2ZRDA

Msreca q196n adp form iv
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
330
structure length
322
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLREPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
total genus 91
structure length 322
sequence length 330
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrdA01
4RKFA 4R9UC 2DR3A 2WOOA 4CF7A 4DEXA 3NBFA 3WNCA 5KSPA 2AWNA 1VECA 1NY6A 1GRRA 2E1RA 2NG1A 3TNFA 3F0TA 1JPNA 3RS0A 1KO8A 3GLHE 2J41A 1GZSA 1GKUB 2DCUA 4W5HA 1XPOA 3V4FA 2VHJA 2REXB 4D0LB 4IOJA 3TVDA 1WMSA 2Z43A 2IXFA 3NTUA 2ZUCA 3OESA 2ZSFA 1EXMA 2IHYA 3OIUA 4IXNA 3EPJA 2UKDA 3A4LA 3ND8A 4P3YA 2VL7A 4M1MA 3ZQ6A 1KGDA 4IXMA 1XTIA 2XJ9A 4NKRA 5DGXA 2REOA 3A1VA 4KFUA 2QU8A 1R5BA 3MWLA 4AKHA 3RAPR 1KYIA 2Q21A 4C30A 1FQKA 3MCAA 2HXYA 2MMGA 1U0HC 5G41A 2V7QD 2ZS8A 1VIAA 2OE2A 3HYRA 4U00A 4Q4LA 3ONWA 3W3AA 3THXB 3IIJA 1T3HA 5HPYB 3VNVA 2XITA 1P2TA 1RC8A 3TSWA 4BLRA 4DLVA 2XTZA 2VHTA 1SGWA 1BYIA 1G8HA 3OE7A 1E1RA 2QBYB 2C03A 1ZP6A 2QRZA 4KHZA 5C4MA 4KBFA 4TMWA 4YLGA 5K8IA 1CJKC 3NBZC 1G64A 2JJ1A 2FMXA 1T91A 1YE8A 2FU5C 2YWEA 4JJZA 4LHXA 5JCZA 5KO2A 2QA5A 4ZDIA 5EE3A 2BOVA 4PANA 5FUVA 1XF9A 4R2IA 2MMCA 4TYPA 4TLCA 5CDFE 4NHOA 1KI4A 1N6PA 1N6IA 4DSOA 1P7CA 2WAXA 1XDBA 2ZI4A 3O8RA 1E0AA 4URYR 1S1CA 2KBFA 3X1DA 3TUZC 1JECA 1OIWA 1SVKA 4PC6A 3C5CA 4ZI2A 3BXZA 1I4LD 2WIAA 4EQ6A 3IEVA 4IRUB 3AVWA 3PG5A 1T6NA 3LBIA 2HCJB 5LDDC 2FFHA 1Z63A 4HLCA 4Q9LA 4PQYA 3QPVA 4I1OA 3IEUA 1VCIA 2WZQA 5EUQB 4PX9A 1M6NA 2F1RA 2FPLA 1I4DD 4GZLA 2BV3A 2GCOA 1GILA 1JI0A 3W8NA 2XB2A 1KI7A 1I2MA 2CBZA 1NRJB 2IYWA 4K8OA 2IYZA 3AVPA 2DFTA 5AJWA 2Q3MA 2K5UA 3CWQA 3AB3A 2GJ8A 1MABB 3BB1A 5HKKD 1LY1A 4JVNA 2JEOA 4HZIA 1VYUA 3K9GA 3PQCA 4RCZA 1QHNA 5FTKA 4GFDA 2YHSA 4DEYA 1ZU5A 2FA9A 3FB4A 1U94A 1RE0A 4LPKA 4BPBA 2DFNA 3A37A 2FZ4A 4YMTA 2ZI6A 3T34A 2RGAA 3A36A 1Z8FA 4OI1A 4JLKA 5KSZA 3THWA 2ODEA 1Z6XA 4LYJA 5JECA 2UVQA 4BFWA 1IXSB 2A5YB 1UM8A 2QI9C 5C2JB 3E5HA 4QHYA 4LC1A 3AH8A 1F2TA 4OBEA 1CP2A 1GFIA 3B60A 2CL0X 1Z2CA 2QQ0A 5HCIA 4NZYA 5BN5A 2HYDA 1S0UA 4E09A 4UNRA 2P2LA 3P20A 1LNZA 1XJ0A 3K09C 4FN5A 1CF4A 1OIVA 1PUIA 1KZGB 3PEYA 1U8YA 2ZYUX 3SJZA 3UXMA 3QXJA 4EFMA 3C41J 4GT1A 2G9NA 3VU9B 4EPTA 5TXGA 5JBQA 2Q0HA 1ZD1A 3EZ6A 4ASUA 1FTSA 3EC1A 5FFMA 2YNMA 3UWOA 4Q48A 4DLWA 1BKDR 4K46A 1JPJA 2KBEA 3ZZUA 2IW3A 2GRJA 1M2OB 2QT0A 2JLVA 2QY9A 1DO2A 3T5GA 2O8DA 5JJKA 3HR8A 4B3FX 2EWVA 2ZROA 2ZJ8A 3LRPA 4NYIR 4PXAA 1G7SA 3K09A 3RS7A 4RZ3A 3T1TA 5CDFA 4N1AA 3F5FA 4F4CA 1QHYA 1P2SA 2J0UB 5L3SB 2QGNA 2VTKA 4KVAA 4MKGA 4MGYR 3RC3A 2ATXA 2AD5A 1IN4A 1T0HB 1NLYA 3FDIA 4RFSA 1WXQA 1XD8A 5JWHA 2ZE6A 1EGAA 1MRNA 3VFDA 4PPNA 3DZDA 3WYGA 2H18A 4O2RA 2D2EA 5F2EA 4M1WA 2NZ8A 2GXSA 4O25A 4AK9A 4BFVA 1F3OA 1AN0A 2QN6A 2IX3A 4TT3D 3I62A 2C5LA 4NONA 4QG7A 1AA3A 3ZVMA 3ZZTA 4QOSA 1Z0DA 1OSNA 2G1JA 2OAP1 1Z29A 3B13B 5JCPA 2VA8A 2QAJA 2VHQA 4C0LA 4A0RA 1W0JD 3MRSA 4OKSA 2AHOA 1YR9A 2KSQA 2W6IA 1DARA 1XTJA 4MRRA 3I73A 2BCGY 2J9RA 4BLOA 4E22A 2N46A 1IN8A 1E9RA 1X1RA 4LBZA 3KKNA 4Q9JA 3AVTA 3RS2A 4KI0A 5E4FA 1ZVQA 2WSMA 3FYHA 4NCNA 2JATA 1G19A 2F43B 4TL9A 1G20E 4CEHB 2O8FA 5DE3A 4CT5A 1ZM4A 1WP9A 2QRNA 2KB0A 1XXHE 2ZEJA 3O47A 1PZNA 2XXAA 1QHIA 4G5QA 4TSFD 2BJWA 3VR6A 2OV2A 4Q4HB 1CLUA 3TH5A 3U3MA 2FOLA 4A2WA 4L4UA 3GJ3A 1U81A 3MMPA 1E98A 3MSXA 1OXTA 5KDDA 1H65A 3A1UA 3FVQA 1LS1A 1M8PA 2EQBA 2ZRIA 2P67A 1NKTA 4W9MC 3I61A 1VCMA 2XSZD 4V0KA 3U3OA 1DVRA 2GXQA 1QHHA 1N5IA 3I72A 4NPHA 1KSFX 2ZETA 3SU8A 2ZRNA 3ZGXA 4ZI3A 3TAHA 1YR7A 4G0NA 3K8YA 4UNNA 2WKRA 4XWAA 4M1KA 4W7SA 2GJKA 4BZXA 1GSIA 1P9RA 5CK5A 3ND9A 1DAKA 2I1QA 1GNPA 3CWZA 2O0HA 1DO0A 1AKEA 1F2UB 1X1SA 2RGGA 4GDFA 3EWAA 1G41A 1P75A 4JYCA 4HB2A 3CZPA 4FMDB 4JT2A 3BD9A 2J3EA 3NKVA 3Q8XB 4AD8A 4FINA 3BH0A 4D80A 5TV2A 1G7TA 1A82A 1RZ3A 3CPJB 4QHSA 4KLZA 3PJRA 3IBYA 3U4QB 3QQ5A 1WE2A 2W0MA 4UJ3A 1U0LA 4B2IA 3LWNA 4QXAA 2EFHB 4EJSC 2E9SA 2YC2C 1E0KA 2IC5A 3K0AB 4TN1A 3TSZA 5BWMA 2ORVA 1E2DA 4GMDA 1YR6A 3RS4A 4C0SA 1W5TA 1ZMXA 5E7JA 3FMFA 1KO7A 1TNDA 3O8CA 5FOUA 1GVNB 2OBLA 3TSOA 2XOKA 2DY1A 1ZNXA 3RS5A 3WBJA 4OK5A 3C5HA 4D81A 1S9HA 2CLDX 4B76A 1EX6A 4KXFB 1NJFA 2OO7A 2ZE8A 3CRVA 3H1TA 1XXHA 1TF2A 3OIYA 4YC7A 5LB2A 4Q1AA 4EJSA 1TTTA 4LJ8A 2WSSA 3D7MA 3R8CA 4NYJQ 4UXIA 4DLXA 4JIMA 1SZPA 3U44A 3CF6R 2ZM5A 3LFUA 2PT5A 3I32A 2AKAB 3M4YA 2GEUA 1XTSA 3LX5A 1W47A 3QVUA 4BLQA 1HUQA 2CK3A 3MWJA 4FCTA 2XNDD 2ZRFA 5BXQC 2Z4RA 3DKVA 3ZJYA 3I8XA 2RH5A 4PR0A 1UEIA 4RFVA 3CM0A 4DLUA 4PAMA 3HP1A 4MH0R 1P2UA 4FWTA 5EZ6B 4MKFA 1CRPA 4JL8A 4PO1A 2OM2A 3SOPA 1T0JB 2J0VA 2CHQA 2JLSA 3OEHA 3R9WA 2ZR9A 2G1KA 4B71A 1DAHA 1GITA 4J0QA 2VF8A 3GMTA 4C7OA 3CUEF 2DB3A 1NI3A 1WCV1 2SHKA 3FHOA 4Q21A 3ZVNA 4P33A 2B8TA 1KY2A 3A8TA 3SQXA 4DXAA 3VX3A 1IXZA 4PTLA 3QKUA 3RWOA 1BH2A 1G8FA 5KUTA 721PA 4QGGA 5HR5A 4QL3A 1N6HA 5C46F 4H1VA 1DELA 1ZNWA 1KK3A 2A5JA 2ZS7A 821PA 2V3CC 3CH5A 4N3NA 3VMFA 2JLRA 4JJKA 3TKLA 1IOZA 2FNAA 3FGNA 3NIBA 4IDQA 3L2OB 2Z6VA 3AVVA 3FE2A 5EXTA 3CPEA 3UANA 4TZ0A 4Y0VA 5KNBA 3B82A 2Q9AA 4TWZA 1OFUX 4UNPA 4KYIB 2BMJA 2VPPA 2GILA 2P6UA 3Q5DA 4C0JA 4H1UA 1KMHA 1ZNZA 2C95A 2OBNA 3N2IA 4GMXA 4ON9A 3R9XA 1H8HA 1KI6A 1NIPA 2QNRA 4XSGA 4V03A 4AG5A 2ZSEA 3AGPA 4F4JA 1X86B 1NBMD 4DJTA 1OKKA 4DB2A 4FW9A 4LYHA 3CH4B 3HU3A 5EP4A 1VKJA 4EQ6B 4Z51A 3K70C 2XAUA 2IS4A 3AQ4A 1L2TA 1Z6AA 1HT1E 4F4IA 2EFCB 1E1RD 3LXXA 3OE7D 4ZDJA 3SFZA 3CBQA 3P32A 1N6KA 1HEIA 1FTNA 2HF8A 1VPLA 2JJ1D 3T15A 2AK2A 1ZCAA 2CCKA 3K53A 3TQFA 2GCOB 4CEIA 3W5IA 4FCVA 4DCTA 1VDZA 2D7DA 1E69A 1NMXA 3T5DA 2ZRHA 2JLZA 1C4OA 6Q21A 3QF4B 2X8AA 4Q9KA 5AUOB 1DAFA 3BJIC 3JZMA 2EVWX 2IWRA 3RC8A 3KUCA 3SHWA 1LF0A 3EC2A 1OXSC 1GNQA 3LAWA 1CEEA 1X6VA 3P4YA 3BWDD 3ZS9A 5JJLA 5JSZA 1F2TB 3FFAA 4RSGA 5FUXA 1GUAA 1KSJA 4BFZA 5A5GA 5JMTA 1TQDA 1Q1ZA 3T12A 3EASA 4CYMA 1S2MA 2D2FA 4KSBA 3NWJA 1XPRA 4Q4AA 4A1FA 5JWRA 3WMGA 1ZJ6A 4NYMR 4QM6A 1KK0A 1G4UR 2JAQA 2RCNA 1UDXA 4II7A 1SQ5A 4RZUA 1E2MA 1D8TA 4LX0A 2PX0A 3EAQA 2QE7A 4FMCB 4D4MA 2GNOA 4IFEA 2AKYA 4TTPA 4DSTA 3GLGB 2QT1A 2B6HA 5TVKA 2NIPA 1J8MF 2FPMA 3LY5A 3MAAC 4GZMA 1Z0FA 4IDOA 5DHFA 1W4AA 2V6IA 5IT5A 3QXHA 1NL3A 4G3XA 2OCPA 2WKPA 4HAYA 2DHRA 2EU8A 2BEKA 1ZC3A 2C2HA 2HV8A 3QVVA 5C18A 4LDJA 4ZKDA 1AZSC 4RD3A 1C1YA 4RFSB 1DTSA 2B7CA 2IYUA 2ZJYA 5G40A 5UKDA 4EPYA 1YHNA 4XVUA 1E2IA 1L4UA 3EX7C 3PXGA 1SVIA 3VX4A 1NIJA 1KAGA 5HE8A 1KDRA 4QJ5A 1NMZA 1XD2B 2KE5A 4NDZA 2QP9X 4ZDWA 4ASUD 3GJ0A 2BJVA 2JJ8A 4BGDA 4DZZA 1NN5A 2BC9A 2ZAMA 2XZPA 1OLOA 1N0UA 2WWWA 1Z06A 4M1YA 2YOHA 3K0EA 5DLQC 3WP0A 3I92A 4MUAA 1RIFA 1P5ZB 3H0KA 1L8QA 2MSDB 4Q1DA 5SZIA 3PENA 1G7CA 1K5GA 1QZXA 2IXGA 2V8OA 1ESNA 2FFAA 2OCYC 1MO3A 4O3MA 2ERXA 3SNHA 4D4KA 1UBEA 4CDGA 3GLIE 1W7AA 3BFKA 4BECA 2BIFA 1J2JA 4IOKA 3PIRA 3KX2A 1QVRA 3HR7A 1HQCA 4PFSA 5HZHA 4C0QC 3KXLA 3BIFA 3RRYA 3KQHA 1AZTA 1M7BA 5FOTA 2XTMA 5L3VA 3LBNA 2LKCA 3HPQA 4P32A 4B6EA 4QRHA 1U9IC 1AGRA 5AUNB 4JLOA 2O8FB 1N5KA 3SJAA 2J46A 4KODA 4W5JA 3EW9A 4WOPA 1GL6A 1XEWX 3T1QA 4V0LA 3WRXC 2QAGA 4DDTA 1RRPA 5F3WB 1E1QA 3ZIAA 2XTNA 1SKYE 1CULC 1U90A 2JLYA 1HE8B 3AVQA 3U2QA 4CGZA 2W2TA 2RHDA 2W6ID 3PUZA 3BERA 3OEEA 4DCVA 1U9IA 1CRQA 2IXEA 4Q1FA 4HDOB 5GADl 3EPLA 2PT7A 3W6PA 4YQFA 5B64A 1QHHB 3L0OA 1S8FA 1XWIA 4LK2A 3B8HA 1ZD8A 1QG4A 3W6NA 4V02A 1VMAA 2ZSBA 2EFGA 4GOXA 4B33A 1NVVQ 1XMSA 4BFSA 5J4KA 1RW4A 5LD2C 1A2BA 1Q1BA 4Q9IA 4XWKA 3U6BA 4B2PA 3DZ8A 5H70A 2PEZA 3SZRA 2QMOA 3EPHA 1G5TA 3BS4A 1W0KA 1ZAKA 2TMKA 5KOYA 3NHAA 4TTRA 5JWOA 3RNLA 4AIIA 4B3BA 1OFIA 3U61B 1N5LA 1XZQA 4ZCMA 3QIAA 3GLFB 5G53C 1OE0A 4R2HA 5FTJA 5AUPB 3RRNA 4ZO4A 3ADBA 4JVLA 2J45A 4A8JA 2BBSA 2FGJA 3VR2A 2QL6A 1ETUA 5SZHB 4B3GA 4BQSA 2R6CA 1E6CA 2JLWA 1EESA 2QMHA 3KKOA 2OBMA 4M1SA 4TQUS 1GP2A 3SEAA 2CLSA 2NO1A 5KNCA 1E9AA 1OFTA 2XB4A 1JR3A 3SJBA 3U7HB 4DLYA 4M9ZA 1FNMA 4BASA 3A4NA 2OESA 4QHTA 5IRCD 3M1IA 1UAAA 1R8SA 1MKYA 4HLUC 4EKDA 3J81k 1XXHB 1W44A 1ZIPA 421PA 5EZ5A 3WYFA 1Q21A 4XTRA 2GK7A 3H84A 3PUVA 5J4VA 2FDCA 1OHHA 1OIXA 3MUFA 4RZXA 3U44B 4DCNA 1E2LA 3B1YA 3DHWC 3CF0A 4ZCLA 3I4LA 3CR8A 5EP3A 3IQWA 4I99A 2WMOB 2RGXA 1DAEA 5E3HA 4ESHA 2P5SA 3X2SA 3WXMA 2GEVA 5EE1A 4HLUA 4A0FA 3QPUA 5DI9A 4LJ5A 1JALA 4FD2A 2VSOA 3A4MA 4TYYA 2J7PA 2BEJA 5FL7A 4AG6A 1U99A 2XOKD 5CIQA 1QHGA 1W4CA 4DSNA 4LHZA 3S1AA 1ZBDA 2CVHA 5H68A 3AF1A 2WSSD 4YDHB 1MO5A 1KO1A 3B1XA 1HURA 3QPWA 2CHVA 3ZVLA 4KFSA 4A15A 2CVFA 3ZS8A 4IFBA 1NN3A 2WWFA 2ZQ5A 3KFXA 5E7IA 2XX3A 3QNUA 3M6AA 1KKMA 3TK1A 2BDTA 4Z1MA 1P9NA 2RGEA 2CJWB 4KLNA 3U6KA 1NVXQ 1J90A 4P4TA 4AYTA 2CK3D 2QZ4A 5JS7A 2Q3FA 4K81B 4B3CA 5DSZA 2ZUBA 5KDOA 1B0UA 3QBTA 4C3ZA 5JS8A 121PA 2BCJQ 2VP0A 2QPOA 4HI0E 3EZFA 4B44A 1KOFA 1T9HA 1W48A 2OFXA 4JBWA 3P1JA 3CRRA 3GLHA 1VG8A 3K0FA 2QENA 4JBXA 4TL8A 3OEHD 5DIFA 1RRGA 4JKYA 2VBCA 1E9CA 3FKSA 4D0NA 3OIWA 4MYHA 4QC2A 4EPRA 3PUWA 1ZRHA 3CKLA 2JASA 1KMHB 3ICEA 1NVWQ 1T3LA 1GIAA 1N6RA 1NSTA 1TL7C 1NMYA 1ZW6A 4KV9A 5DO9A 3B9PA 4ZCIA 3UG7A 1W46A 3HPRA 1XU4A 3LLMA 2CEAA 1JEDA 4BRUA 4HB3A 2HF9A 4LI0A 5FTNA 5L3QA 1V5WA 2YINC 5FOWA 3U7FB 3T61A 3NEJA 2WM9B 1KIMA 2V4ZA 5E95A 2WOJA 2AWOA 4PPFA 2H5EA 4EPXA 4O0MA 3IPXA 2YWGA 4UKDA 3I5YA 1T8UA 5CJ2A 4L9WA 4KFTA 5J40A 1XNJA 3A6PC 4CEIB 1YU9A 2FWRA 2L0XA 2NPIA 2R2AA 2OG2A 3RABA 1MH1A 4A2PA 1ZUNB 1NN1A 2PJRA 2VP9A 1AM4D 2GKSA 5GJBA 3QEOA 1J70A 3DM5A 4ITRC 2QMEA 3R7WB 3NHBA 3SDZA 1BIFA 3IKJA 2EYQA 4NYIQ 1ELOA 1H8HD 3QKSB 4D2IA 4FI3C 4IJMA 3AVYA 3DMDA 3NH6A 4OQXA 5JI3E 3LA6A 1HTWA 1OKKD 3NVAA 1NN0A 1IAQA 3SR0A 3RYTC 4LGMA 2OCAA 4OQLA 4LJ7A 4RKEA 4YONB 3AF4A 5JSZB 1R7RA 3SHFA 3AVOA 3PR1A 1HV8A 3I3SR 4UNSA 1IN7A 2ZSAA 4HAVA 1JB1A 4C2TA 2WV9A 3EIHA 3CX8A 4DVGA 3WYAA 1P9WA 4XJXA 4CEJB 2IUSA 3REFA 4F93B 4NL4H 1VHTA 1CR1A 3DOFA 5K8LA 4OHYA 4TTQA 3TVTA 1N5JA 4EFLA 4A6XA 2ZIAA 4GPTA 2NO7A 1MOZA 1MR3F 1P2VA 4RCYA 4MDEA 1MV5A 3SI7A 4ZV4A 1GWNA 3GJ4A 1Q3HA 3A1TA 4FCWA 2W6JA 4JMPA 3C15C 2WIBA 2GAOA 1Q57A 3PCRB 4UXHA 3K70D 4R98A 1PV4A 1N25A 4GI7A 3ADDA 4UXJA 4PHGA 4XOIA 4WVFA 2B7BA 3NEYA 1RFLA 3CNOA 2CL6X 1PUJA 2IBMA 4HEJA 2ANCA 4P0TA 3KQUA 5FOXA 2BKEA 2MSEB 2DWQA 2JJ2A 3VQTA 2PLFA 2VLIA 3VAAA 1FQJA 2DWPA 2CCJA 3QEJA 1Y3AA 4M0LA 4DSUA 4P4SB 3TW4A 2GETA 5EXSA 1JAHA 3TAUA 1S3SA 3OAAA 2OZEA 3T1OA 5FBWB 3THOA 1FX0B 1ZD9A 4PSVA 1XCGB 2Q9CA 1E4YA 3F8TA 3Q72A 2BVNA 2QE7D 2IS1A 1QHSA 2B8WA 2OXRA 1LB1B 2IYVA 3TJZA 4OI0A 2YYZA 4C0BA 4YMVA 1OJLA 2FFBA 2CE2X 3UKDA 3DKPA 3TBKA 3B1VA 1YZGA 1OXUA 1LW7A 5DHAA 3FHTA 1G3UA 1M74A 2G0NA 2FFQA 5AJXA 1I2DA 1XTRA 3G0HA 3CF2A 2ZJ5A 1DAGA 3BC1A 2ZR0A 1H8EA 5B58C 2ZRLA 1ZU4A 2KI5A 3LDAA 5D3MB 4QM7A 2EW1A 3GFPA 5J47A 1WB9A 4UNQA 5JEDA 3LV8A 2OSBA 3KJIA 1R4AA 4E07A 2ZR7A 3SYNA 1CR2A 1SVWA 5LB4A 1MT0A 4TMKA 2F7SA 1QRAA 2PEYA 1RRCA 1Q22A 2OXCA 1R2QA 4DUGA 1VTKA 3QY0A 4OHZA 2RHMA 1Q0UA 3QBVA 5J4HA 3AF3A 3EARA 2ZITA 3K0SA 2QAGB 3AF0A 4NTZA 5H8WA 4A9AA 1FP7A 1RPZA 1N3BA 1CXZA 2NZJA 1Z6TA 3CIOA 2AXNA 2ZJ2A 2ZJBA 2P3SA 4Q7KA 4M1OA 2IYQA 3ECCA 4PZLA 1II8B 3MGCA 3BORA 5FTMA 4TLDA 2XNSA 1EFRA 4C4PA 5AR1A 4EUNA 4CIDA 2R44A 1XJCA 4DWJA 1F5NA 4KU4A 2ZAOA 3AGQA 4TLBA 5AWFC 2O8CA 2A5GA 1A1VA 2R6AA 3FPAA 4FMBB 4JVMA 4XD7A 5G3ZA 3HDTA 4MITA 3DMNA 1KO4A 5F98A 4MRSA 4N0EA 1CKEA 3L43A 2DBYA 4RZ2A 1E9FA 1UDWA 2ZRKA 4X8OA 5EQTA 4KFRA 221PA 2FH5B 4DC9A 1E1QD 2NGRA 3LD9A 3OZXA 5AJVB 4A92A 2YV5A 3ZIAD 4Q66C 3K1JA 4LHYA 4DB4A 2Q6TA 5SZJA 3RLFA 2CLCX 2C9CA 1S4QA 2C9YA 4Z8XA 4CVNA 4S2EA 4TL6A 2RMKA 3OEED 2FV8A 5HCNA 3KKMA 4CW7A 2W58A 1GRQA 2BBTA 1F60A 1KTVA 1XD9A 1P4SA 4D0GA 3L8YA 1DG1G 2V7QA 2ZE5A 4ARZA 3CZQA 4A8JB 3GJ5A 3KXIA 2A5DA 3UG6A 1TAGA 1Q1EA 3W3ZB 4BZQA 4I1SA 5KDLA 1OB5A 4L9SA 5DN6A 1HE1C 2RGBA 3B1ZA 3KKPA 5TARA 2H17A 4HAXA 1JAIA 2QMUA 2B21A 3QG1A 1E2NA 1UKVY 2PJZA 2QTFA 1W0KD 2JA1A 1R10A 1NLFA 4MRNA 2GJSA 2GXAA 1D9ZA 3B2EA 2QSYA 3AM1A 1IHUA 1R0ZA 4QGAA 3EA0A 2ZRBA 1NG1A 4Q1CA 1COWD 1SKYB 2FSGA 1II9A 3FTQA 2ATVA 3G5UA 3X1WA 3GJXC 3IUYA 4Q1BA 4WA7A 1SXJE 3VTKA 2ZRPA 3KUDA 3THXA 3EIEA 2C78A 4MUBA 3QENA 4PC7A 2FSFA 1TUIA 1IN5A 4GP6A 4G5SA 1HQYE 1N0WA 3RSOA 3R8FA 3GEEA 2QBYA 4B47A 4GOKA 2YVUA 3RHFA 1CTQA 2H92A 2R6FA 1NY5A 1JR3D 3AKDA 1KSGA 3NH9A 2EYUA 5FTLA 1JBKA 2G83A 2WWIA 3P26A 4ESVA 1G16A 1OXXK 3UATA 1G17A 4I81A 1AS3A 1W2GA 2C8VA 2ZS9A 4LYFA 4NU0A 3RANA 3ZD7A 2C99A 2NTYC 1OHHD 2BMDA 4HAWA 3MJRA 1WBDA 4BRWA 4LCBA 2H1LA 4QNMA 4XVQA 4GRAA 3C16C 4MGKR 4Q7JB 3BAFA 3IIKA 1E9EA 2OLKA 4LRWA 3HYTA 4LJ6A 4Q5IA 1E3MA 2GJ9A 3MWYW 1IONA 1D2EA 1KDTA 2ERYA 3QI2A 5FOSA 4R71A 3CW2A 2H8KA 4FMDF 4TQ9A 2Z5FA 2J7PD 4U5XA 1KAOA 5FL7D 4LZZA 2ZJAA 5DISB 2ZREA 4B48A 3W8RA 4Q01A 1UKZA 1MO6A 3VR5A 3O8DA 1JQLB 2QUZA 1NNEA 1A5TA 1SXJC 1DOAA 2P6NA 3CO5A 3GLHB 2J59A 3N5CA 4KVGA 4WZ6A 1G3RA 2J7KA 2IUTA 4KJZA 2GHIA 4LHVA 4D6PA 1Z28A 3B1WA 5P21A 4PPQA 4Q02A 4DIEA 1TU3A 1GOTA 4ACAA 3UK6A 1DPFA 2O8BA 2F3RA 3NC1C 3LLUA 4QBIA 2GZHA 2VEDA 4Z1MD 4RD6A 8OHMA 3AP2A 1US8A 1UKEA 2A2ZA 2RGDA 3ZDQA 4TMZA 2HJGA 1M34E 5L8VA 1P73A 1SXJA 1KDOA 2YWHA 3BFVA 1E2GA 3LH5A 5L3QB 3THWB 2ASEA 1PVOA 1XFAA 3U5ZB 5FR2A 5FBVB 1VYTA 4C0KA 3QKTA 2LCFA 2IA5A 4YDSA 2PMKA 1LTQA 1XB2A 4NYMQ 4F91B 1B23P 1EFUA 1N6NA 1KKLA 3UMFA 5HZKA 3VU9A 1HA3A 4B2LA 1OW3B 2QTHA 2ZI5A 3MJHA 5ANRB 1ZM7A 1CJVC 3FKSD 1KZ7B 2AR7A 3TR5A 2OFOA 4YMWA 4TMXA 1ZIOA 3WHKA 2HYIC 1X8KA 4V0OA 4DDWA 4OYHA 1FOEB 3QJYA 3V00A 2J0UA 5L3SA 1CU1A 2O8DB 4LY6A 4URUR 2V1XA 2VH5R 5FPYA 4LBYA 4LYAA 1ZM9A 1KNXA 1TEXA 1E99A 1NG9A 2CNWA 2A30A 4PAOA 2BWJA 2ZRJA 1ANKA 2WJGA 1QHXA 2X2FA 4F38A 3L82B 3GFTA 4KSCA 3H2YA 3L8ZA 1E2PA 5JEEA 1P61B 2UZ3A 5AK0A 3KFVA 5E7MA 4AKEA 4X8MA 2NQ2C 3KQNA 2VHUA 3OFNA 3EA5A 3JVUA 4HSEA 2V6JA 3A1WA 4Q1EA 1OF1A 2NO0A 1JJ7A 3B78A 3FKQA 3H4MA 3UPUA 3MG9A 4B35A 5AJYA 4D4JA 4JZKA 5IHPA 4HLDA 2W0SA 2Z83A 1K8RA 1M1YE 1YJ5A 4OHXA 2DPXA 3FWYA 3SC3A 5AJZA 3RRZA 2RB4A 4WW0A 1WQ1R 3T35A 2ZI7A 2IT1A 2JLUA 2QP3A 2IHBA 4IW3B 5CLQA 2HUPA 1E2KA 4LJ9A 4Q4JA 4WXPA 4RD1A 1D2MA 1TF7A 2ODBA 4BEBA 2MSCB 1G291 2VSFA 3AKYA 3B6EA 3LVQE 2QP4A 3IDQA 3REGA 4PPGA 3BH7A 2QQEA 5SZKB 2FSIA 2F1HA 2W6JD 3WNDA 3LO5A 4Z54A 4QNRA 1J99A 1AKYA 1UADA 2YOFA 2ONJA 2IYRA 2ZRGA 1D5CA 2I3BA 2XXAB 1AQUA 1IY1A 1TUEA 2EFDB 5FI1B 4M53A 1VG9B 2O8EA 3C8UA 1SKQA 1UFQA 2BM0A 5TMPA 4C9BA 4PQFA 3LQRA 5KHOC 4EPWA 4NCIA 4B6FA 3SBDA 4PZZA 3FMPB 2JJ2D 4WIAA 4KYUA 4L5BA 3T1VA 1IJFA 5FBQB 3EWSA 4JLVA 4HYYA 4KAXA 4LC0A 3WP1B 3PEWA 1SULA 2VP4A 4DDVA 4GNKA 4WZBE 4XH9B 3F3YA 1OH8A 1ZNYA 3OAAD 3PFIA 2FGKA 3PUXA 3RSLA 1F2UA 4JBYA 4LBVA 1XJQA 2J1LA 4G01B 521PA 4CRWB 3VR1A 1XCPA 1E0JA 2BKUA 3AUYA 5C4GB 4QBGB 1N0VC 2G6BA 4XWOA 2RAPA 4BLTA 5EE9A 4DLRA 1LF5A 4OQFA 4A6PA 3KQLA 4F92B 1ONBA 1NBME 2KJQA 1KJZA 4US1R 3PITA 2XGJA 1SHZA 3N70A 2R6DA 5IDVA 1UF9A 3U4QA 2QPAA 3ASYA 4BFTA 3BE4A 3GJ6A 1FNNA 4LV5B 2CHGA 3K0AA 1Z0AA 2OT3B 3D31A 3EZ9A 5CM9C 4RD4A 2QTVB 2C04A 3BH6A 2ZANA 1YR8A 3L0SA 4OJQA 4URZR 1G4AE 4OI4A 2G3YA 1YRBA 3U3KA 5B2ZA 4OI2A 2VP6A 3V9PA 3ZH9B 1O87A 3GLIA 2GTPA 1XEXA 2X77A 5EP1A 1S1MA 4M1TA 1VYVA 2D06A 4HB0A 3DL0A 3FOZA 3L0IB 3CX7A 4B43A 4DUGD 2EFEB 2WPDA 1KK2A 4TMTA 4DLSA 5CB8A 4JL5A 2GVDC 3VHLB 1A7JA 1SVSA 2ECKA 2JIZA 2D74A 1BYUA 1QG2A 1IQPA 2R6GA 4A36A 1S9DA 3CR7A 4EJSB 2IYYA 4TYQA 1GL7A 3IHWA 3ZVRA 1FW6A 4MQBA 3DDCA 1ZC4A 2FEMA 3AV0B 1BOFA 1EFRD 1EFTA 3DOEA 4LJAA 3EXAA 4Q9HA 1XRJA 2GZDA 1K6MA 3NXSA 1W49A 1QDEA 2VQSA 3QKRA 4ARZB 2PZEA 4BFYA 4PQRA 4IKEA 1VIYA 2CXXA 4M2LA 2AFHE 3KTAA 1DAMA 3QSYA 1VCNA 2ZRMA 2B92A 4JLDA 5A4JA 3LBHA 2PCJA 4XD7D 3P4XA 2JLXA 2ZUDA 4G5OA 4B32A 3AP3A 1U2RA 1PLKA 2ZU6A 1NSFA 3DPUA 4G1UC 4JS0A 3HWSA 1L7VC 2PMDA 4URWR 1CJMA 3P27A 5ELXA 3AF2A 3LNCA 1R6BX 1JR6A 3BRWD 2PLRA 2P0EA 2P65A 3I1FA 1Z6YA 4TYNA 1E79A 1G8YA 1HY3A 2WICA 2JGNA 1LV7A 3W34A 4MDFA 3GQBA 2ZU0C 4RD0A 3VHXA 2J0SA 5DI3A 4Q7LA 621PA 1Z0JA 2OHFA 1G3IA 2ZJZA 1NBMA 4C0AC 2V1UA 4E03A 3LVRE 2WKQA 5FPSA 1WF3A 4C7OB 1RYHA 4OK6A 4DIDA 2QM8A 4Y0AA 3NG1A 5FPHA 2ZRDA 1YZKA 2IYLD 4MKIA 3IPYA 2V54A 5EJEA 3RRMA 2FSHA 2JDIA 2G77B 2NO9A 5DN6D 5F9FA 3B7GA 1IM2A 3OHMA 2QM7A 1R5NA 3ADKA 3QUSA 1W36C 2RGNC 3C14C 2Q9BA 1T3SA 5FUYA 1NLZA 1GDDA 2X19A 1YZNA 1A2KC 3CLVA 4FWIB 3TMKA 4AY2A 5A0FA 3ZYCA 4A0HA 3K9NA 3QXCA 2ZTSA 4H9GA 1TX4B 1U8AA 1ODFA 2AN9A 4ILEA 3BBPA 1FUKA 4JSYA 2WVJA 4MKHA 3GLGE 1K5DA 1CR4A 4PO9A 5G3YA 4G5RA 1M7HA 1T4GA 1W1WA 2AK3A 3FFBA 1MRSA 3AVXA 1TMKA 1JEEA 4L15A 5FH9A 1Q20A 3HU1A 4ZIRA 5F9HA 2RGNA 5CJPA 1G18A 3CONA 1KI6B 4I1VA 4AWXA 1KDPA 5IK2A 2ZYWX 3KJEA 1J7KA 2W00A 3WMEA 3AP1A 4BE7B 1W5SA 3R9IA 3KL4A 1P3JA 1X3SA 1FZQA 1Y63A 3AKCA 1Z5ZA 4NP6A 1KJWA 1E2QA 4PC3A 4JLPA 1GKIA 4Q19A 3OIVA 3B5JA 1TPZA 4MYCA 5CB6A 1OYWA 3NDPA 5TDHA 1KI3A 1EWQA 4RJLA 1G1MA 2E87A 3MD0A 4QGFA 1PLLA 4V0NA 4EIWA 4NCHA 2ZE7A 5EE0A 4A82A 3QF4A 2I4IA 3IGFA 2ONKA 5GVRA 4EDHA 4DT1A 2O8BB 2XZOA 1EX7A 1X8JA 2GA8A 4E5UA 5BYJA 4BZPA 2QROA 1XPUA 4D25A 1R0WA 3K70B 4TZ6A 1US8B 2DYKA 4B74A 4HDCA 4PHHA 4BFXA 3GPLA 2WMNB 1AGPA 3CX6A 1HYQA 2XEXA 3KDSE 1YZTA 5JRJA 2CDNA 2WJJA 3V4RA 1SXJB 2HT6A 3EPKA 4QBFA 1FMJA 3TR0A 1OH5A 3ASZA 1RJ9A 1G9XA 2D3WA 2REBA 1BMFA 2DWOA 5FL3A 1TEVA 1AA9A 4C2UA 1G3QA 1LFDB 1TQ4A 3Q7QA 5J4YA 1XCMA 5CIWA 3U60B 3OF5A 1O3YA 1Q1QA 1R0YA 3DEFA 1QVAA 2ANBA 1NKSA 4M4SA 4Q4AB 4AYXA 1CR0A 4MRVA 5GJCA 4ABYA 5GJWC 2XJ4A 1YRAA 4JYBA 1IY0A 4IVPA 4DHEA 4TLEA 3GLGA 2ZJOA 1NVUQ 2PL3A 4AC9A 4WAUA 1SVMA 4YXWA 1R5OA 3TUJC 5B57C 1T5IA 1DG3A 2AL7A 3E1SA 3GEHA 2BMEA 4POAA 4FIDA 2GXUA 4MYTA 1I4TD 5JRZA 2OILA 3UMSA 1FUUA 1SXJD 1AS0A 4Q03A 2ZVPX 1G8PA 1RRFA 2PH1A 3GJ7A 1G7RA 2GBLC 4Q00A 2YZ2A 3WY9A 1G3MA 4DBLC 1A4RA 1XD2A 5FPTA 3KJGA 2IUUA 5FR1A 3C4JA 2OLJA 4BFUA 1ZYUA 2FPKA 3E2IA 3SN6A 1YKSA 3ADCA 4Q7MB 4PC2A 3NBXX 4I4LA 2J0QA 1P62B 2GBLA 2VHCA 2FF7A 5BQ5A 1EFCA 1VG1A 2A7QA 1PLJA 3GLFE 2GDJA 3WHLA 2BMFA 2CL7X 2G0TA 4UJ5A 2R8RA 2IYSA 3THYA 4DCSA 1GM5A 1AIPA 2PCLA 3TUIC 4OQNA 4Q18A 2WWXA 4GL2A 4QJ3A 2WTUA 1IXRC 2X1VA 3K0CC 4B34A 1D9XA 2CNWD 3ZLJA 3KXKA 4ZKEA 4I1UA 1Z47A 1JXOA 1KI1A 1VG0B 2J87A 5GJVC 3BK7A 4US0R 4PO8A 4Q4JB 1D2NA 2FZLA 4U02A 4HUQA 1EG7A 1U98A 1UPTA 4R7ZA 3TIFA 4AKGA 4RD2A 2GESA 5B30A 1XX6A 3IO3A 4JLNA 2FJUA 4QFMA 3Q7PA 4LPSA 5TB5A 1TQ6A 1OH6A 3U7EB 2HLDA 3OFND 5L3RA 3Q9LA 5KSYA 3PUYA 1G5RA 1KNQA 1Z6GA 2F6RA 3K0CA 1FL9A 3SBEA 3BFXA 1NP6A 2A78A 5HTKA 3IILA 3ZZ0A 2YKGA 1D6JA 2ODNA 1J8YF 2IF2A 2NMVA 1E4VA 1KI8A 2JCSA 5DH9A 3PEUA 3VKHA 1EWRA 2ZXUA 4ERNA 5JZVA 4GSYA 2O0JA 1KK1A 1UJ2A 2GK6A 2O8EB 5C1BA 4EPVA 3K9HA 4PSAA 2AFIE 4LSGA 2X2EA 1E9SA 2D7CA 4MGIR 2Y8EA 4MGZR 3MWKA 1T8TA 2P5TB 1WDTA 1GTVA 2WJVA 3GEIA 3JZAA 3SYKA 2GJAA 1HH4A 3QXSA 4DRZA 4BUJA 4HB4A 1X8LA 1E2HA 2P6RA 2WJHA 5DYIA 1CBUA 2H16A 4HAZA 3SE0A 2G88A 5FUWA 5KTYA 1Z3IX 1E2JA 1G6HA 3B9QA 4UQOA 2ZI9A 3U3JA 4JLAA 2VP2A 4DLZA 1PJRA 2BBOA 2CE7A 2HCBA 4FXPA 4ZPXA 5J5CA 4JLJA 2WWHA 3SQWA 3D8BA 3PV0A 4QJ4A 5JJIA 3GLFA 1LS6A 4HZUA 2R65A 1CS4C 4QKQA 2FN4A 5LBIA 2WHXA 1XTQA 1YQTA 3CRMA 1II0A 4GP7A 4DLTA 1ZUHA 1IN6A 1FMLA 4M22A 2D4HA 2OUKA 2PZFA 4OHVA 1P6XA 4RVCA 4DDUA 2AD1A 5LD2B 1E32A 2GZAA 4HATA 4OL0A 5BYKA 1OXVA 3GLIB 1WBBA 1ZUIA 1XEXB 2HJVA 2WWGA 1IJEA 1DBSA 2LWIA 4Z8YA 2DFLA 4TQAA 1XMVA 3RS3A 3ICQB 3IBGA 5K8UA 2F1JA 3ZQJA 5IF9A 3I5XA 2ZRAA 1G5PA 1OT3A 4NMMA 2O0KA 4N0DA 1W4BA 3MFYA 1RKBA 2ZYTX 2WWYA 4JVSB 4MRPA 4AYWA 4P31A 2V55B 3RDPA 2R62A 1WRBA 1CIPA 2RGCA 1ZM2A 3A1SA 3N2EA 5FBRB 5KYKA 4NYJR 5H1YA 4AURA 5JLJA 2PX3A 3UMRA 1KJYA 3WBKA 1RYFA 3TQCA 3KB1A 5TY0A 3QKRB 3CRQA 3Q85A 5FI0B 2ZSDA 4YMUA 4OQMA 2D62A 2VYFA 3IO5A 2O5VA 3KTAB 4KO8A 1DS6A 1T5LA 1Q3TA 1TF5A 1C9KA 1M7GA 3MLEA 4M9XA 3WNBA 5JHGB 3E70C 2FEOA 4TMVA 3BGWA 1P72A 4PC1A 5FOVA 3K9LA 2WPDD 3H86A 2AX4A 2I1VB 1S3GA 2IYXA 3FMOB 4AKIA 1E96A 4LJ4A 5BN3A 2PZGA 2QSZA 5D3QA 4ZDKA 1GNRA 2JIZD 2YWFA 4HAUA 4TL7A 4BWYA 1DE0A 3S1AB 4F7WA 5DI3B 2BBWA 4PHTA 5HKKA 2WJYA 1Z0KA 2CJWA 4WZAE 2VRWA 4QGHA 4Q47A 1OV4A 2GCNA 2Z0MA 4IDNA 4IVQA 1CJTC 4JSTA 5DYGA 1P60A 4A2QA 3A58B 2VIIA 4S35A 4D26A 1S96A 3KJHA 3B85A 4M9SA 5M04A 1YVDA 2CCGA 3R20A 1WA5A 1E9DA 1R8QA 2VSXA 3W6OA 4PZYA 2ODWA 1YZLA 2J5XA 4IDPA 2W83A 4DKXA 1XP8A 4YMSA 4TYWA 1W2HA 3X1XA 3VKGA 5K8TA 1N2CE 1E79D 3BB3A 4LV6A 2OAQ1 4IOLA 5JFGA 3UIEA 1MABA 3GP8A 3K0FB 1L4YA 3GCGA 2WBLC 3QOFA 5KNDA 3CNLA 4GBMA 1UBFA 1QF9A 4ZIRB 4JLMA 1SVLA 2N1BA 3CRW1 1W36B 2IS6A 1XEWY 2IEYA 4BLSA 4RY2A 1Q12A 1UKYA 3VR4A 4L16A 3TW8B 4O2LA 3WRYC 2JDID 2QORA 2QEQA 4IEIA 4OHWA 3SFVA 1Z83A 4B3XA 3ZD6A 4A4DA 4BEJA 4B3DA 2F55A 3QG5A 2GEDA 5CLLA 1CJUC 3AEZA 3PVSA 1FP6A 1XEFA 3EG5A 4MYUA 3NC0C 2IS2A 2NOAA 2CMKA 2QG6A 2V9PA 4XVRA 1G8GA 3T06B 2H7VA 3R7WA 2FX3A 1ZM3A 3QF7A 2RKOA 4LBWA 3CPHA 2IK8A 4PAQA 4TT3A 3QKSA 1YZUA 2VP5A 4LJYA 4NBSA 3JVVA 1UEJA 4HDQB 4DT1B 1GG2A 1E2FA 4PHFA 4DCUA 5KSOA 1W36D 4NH0A 2WAYA 4JLBA 2GF0A 4L8GA 3AVUA 1U0JA 2KWIA 2IWHA 4CT4B 5IK2D 1BS1A 5CYOA 4JKIA 2BM1A 5FPKA 1W0JA 2A3RA 3DO6A 1NJGA 1GL9B 1RVDA 3IHLA 4W5WA 1ZCBA 1ESMA 5LPNA 3KQKA 3X1YA 4QBHA 1RJ9B 4CEJA 2IL1A 2GWHA 1ZINA 4KITB 1VCOA 2F1IA 4HLQB 2F9MA 1Z08A 1UBCA 3DM9B 3GJ8A 4LUCA 1E2EA 4IOMA 5FBLB 5BW8A 3U7GA 4B75A 2C9OA 3VNUA 2ZRCA 2QGZA 2UZIR 4HUTA 1JXMA 3CB4A 2HDNB 5HE9A 3W5JA 3TRFA 2A5FA 4M9QA 3QE0A 4EFNA 4LOAA 2IF0A 1R0XA 2C96A 2NPFA 3NDBB 1Z0IA 3NBYC 1Z2AA 3I8SA 2H57A 3KKQA 2QPTA 3LQQA 3LXRA 2Z4SA 4M21A 4TSFA 4GOJA 4V0ME 1MO4A 5KPJA 1G21E 1OYYA 2GAAA 1IY2A 3Q3JB 5CYPA 1U8ZA 4ACBA 4TLAA 4A0GA 2HXSA 4IDHA 4EAQA 2Q3HA 3RWMB 2NO6A 5BN4A 2HT1A 5EXXA 2A9KA 4X8HA 2AXPA 2XSZA 1UBGA 1BMFD 4P4SA 1KHTA 2EWWA 1Z07A 1JQJC 2WJIA 1BO6A 2W2VA 4X8LA 1FX0A 4MA4A 2F43A 4D82A 1VHLA 3SS8A 4CEHA 1NF3A 3W9YA 3BB4A 1XZPA 1Q44A 4OK3A 1OPXA 3ETLA 5EE5B 4NCKA 2PBRA 3M0EA 5EXPA 4OJKA 2YC4C 2YOGA 4YXWD 2XZLA 4PSKA 2ZVQX 1N6LA 2ORIA 2OCBA 4Q4HA 4NE2A 1SHKA 2GF9A 3KZ1E 3THYB 1AQYA 2VF7A 4NCJA 5CM8B 2QAGC 3X1ZA 4C0HA 1OFHA 1DEKA 1IBRA 1E0SA 1KI9A 3D6TB 4KCGA 1JNYA 4LHWA 4M8NE 2N42A 5D3MA 4D4LA 3SJCA 2IEZA 1JR3E 4HUQB 1JJVA 4XIGS 2LKDA 3Q5EA 3GD7A 3QXXA 1YZQA 4KBGA 5CK4A 2HEIA 4URVR 3HJNA 1KO5A 4WXRA 4BLPA 4CZ2A 3BOSA 1DAIA 5DNYB 4LWZA 4WBSA 1TQ2A 4LV8B 4US2R 1N6OA 5JHHB 1TU4A 2F3TA 2ORWA 3UWKA 4B73A 3G82C 2C77A 2ZI3A 3KB2A 1KY3A 3D3QA 4JL6A 1LVGA 2O52A 4IEEA 3RVBA 1F6BA 3U3RA 1KMQA 2F9LA 3LW7A 1F48A 1W4RA 1G6OA 1KI2A 2JLQA 1GRNA 1AK2A 5GVSA 3TE6A 5KPDA 1HT2E 3CNNA 2OEPA 5AUQA 2W2XA 1E9BA 1KSHA 3VKWA 1TADA 2IYTA 1II8A 3L0PA 2GVZC 4P4UA 4V0MA 2VO1A 3AKEA 3VR3A 3GFOA 4U7DA 3LW8A 1FFHA 1AS2A 3FHCB 5EUMA 2BHRA 2YJTD 3O8BA 2ZPTX 5J4LA 1XMIA 4AI6A 1Z22A 2DFKB 3IQXA 5EP2A 1H8ED 1E94E 4XSHA 2XNDA 4FMCF 3DVLA 4XTCS 3SYLA 3PEVA 2HLDD 4IHQA 5KU1A 3EZ7A 4G5GA 1QBKC 1GAJA 4A8JC 3C7KA 2O8CB 3HU2A 1XTKA 4JT4A 1FPMA 2GCPA 2OFWA 2FG5A 1NVVR 3AUXA 5CITA 5JI2E 1OH7A 1EFHA 1AJEA 1V43A 1XBTA 4URXR 2ZYVX 3TGPA 3LX8A 2FE4A 3EZ2A 1DADA 3IIMA 1COWA 4IVRA 1OB2A 3EIQA 2R9VA 4HZUB 1GKYA 3TLXA 3W90A 3FMIA 1SVOA 1EK0A 1XMJA 3WMFA 2C98A
chains in the Genus database with same CATH superfamily
1J2YA 4RKFA 1F8YA 2RGWA 1Q95A 2ZYDA 4I4TF 3EIXA 3NBFA 4DEXA 5LSAA 2BRUC 5KSPA 1Z0SA 1VECA 4Q6BA 5KOHB 1NY6A 1QAMA 4KE7A 2NG1A 3ORHA 4IDCA 2WU1A 1LDYA 2X4DA 5ALHA 2PRKA 3GLHE 2I54A 1GZSA 2BEUB 1RWPA 2DCUA 2XMGA 3IJ5A 4GS5A 3V4FA 2REXB 4CW7A 4MWDA 3V97A 2K2WA 3ZWDA 3EIWA 1Z82A 3DC7A 1EM6A 4CFSA 2ZSFA 4DQKA 1EXMA 1NUUA 3OIUA 4RZSA 3MS7A 3C0KA 3M6XA 2UKDA 5K0LA 3EPJA 4GKJB 2H7XA 3RVNA 4B3IA 3ZQ6A 1KGDA 3RODA 3S28A 1FP1D 4TM7A 3RK1A 3G5AA 3M81A 5FKJA 1JTVA 2YY7A 1PDWA 3F9IA 2UYCA 4ETNA 4YUYA 2VRCD 1VJCA 2EJCA 3OIDA 1GZUA 1VPTA 3L7BA 1M6VB 1FQKA 2JBAA 3A25A 3EXG2 1B0ZA 2LIPA 5G41A 5BR1A 4N7BA 4ZRMA 4JZYA 2HWXA 4IQ4A 3SEQA 5KWIA 4OU5A 5J2TA 2WJPA 1T3HA 2VJDA 1IDN1 2JCYA 2XITA 4IHJA 3TSWA 4BLRA 3WGQA 4P3XA 5DCWA 2G4VA 3SX2A 1MNQA 3GOQA 4Y8VA 5KHLB 2EIHA 3ITKA 1H93A 1V1MB 2QRZA 4HNAB 4U7FA 4CR7A 2JANA 1JLKA 1R12A 1EK6A 4YLGA 1BX0A 3NBZC 4FUQA 3BMXA 2JJ1A 4WLVA 4GSLA 4KIJA 1WU7A 2BMWA 1PD1A 2FU5C 1UC5B 1NU6A 2YWEA 4NULA 5GQSA 4JJZA 3TQSA 4ZHQA 1EZ4A 2P11A 4ZDIA 1HE4A 2E4YA 5IYZA 3GFBA 3Q7TA 4JX8A 4YFYA 5G2OA 1EWKA 3RG2A 4G6ZA 2MMCA 4JP5A 4TLCA 1JRLA 3A6KA 1SC1A 4X1YA 3U40A 4OP3A 1KI4A 1H94A 5LM3A 1L7EA 4KR7A 1V5EA 1LZLA 1W6UA 4IG9A 1EXNA 3H5AA 3LCJA 1UAGA 4F2GA 5JXIA 1S1CA 1E5TA 3X1DA 4OB8A 2PUFA 1JECA 3ER9A 1OIWA 1SVKA 2A0FA 4ZI2A 1SEPA 5G0WA 2ICAA 4QDJA 4UQPA 1VKRA 4GYJA 3E81A 4KJXA 4DE5A 4EQ6A 5CBPB 5MN4A 4AU1A 3GJQA 1R0BA 2BDEA 2QX4A 2WPNA 3U31A 1YRYE 2HMAA 1P5RA 3LBIA 4KR2A 1Z63A 1E62A 1TTHA 4Q9LA 1F4VA 4BJ6A 4Q3NA 4Y1EA 5CLHA 4IUYA 1VCIA 1U4NA 2HMWA 4PX9A 2F1RA 2QUKA 4E13A 1VBKA 2BV3A 2GCOA 1GILA 1AK9A 4J16C 3W8NA 1QJ4A 5K20A 2DLDA 2JAXA 4AX4A 2IYWA 1NRJB 2CGEA 4GM1A 3KEFA 4K8OA 3U1BA 5AJWA 2Q3MA 1Y6FA 5JMOA 4R7GA 3BB1A 5HKKD 5B1HA 2C3PA 3EZLA 4JVNA 4V1CB 1VYUA 3PQCA 3JQAA 3UHAA 2YHSA 3MEQA 1PQUA 3C3EA 1YJQA 1KJJA 2FA9A 4LPKA 3H8JA 5CAEA 4YRBA 3PRJA 2ZI6A 3T34A 2RGAA 2XMCA 3EVCA 3A36A 1Z8FA 2J07A 2XWQA 4FLEA 4WMLA 5EGSA 4OI1A 3MTEA 5I8WA 5IDQA 2YNMC 3V1UA 1IXSB 4LRTB 2QI9C 1UM8A 3E5HA 4H6XA 3AH8A 3OZGA 5JJ5A 3TMAA 1GFIA 2QVXX 1YMVA 4EW1A 1JHMA 1W29A 4LSZA 4D9IA 5GIOE 1S0UA 4WXHA 1D6MA 3I45A 1HR0B 2P2LA 2H1HA 1LNZA 5CHEA 5GINE 1OIVA 2FPPB 1AGYA 5BW4A 1PL8A 1U8YA 2ZYUX 3FHJA 1EFPB 3SJZA 1I5OA 3QXJA 3R3YA 3ZTTA 2BI8A 3HS3A 3IE0A 4N03A 2G9NA 3UH1A 2BN4A 5JBQA 1ZD1A 1Y5LA 4RMNA 1ZRNA 5FB3A 4RABA 1BKDR 2KBEA 3L6DA 1L5SA 1SRQA 4UUMA 4BJ5A 5KNDD 5KYWB 1RCFA 4BVLA 2CYBA 2QT0A 1XTUA 2WFZA 3ADPA 1FRVA 4YUVA 2JLVA 5JJKA 3D4BA 3HR8A 1NVBA 4W82A 2EWVA 1AVTA 5EWJA 2ZROA 3KP1A 4NYIR 4J1SA 2QUJA 3H5IA 1SG9A 1Q0RA 1JJIA 3EULA 4ZEOA 2PR2A 5CDFA 3MINB 4F4CA 4PLWA 1P2SA 4G0UA 1BXKA 5L3SB 5C31A 2OV6A 1DTWB 5BSVA 3QEAZ 1MUUA 1VE5A 5BWBA 4S1WA 2ATXA 3K5IA 3OH8A 1F7VA 1ZJ4A 5JASA 1RWBA 2AD5A 3KPWA 1IN4A 1CUEA 4ENUA 4RFSA 1CS0A 1WXQA 4RHTA 2GPWA 3ZJVA 1NOKA 1EGAA 5JNSA 5LP1A 4KAFA 4FYWA 4KXWA 5H59A 5TT0A 3I1JA 4IIJA 1B8PA 1BA3A 3AZQA 2NZ8A 1HFJA 2GXSA 4O25A 4BFVA 1HRDA 5JCJD 4C89A 3M49A 2NU6A 3R5JA 3EAGA 1F3OA 1AN0A 2QN6A 2UZ0A 4UU1A 3QX8A 2C5LA 2HQ1A 1G42A 1RTTA 3IAXA 4NONA 4QG7A 1GT6A 2NUPB 4HRAA 4NU8X 1UXGA 2CNNA 4K9KA 4OM8A 5DJ5A 3ZWVA 2OAP1 1KYQA 1UJ4A 2DTDA 3B13B 3LIPA 3TMYA 4CNBA 5JCPA 3GZJA 2D2XA 4NJOA 3TCNA 3X3HA 4LVOA 1Y4ZA 2P9GA 4MKRA 3HA3A 2O1WA 3HYLA 3NT5A 1YR9A 3MQ4A 1DARA 2ZUWA 3I2FA 5LFAA 3I73A 2PUAA 1PBTA 2MSWA 2ZBRA 1OILA 1WLSA 2EP5A 4WNAA 4CN9A 2VTVA 3ZV7A 3M5DA 1IN8A 1E9RA 1GSHA 1X1RA 5IJ0B 3PJDA 1T2EA 1E8NA 4ZXPA 3RS2A 3ED5A 3P9NA 5E4FA 3SQNA 5J1SB 3ORRA 4HGYA 1A9ZA 1C30A 4R41A 1DBPA 1MOSA 3FYHA 2Y99A 4NCNA 4BX9A 3ZV5A 1B8UA 3IXLA 2EZTA 2F43B 4TL9A 3ZU5A 3R0JA 4QT0A 5BMVF 1NURA 3A9UA 3ANMA 1ZM4A 3A6GA 1XL0A 1WP9A 2AQHA 5TQ0A 3AT1A 5IABA 1YQUA 3O47A 4JFRA 3A1CA 4QTZA 1RSZA 4CTNA 3AJ8A 1RM0A 4RETA 5HNKA 2XXAA 3FTPA 3PUHA 2BJWA 2Y4NA 3RSGA 1W85B 3H8VA 1QOQB 3VR6A 5JIBA 1E3QA 3GO4A 3FNRA 3OLXA 2CDAA 3U3MA 4XWGA 2FOLA 1ND6A 4A2WA 1U2PA 1U81A 2QG9A 3MMPA 1J2RA 4HLNA 3PKIA 1OXTA 4KXVA 3WV4A 4F8EA 3NONA 1USVA 1LS1A 1F3LA 2HJ9A 1XVUA 2NU7B 1L5HA 4F97A 5EJ9A 1NKTA 4Q39A 3WSTA 3NHZA 2XMZA 1R50A 5JNUA 1EHIA 4KMOA 3I72A 2ZB4A 2BFFA 4JYAB 3TTYA 1TIKA 4ZI3A 5JAMA 1DHRA 4L0CA 5EN4A 2YV1A 3B6IA 3N0VA 2XCLA 2WKRA 3UW1A 4XWAA 3P0JA 1A69A 2QM3A 4Q7EA 2VQEB 4M1KA 4ZU3A 4CIYA 1SCBA 1YS9A 2BGNA 5IU6A 4DYVA 2OYSA 3V7WA 1RPTA 1ILWA 1DBRA 1E0DA 1MBZA 3BQ9A 4MVYA 3RHSA 3UWSA 5BWNA 2UUCB 3IVAA 2FLVA 4JYCA 1Z2DA 4G85A 2HU7A 3WGYA 5LQDA 3H83A 4HB2A 1ZVJA 2DSTA 4JT2A 1L5VA 3MA0A 3NKVA 1SC4A 1VLHA 1KYYA 2J9XB 3CPSA 3BH0A 2VZEA 5CCBA 2HDWA 5TV2A 3TSAA 4C05A 1A82A 4QHSA 5A4KA 1YF3A 1N2JA 2R3SA 5A1JA 1MH9A 3M8KA 1XA0A 3QQ5A 1RPJA 3F97A 4UJ3A 3UOWA 4BO9A 1F14A 1KEZA 2FP4A 1BDHA 1QTNA 2EFHB 3DBOB 4LF8B 1BDIA 1E0KA 4OQ4A 4RA6B 5F1PA 3BXXA 2V59A 3QA3E 5BWMA 3KOYA 3URMA 3RS4A 4LRUA 4O8CA 4BAGA 4TVBA 4M0EA 1O58A 2PUVA 1W5TA 2A7XA 2GPYA 3UXHA 4ZYWA 2BGKA 2QLLA 3C8ZA 3DFMA 5FOUA 1GVNB 1Y5NA 5E6RB 2I7TA 4Q34A 4KGZA 3U49A 3OZWA 2WK1A 1ZNXA 4ZOLB 3ZWQA 1XV5A 4PVCA 3UZUA 4OK5A 2V3VA 2PVPA 1DIGA 4YCLA 3DXZA 4B76A 3IKTA 3QUCA 1NJFA 3CRVA 3KZCA 4W1PA 5LB2A 4EJSA 3OIYA 5ICCA 2JL1A 3PGXA 2O48X 4FDTA 4LJ8A 1YC5A 2OQVA 2NLOA 3ACDA 4RU1A 5FJJA 2R4UA 3U44A 2CNOA 1NVMB 5FORA 3CF6R 5B7QA 4NLLA 4XARA 3LFUA 7YASA 1IBKB 2PT5A 1KERA 3HCPA 4GPIB 3FRJA 5IM4F 3P2JA 4QFCA 4C6TB 5E3JA 1B1AA 1DKOA 2BFEA 4W8HA 2PS1A 3QVUA 3UK0A 2BLNA 2CK3A 1DXHA 4ZANA 2QTGA 1AQ6A 1XZHA 3MXOA 3PPXA 3B9RA 2JGDA 4FDVA 1YQWA 1ZWKA 1EZZA 3I4FA 1YL6A 1EFAA 2O7QA 3JXEA 4BU0A 4DLUA 4J3NA 1NNSA 1WCIA 1QK3A 1C0PA 3L6OO 2RFLA 2WT4A 2BTQA 1MB3A 1P2UA 4MH0R 1DFGA 2JFGA 4NV1A 5TT1A 4C5AA 1ULHA 2EKDA 1RPAA 2PU7A 2XD9A 4CTOA 5BW5A 4B7CA 2OM2A 1BVRA 3IAM6 4D4IA 4KKVA 1HDRA 3R9WA 1B6TA 1F0KA 3IVCA 3LUDA 4IQ0A 4YRIA 1MQAA 4G63A 2ZR9A 3IIIA 1NONA 4B71A 4CLHA 4MV8A 4J0QA 4JI0B 4WNYA 8GPBA 1DBQA 2SHKA 2YY6A 3FHOA 2XMDA 4P33A 3AFMA 3OJCA 3K8OE 4DXAA 2H48A 3CUSA 4D8XA 2OY0A 5A5FA 2IZZA 2Y67A 4C5BA 3JPYA 3NM5A 2DBZA 721PA 1EBBA 3IT2A 3PQ2A 1U3CA 5HR5A 1N6HA 1OFUA 1PG5A 1KK3A 2A5JA 5CLJA 5H7XA 1ZQ1A 4II3A 2V3CC 3WJAA 4YGXB 1KEWA 1NW5A 3VMFA 4JJKA 2WF7A 3PC3A 4C2AA 4OLBA 3CRZA 4RXTA 5HM8A 2XGGA 3FGNA 3NIBA 4UM9B 3F6PA 2Z6VA 1UMKA 3AL3A 4ARBA 3CPEA 1VL6A 4FK8A 1H2XA 2X5KO 3DULA 3UANA 4U6SA 4FFPA 5IH3A 5KNBA 1GADO 3FETA 4OOFA 3FCYA 2VPPA 2GILA 2UXDB 5AM5A 3VDQA 5DNUA 4H1UA 4NFLA 2OBNA 1J0XO 4OEHA 3DCYA 1XLUA 2Y1DA 1LPMA 2EQAA 1T0PA 1YDWA 3AERB 3CV3A 1ECLA 3DYBA 1VHQA 4IRXA 1X86B 4HNGA 2E1PA 2JJMA 4NAVA 2VDKB 2X6QA 4EO4A 5C9ZA 4RA9A 3M6UA 4FW9A 1BGXT 5F73A 3CH4B 3HU3A 3OPXA 4TKVA 2EFYA 2LR0A 4WH0A 5BO5A 2XAUA 4UUBA 1DV1A 1YE3A 1WOYA 4AN1A 1Z6AA 1HT1E 1JVNA 2EFCB 3RW9A 1YB7A 2HF8A 1VPLA 4TWRA 2JJ1D 1WBJB 3SVZA 3T15A 3UJAA 3ZKWA 3W5IA 1X7DA 1Y8CA 2AG8A 2FW6A 1M8JA 2WR8A 2Z1DA 2C83A 4UU0A 4DCTA 4YR7A 4UHEA 1NMXA 5MDHA 7REQA 4P58A 2VHWA 3NHFA 3GEGA 1KXZA 1C4OA 2YVKA 2XWSA 3HM2A 2CVQA 3GGOA 3QF4B 4Z9XA 5AUOB 2P3OA 2WFAA 1YS1X 1Z2OX 1VBMA 1DAFA 3QVLA 1WSWA 5HIIA 4BVBA 1I32A 1CEEA 2P4UA 2PSJA 4OATA 4ISBA 5L4SA 2W5UA 1SUDA 1X6VA 5DRTA 4E6PA 1PL7A 3ZS9A 1TYBE 1UJNA 2W6MA 1NVKA 1TKRA 4X44A 2AKEA 2OA0A 1YI1A 1HC7A 5A7FA 1S6YA 3FFAA 3ZWXA 5LMZA 1D4AA 4EA8A 4L74A 4RHCA 5H0IA 2VDMB 3C3XA 1H9BA 5AK3A 4QGBA 4LECA 4QXOA 4RADA 1HDZA 3AJRA 1Y3DE 2NSHA 2D2FA 5JALA 3D4IA 5IJZA 1XZDA 4PQEA 2DUWA 4WKCA 1E77A 3NWJA 1IB6A 3DG9A 1J8FA 1ZGJA 3SSOA 5JWRA 4ZI7F 4R1SA 5DWQA 3ZHUA 4KPUB 4E1BA 4LC9A 2CNKA 3LYUA 2PIAA 3WL4A 4U9HS 3TL2A 1UDXA 1SQ5A 4YMGA 3ZQKA 1D8TA 3JQAD 4WWHA 2QE7A 2ZIFA 5K3FB 4FMCB 2IE0A 4RKYA 1XRNA 3NAMA 2HQRA 3KVYA 5JS6A 3P7MA 2P7HA 3H2IA 3PGA1 1B14A 4BO0A 3FNIA 4B7AA 2QT1A 4FE7A 5AMXA 1HTBA 1YQEA 3T4XA 1QPGA 2R7AA 1XEAA 3QVGB 5EMLA 2BFCB 1QK4A 2H5IA 2OCPA 2P9TA 2PZMA 2R96A 1DWQA 1TO2E 2QV0A 5E6SA 3ZCTA 1S2GA 4NE7A 4N82A 2BUCA 1ZC3A 1P5FA 2HV8A 4DFDA 4E5YA 5C18A 5B2FA 2VDLB 1LBTA 5HVNA 2B7CA 2XTJA 1T6XA 4P7JA 2BFBA 3KBBA 3E22A 1YHNA 1XKXA 2J8ZA 4LIPD 5FULA 3TW0A 3PXGA 1SVIA 3EX7C 3HCCA 1NIJA 2I7VA 1OY1A 1K6XA 4LXTA 1KDRA 3EFOA 4HQNA 1C3VA 4TYMA 5IM4A 2IRWA 3CO0S 2LDXA 1DC5A 2OTCA 3PNOA 2B3TA 4ESOA 2BC9A 2NUTA 4EW3A 1OLOA 2WWWA 4B85A 3SZUA 4AS2A 1MHPA 2O6HA 4I5FA 1I36A 2YOHA 3K2QA 5AHKA 3K0EA 5FLXA 4E3WA 4FD3A 4HNSA 3I92A 1N4AA 3HBLA 5AI4A 1FEZA 4JUCA 1U9CA 4N3AA 3PC7A 1HFEL 2WHPB 4OXNA 4DIFA 1U02A 1T5SA 1JHZA 4P4LA 5CEEA 3W8EA 4BWVA 3NMUF 1PDVA 3BRSA 2OCYC 1UMCB 1POWA 1J0EA 3CKKA 1B8VA 1U2TA 2H4WA 1UBEA 3CCBA 4G0QA 3ZLBA 1R4NB 4CDGA 2Q5JA 1J9EA 4GGPA 1W7AA 5B4VA 4BECA 3KZKA 3V1MA 4K9SA 1GTZA 1P1FA 2BIFA 1JDSA 2QXUA 3KYCB 3NORA 4QSHA 1I01A 4DNPA 3CVYA 2I6FA 3OTGA 5HZHA 1R9JA 2PXHA 3IEXA 4MLPA 5AIBA 2Q3LA 4WBNF 1NVEA 1D6SA 2CDBA 1LW6E 4NBLA 1M7BA 4RY0A 4DA0A 2DPYA 2Q2VA 2XTMA 3QQPA 3LBNA 1DIHA 1KQOA 2LKCA 2XUKA 3KZVA 5L3VA 4KWCA 1HSOA 1AGRA 3LQ1A 1DAOA 1I0ZA 2O8FB 2NSYA 3ILYA 4BLWA 1PZMA 1SU7A 3CW8X 1B76A 2RJ3A 1N5OX 1N2GA 3OTQA 4V24A 4AZWA 5GY7A 1XEWX 2GCIA 4LXGA 3T1QA 3DE1X 4X9XA 4DDTA 1EQUA 3C4QA 1SKYE 4K28A 1UQRA 1CULC 2A0WA 4MARA 1HYEA 4P3KA 3RT9A 2R1TA 2R47A 1W96A 4PWYA 4QYXA 2FWJA 5FA8A 4C03A 1KZ6A 5HK9A 1RJGA 2CFOA 5FAXA 3BERA 3OEEA 3PICA 3T9DA 3EEBA 3OPQA 4Q1FA 4HN4B 2YS6A 2QTAA 1Q0HA 4NH4A 2BFNA 3W6PA 1Q0ZA 1RXIA 1XWIA 1L7QA 4ZVQA 2HTFA 3BHNA 1QG4A 3WRXA 4R4JA 4V02A 1WJGA 3ZXUB 1N3YA 5JAIA 1XLTC 4PN7A 4OBWA 3AR4A 4N8EA 2HQOA 1BQEA 1VMAA 4GGMX 1MAAA 4DQVA 1R8XA 1XMSA 1XELA 1RLMA 3WBFA 4KV7A 4FBGA 1RW4A 3OBBA 2EAUA 4PZ9A 1Q1BA 3EMDA 3Q3CA 4Q9IA 2PT9A 4IJ6A 4ND8B 4CU5A 3U6BA 4EKIA 1PX0A 3BUSA 2C58A 3RD5A 3RI3A 3SZRA 3VR6D 3H6GA 4HQLA 4G8DA 3BS4A 1CRZA 2IHUA 1I0LA 1W0KA 2D7JA 1WL8A 1C81A 2FVXA 5KTSA 2Q8PA 4V0KA 2WM3A 4ZICA 1WXDA 2KLBA 1PGJA 1UP7A 3LWZA 4U63A 4C14A 4MRMB 5IMSA 5T7BA 1JYEA 3ZWBA 5EJ5A 3QIAA 5FNVF 5J3JA 5G53C 5FTJA 4FM9A 1V8OA 2JFWA 5AUPB 2GEKA 1OXBB 1G5HA 4JVLA 3ADBA 2J45A 2HPAA 5IN5A 4DZTA 1GD1O 2OP1A 2NYAA 4YP1A 1RLTA 2PRIA 2FGJA 4BNIA 3EZXA 4BQSA 3BVPA 5K2MA 2BP7A 1JHYA 1MO2A 4OH7A 1GYQA 2QD5A 3NHPA 4DYDA 3WGHA 1PK7A 3PWZA 1A9XA 2HTEA 1GP2A 3GRRA 4A8HA 2DJIA 3B3AA 3IXQA 4PX2A 2YKQA 1E9AA 1DI0A 3CLUD 4CWAA 3AUKA 1PJ2A 4GI3A 5BSFA 5YASA 1ZK0A 3KTOA 4OX9B 1GPNA 1FNMA 3CLSD 1Y7TA 3DUFB 3VSEA 4D56A 4L9RA 1PJAA 3UK2A 4DV6B 1G20B 2OESA 1U0SY 2GKGA 2A9JA 2V58A 2VJNA 3A4NA 3CYFA 5DKFA 4A8JB 4AW9A 4HLUC 2OFFA 3KR0A 4EKDA 2ARKA 2VSNA 4HWKA 4KXNA 4L5AA 3OCXA 4XTRA 4ZZ1A 1XAGA 1OHHA 1OIXA 1T3ZA 1O4WA 2EW2A 4JCCA 1A1SA 4DCNA 3DMTA 1BGWA 1L5FA 4IZ6A 2NAPA 4NVRA 1AQJA 2TS1A 4GR5A 4MA5A 4ZCLA 1EINA 1A5BB 2PT6A 5B2EA 3F5MA 1K9SA 1E9VA 3EFHA 3GEDA 4Y98A 5E3HA 4ESHA 1WSDA 2AJTA 1U2QA 1E7SA 5AVJA 3WXMA 2GEVA 2P0YA 1K2VN 2DT8A 5EE1A 3NC4A 3VDXA 1W5BA 2H85A 1TMOA 3L4BC 3QPUA 5IVKA 4KQ2A 3G68A 2C9BA 4LRSB 4TYYA 1NWHA 1YB4A 2BEJA 5FL7A 1QWSA 3N2KB 2ZXFA 1U99A 2GBFA 3KYIB 2WHEA 1W5AA 3NGXA 3MRVA 3L01A 3WZ2A 4U4AA 4DSNA 4CM1A 1IB0A 1NI4A 3BWVA 5HFNA 4LQCA 2H65A 2QVZX 2D2VA 4TRNA 3LE8A 3UHFA 1PTJC 1QORA 2Q5LA 3QSGA 1ZBDA 4ZGBA 1T0UA 2IP1A 1JU4A 2R00A 5H68A 1ISPA 4F9FA 1PNRA 1GTMA 3AF1A 2RK3A 4CLXA 4IEFB 3C8HA 2CHVA 1I1HA 3ZVLA 4EG7A 2CVFA 1CQXA 2UAGA 3S7TA 2G04A 5EKDA 5AVTA 2ZQ5A 3TS1A 1SUSA 3CE9A 2HI0A 2NNWB 1IY8A 1DJQA 1WZUA 5I7UA 1C4KA 3O2NA 5KWSA 1J90A 5KC9A 5KWEA 4O4JF 5TEWA 4P4TA 3UKJA 4AYTA 1BH6A 2CK3D 1EVLA 3AY7A 4HXYA 3TZQA 4B3CA 5JCOC 3RFUA 3OO1A 1LBIA 2DQSA 2QLNA 5K4GA 2ZUBA 1B0UA 1X7ZA 2QZJA 3HCWA 3FDZA 4B0OA 2Z2IA 4UOEA 3PJGA 3VR4H 4TTTS 1ND5A 1SAYA 2IPAB 3CVOA 2VXBA 4HF7A 4C3ZA 2VP0A 3A2NA 4QEKA 5JTTA 1LI5A 1NYLA 1Q91A 4QJBA 3ESRA 4HD8A 3RVDA 1KOFA 3HKDB 4KDRA 1OAAA 2OFXA 1IHPA 2IPOA 3P1JA 4ZYTA 4NV0A 4JBXA 1CY1A 2QENA 4TL8A 1WMEA 4B09A 1DOZA 2E82A 4JKYA 4ZGGA 3M1LA 3MJVA 1J06A 2VBCA 3FKSA 3B6KA 4K40A 1PFYA 2O2ZA 4EPRA 1P2GA 5ALFA 1G8SA 3I28A 2CJFA 4G97A 1N6RA 1LBEA 1NR7A 1OXKB 1TL7C 2SBTA 2Q3EA 3MTGA 5DO9A 4DV7B 1QV6A 2Q3BA 3TLKA 3UG7A 2OLEA 3UXYA 3HKBB 2X5JO 3BWEA 2WC1A 3PHCA 3UQZA 4H18A 1S2NA 3MBOA 3LP6A 4AECA 1VZ2A 3DDZX 5EY5B 3RS9A 4DN6A 3U4QB 2BHNA 3TD2A 3PDUA 2OCIA 2PKCA 4GWKA 2GD2A 1G5QA 1IHXA 1Y81A 3N8GA 4JI1B 4JJ6A 4N6GA 5JSUA 2FW0A 2WM9B 3SIWA 4Y0NA 2V4ZA 3BMCA 2NZXA 2PX5A 2H5EA 2WOJA 4MQ5A 4CFYA 2YJ4A 2HRQA 2E85A 1H4TA 1VLZA 3IPXA 1FDIA 2GPTA 4QAJA 4AJ4A 1ODKA 4LSMA 4E5SA 1XIVA 4EF6A 2FWRA 4ARIA 2NPIA 2R2AA 2FDXA 3RABA 1MH1A 4A2PA 4E5NA 1NN1A 2O1EA 2YR0A 5FWDA 5KNBD 4B6SA 2D5BA 4BCBA 2PKEA 4C29A 3UV6A 3MFQA 4ITRC 1NUAA 5DLEA 4CBVA 3QPCA 2EYQA 4NYIQ 1OTYA 1V16A 2ZDGA 3G2KA 3QWIA 4FI3C 3PX7A 1N7GA 3N39C 2CKDA 1YUNA 2XVMA 4I9HA 1A97A 5AXBA 4B4WA 3SNKA 2H9YA 2MSNA 3SR0A 4EEKA 4MPRA 2QW1A 2ZIWB 2NSLA 5FRDA 3OZBA 3IUQA 3H7IA 2PKYX 4UNSA 2F48A 1EDOA 2GAFA 1JB1A 4D1YA 2B20A 2FN8A 2P9QA 4HN2A 3I01A 3N07A 4LRYA 2I76A 2EZUA 1AKTA 1DKQA 2VSYA 1GUFA 1HDXA 4XJXA 1SWWA 3WYAA 4RK5A 3NT4A 2C9MA 1RT9A 4DUPA 4F93B 2C42A 1VHTA 1WW8A 1NUTA 2I71A 4CG0A 3IQGX 2G7ZA 4OHYA 3NRCA 5IVIA 2ZIAA 3AILA 1UBNA 3ORSA 2NO7A 1MOZA 1EUZA 2RAVA 3TCXB 3U19A 2OV1A 6PFKA 2R4QA 4HFNA 1QYWA 3QBJA 3GJ4A 4FCWA 5LCXA 3I2KA 3ZHXA 3KWJA 4TPKA 2R1VA 3K70D 3OKPA 1UMBB 4MQFA 1PV4A 4YRNA 5ICFA 3ZE7A 4CMIB 4EYEA 3DCIA 4GI7A 4ZYUA 1NJ6A 5IX8A 4UXJA 4D6YA 1LTKA 3ZHZA 4NENB 3THRA 4D3XA 1JEQB 2FVYA 4XUGB 4QULA 5T67A 3CNOA 2X5OA 1VOTA 3EDOA 3L7DA 3MT8A 4HQ0A 2PRJA 1KVTA 2Q6LA 4LTMA 1SZDA 3VBEA 2VDWB 3UMMA 1AURA 4NRDA 2ANCA 1YASA 1CQZA 4YRJA 1MAUA 2DWQA 4CIVA 4JJ8A 3O2JA 2PLFA 4EI7A 3RVMA 4WSOA 1ZXBA 1PX2A 2CCJA 2C7BA 2ZFUA 4M0LA 3JARB 5K4HA 4JJGA 4O0LA 1BRMA 3TW4A 2GETA 1JAHA 1SC9A 4DWVA 5IKEA 1VXOA 5SY9A 2ADOA 5EZYB 2OXFA 3THOA 4NECA 4EJFA 4P4NA 2P4EA 2A9QA 1YAHA 4PSVA 1XCGB 1XZIA 3GWGA 1E4YA 1PN3A 3Q2IA 2QE7D 2JD0A 5IJ9B 4E3ZA 4DMLA 1QCCA 4KRFA 2IYVA 3OTIA 2PS3A 4W9NC 3V34A 3U13A 5E6UB 3TX2A 1OR8A 2CE2X 3AINA 1XU9A 4YALA 2GN9A 3B1VA 1Y1QA 1OXUA 3SM9A 3SHOA 4X6XA 4S1VA 2OYCA 2YJZA 3K8QA 3I5AA 1ZZGA 5T4FA 3O4FA 3DHVA 5AJXA 3T7AA 3SF8B 3CC8A 3UJ9A 4WRRA 4FNOA 3N2LA 3Q3HA 2IOFK 1LJUA 4RXUA 3JS5A 4KACA 5D3MB 4QM7A 1LI4A 5KTTA 2C54A 5J47A 4LCEA 4UNQA 5JEDA 1I3MA 3Q7SA 5JROA 3CUUA 3GJSA 4QAQA 4Z0NA 3EUEA 3SYNA 3P52A 1DKPA 4O4JA 1QE3A 4YCJA 1MT0A 3Q40A 3SLGA 2F7SA 4HNRA 2IGTA 3OIFA 1YQDA 2JPDA 3LXUX 3JX9A 3GNSA 4JEHA 5LLDA 4F3TA 5JSQA 1WPGA 3SYTA 3WGIA 1Q0UA 5J4HA 4N8DA 2UZ1B 4MUYA 1UMDA 5TPWA 2RI1A 4KSYA 4FQ8A 3AF0A 1EHYA 1MEJA 3UAZA 4HC4A 4V3BA 4RF4A 4YP5A 1FP7A 2VJMA 4MS4A 1CXZA 3D8SA 3TB6A 4AUKA 1JIUA 1WS6A 1ZGHA 4IG4A 4YN3A 3F98A 1C4WA 4HWOA 1N5MA 3HV2A 4NY1A 4CKEA 3ECCA 3IVMA 5EGNA 3MGCA 5ITWA 3BORA 3T8YA 4L2IA 3OX4A 5JQWA 5LQCA 3T5AA 1S01A 1LTHR 3DCNA 4RK6A 2PFKA 3BGVA 3PFKA 5B6PA 1VXRA 2CFRA 1F2DA 3AGQA 3KAKA 3SGLA 1JMVA 1SUAA 4Z5XA 4FOOA 4B46A 4WY5A 4Z4GA 2GFQA 2O7SA 4V38A 3FPAA 2OHOA 3M9XA 2E5WA 3A3OA 3NM4A 4FMBB 2XRMA 4IMPA 4FYYA 5F98A 3FSGA 4MRSA 4N0EA 3L43A 2UZ4A 3MWEB 1UXJA 3AIKA 5EQTA 2J0EA 1ESDA 221PA 2LTAA 4DC9A 4D41A 2NGRA 1DIOB 4PYIA 4ZREA 3EZGA 4QATA 2Q6TA 5CXUA 2ORYA 3RLFA 3GN2A 4MI9A 2B2NA 2CLCX 3FNBA 5HILA 1C0KA 1S4QA 3S2GA 4Z8XA 4CM7A 2A88A 4UU7A 4ZPJA 3OEED 1PT9A 1IRIA 2JAHA 3IT1A 4H4EA 4JBGA 4Z2YA 3SICE 1GRQA 1OMOA 2BBTA 1XD9A 2OENG 1P4SA 3C8MA 4OQDA 5KOHA 3SYMA 3PVZA 4L08A 4C01A 5KQMA 2V7QA 4IZHA 1E6LA 1K3TA 2VATA 3RAJA 4ARZA 4D46A 4DNFA 3KXIA 1KZ4A 5BUZA 4MTCA 3JV7A 1ZVVA 4IIYA 1BDBA 1YCDA 1GKKA 2BEUA 1ULSA 2VPTA 4IQ8A 3BCHA 5KDLA 1QYIA 3JYHA 2PSDA 5K0GA 5DN6A 3JD3A 3G2HA 3BHIA 4UEWA 3KKPA 5EJIA 2O2DA 3U3ZA 4A8TA 4I4CA 4J29A 4OLJA 1IAVA 3PUIA 3GCZA 2B21A 1HO3A 1XQXA 3QG1A 5EHIA 3O84A 4IIDA 3R3WA 3IALA 1M5TA 2QTFA 4MGHA 1W0KD 2VZLA 3GPDG 4BB6A 3GFSA 1V3UA 1I6WA 1WCWA 3H4TA 3PZRA 4MRNA 2JFZA 3VPHA 1D9ZA 3B2EA 5AW3A 5IKPA 2P90A 3G13A 3TX6A 1AKQA 3L8EA 4OFXA 1ULTA 3JWGA 2R48A 1M6VA 3FTQA 3IUYA 4WA7A 4TTJA 1NP3A 1SXJE 2W4IA 2ZRPA 1CVRA 3KUDA 5EEHA 3VTKA 3WL7A 5JXGA 3EIEA 1RWVA 2H4YA 4PC7A 4N49A 1KYWA 5CJJA 3K6SA 4HH4A 1HQYE 1IVYA 1N0WA 5EJ4A 1QF7A 3JU3A 1EQ2A 4HNAA 1SO8A 3AL0C 2H92A 3BG5A 4AX8A 3IURA 5A2QA 4G0ZA 2I03A 3AX6A 3A4TA 1CUJA 3N7AA 4IS3A 4OL9A 4DV4B 1N32B 1YBMA 1MC4A 4H0CA 4J43A 1BSVA 4I81A 1H1LB 1U8EA 2R7NA 4QTUB 5AJUA 2C8VA 4L6IA 5CLFA 1JHVA 3DAOA 4EL0A 1RAFA 3ABRB 3D5TA 2C99A 4GPD1 4PLTA 1OHHD 2BMDA 4HAWA 1VA5A 1Z2PX 1ZN7A 4G23A 4P7GA 5F5LA 4F60A 4QNMA 3IR7A 1GA1A 1WUKS 3C16C 4MGKR 2DEUA 1A5ZA 3NJ4A 1AKMA 1M5UA 2PVSA 3MF4A 3VKUA 4PSUA 2X9NA 4LRWA 5DHUA 1N57A 1ZUWA 1HWYA 2H5JA 1WY5A 4IDDA 3HJCA 5I47A 4UVEA 2ERYA 1CDEA 2IUEA 4HX9A 5IT9A 3AIOA 3A26A 1IYZA 3IPRA 3VZCA 1R1DA 3PD7A 5FL7D 5DHRA 1XNGA 5DRYA 2GR9A 4KMSA 4B48A 6CHYA 2CSUA 3CJRA 1UKZA 7MDHA 5K7SA 3F9RA 2O4UX 2ZIXA 4Y1RA 1MFPA 4TTAA 4MTLA 3L1HA 2I6UA 4JC0A 3USZA 3N5CA 1NQOA 2C97A 3GLHB 4AS1A 1Y9AA 2PM8A 5U4QA 4BVAA 3V4SA 1Z28A 5BQOA 1QH1A 5P21A 4CV2A 4MI1A 1TU3A 4L57A 3RSHA 2F3RA 3NC1C 4ZZ0A 3VH4A 3LLUA 3SQMA 2VJLA 3ZD8A 1FVXA 3IUMA 1MMFB 2VEDA 1XVVA 3OY7A 2NO4A 4J03A 3I6YA 3S2UA 2WDPA 3GBSA 1M1NB 2DECA 2P62A 4ZOLF 5HFAA 3ZDQA 4EGSA 3L6UA 3SLRA 1KEPA 1RQPA 1V25A 2ODQA 4MWEA 3G0DA 3LH5A 1L4LA 5IKOA 1BWRA 4BRZA 4CUZA 2ODPA 1ZOOA 1FTYA 1XFAA 2F3QA 3G17A 3LSYA 2BEWA 3QWBA 3HCNA 2P6PA 5I7HA 3D8RA 2FPPA 1TEZA 4R1TA 2VWQA 4FYKA 4CETA 2VAWA 1NJ1A 3MTQA 2XUQA 3DC2A 3CZ9A 2UXBB 2AEMA 4C20A 2O2YA 2E4XA 1U5AA 4ZCQA 3R40A 4IS2A 4W63A 1INLA 2ZI5A 3MJHA 1Q83A 1ZIYA 5FUMA 2ZYSA 5ANRB 4ND7A 2LCQA 3FKSD 4ZVVA 1KZ7B 5ELLA 3TR5A 5H9VA 2AT1A 1YA6A 1BVYF 2ATEA 3WHKA 2HYIC 2B36A 1WB5A 3QLVA 2O5RA 3FLEA 4G1CA 4JBHA 4LDNA 1DEXA 4U7TB 1FOEB 2O20A 4YJFB 4GYWA 5A4IS 5L3SA 1ZEMA 2O57A 2EZ4A 4C7KA 1CNMA 1YTLA 4URUR 5IEBA 5AW4A 5KKCA 2WFLB 3SVLA 1X70A 1QRDA 2V1XA 3QMPA 1WUTA 3AEYA 3K2BA 3AG5A 3RFXA 1BU8A 4DJFC 5ICMA 3O3NB 2VH1A 4PAOA 2ZRJA 5ER6A 2X14A 2ZDQA 3MT0A 3L8ZA 1E2PA 1VL1A 2XE6A 4K9DA 4ZT2A 2X58A 1LU9A 1P61B 1GG9A 2UZ3A 4BCDA 3M1YA 2YHUA 5DTRA 1XZAA 2FMKA 4AKEA 1RQ7A 4R2JA 1RLIA 1X0VA 2GEFA 3KFLA 1ODJA 2HGSA 2VHUA 3F90A 4J49A 5IAEA 1MW9X 3KQNA 4G56A 3RHTA 4CG3A 3A1WA 4C43A 3FAKA 4Q1EA 4XFKA 1VSBA 1TYDE</