4C3ZA 5FBWB 2QE7A 1DVRA 4LHZA 1RRPA 2GJKA 4JLVA 2AWNA 2BCGY 1GILA 2FOLA 4QNRA 1KY2A 4M2LA 4KODA 1UKEA 3EZ9A 1HTWA 4FIDA 1UDXA 4EUNA 1W0KD 3B1XA 1U99A 1KSJA 2JATA 1R5BA 2E1RA 2CNWD 2VHJA 1VYUA 3AP3A 4TTQA 1K8RA 5DHAA 4MDFA 1W4AA 5DGXA 1NP6A 1X6VA 4U02A 1E0SA 3ADDA 1E2GA 2LKCA 1A4RA 1G20E 1EFUA 2G3YA 2XAUA 5DE3A 1IN5A 4Q4HB 4D4MA 1KJZA 4A82A 2Z4SA 5CYPA 2ZR7A 4PSAA 5KDOA 3CIOA 5JMTA 3BIFA 1CR2A 2H1LA 2NIPA 4Q4JA 4LHXA 2AN9A 2GCNA 4DUGA 3T34A 3SJAA 5H1YA 3EXAA 1U0JA 2F43A 4OHWA 821PA 3ZD7A 2HT1A 1W5SA 4OJKA 4HUTA 1G3UA 2ERXA 2RAPA 4E07A 4OHYA 4FW9A 2BHRA 1W49A 1E94E 3KUDA 2N1BA 3CH4B 3I1FA 3AVOA 1KJYA 3E1SA 1GUAA 1M6NA 2ZSAA 1XBTA 2J5XA 4OQLA 5HTKA 1G21E 3U60B 3UXMA 4RD2A 1DAGA 3LBIA 3QXSA 1E9EA 5J40A 1VPLA 3FGNA 4PX9A 4ZPXA 3TQCA 1DAMA 1SULA 3WMGA 3E5HA 4KFRA 4BFTA 1KI9A 4TLDA 1G3RA 3TUJC 1H8HD 2VH5R 4A2QA 1U98A 3IHWA 5JI3E 2KB0A 2BKEA 2IUTA 1RKBA 2RCNA 3KX2A 5TDHA 2PH1A 3VHLB 3BJIC 3QKSB 1ELOA 4JLJA 4TMTA 3AUXA 4BZPA 2K5UA 4XTCS 1X86B 3ECCA 4PO1A 3SR0A 5KHOC 3X2SA 4DCTA 1T8UA 3TLXA 1R4AA 2JDIA 2VSXA 4LJ6A 5AJWA 4D0NA 2VHUA 1GNPA 4FCVA 4LUCA 4AYTA 1NBMA 1XZPA 3KXKA 3MFYA 4LWZA 1P73A 3OZXA 1RJ9B 3QXXA 4JBYA 1C1YA 1LF5A 3CZPA 1XJ0A 1SXJD 1IHUA 3U6KA 2BM1A 1ESMA 2IYWA 2A5FA 1L4YA 1OXTA 3FB4A 4OQMA 3RS0A 1YHNA 5HE8A 4C2TA 3GLHA 1XPUA 2PEZA 2QMEA 3W8NA 4TMVA 4F7WA 2WJVA 3B1WA 4WXPA 5J4LA 2EU8A 1Z6GA 4QHTA 1UKZA 2JJ1A 1AIPA 2RGAA 3AF3A 3AF2A 2Q9CA 2F1RA 5J5CA 1B23P 4DEYA 1SGWA 3RYTC 3U44A 1KI1A 5HZKA 4ZV4A 3OE7D 3CH5A 1NIJA 2CCKA 4PTLA 1NKTA 3QJYA 4C30A 4NU0A 2HXYA 3EC2A 2D4HA 5EZ6B 3VTKA 3SYNA 1FMLA 1D5CA 4DLVA 2ZJ5A 1KI6A 3RSOA 1KNXA 2Q6TA 5SZKB 4A6PA 4US0R 2C9YA 2J7PD 3CRQA 2ZRNA 1DPFA 3KQKA 5JLJA 4U7DA 1CR0A 3K09C 2QRNA 1DARA 4BEBA 3W6OA 4DDTA 3MWJA 3QPUA 2VHQA 4QBIA 2VF8A 3AV0B 4M1SA 1E4VA 4PHTA 2QM7A 3WNBA 1AGPA 2IWRA 1CEEA 3L0PA 4B35A 1QRAA 3FVQA 1XCPA 2EFEB 2FF7A 3CNOA 2R6AA 3GFPA 4G0NA 5LPNA 2OLKA 1KK3A 3K9GA 3AKDA 4B3BA 4KYIB 1QDEA 4LHVA 1Z3IX 1VIYA 2WJIA 3D6TB 1FP7A 4DB4A 2FG5A 2FEOA 3NKVA 2J9RA 4GBMA 2CHQA 2J7KA 4UNPA 4B33A 1Z06A 2WHXA 1NBME 2BJWA 5G40A 3I32A 3FKSA 3I62A 5ANRB 4A8JB 3P20A 3AP1A 1S8FA 2F1HA 5CITA 2QTHA 1KI2A 2B8TA 3GJ8A 2OXCA 3VX3A 3V4FA 1NVUQ 1EWRA 1JI0A 3IQXA 4DLYA 1G4AE 2AKYA 4K8OA 3VMFA 3VX4A 5AK0A 4MGIR 3LRPA 4P32A 1OYYA 3WP1B 3HDTA 4TYPA 3REGA 1GRQA 4DCNA 2QP9X 3RABA 1BYUA 5JI2E 1P3JA 5EE9A 4PAQA 2PCLA 3WP0A 421PA 2J46A 3HU2A 4KLNA 4MYCA 4AK9A 1E2FA 1JAIA 4BRWA 2H7VA 3FTQA 4AURA 1CTQA 3EPLA 3AH8A 4MA4A 2FA9A 3QY0A 4MRRA 4NZYA 2IX3A 2GK7A 1QHYA 2OCBA 2ONJA 2BMJA 2PX0A 2XSZD 4RFSA 5FOXA 1ZNZA 2ODEA 3I72A 2EYQA 3P32A 3R20A 4Q1EA 3QKSA 4XWAA 2JGNA 2CVFA 5CK5A 2D2EA 2ZVQX 1IJFA 2EFCB 4IOMA 1CJKC 2OCYC 1YZQA 5KSOA 5FTMA 3LLUA 1ESNA 1EFHA 1Y63A 4PANA 2JLSA 1X8LA 2DFKB 1NMXA 3ZZUA 1E9FA 2ZYUX 2JLQA 4XVUA 4AKGA 4V0ME 2ZRGA 1GG2A 1JR3A 2GHIA 2IK8A 2GEVA 4HB3A 4US2R 5CJPA 4CEHA 2R6FA 4EJSA 3D3QA 1E9AA 3K9LA 4MKFA 2B7CA 3R7WB 3NBZC 4MKHA 3BB4A 4EJSB 1DBSA 1OIXA 3L0OA 3CF2A 2IS2A 1ZM9A 4LHYA 5EZ5A 4FWIB 3QSYA 3LNCA 3HPQA 5EE1A 1KIMA 4DLSA 4B2LA 1OB2A 5AUOB 1E3MA 1ONBA 1T3SA 1GAJA 2V7QD 5A4JA 3GLHB 3AF1A 4NYMR 1RYFA 4NKRA 5JS8A 4AWXA 2OZEA 2HJVA 4PC2A 4B3XA 2BV3A 4G5OA 1VCOA 2P5SA 2Q3FA 2BOVA 2WJYA 3RS7A 4R71A 4ZCIA 1S3GA 1OH8A 4LYJA 2WWGA 1GDDA 3QEJA 4TMXA 5IK2A 1SVSA 2NMVA 2BVNA 4F4JA 4PZZA 3I92A 4OI2A 1GIAA 2O0KA 3IUYA 2XTMA 4IJMA 4EPXA 2OFWA 2Y8EA 2Z83A 4W5JA 2WJHA 4XH9B 2DBYA 2W2TA 3EW9A 1VG9B 5FUVA 3WYGA 4MUBA 2MMGA 2P3SA 1JR6A 3ZVRA 1OV4A 5FOUA 5IK2D 1W7AA 1TF5A 4QGGA 5KSZA 1PLJA 4JLMA 2XNSA 2R9VA 2BKUA 3DM5A 4C2UA 3MMPA 2ZJ2A 2OUKA 4D6PA 4PFSA 4CEJA 1AGRA 3RHFA 1AKEA 2EW1A 4IDNA 4ABYA 1Z08A 4Q02A 1LS1A 2ZRDA 4GOJA 4BFSA 3GLFA 4IVQA 1Q1BA 4DLWA 3K0CA 2QAGA 4B2IA 3NC0C 1W0KA 5FUYA 2V8OA 2XX3A 4B3DA 2O8EB 4DRZA 1E79A 2FSHA 4TYNA 1F2UA 3HU3A 3HJNA 5F3WB 4DIDA 1E1QA 1XXHE 3NH6A 3UATA 1R5NA 3NHAA 3P4YA 2GJAA 1G17A 5D3MA 1R0ZA 4DKXA 2OFXA 1Z0JA 4TTRA 2BMEA 2DR3A 2VRWA 2FJUA 4A9AA 2ZROA 5EE3A 3IKJA 4MGKR 3BD9A 4R2HA 1AA9A 1COWA 2XJ9A 3K70D 4IRUB 3LFUA 3I8SA 2VP5A 2ZRFA 1XCGB 4Q1DA 2NG1A 2IBMA 3EARA 4W7SA 1E6CA 3QUSA 2P5TB 1Q57A 1UFQA 2B92A 2XNDD 3MJRA 2XTZA 2OEPA 4US1R 5TY0A 3K0EA 3GEIA 2ZS8A 4TQAA 5H70A 1NY6A 1RPZA 1G7SA 4XOIA 1KO7A 2DY1A 1G5TA 3ZIAD 3C14C 4LV5B 4XVQA 1MKYA 3B5JA 2J0SA 1LFDB 2D3WA 4M0LA 3AKCA 2RGEA 1XNJA 2Q3HA 4C0AC 4C7OA 4PC3A 3L2OB 1EXMA 1G19A 3PEUA 1W36C 2IHYA 4RZXA 4EPRA 4FMDB 3SYLA 2QT1A 3WY9A 3SQWA 2ZSFA 1F5NA 4NCHA 1DEKA 1G291 3EPKA 1ZU5A 2DHRA 1RC8A 2HEIA 1CULC 4FMBB 1Q44A 4PPFA 1YRBA 2ZRCA 3F0TA 4KVAA 2AXNA 3C5CA 1OB5A 3T35A 4E22A 1GNRA 4GFDA 2O5VA 3QG5A 1TEXA 1HE8B 4B74A 2QBYA 2HF9A 1XCMA 4C0JA 4B3FX 2NO7A 3C7KA 2PBRA 3SE0A 4D4JA 2ODWA 1G8PA 3NVAA 4HAWA 1D8TA 3LQRA 1AJEA 1AK2A 2X8AA 4NYJQ 1N0UA 5F98A 3H1TA 1E2KA 1FFHA 1Z2CA 4KAXA 3ZQ6A 4TMWA 8OHMA 4BLSA 1OH6A 2ZTSA 2GXQA 5EE0A 2C2HA 3RRYA 4M1MA 2O8DB 4D2IA 3OIVA 4LBVA 2CEAA 3B1VA 4QRHA 1Z2AA 4KFSA 2E9SA 2CXXA 1D6JA 1N0VC 3GMTA 2OBMA 1OPXA 4JT2A 2GBLA 2R6CA 1YR7A 5IDVA 1EFCA 3IQWA 4FD2A 4NBSA 3RS4A 1OT3A 1FTNA 1J99A 4EPYA 2ZSBA 2PL3A 1KOFA 2QPTA 3HYTA 4LJAA 1Q3HA 5KNCA 2YC2C 1S0UA 2BEKA 1FNMA 1T8TA 2J1LA 2VF7A 4LC0A 4GI7A 2Z6VA 1GL6A 2QPOA 4WXRA 2FH5B 5JCPA 1E2DA 4WZ6A 4C0LA 1KI3A 3CO5A 5JRZA 3ICQB 3TBKA 4HDQB 1SKYB 2KBFA 5FPKA 2FPMA 2ZI5A 2EVWX 5JJIA 1Q21A 1OE0A 4L15A 3X1ZA 1SVOA 3BH0A 2CLSA 4JSYA 2QQEA 2IS4A 2J0VA 4AKEA 2B21A 1KY3A 4NCIA 1S9DA 4YLGA 1ZINA 2GA8A 2OFOA 4H1UA 1UBCA 1S9HA 5LB4A 4F38A 3BC1A 1HURA 3QENA 1T5IA 4RD6A 4FMCB 1YKSA 4KJZA 4LZZA 2UZIR 1JJVA 1X8KA 1F3OA 3K0FB 2OSBA 5KDDA 1KO4A 4IDQA 1TQ4A 1BKDR 5TV2A 3Q7PA 2WV9A 1WBDA 4UXJA 3R7WA 2ZXUA 2VTKA 3OEED 3MLEA 4URUR 1Q0UA 3DKPA 3BFKA 3A1TA 4EJSC 5HR5A 4AG5A 3DM9B 2I1QA 3AVUA 1PLLA 2VP9A 1YR9A 2ZI3A 2ZI7A
chains in the Genus database with same CATH superfamily
3WGZA 2ZUBA 3GJ5A 1R00A 4IG9A 3VR5D 4OHCA 1FFDA 1OFTA 1R6UA 3N28A 1HH4A 1BFKA 1KOJA 1M6EX 3O4HA 4KK4A 3MA0A 4TPKA 4W8HA 4MAAA 4UFOA 2QP3A 3SOOA 4N4AA 3ZUGA 4X60A 3BGIA 1I4LD 3DEKA 4PG4A 2C8VA 1HZZA 4K6CA 3GY0A 4YDHB 3ILHA 1RXUA 5C3UA 4ASUD 3QU9A 4EVQA 4X94A 1Z8NA 2HCTA 3TTWA 5JFGA 4FQ8A 3TZHA 1NDUA 3KEQA 1FP4A 3SKYA 4QNNA 2A0XA 5ELLA 4XDZA 5HHTA 2C82A 2ZYTX 4MI9A 1AH2A 4AKHA 3NAMA 2CJXA 2EG5A 3ZCVA 3FROA 3GJ6A 5H3HA 5SZIA 4EQ6A 4EVIA 1UOQA 4XUEA 4P0PB 1I3MA 3HJUA 3KHSA 4FE7A 5AUNB 3FYSA 2YMLA 1JKXA 1G6KA 3GFTA 4G0XA 2LTAA 1SRQA 4S2EA 4ACBA 5HKKA 3HBJA 4CV3A 1Y8QB 3TDNA 4ZAZA 5AXDA 5F9FA 1AD2A 3GU3A 3O8OA 4URVR 1J7JA 4BY9E 1P75A 5K4HA 2HK7A 3KC2A 6NULA 1W9MA 3OA0A 4JNCA 4B83A 2Q1UA 3LVBA 5CGQB 2EEPA 2ZU0C 2O2HA 2FU5C 1YJXA 2D5IA 3G6WA 3UB3A 3W5BA 3FBTA 1O9BA 3P0IA 4MDYA 3U4AA 3UYLA 2IGTA 3S99A 3STXA 3N3BC 3ACBA 1EWKA 5C53B 3S4YA 4B2YA 5TEVA 3ZQUA 3K2EA 2FXIA 5AJTA 3UPUA 4BYMA 1H9AA 2CLHB 5AJUA 3TJZA 5A2GA 8ATCA 3QF4A 3IKVA 2ZYGA 3QZUA 3KQTA 3RU9A 3THWA 1N1EA 4XZ3A 5LMCA 1DKRA 4B9AA 2NVUA 2Q2QA 2ZWOA 4L6IA 3O8RA 5IUJC 2ILVA 3JASA 1JHZA 3DTNA 4P4UA 1H2WA 5DN6A 2M9MA 1PK9A 3ZCXA 3TLBA 3K9QO 1IDOA 2IL1A 1B6SA 1NE7A 2CZGA 2QX6A 3DBHB 3EBLA 1MCZA 2P9QA 4LRXA 5AKLA 4ZYTA 2DMRA 5FBLB 4HB4A 1FFYA 3KR1A 1ECLA 4QDZA 2WQ7A 4R0VA 1CZRA 4ZD6A 3ERCA 4HWOA 4OFWA 5CLIA 3TLZA 2PUVA 3PJFA 1BHSA 1BDIA 3ANXA 4FGUA 4E1VA 4J0DA 4TKVA 3AHGA 3TNDA 4URZR 2AOUA 3RDPA 4XRRA 4U0JA 1IN6A 7AT1A 1HLGA 3DP7A 5A7GA 3RC9A 1NVAA 3LDFA 4ZN6A 3I12A 1I6MA 1Z3CA 1PNQA 1BU8A 5KYKA 2VCYA 3K70C 1T24A 4A15A 5DX0A 3GGSA 1DC5A 1TVKA 4NVRA 1H94A 1Y1LA 3ZX5A 3OJLA 1FSFA 4C0SA 2I9KA 1E60A 4LZNA 4X1YB 2AXPA 3U40A 4QDXA 3PV0A 1M1UA 5FAXA 2A5JA 2EKLA 2YMQA 1U2PA 2YW2A 5THXA 3G8AA 2Q49A 3RJMA 4B87A 1G59A 1QHHB 1JDZA 5F2KA 3C85A 2QM0A 3BEDA 1P39A 4BNZA 1TLLA 2IVFA 4WQMA 4LYHA 2W42A 3L7CA 1E1QD 3W6NA 2HH9A 2OHFA 4IY1A 1XD2A 3EFEA 4K9QA 5FA5A 3ZBPA 5C80A 2FZEA 4TMZA 1ISSA 3OTOB 1LH0A 1MLDA 2Q5FA 1L8OA 2C5GA 4K2AA 3N2GA 3RB8A 2QUHA 5E1MA 3TKAA 3UAYA 1EFVA 5HTOA 1XTVA 2BT4A 1ESCA 1H8EA 5TF4A 4EFMA 1A2QA 1DQYA 4QGBA 4N39A 5IBCA 4MYHA 3BRWA 3NAZA 2JBAA 2AOTB 3WJ7A 3WFIA 1LTKA 5FOSA 4M1TA 5FDFA 4QIHA 1JAHA 4YJ2A 1SU7A 1KEEA 3QKRA 3TPFA 3D3KA 5JLAA 2JHAA 3H18A 4V2IA 3KAJA 4MS3B 5EPOA 3T4UA 1JALA 4DCVA 2WWFA 4AC9A 5J4KA 5AI4A 4JBLA 3D7LA 1MD9A 4U7TB 4AWAA 2GLTA 3ZH2A 2OXTA 1EUZA 2ARKA 4JYAB 2GH1A 1NVEA 3U9SA 2KPOA 1SVLA 4E51A 1HEYA 1FFGA 1WUHS 4NHOA 1XZFA 4JJAA 4HEQA 5AJYA 3CRVA 1K6MA 2B1GA 2QWXA 1E4EA 3LC7O 3L4EA 3MOSA 3MS2A 4FZJA 3UMJA 2Q6IA 3GYGA 1E66A 4MRVA 2F2TA 5E38A 2WD7B 4MUJA 1DDOA 4UU1A 3S2IA 4DBLE 1GZSA 2YXPX 4F6CA 3MJDA 1M6VB 3BMQB 2P62A 2BI8A 2WIAA 4KV9A 3TH5A 3ZH9B 2X5OA 4GBED 4RH1A 4ETIA 1VKRA 1NBMD 4GQAA 1SXJC 2J4DA 3G2QA 1DUVG 4I50A 3V80A 1VYTA 3QEBZ 3HI4A 2GKSA 2JCSA 5HE9A 1AG9A 2ZE5A 5CEEA 3ICEA 1XLTA 4LOKA 1HTTA 4MKZA 3VR4D 3PCRB 4ZV7A 1WTCA 2NO0A 3F8TA 4FOTA 4TVBA 1SVIA 2C7GA 1C3EA 1IJKA 1BGXT 1QK5A 2HNKA 3GZNB 4JJGA 4V0KA 2J4CA 2QRZA 3WAKA 4IHJA 3W78A 3ESRA 1C2YA 2CDRA 2V59A 3F9RA 3KP1A 4RMHA 4D46A 4RXMA 4W5HA 1ZA1A 3FSGA 4PPQA 2WSMA 4LC9A 5C8XA 4B17A 1H2YA 3EODA 4HQRA 2F6RA 4B6QA 4Y2HA 2FMHA 2AKAB 2I6TA 2GTHA 3D7KA 4H7DA 4CUZA 4NYIQ 4C29A 4OK3A 2IFTA 4GR5A 1VLJA 5EMJA 2XAAA 4HAOA 1OXSC 1UKAA 3UYKA 1VMEA 2Q7XA 5EIWA 9GPBA 5J3JA 2R48A 5TQ0A 4N0QA 3EZNA 4GDFA 1AUQA 3BAZA 1A8SA 3E82A 5A4AA 2IUSA 4L2IB 4LTMA 4BX0A 3R77A 1B41A 4Y3UA 2PSHA 4IBOA 3KQSA 5IZCA 1E1KA 1R9JA 2ZPUA 3HR8A 2IYYA 1O4WA 4BE9A 1O6ZA 3K8ZA 5C1BA 1I3KA 2PK3A 1JDPA 5DM0A 5I9TA 2PGIA 2R8YA 4LDPA 3RC2A 4YCMA 3QKRB 2PANA 1XWFA 4ZU1X 1B0UA 3IVRA 1W25A 1TCCA 1ZHHA 4MWGA 1ODIA 2LDXA 4Q1FA 1JU9A 3GX1A 3T1YB 4TMYA 1F8GA 3FCCA 4YCJA 4MUNA 4PPYA 3K8YA 1U04A 2D4AA 3KXIA 3GQBA 2OY0A 1YB1A 2QP4A 3KLMX 3UJDA 2WJGA 1ADJA 5MGBA 2O59A 2CLFB 2WA2A 3U1BA 3K0AA 5JRDS 1UZMA 2CXNA 2ECPA 1T8RA 1YKFA 3JQCA 1HO3A 4G1MB 5G2OA 1M6VA 3BMQA 4C0WA 1AKTA 1EM6A 1QHHA 3WO0A 3NRJA 1X42A 5K3FB 4WACA 3PWKA 3W0LB 1R0WA 3R23A 1JHMA 3DC2A 2X0FA 1HWYA 1XQXA 3R6TA 3AJ8A 3HJGA 4NCXA 3KJGA 2ZBUA 2DWOA 4EECA 1TEZA 2HMAA 4H7KA 2ID9A 1GDHA 2A9FA 2VAXA 2VZ8A 3MXTA 4GXRA 1KDRA 3NM4A 1Z8DA 1RHRA 2DH5A 2RHOA 3LPAA 4UEKA 3UJ7A 2EIXA 4CPDA 5L3QA 4L22A 5FPHA 3AEZA 4QC2A 4RM3A 4WJKB 3UW3A 4CM6A 4GMGA 4Q7MB 2V3WA 1KFCB 1WF3A 2WW8A 1I6KA 4NFSA 5B1IA 1FK8A 1LPNA 5A5FA 1UM9A 1GHTA 1TMGE 3THRA 4ZCRA 4P5EA 4ND8B 4L4YA 2F1KA 1M5RA 2JJ8A 4PINA 2DGDA 1DZ3A 3O2JA 4DJDC 3D4OA 5LVAA 2VK1A 2YHBA 1P7WA 2Y1DA 4LY3A 1RKUA 3ZLBA 4CW7A 3VOBA 2Q62A 5MFZA 1R1DA 1JLHA 3PJEA 4NULA 3RRBA 3AW8A 3VR2D 3F4LA 4K86A 1X2BA 1NUUA 3E84A 3FJ1A 5EVCA 2B2CA 1MX9A 2VATA 1U9JA 4ZJZA 2A14A 4DZZA 3D6JA 4RVHA 2Z6QA 4AROA 4DXAA 4M83A 4HL6A 1THZA 2VNIA 1SCDA 3E4DA 2GK4A 4KVGA 1G1MA 1HQDA 5AVKA 4RDCA 3STHA 3UAZA 3LCCA 3WLAA 4D92A 2KW5A 3DE3X 3D43A 1PP4A 3KEFA 5EHNA 4GL4A 4UHCA 3PEWA 2IXAA 1QVAA 1SXQA 2RGNA 3DE5X 2LZ0A 2CXQA 5AK6A 4EYEA 2C31A 3IEMA 2QTBA 3CSUA 5EXSA 5HGJA 3QTTA 3ZKAA 4DDHA 1TRKA 3MGKA 5KU7A 5K4AA 3S81A 1TDJA 3CF4A 1RFGE 1QWSA 1Y1TA 4K40A 4M1WA 3EDMA 2WJ3A 4RH0A 1ULUA 4RPCA 3WQSB 1ZKMA 2TMDA 1T0UA 3EXIA 4RZHA 4Y2TA 2PMEA 5CAEA 2WWVD 2POCA 1JUDA 5A7HA 3L7JA 1GUYA 1XG5A 4CBVA 3IFSA 3FDZA 3WNDA 2JJ2A 2QN6A 1X7GA 2IY7A 3AHHA 3CUUA 1EXDA 3CXUA 1JHVA 1CUZA 3Q88A 5F9HA 2BEVB 2QMUA 2HPAA 3E18A 2JI6A 2H2GA 2NZYA 2PS1A 4IDBA 5TQVA 2COKA 4C7BA 4D96A 5AVVA 3GPLA 3B6ZA 1SCUA 1YB7A 5HKBA 5IVKA 2QLFA 4EHNA 1JIIA 2OZVA 2P1DA 1PJQA 1UBNA 1H9BA 2KLHA 3SZ3A 3MLBA 1YVPA 3LIPA 2LUOA 3OF3A 4EW1A 2HC9A 1RVV1 1WKVA 5JSZA 3E0QA 3VSCA 4E46A 2XUKA 3OP1A 3L05A 5KTTA 1ISFA 2ZJBA 4QSHA 4TM8A 1T9BA 4PEVA 2ZSHA 2O4UX 2BGMA 4P5PA 3CBGA 1IY8A 3DFIA 3MPOA 4Z86A 5AP9A 4W9MC 3A27A 1KF0A 1O95C 1QGUB 2ZJZA 3HCRA 3L6CA 3ZN2A 4ZYZA 721PA 2WIDA 3O2NA 1PL8A 2OBNA 1CQIA 3ISJA 3GJ4A 1HY3A 4NFLA 3KV3O 4FHEA 1Y3DE 1CZNA 4EGAA 1M2VA 3DFFA 4BB0A 4KPUA 4KIWA 4MMXB 4JU8A 1BMDA 2P0EA 1RAIA 1OOEA 4NDNE 5CIWA 2ANCA 4MV6A 3GRUA 5JYCA 3I9JA 4LRQA 4YJGA 4EB8A 3OY2A 1RQXA 3UIEA 4UCWA 1XMQB 3IV9A 2C7QA 1Y33E 5E7IA 3GMDA 1PR9A 2FP4B 2IDMA 3LNTA 2CLKB 1OLUA 4H27A 2H17A 4YALA 2Y3IA 1PCXA 1VHWA 1LPSA 4MJ7A 1MABA 3UKOA 4A1OA 2NO1A 5LJIA 3GNTA 5DW3A 4E09A 1C9DB 1FZQA 3IUJA 4G09A 4IILA 1JXOA 1Z8HA 5ETJA 3DEAA 5DTEA 2Y0DA 3SWWA 3THXA 1PHPA 4RBNA 4EQ6B 3ZJTA 2D5CA 4LZPA 3HBFA 3ZI0A 4FDMA 1RJWA 1SUEA 1KQOA 1B6RA 4LRSB 4JYBA 3ZHUA 4KG7A 3THYA 4KXXA 3TRIA 4I1RA 5BMOA 3N6RA 5BUZA 4L8WB 1VHQA 4FGSA 1NFQA 1W0JA 2C4UA 3KAKA 2VT3A 3GLIE 2VDWA 4XJXA 4OH7A 4BMZA 5L45A 2CMFA 1GZ7A 1MOSA 3NHYA 2VJMA 3WLLA 3IUSA 3JQBC 3A6ZA 4HVCA 1OWLA 2VXCA 3REOA 1ULBA 4DREA 2HLDA 3MWGA 2PR2A 4G5FA 4CMIB 4HZGA 3O3OB 4PSVA 1QOQB 3D59A 1YZNA 3QW2A 4G9GA 4QUIA 5B1HA 4B7UA 2C42A 5C4MA 4AN4A 2I2DA 4O4IA 4GM4A 4KRXA 3M6WA 1SOWA 4MRNA 3RBVA 2PLNA 1YQGA 2FPGB 3K09A 3M4NA 4H7JA 3WRVA 4EJMA 4FSHA 4IDGA 2YJ4A 3U3RA 1CR4A 2JW5A 1VYVA 2OORA 4KP7A 4C08A 4LAFA 5DRYA 3K6KA 3I6IA 1T10A 1RTKA 2AFHE 3H6HA 4BMPB 1FJHA 2WP8J 4JJFA 2NV2B 4JI0B 1C9MA 5JDCC 4X6UA 1QO9A 4K03A 2HFKA 4EHIA 4F5DA 2BFOA 3LL4A 1NP7A 1RWNA 2D2VA 4EHAA 3GLVA 1XIVA 4HNHA 2CLLB 4RJ2A 5IEJA 4J0KA 1AUPA 1Y4DE 1DXOA 2JFZA 2I4MA 4AJNA 4IMPA 1SNYA 1KERA 5AMXA 3WDLA 1N2OA 5DTMA 3HVJA 5ALKA 1P0PA 3A4LA 1HYQA 3T52A 4ENPA 3O2SB 4ZIRB 5TVKA 3F47A 2CXTA 2DUJA 4M9QA 5IASA 4PLTA 2MTBA 4KNWA 4ZOCA 5ENDA 4FINA 1NPDA 1XTTA 2PZKA 1RXIA 1GITA 2A9RA 3G79A 2R2AA 3PQ4A 3USZA 5K3FA 3WB1A 2G25A 1L7RA 2P2NA 1OYWA 1JSRA 4ZKDA 2H16A 2VIIA 4R2JA 4JGGA 3RTGA 3B53X 1UBFA 3NVKI 1UXGA 3C3MA 2O4CA 3K9HA 1PHRA 1DAFA 2M32A 3CLSD 3IOBA 1JHRA 3F97A 3PXBA 3QE0A 5B2ZA 3RFTA 1BQ4A 1O3YA 5KYUA 4RMJA 2QEQA 1IBRA 3TNJA 4EENA 3CUVA 3FHCB 5M34A 2ZT7A 1XCLA 3F96A 3ZGLA 4FDVA 4NH0A 2YWEA 5E3JA 4EYGA 4YMUA 5C32A 2NM0A 1S2NA 4F8EA 2VJKA 1GPUA 1X94A 4DARA 4DQUA 2O8BB 1KYVA 1PFGA 2GTPA 2EDCA 1H66A 1NFFA 2I7CA 5GPBA 3N2GB 4ALJA 2R7AA 2CMHA 3GROA 4R8RA 4QATA 4YAFA 3VGPA 3NFYA 1ZW6A 5CW1A 4FTWA 2ZRJA 1XWIA 3PUYA 4C0KA 1W19A 2P75A 3FIJA 2QK4A 3IS3A 4Z51A 4MEAA 4TQ9A 4H35A 2WB2A 3AC0A 3DTVA 4BXOB 4MUXA 4ZI5A 1S1CA 4XM0A 1JEYB 3N0TA 4BLUA 2BMFA 3LQKA 4BIMA 3W5CA 5ISMA 2HQRA 4UE2A 4BO6A 1TT5B 3QPDA 3KXPA 2NPIA 2R1ZA 3PXCX 1P72A 4KDCA 3G0HA 1PWHA 5BSGA 3R6GA 1RU3A 3NBFA 5JJLA 5K8LA 1O0SA 1UF9A 3QF7A 1QV6A 2GFHA 2L18A 1T6XA 2WPNA 1NXXA 2ECFA 3GFRA 1RD4A 4EUSA 4I6JA 4DL9A 4HNTA 2VDOB 2W2LA 2C4KA 4PC1A 5EKUA 3RYIA 3CKYA 4A6DA 5C8YF 3GDHA 4G4JA 4FDTA 3RIMA 1E7RA 1MJGM 1QQ7A 4AIRA 5I9IA 5D00A 2RBKA 3T9EA 1DX9A 2XQFA 2CVPA 1DEXA 1QVVA 2C5BA 3LVFO 1VJGA 2CLEB 1M8JA 1PX2A 1XEWX 3IDOA 4JC5A 3U49A 3AILA 1DBRA 2W2LD 5L3RA 4E2XA 1A27A 4J07A 5BVGB 4C05A 1PEAA 4POAA 1V9CA 3ZDYB 4M8IA 5CLFA 1YBHA 3BFPA 5C3MA 5EI5A 1ODFA 4IDOA 2CHUA 3QVKA 4I3GA 1RQ7A 1YC2A 2DM6A 1FP6A 1F9EA 1TVMA 1PV1A 2F3UA 2KJQA 2QD5A 2VXOA 2XGGA 3UCXA 3VYRB 4F3KA 4CG0A 2CUTA 3NJ4A 2B0JA 3UAWA 4QOIA 3NIGB 2FW0A 1QGED 2W2KA 4KYUA 5KQPA 2B8JA 2BSQA 3ANTA 3GVXA 2FW9A 3D2CA 3HS3A 4WCFB 4D74A 3HWX1 1X7ZB 3ND8A 4UM9B 3TSCA 2QNIA 4XR4A 1C7FA 1H2RS 1Y7LA 5IAJA 1R9GA 4DHEA 3C41J 1EGAA 3OCYA 2Y1KA 3FWYA 4KUHA 1KI8A 2XYVA 3MT8A 4X71A 3WTCA 4OBXA 1AMOA 4FYIA 1WCWA 3BGOS 1Q3TA 5DYIA 1EHCA 5HZMA 1JQAA 3OPXA 3CNEA 1CY8A 2WNSA 3DCNA 2ROQA 1XA0A 1VBFA 4BNXA 3N2NA 4QJ4A 4FFLA 3OQ6A 3R3SA 4ZAYA 1KZHA 5DYWA 3TCXB 1KQNA 3A4IA 2GI4A 3C7CB 1YR8A 4OHRA 2QJTA 2DPYA 3MZ0A 4P4SB 3CWZA 4MWCA 3ZDQA 3RRJA 4D25A 1PZXA 3T7AA 3W8FA 1I4DD 2DFVA 4B7CA 5AFSA 3FY4A 3M7IA 2XDWA 2AZTA 4YUXA 5IVHA 3GFOA 2CUNA 1N9ZA 1L5ZA 2AHOA 1T1IA 2ZRBA 1V3VA 3KOXA 4TVOA 1D1PA 2QG4A 1U9ZA 2CMKA 2E5LB 4RSRA 3PYMA 3TVTA 1XHEA 2WTXA 3HK2A 4FXPA 2RHCA 3QX8A 4UARA 4QU8A 4OK5A 2DCUA 3S5UA 4E21A 5K0ZA 4PQFA 5A0TA 3WWOA 4H4CA 3FFBA 4LE1A 3RVKA 5AOAA 4F4DA 4PVDA 4V0QA 1EP2B 1R8JA 3PXGA 1WE2A 1QPZA 1I9GA 4B3SB 5H81A 4BX2A 5BRJA 1BFDA 1RPTA 3WKAA 2QZJA 3AJEA 4UREA 3ZWPA 1T4GA 2LWIA 3L0YA 1KRWA 2MJLA 3DW1X 3TZ6A 3PDIB 4LOIA 4GZ5A 1O94A 3OEEA 4RXUA 2PDAA 4WUTA 5JZSA 1J07A 1DC3A 4BV2A 4JI8B 2JZOA 3EPRA 3E1KA 4FOOA 4YJDA 1FS4A 1XROA 1F2TB 2XYQA 3A4NA 5H3CA 2J0QA 2NZ2A 3GAZA 2QRQA 1MAVA 4HAXA 3K9NA 4UM8B 1UAYA 1WNFA 1U8ZA 3R4VA 1QHFA 4JELA 4WOBA 3RS5A 3QKUA 3ZVMA 2HDNB 2ZZMA 1WZEA 3S7ZA 3G8DA 2OCIA 3PGJA 3DULA 6CHYA 1E6EA 1GPJA 2IXBA 4TN1A 2WKWA 5JCXA 1F12A 1FTYA 1W88A 4JCCA 2P9EA 2NW6A 4IFBA 3TL2A 1H23A 3KQMA 1QIGA 3ESXA 1GRRA 1CWUA 4ASUA 3QMPA 3W5HA 3EZ2A 5K8IA 3E3NA 2NUTB 3RNLA 2L19A 2O50A 1NZJA 5B53A 2QAIA 2W37A 4DZRA 5K99A 4C7XA 3PRHA 4I1UA 3DCIA 4N5NA 4LJSA 2WP0A 1OWNA 4MW4A 4H7EA 4PGGA 3VO1A 1UDRA 2QDXA 3M3DA 2HB6A 1A8QA 1VMDA 2ZE7A 5D2CA 3W04A 4BZQA 3EULA 1UZAA 4ADSG 1WVMA 1XAIA 4E5SA 2JKZA 2RB4A 3A6PC 4FEYA 4FT2A 5CNIA 3L1JA 4IGKA 1UEJA 2O2CA 4DF3A 5GAJA 1GFZA 2D7CA 4KREA 4I8XA 3EYWA 4PE5B 4CT0A 5I9LA 1NVTA 1VKJA 1X1QA 1R0SA 1RWXA 2CF5A 3RC8A 4YP5A 2P4HX 3Q9NA 4UNQA 2JJ1D 5JEDA 1XGKA 3O84A 1U2TA 1P0CA 1CFZA 1ECGA 5JY6A 2COEA 2DBZA 2QMYA 4GQBA 2ZJYA 4JLWA 1ISHA 5B30A 4JENA 3L7NA 2JRCA 2R65A 4YR9A 2A35A 3ABSB 2V65A 3ET4A 2HCFA 4Q1VA 4RENA 2XMQA 3IO3A 4LBYA 5CH8A 4F2DA 2F3PA 2Y1EA 3VV3A 3TRDA 5F3RA 4DLRA 4B6SA 3G68A 3G2MA 4BO9A 4ZCMA 5CPBA 5F77A 2FR8C 5M5BA 3EQ9A 4L02A 1Z4MA 4DAEA 4JZKA 5JCZA 3GYBA 1QB7A 4KPYA 3IO5A 1UK9A 1N1MA 1X15A 2GBLC 1WCYA 2RH4A 3AJ9A 3M6LA 3WLSA 2R751 3SSNA 2GZ3A 4ID3A 2FZ4A 2ZI6A 4FGJA 3PE4A 4ZC1A 3EH1A 2GEKA 4FDLA 3ABIA 1KTVA 2WG1A 3I9MA 3KQOA 3NOOA 1A7KA 5FD8A 2GPTA 3TEMA 1ABEA 1LTHR 4II2A 1EH5A 1ACJA 3LLVA 3AJDA 3EG9B 3GA5A 2WJWA 3GIWA 3B7WA 4JWKA 2EWWA 4B47A 2YIVX 3B3JA 3CR8A 4D8YA 1N5DA 5EP4A 2HGZA 1NF9A 3GJ7A 4BO3A 3KU1A 4K26A 4YCDA 1E9BA 3VZDA 1LLUA 4G41A 4MQMA 3OJCA 1JHXA 4KOAA 5LQNA 1HZJA 3IHTA 3N8DA 4D4HA 3K9WA 4KQKA 3OQMA 1L4FA 1ECBA 1FNNA 4BWFB 3BE6A 3VPBA 4L6AA 4C4XA 2Q6OA 1NN0A 3FFTA 2RIPA 5G0UA 5KTOA 1S7CA 2ERYA 4X00A 2I2CA 1WZIA 4EITA 1ML3A 4CE6A 3EWSA 5AW2A 4DYHA 1FX0B 1OKKD 2FQWA 4B85A 3V4RA 4EHBA 4Q9AA 1SKYE 3V8PA 1NC1A 3ZLTA 3RAPR 4DEXA 3WBFA 2XOXA 4DMKA 2Y0BA 2DPXA 3KOWA 5CB8A 4LY6A 1OIWA 1CJSA 3R5KA 3GVCA 2PVSA 5D3QA 1ZIDA 1WAMA 1X19A 2NZXA 3JZDA 3CEHA 4PLGA 4FI3C 4YYZA 3QU7A 3LHIA 4OGGA 1UJNA 3UO8B 3VAAA 5I8PA 1GUFA 2P9FA 3GLKA 2I03A 3TDKA 1SBIA 2QT9A 4LSGA 1G41A 2CMGA 3UWOA 2NTJA 1ST3A 4BQOA 1E7MA 4ZU6X 4NECA 3FYTA 2D54A 2Z4RA 3QE9Y 3VR4A 2P69A 5ED0A 4OL9A 1CEQA 1PDOA 1MEJA 3VR6D 3DDCA 2MDTA 3FYHA 2EF1A 5B58C 3NEYA 1U0BB 3IIJA 3PJGA 3ZVNA 3EMBA 1E0JA 3HP1A 3KYDA 3NB0A 2AQKA 2UYCA 1D4OA 1HLDA 3UH1A 5ADWA 1H4TA 1ZNQO 4D57A 1E2BA 3CRMA 4DCSA 1CS0B 4TV9F 2H08A 5DPMA 2DB3A 4DSOA 4MUKA 2OV8A 4N5MA 3VC7A 1KORA 4X1OA 5EN4A 1IJEA 1JJ7A 1U7PA 2JAQA 4TMFA 3C1TA 1RNLA 5LQDA 1TJ4A 1X1DA 3A3PA 1CKEA 3L8GA 4DHWA 1Q7CA 1RC0A 2IA5A 3UHOA 2BHTA 4FHZA 5AW0A 1E1RD 5DK6A 4HH3C 1JPJA 4ZJPA 3AQIA 1R16A 2H4HA 4RIHA 2QRPA 4ENSA 1SB8A 3LX5A 1W47A 4AECA 1C80A 2YV1A 3W6ZA 5FTKA 4U9UA 1IIBA 3ME5A 2ABWA 4OJTA 2EKDA 4L0QA 3VNAA 4MI1A 3TE7A 4EI2A 3T7EA 1X1AA 4JOCA 1V1MA 2XZPA 3CH6A 3OFND 3GUUA 2BUCA 3F2IA 5JR3A 1OXUA 3LE8A 4B5LA 4DA9A 2C84A 4BLTA 3BS4A 3KEGA 4YJFA 2BTOA 2PH5A 2PZGA 5EKTA 3JWIA 1ZP6A 2CXSA 2G5CA 3C74A 2PGJA 3PFGA 4O5AA 1NW8A 3DF9A 1JQJC 3EGEA 2ATCA 5ILQA 1W35A 3EEOA 3IE0A 4LVOA 2W90A 1I7NA 3CZ9A 3UJHA 3PR2B 1TVEA 3ZQJA 4DLBA 4PM4A 2VJCA 1GFIA 1W2GA 4L9WA 4O4HF 4W5WA 3FNRA 2Y68A 2FZVA 4IOKA 4E13A 5JYDA 3CW2A 2FB9A 5HF6A 1A9TA 4BAUA 4LJKA 4XD2A 3NVMB 3AKEA 3IB6A 4F5ZA 1XE3A 5CA1F 3IXQA 2QI9C 1ISPA 5IH3A 1CQPA 4GOOD 3GLFB 1V8BA 4H59A 1BH6A 2X8BA 1FNCA 1WZCA 5AKYA 5B55A 1WLYA 3MB8A 1R0BA 3OQNA 3B82A 5T3YA 1ES9A 2PL1A 1I3OA 4QUHA 4P54A 5DGHA 3EF1A 2ISSD 3KPWA 2QX8A 2O3QA 3FKSD 5BNFA 1T9GS 3STWA 3UICA 1BCSA 1UWCA 3GJTA 1H5UA 1RE0A 2VDQB 3PUHA 1UAGA 3Q5GA 4NBKA 3REFA 3R0QA 1EI9A 4NMMA 3M83A 2XQVA 1PQWA 2VJLA 3B2NA 2BJHA 4YRFA 2I91A 2G0NA 3KJQA 1V8ZA 4Q5IA 3AKZA 5C18A 1FCJA 2WWXA 5LXTA 4B6OA 1T29A 4PYKA 4C3OB 4DBZA 4JL6A 1J2EA 1DELA 4ZYWA 1JG6A 4JJKA 4N8SA 1DIRA 2Z2IA 4WFQA 2E21A 2XKJE 3LXUX 4WKGA 2F9FA 4AX4A 2DRIA 4F5EA 4LFBB 3L43A 1WW8A 1D3AA 3OOWA 2XCUA 1BQEA 1R0RE 3KLBA 1Z37A 2PGDA 3QM1A 1JHQA 1ZCFA 4MV7A 2IF2A 4PZYA 4PIPA 5IJZA 5K6AA 3AU9A 1NUPA 3JU3A 4U3JA 2OYSA 1K06A 1RAAA 3RSQA 2HQSA 2YMMA 3FB1A 4KSCA 5KS2A 3LCRA 4HGRA 1A82A 2NT4A 4WOPA 3K9BA 1QAMA 2PM8A 4MCAA 3YASA 3MQ2A 1W94A 5CIYA 1GKIA 4ES6A 1CRQA 2XNHA 1SXJB 4W9NC 2ONKA 1U4OA 5TT0A 1QRTA 2A9KA 4RWEA 5B3JA 3MT0A 4I2NA 5JWRA 1N5IA 2PZ8A 2WWTA 4R7GA 1NUAA 4MYDA 1F2UB 3KSBC 2W2MA 4MGYR 1HFWA 1Z4JA 3JSXA 3UJ3X 4XWKA 2JH9A 4PWYA 4QASA 4EVRA 4BLPA 3GT7A 4YMWA 3VDRA 2XUQA 2MSWA 2QUAA 2XADA 1GLVA 3NX4A 4HXYA 4RLSA 4AXXA 2OE2A 3ZEIA 5AT1A 2ZIAA 3B9BA 3BWCA 1F51E 3I6ZA 4L74A 4YP9A 5GJBA 1NBOA 2FG6C 3WYNA 3IT2A 1SB9A 4G2NA 3RTAA 1I5EA 3KKQA 4O59O 2IC5A 1JF8A 3PQEA 1RHQA 2GWHA 1QHNA 2W6JA 4ANFA 2D00A 3LQFA 4GPD1 4WN9A 3ZK7A 2H2IA 4RORA 3SNHA 1BEZA 1JXQA 3GVHA 5CVCA 1Y4SA 3PGA1 3S68A 2RH5A 4BGIA 2JASA 1TD9A 4CIXA 5ARBA 5F7OA 1TKCA 5LDGA 1E9CA 2CFTA 4WFKA 4Y6OA 3RYFA 1CQJB 3SJUA 1HLPA 3TFOA 3L8EA 2OV1A 2XLCA 3NYWA 3EGWA 1SH7A 4BQRA 2GAAA 3GPCA 2QGZA 3RYFB 3CVWA 4ND6A 3K6SB 1FEZA 4K0KB 3KTAA 4XIJA 1IZYA 1I3LA 1BC5A 4B4OA 5H4HA 4ZCLA 3DWEX 5FYQA 3E9DA 1XALA 1UH5A 4EKYA 4JSRA 3FDIA 1Y7PA 1ANKA 2Y0CA 1SHLA 3DLCA 2JFPA 1JG4A 3G0IA 3KKNA 4XD7D 5DHSA 3O8CA 3AUYA 4NJMA 4UPDA 4R0NA 5KJEA 2ZTMA 4NEHB 1AQJA 1RXWA 4MYRA 2APJA 1Q1EA 1IPHA 2V45A 3F3MA 3O9ZA 4HH4A 5KVVA 2H65A 5LU9A 1SKAA 1V11A 3CGWA 4WD3A 3VNSA 1TZJA 4ZHSA 2CJWB 5LIRA 2GZDA 2R1TA 4UNSA 4CQLA 3DLTA 2FZLA 3NWOA 3QWBA 4XM2A 1VIMA 1FFCA 4ARSA 4V0MA 5JBQA 2BBSA 1CUJA 1ZOPA 4K87A 2X77A 2NU8A 3TG8A 4TX1A 1MPXA 5C8DA 1SC9A 1ZL2A 1VLLA 1VJ0A 1U8CB 2PKXA 2XYRA 2NUAB 4COOA 2WILA 4OAPA 5AKXA 1YULA 4QUBA 2JC3A 4QG3A 3FCXA 3I0NA 1EYZA 4BKUA 1EK0A 3CBQA 1O6GA 2EC5A 3CR7A 1MDFA 2H51A 5DBGA 2HCBA 4BNDA 4CMAA 3C45A 3G9TA 4MB2A 4JP8A 1NRXA 5ERYA 2V58A 3G9QA 1I7DA 1DC4A 4LN1A 1N2JA 4O2BF 5G1NA 1E3IA 1PFKA 3THOA 4D9GA 3C4JA 4A6EA 1XRMA 2JLVA 4P4GA 5FTNA 2HYDA 2J45A 1DAIA 2Q3BA 3MEQA 3E8MA 1QZZA 1G66A 2ZU6A 2ZUCA 2VPWA 5T4EA 3RO7A 3EOBI 1ZN8A 3UOWA 3P71T 1LB1B 3IQFA 4L3WA 3L82B 4ZO7A 1NBEA 1KPGA 3OTGA 1JQLB 4F46A 1LXCA 5CCXA 4OX9B 2JJMA 3IULA 4PC6A 5JAQA 2CN1A 3G88A 4DXDA 2G1JA 4MAMA 4DR4B 1P2SA 3VPDA 4RA6B 4ENQA 1JXAA 4KLZA 1HDGO 1L1QA 3D31A 2Q6LA 1M2KA 2FQYA 2Q41A 3T9AA 2AJDA 1TJ5A 3ZCRA 1E9VA 4GEGA 2JLWA 3OTWA 5DTJA 2F3QA 3UHJA 2OAGA 3VJLA 1ACMA 5H9VA 1EUYA 3U4MA 1B42A 2WAYA 1BMFD 3EEIA 3OLWA 4MLCA 3RSSA 4CEJB 4V3BA 2QXTA 5A6SB 3H4MA 1XZQA 4LOHA 1PZEA 3JZIA 3D8RA 3GQBB 4R3WA 3D1VA 1NONA 3NT5A 1M33A 1M7HA 4E6EA 2N47A 1V25A 2VDNB 1SY7A 1WUTA 1D0SA 4KOEC 1EVYA 4HADA 1EP9A 3WBJA 1UFOA 1KKMA 2JIBA 3FHLA 1G6HA 4BB6A 3LHKA 1QRDA 2JD1A 1DC6A 3LZ6A 4KO3S 2NTYC 2R4UA 1XVUA 3B12A 2CE2X 1SKQA 2MSLA 4D3YA 4X8HA 4PHHA 4XGQA 5C4IA 1VHLA 4CGZA 3MAGA 1RWVA 3BFVA 1KAMA 3D3JA 4DWJA 1N0WA 4RFLA 4K6GA 3FCUB 3P9CA 1T2CA 5JAIA 1I7SB 3SYMA 1AUOA 5A9SA 2Z6AA 5NULA 1VMAA 3WBKA 2WKPA 1P4GA 2X4IA 4DG9A 3PC6A 2BFDB 2HBYA 4JI5B 2BE7A 4J0EA 4X7RA 3BOSA 4IG4A 2NUAA 4KBGA 4Q16A 1XCJA 1NHGA 4MA0A 1DRJA 1WMEA 4QFBA 4YAWA 1BXZA 4YROA 4Z8YA 1ZGCA 3W90A 3I5XA 3NWJA 4LYGA 4C4TA 2CBGA 2PSEA 3AUJB 2O6LA 3F6PA 3AIKA 3LBYA 5BSEA 1P4HA 1K2VN 1QYCA 1VFNA 4JVNA 1TZCA 1VCHA 2RSLA 2A30A 2X5JO 4F92B 3T1HB 2JA1A 1XNGA 3MLAA 3OJ0A 4GMFA 1MOPA 4JJIA 2F1JA 3DYVA 1C9EA 1OHHD 1G3MA 1XQVA 2JIMA 2ZM6B 4FEEA 1WVIA 3MGBA 4A1FA 1BWSA 5C52B 1XKXA 1E1YA 5ICCA 1UJCA 4FFNA 5F7ZA 4KIUA 1CJCA 1T0BA 4LK2A 4JR2A 4RJJA 1GNLA 1SZPA 2OHOA 3SBEA 5BVHB 5C7LO 4B6JA 1O9GA 5BQ5A 4CM5A 1BWQA 1PJRA 3HCEA 4P84A 1R6XA 2NAFA 2YJ6A 4WV3A 5T4HA 4RHCA 3AR4A 4XDHA 4ZCPA 3LFHA 5K2OA 3AI1A 2FFHA 1MB9A 1KZGB 3OZEA 2M2IA 4EY6A 4J43A 2SNIE 3UUFA 4H1HA 4BDSA 3THYB 3FSGD 2C7OA 1XMSA 2X1LA 3E3AA 4E30A 4MIEA 4BZXA 1M1ZA 4MQFB 1NT2A 3ON5A 4MEJA 1PIWA 3IV6A 4QDTA 1Y5NA 5BN5A 4D4GA 1ZNWA 2CNWA 5CNKA 1CUHA 1SAYA 1BCRB 1JB9A 1ZI9A 2BM9A 5JG7A 1TTHA 3DAOA