2ZRDA

Msreca q196n adp form iv
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
330
structure length
322
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLREPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 91
structure length 322
sequence length 330
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrdA01
1F6BA 1PUJA 3CPHA 3ETLA 2FPLA 5FUVA 4TT3A 3REFA 4OHXA 1SVKA 3QXSA 5M04A 2F1JA 3QOFA 1YZTA 1E2EA 1HT2E 4P32A 1WBDA 1KK1A 2MMCA 4EAQA 2REXB 4CEIA 2FDCA 4MGIR 3VFDA 4CIDA 2WPDD 3MWJA 3SQXA 1MRNA 2JASA 6Q21A 4A6PA 1F2TA 2DBYA 3WNBA 4EQ6A 1G20E 4LHVA 1L8QA 5JWOA 1G7SA 5EJEA 2WM9B 3THXB 1KI1A 4PQYA 3QI2A 4WXPA 3CONA 3VTKA 3WRXC 3TR0A 2FFHA 2YV5A 2QRZA 1N6RA 4TYPA 1NN0A 1CXZA 1GVNB 3U3RA 3RDPA 4D0GA 3W90A 3B1WA 4G0NA 1IXZA 3JVVA 2QSYA 3BFVA 2IHBA 3LY5A 1BS1A 3MWYW 5LB2A 2OSBA 1RJ9B 3ZVLA 4P4TA 1QVRA 1YU9A 3K9NA 4MYCA 4TYYA 4PX9A 4NU0A 2HLDA 1TMKA 4PO8A 1TQ6A 4JLBA 2PEZA 3NDPA 4LSGA 4NYIQ 4BLSA 3U3MA 2JJ1A 2QL6A 4C7OA 4LZZA 3F8TA 4JJKA 3BORA 1I4TD 1Z6XA 4TLAA 2X19A 2DFLA 2IXEA 4QM6A 1C1YA 3KXKA 3LQRA 5H68A 2JA1A 4JVMA 3T5DA 3KKOA 3ICEA 4M21A 5KPJA 3PEYA 4BFTA 4PSKA 1KK2A 2P5SA 1SVSA 2W58A 4QGFA 1TQ2A 2W6ID 2HCBA 3Q8XB 4JLOA 4BECA 2ZRCA 2GXSA 3DEFA 1YZGA 1E9FA 4US2R 1N6NA 4V0OA 3SOPA 3SJCA 2XZOA 1R10A 4QBHA 4AKHA 2RMKA 2VBCA 4J0QA 2VHCA 3A1SA 3CZQA 1E2MA 2WMOB 5GVSA 1P62B 4AWXA 2QUZA 2ZJ2A 3C15C 4KVGA 3K0SA 3TH5A 2A9KA 1S9DA 4RVCA 3VKWA 1JQLB 2JLZA 3U7HB 1HQYE 3KTAA 1OHHA 3NG1A 2QENA 1QBKC 2R9VA 2ZSFA 3L0PA 4Z8YA 2XAUA 1ANKA 4IW3B 4G5OA 4IEEA 4A8JB 3Q3JB 4FMDB 4MGZR 4Q9JA 3EPJA 4QJ4A 3K1JA 2RGBA 4P3YA 4QNRA 2WSMA 4TWZA 4DC9A 3LLUA 3KQHA 1W48A 2SHKA 3CRQA 2CXXA 1F3OA 2QMOA 3FPAA 3LBIA 4PXAA 4B75A 1RRCA 1XMSA 5DSZA 2Z43A 1GL7A 5CM9C 1WXQA 1II8B 1LTQA 3CW2A 3LDAA 1M34E 4C0BA 4JVSB 3O8CA 4IJMA 3TSWA 2V55B 4FMDF 1J8MF 3B60A 1TU3A 1SVWA 1Z5ZA 4A8JA 1P5ZB 3P4XA 1N6LA 2WOOA 4I81A 3UMRA 4QJ3A 2J0UB 3SZRA 1RVDA 2VTKA 4AG6A 1BH2A 3ZZUA 3CF2A 1DPFA 3D8BA 4CEHA 4HEJA 3ND8A 2FWRA 3TMKA 2JIZD 4G5QA 2G9NA 4B6EA 521PA 1N0VC 1PVOA 3VX4A 1MH1A 2WIAA 1S8FA 2BIFA 3AKYA 4GSYA 4I1OA 4D4KA 2VF8A 3E5HA 4ILEA 4F4JA 2QG6A 2QORA 3TUZC 2PEYA 4XTRA 4GI7A 4PAMA 3BFKA 4JL6A 1G7CA 4QHSA 3BWDD 2VP9A 1SVLA 5BYJA 5EP4A 4BLRA 1BYIA 3VNUA 2WJVA 1UF9A 2Z5FA 2AX4A 4OI2A 5TDHA 4IRUB 4M0LA 4OI1A 2P5TB 4TSFD 4LYAA 2FZLA 3A1TA 1M7GA 3WP1B 1D9ZA 4AYXA 1GDDA 1G3QA 4KFUA 1G3IA 1QZXA 2CNWD 1ZU5A 3DVLA 3KJGA 1U2RA 2ZYUX 1JQJC 4R7ZA 1IXRC 1OXVA 3BRWD 4RZXA 5FOTA 4RD2A 1T3LA 5HTKA 4CGZA 5HR5A 5AUQA 1YR7A 3GLGA 4X8MA 2KBFA 3NHBA 1E2IA 3LW8A 1TEXA 2WIBA 1P2UA 4GNKA 1RYFA 1NIPA 2DCUA 4RD3A 4IEIA 2ZSBA 1KK0A 1D5CA 2ZUDA 2PX3A 1CJUC 4Q1FA 4XWAA 1L2TA 2HF9A 2IYTA 2HXSA 4KBGA 4LV5B 1W0KD 3AP1A 3BOSA 5L3RA 4GMXA 2QT0A 1KNQA 2VA8A 1NIJA 3D6TB 2V6IA 3WHLA 1EESA 2F1RA 3EG5A 1NMXA 4S35A 1KI3A 1HTWA 1NY6A 5JBQA 1JBKA 1E99A 4U7DA 1Z2AA 4I99A 2DY1A 1NMYA 4AY2A 2P2LA 2NQ2C 2DWPA 2IYRA 2R62A 4JSTA 4B2IA 1NJFA 3KFXA 1D8TA 4R9UC 3SU8A 3VU9A 4DDWA 2XGJA 4WOPA 2D62A 3RRMA 4B71A 1JXOA 3D31A 1LY1A 1N5IA 4NYMR 2FA9A 3ZZTA 1E9SA 421PA 4IKEA 4B47A 4A36A 2EU8A 3MSXA 1TQDA 1J99A 2IX3A 2VLIA 1ZVQA 4PC7A 2N46A 1NN1A 4G5GA 1X8JA 3VR2A 4DLSA 1GFIA 2CLSA 1FL9A 3G5UA 4GOJA 4OK3A 1Z0KA 1ZINA 3QIAA 4P0TA 2IEYA 3U7EB 1T8UA 1TEVA 2WWXA 4DLTA 4FCVA 2WVJA 4TQAA 3O8RA 2ZR0A 2WWIA 4MA4A 1Y3AA 5EUMA 3R7WA 1UKYA 2W2TA 4G5RA 2FSIA 2ONJA 4Q03A 5B2ZA 5CDFA 3DKVA 3CB4A 4TL7A 3RS0A 2GF9A 4GZLA 3BFXA 3ZD6A 2ZRDA 5F3WB 4HLCA 1NI3A 2QEQA 1NL3A 2DFNA 1CJMA 1CBUA 2DFTA 1ZM2A 4DLXA 2DR3A 3BJIC 4C0LA 4LC1A 3LH5A 4ZDJA 3BGWA 1QHIA 1XCGB 4KSBA 3B7GA 2VRWA 4PFSA 3IQXA 3K53A 2P6RA 2JAQA 2JLYA 2QPOA 4YDSA 3T1TA 3EA5A 1W4RA 3QEJA 2VP2A 2ZJAA 4QBIA 3IDQA 3W6PA 1KZGB 5DYGA 3T12A 4PZLA 2QQ0A 4FIDA 4BFVA 4GFDA 4B35A 3BB4A 1QHHB 2BBSA 4Q4HB 2ZXUA 5JWRA 3UWKA 4GRAA 5JJKA 3OIVA 1BO6A 2A5FA 2ZR7A 5GVRA 4TLEA 1DO0A 1G5RA 2B6HA 1LVGA 1G8GA 1TUEA 4PPGA 4KXFB 4FXPA 2V54A 1XJCA 2BEKA 3H86A 2CHGA 4BFXA 3KJEA 1XCPA 1MV5A 4MKGA 2CHQA 3RANA 1N25A 1XEWY 4EPVA 2GJKA 2KSQA 1UADA 2FU5C 1XTKA 1SVIA 3N2IA 3K70B 4LDJA 1XZQA 4IDOA 2YZ2A 5SZKB 2HT6A 1W7AA 3HJNA 4URYR 4ERNA 1HEIA 5HCIA 4ZCLA 3LAWA 2HCJB 2JLWA 1GRNA 3PR1A 2NO6A 4IDQA 4MH0R 2GJ9A 3B1XA 4RKFA 4OK6A 4D0LB 4IDHA 3CM0A 4MKFA 1E4VA 2F55A 4KFTA 3VX3A 2AWOA 4IVPA 4OJKA 2JDID 2VH5R 3IBGA 3A4NA 1CF4A 2QAJA 2YWEA 2VEDA 1IONA 1U81A 2ZQ5A 2WJJA 1B0UA 1E3MA 4GZMA 1DAIA 2F3TA 4OHWA 1E2DA 4L15A 3DDCA 1KO8A 5FOWA 1YZNA 3EIHA 3K0EA 4M1YA 1IXSB 3QPUA 1U8AA 2WHXA 3ZLJA 4D82A 4L8GA 4A2PA 2D7DA 3WNDA 1GKUB 2PZEA 2OEPA 1NP6A 4EPWA 1VYVA 1KDRA 3AEZA 1C4OA 1IN6A 2V1XA 2GCNA 1K5DA 1GOTA 2PCLA 3RHFA 3MJHA 3U2QA 1SKYB 4YLGA 4HB0A 1DAKA 5JI2E 2QM8A 1E79A 4TYWA 2ZJYA 1MRSA 1VPLA 2JGNA 5F2EA 1Q44A 3EXAA 1AM4D 5H70A 2WKRA 5JJIA 3FDIA 1YE8A 1E1RD 4NONA 4V03A 2NGRA 3FKSA 4UXHA 1NRJB 1OFHA 1OIXA 4W9MC 4II7A 3ASYA 1I2MA 3EIEA 5BW8A 1W49A 1F48A 1U8YA 1UDWA 4C0QC 3HYTA 3GLGB 3NTUA 1RRFA 4Z51A 1EFRD 2ZU0C 4TL6A 3A37A 5IDVA 5SZIA 2ZVPX 4BRUA 3QSYA 1XRJA 1CEEA 1M1YE 3IILA 1V5WA 3IPYA 2W0SA 1Z07A 4A9AA 2ODEA 4XVUA 4ZV4A 3AGPA 4LV6A 1XMJA 2O8CB 1ZNYA 2WWGA 1Z6AA 2ZE7A 3NHAA 4DWJA 2AWNA 4DSOA 5DN6D 1BKDR 1KI6A 1FUUA 3GJ0A 2ZRGA 1XD2B 4M1WA 4O2LA 4MDEA 3AF0A 2GRJA 2FV8A 1HE1C 1KY3A 3D7MA 1FX0B 2VIIA 4US0R 1U90A 1JNYA 1P2SA 1MT0A 4BEJA 2GXQA 4AC9A 4TYQA 5EP1A 3VHXA 4Q4JA 3ZVNA 3IHLA 4KBFA 2AXPA 3BC1A 2OBLA 3CR7A 2AK2A 4JLNA 4QC2A 2G1KA 4UQOA 4EJSB 3OF5A 3FKSD 5B58C 1DAGA 2ZJ5A 3VHLB 3QXCA 4CW7A 4DLZA 1S96A 2A5GA 3FFBA 2CEAA 2X1VA 2F1IA 3AVXA 2RGAA 1G3RA 3U4QA 3U60B 4HSEA 1YRBA 5HPYB 3GLIA 4AKIA 3KXIA 2ZAMA 1Z22A 1XPOA 1FMJA 5EP3A 2AKAB 4OQLA 4IFEA 1BOFA 3GJ6A 3MGCA 3K0CA 4JL5A 2J0QA 4M1OA 1OXTA 4D80A 3UPUA 1G8YA 2A5DA 3KX2A 1IY0A 1FTSA 3NH9A 4V02A 4B33A 4NMMA 4DIDA 3W5IA 1UM8A 3R7WB 5EP2A 2B8TA 1E9RA 2EYQA 2JLRA 3SYNA 3R8CA 2ZYWX 4TMVA 4W5HA 4PC6A 1OH5A 4E22A 1KDPA 3O8BA 1ZCBA 4O25A 3CZPA 2C96A 3UG6A 3AF4A 1AZTA 1MO5A 1XEXB 1XTJA 1G5TA 4DDUA 3FWYA 3EX7C 4FINA 5TMPA 4A15A 2F9MA 4CDGA 2ORVA 1OXSC 1XBTA 3AF3A 5JHGB 5JMTA 4LJ4A 3PEWA 1GM5A 1NNEA 3VKGA 1GZSA 1E2FA 2XXAA 1JEEA 4CEJB 1RZ3A 1RW4A 2BMJA 5F9HA 2REOA 5FOUA 3F3YA 4Q4HA 5SZHB 5HCNA 1OJLA 1SQ5A 1GILA 1ZD1A 2OG2A 2VO1A 4Q9HA 2QM7A 2CK3D 4NCKA 3WYFA 5CYOA 2JLUA 4DB2A 5BYKA 4KODA 2ZUCA 4HATA 2QE7D 5L3VA 1OF1A 2ASEA 1QF9A 4POAA 1G6HA 3RAPR 1OKKD 1G3MA 2YINC 3QY0A 4N3NA 5KNCA 1F5NA 2AL7A 2XOKD 4KITB 1N5JA 1R0YA 3CLVA 2GF0A 221PA 2ONKA 1JJVA 2JEOA 5AUNB 1EFHA 4OQMA 3TAUA 3WRYC 2HT1A 3EPKA 3C8UA 3FE2A 1NN5A 1DAFA 1G1MA 1P61B 2RGGA 1N6OA 2EFDB 4ZPXA 4C0KA 5EE3A 3PUXA 4LK2A 5FUXA 2WSSA 1GUAA 1X3SA 3X1XA 2KE5A 4TMZA 4IVQA 1JPJA 2ZPTX 3ICQB 3AF2A 1G9XA 3BB3A 1ZNXA 4RSGA 4WZAE 1VYUA 3L82B 4A0GA 1Z3IX 4B3DA 1W2HA 4ZDIA 5EXXA 3HR8A 2ZE6A 2BCGY 3WHKA 2OXRA 3QF4B 3E2IA 3ZGXA 1G7RA 3BBPA 3QF7A 1QG4A 2JIZA 4LPSA 3RRYA 3DKPA 2J87A 2BEJA 2XX3A 4C2UA 3K0CC 4BUJA 1MABB 4LPKA 3K0FA 1E94E 4PQFA 4YC7A 5DIFA 1LF0A 3B9QA 4M1SA 4F7WA 3KKNA 2GAOA 3KDSE 2QA5A 1IY1A 1P9NA 3U5ZB 3T15A 4BFYA 4C3ZA 4D4LA 4IDPA 3KXLA 1YR9A 3P4YA 3GFPA 2QGNA 2ZROA 2QU8A 4BGDA 3CRRA 1S0UA 4FN5A 5CIWA 4BRWA 2ANCA 2ORIA 3HPRA 2PL3A 4KYIB 5CLLA 2VSXA 3RS7A 2RHDA 1RPZA 4XWKA 1GL9B 1EX7A 2ZYTX 2XZLA 1T3HA 2KWIA 3ASZA 1MABA 4JS0A 2IS2A 1W36D 1R5OA 1JXMA 1OV4A 3PENA 1DADA 2QN6A 1LFDB 1AJEA 1DARA 3CX7A 2NO1A 4TSFA 4AK9A 2XB2A 1MR3F 2EWVA 2IHYA 1R8SA 4C4PA 3ADDA 2BHRA 4D4MA 1QHXA 2ZUBA 2QI9C 4EJSC 1GAJA 2IUSA 1KDTA 4P4SA 1T0HB 2QE7A 2BOVA 4HLUC 5CK4A 4AYWA 1ZC3A 4FCWA 4KLNA 3R9WA 2O8CA 1E9AA 3MWLA 2GEDA 4DDTA 3X1YA 4PPNA 3C14C 4UNNA 4C0JA 2J3EA 3K0AA 3LQQA 1U8ZA 2GBLA 3JZAA 3QXHA 3OIYA 3BH6A 3ZIAA 3MMPA 1P72A 5DI9A 3B1VA 4QRHA 1XTQA 4HDQB 1NG1A 1IN7A 1XDBA 1U94A 1AS3A 3P20A 4C0HA 1XXHE 4D6PA 2D74A 4V0ME 3Q85A 2LKCA 4DRZA 1VTKA 1ZM7A 3I8SA 4OBEA 1EFUA 5KDDA 2KJQA 2QZ4A 2O8BB 2FZ4A 2OUKA 1NKTA 4XWOA 5J4YA 3MJRA 5EE5B 5J4VA 1NVVR 2OESA 2HYDA 2VP4A 3OFNA 4NH0A 1OXXK 1DOAA 1A4RA 4OQFA 4RD1A 4A0HA 5E4FA 2GNOA 1GSIA 2ZRNA 2I3BA 2CCGA 2CBZA 4PR0A 3KZ1E 3CNNA 1P9WA 2ZE8A 4JKYA 1W0JA 1SVMA 4TLCA 4V0NA 2IEZA 2O0JA 2GBLC 2FPMA 2RCNA 4TMKA 3TUIC 4DUGA 2NG1A 1E0JA 2ZYVX 3KQLA 5FI0B 1R5NA 4HLDA 4A1FA 2J7PA 1S9HA 5C46F 2WWWA 4Y0VA 1DELA 4HLUA 1E9CA 3SJZA 2ZRMA 2O8BA 2N1BA 4PHTA 4E5UA 2HUPA 2UZIR 3W9YA 1TAGA 3B85A 4B2LA 5KU1A 3WP0A 2OFOA 3BXZA 2O8EA 3MCAA 4L9WA 3I62A 1IOZA 2ZI4A 4OHYA 5KDOA 3GLHE 2GK7A 2R6FA 1KK3A 5EXSA 2IWRA 1LF5A 2FEOA 5C1BA 4MGYR 821PA 5L3SA 2VP0A 4LX0A 2C95A 2AFHE 2DYKA 2W6JD 3OESA 5LPNA 2XZPA 1YR8A 1G3UA 3KKPA 4Q7LA 1ZNZA 3LXXA 3VR5A 1OT3A 2QRNA 4M1TA 4HAVA 5KSZA 2QY9A 4EKDA 3U3KA 4WXRA 2Q9AA 1U0LA 2RGDA 5TV2A 3DHWC 1FW6A 4WA7A 1DAEA 1KKMA 4DVGA 3IEUA 2C04A 4AD8A 1T5IA 3KQNA 1KDOA 2DB3A 2XITA 5EZ5A 5C4MA 1Q12A 4ESVA 2YWHA 4OKSA 1MKYA 4CVNA 5L3SB 4U5XA 1E6CA 2AHOA 1OH6A 1KTVA 4S2EA 1AIPA 3T34A 4ZIRA 1P3JA 3QEOA 2BV3A 4P31A 5DYIA 5FTJA 3QKRA 3QKUA 3KB1A 4UXIA 3QBVA 1VIYA 5KNBA 4PAQA 5CJPA 2AXNA 1I2DA 2N42A 1TU4A 2PT7A 2FGJA 2GJSA 1BMFD 3Q7QA 1W5SA 5CJ2A 4TMTA 3LRPA 4MGKR 2CVHA 3WMEA 1G19A 2GWHA 4Q18A 5CK5A 3THWB 4PC3A 2DPXA 2R8RA 2CMKA 4LV8B 4Q1DA 2IYYA 2OLKA 2CNWA 2W0MA 4IVRA 1CRPA 2ZS9A 5EZ6B 3SJBA 5GJCA 4B74A 3I5XA 2QT1A 2WJIA 4MRSA 1E2NA 2P65A 2YKGA 3MUFA 2IYWA 1TPZA 2TMKA 3QVVA 4RCZA 4PO1A 5LDDC 4NL4H 4I1SA 1YR6A 3IKJA 4MITA 4FCTA 3QF4A 2F3RA 3H0KA 3OZXA 4Q1CA 3OAAD 1NJGA 2BMFA 2ZRBA 2VQSA 3GFOA 4PAOA 4TLDA 3THWA 2V3CC 1JPNA 4BEBA 1OSNA 3THXA 3THYB 5J4KA 1DAHA 1G16A 3ADKA 1DBSA 3QVUA 2FH5B 1OPXA 1GP2A 2EVWX 5FI1B 3N70A 1ONBA 1M74A 3AV0B 4R98A 2CVFA 1JEDA 3K09C 2B7BA 1E9DA 4D0NA 3QBTA 1J70A 1MOZA 1Q20A 3MG9A 4TT3D 4EFLA 1XEFA 3GEIA 5FR1A 3RSOA 3LA6A 1OYWA 5BN3A 1GRRA 1H8HA 1XXHB 3TJZA 1HUQA 4B3CA 5SZJA 2FFQA 2OCAA 2XTMA 4WZ6A 4JBXA 4QHTA 1Q22A 3LV8A 1TF5A 3NKVA 1JI0A 2OAQ1 2WZQA 3NVAA 1SGWA 2UZ3A 2LCFA 2Q9CA 2GJ8A 4RZ2A 3IO5A 3ZQJA 1KI2A 1NVXQ 4P4UA 1XCMA 4FMBB 2WJHA 4G01B 2GETA 3GLHB 4MRVA 1AZSC 3DOFA 2G83A 2H16A 2JJ2D 5TXGA 4L4UA 2NOAA 1W36C 1GNPA 4JLKA 2GA8A 3C4JA 3H1TA 2X77A 4Q7MB 2RAPA 2O8FA 2ZI3A 1IY2A 2F1HA 3AM1A 2B8WA 2ZS8A 3RSLA 2P6UA 3RVBA 3GLGE 5FOXA 3W8NA 2BWJA 4BFSA 1TTTA 3UMFA 1ETUA 4QL3A 3U3JA 2ZRAA 2IYVA 4I4LA 1NBMA 1FZQA 1T8TA 2J0SA 4QNMA 3REGA 2QSZA 2BKUA 5FH9A 1Q1ZA 1IJEA 3I3SR 1MO3A 2CLDX 5E7JA 3RABA 1AKEA 2PX0A 2GESA 2V9PA 3OEHD 1W0KA 4YMSA 3UG7A 2C9OA 5JCZA 1S4QA 3GLHA 4X8LA 3W34A 1WQ1R 2QTHA 2ZSEA 1W4AA 2GTPA 2EW1A 3BS4A 3GLFA 1RRPA 5EE1A 1PV4A 4PSVA 1P2VA 3B82A 1R7RA 2XB4A 1FNNA 3PEVA 4E07A 3SNHA 1DVRA 1XNJA 1N0WA 1OIVA 3I61A 1ZIPA 2MSDB 2PZGA 1SXJD 4Q47A 5BWMA 1G4UR 1QHGA 2JLXA 4BZPA 3CH4B 1KI9A 2VHQA 1EWRA 3QKTA 4DIEA 4ZI2A 2E1RA 2W00A 4AYTA 3A8TA 5IK2A 1LS6A 1DG3A 1TF2A 5L3QB 2IYQA 3SN6A 3TGPA 2V1UA 1H8ED 2GCOB 2WJGA 1CJVC 4NZYA 3GLFB 2GCPA 3QQ5A 2V7QA 4URWR 4OL0A 2QTVB 3SR0A 3L0OA 2WAXA 3LWNA 5CB6A 5G3ZA 5KTYA 2MSEB 3EZFA 4LHYA 2G88A 3L0SA 2HEIA 3SBEA 4HZIA 1T91A 1H8EA 3IUYA 1Z0IA 2YYZA 4I1VA 4B34A 2XNSA 1QG2A 4HAWA 2IUTA 4ACAA 1TX4B 4NYMQ 2EYUA 4RY2A 5FFMA 3LBNA 2K5UA 2Z83A 1DG1G 1G17A 2DWOA 4NBSA 1XD8A 3UATA 2OAP1 2DWQA 1B23P 1LS1A 2IYLD 3W3ZB 3I32A 5DISB 2ANBA 4URXR 4P33A 1XX6A 2W2XA 3IBYA 5KDLA 4FWTA 5AJXA 2ZJOA 5GADl 4AI6A 2BBTA 4LRWA 3HWSA 4JLVA 4ACBA 3PITA 5ANRB 3VR6A 3KJIA 2OT3B 3R9XA 1BIFA 5D3MA 1E2HA 5IRCD 4JVLA 3NC0C 2CLCX 2A3RA 2HLDD 4DLWA 2ODNA 2P6NA 3KKMA 2HV8A 3HU1A 5CYPA 1AA3A 5DN6A 1FUKA 2OBNA 3CH5A 5JI3E 1UKVY 2GK6A 4HDOB 2WWYA 2MSCB 2WSSD 2ODWA 4LC0A 2OILA 2ZR9A 4A0RA 2ZREA 2QROA 4NYJR 2ZRLA 1JR3E 2IK8A 1ZNWA 4LY6A 2J7KA 3DM5A 1J7KA 4Z1MD 3CRMA 3I73A 5JECA 5JFGA 2WMNB 4YMUA 1GTVA 4KO8A 3FMPB 1UFQA 4N0DA 1RJ9A 4Z54A 1E0AA 3MD0A 4W5JA 3VR3A 2XJ4A 2C98A 3FB4A 1KMQA 1UJ2A 4JT4A 1S1MA 1ZBDA 2RHMA 3B13B 3GJ5A 3H84A 1HT1E 3L8YA 1U99A 1RIFA 1S1CA 2JLSA 4JL8A 2V6JA 4OYHA 4QBFA 4W7SA 4LJYA 2G3YA 5AJZA 5HE9A 3THYA 2B7CA 3UWOA 4CZ2A 1E2JA 2AKYA 5BN4A 3I5YA 4RZ3A 3K70C 3PG5A 1G18A 3A4LA 3GPLA 2UVQA 3A36A 3C41J 4H1UA 1EG7A 3LFUA 4BLOA 2NIPA 2V8OA 2OFWA 2GVZC 3DOEA 1T6NA 1GKIA 4HAYA 4LHWA 2VYFA 2NO7A 3SQWA 1IM2A 2NPIA 3B5JA 4B73A 1KSFX 1W4BA 2EWWA 4OK5A 5TVKA 5A4JA 1A1VA 3R20A 4YMWA 1Q0UA 2YOFA 3EWAA 1N0UA 1FFHA 2I1VB 4W5WA 1NSFA 4LHZA 4BLQA 4B44A 1XJQA 3LX8A 3S1AA 3ZS8A 3GJ3A 3SEAA 4B3GA 3PFIA 1AS0A 4WVFA 2ZI5A 1YQTA 1EFCA 2YC4C 3TRFA 2YVUA 3A1UA 4TMXA 2R6DA 3PUWA 1MO6A 4HUQB 4NYJQ 2F43A 3HP1A 4DKXA 1Z6TA 2IF0A 3AQ4A 3QENA 5DO9A 2GEUA 5E95A 4TTRA 3F0TA 1KJWA 1XU4A 3K9HA 1L7VC 4AKGA 2VSOA 2ZRHA 4K46A 4AG5A 4NCIA 4C7OB 1VECA 1WMSA 2FGKA 4QHYA 4ARZB 2G0NA 1NY5A 2ZANA 3IPXA 1KOFA 3FMFA 3TSZA 2ERYA 4YQFA 1II8A 1T4GA 3CWZA 4GBMA 4BLTA 1Z0JA 4HUQA 4NCHA 1XB2A 4F93B 1GG2A 3TW8B 3RYTC 2PMDA 4JZKA 2OO7A 1ESNA 3F5FA 3SYLA 4PC1A 1CLUA 2J0UA 3KB2A 4N1AA 4Q02A 3TSOA 2YHSA 3PUYA 1XWIA 5FTNA 1T5LA 1W1WA 3EW9A 2RKOA 4RD0A 5DNYB 2CDNA 2RGCA 3OE7A 2FEMA 1OH7A 1TF7A 1PUIA 1I4LD 1AS2A 2BJVA 1YZLA 4Q19A 4DBLC 5AUPB 3M4YA 1UBEA 1Z0FA 3T06B 4LYFA 2ZS7A 3KFVA 2CK3A 2Z4SA 3DL0A 4HI0E 1E2PA 4URVR 3QPVA 3L2OB 4NYIR 3PXGA 4DB4A 2Y8EA 1JALA 3KTAB 1HV8A 1IAQA 2H18A 2ZI9A 3FFAA 5EUQB 3RRNA 3SFZA 5ELXA 2D2FA 1UEJA 3CX8A 2CE7A 1FNMA 4LCBA 3RS5A 4DUGD 3HYRA 4BFWA 2WWFA 1EX6A 4R71A 5JS8A 3V4FA 4OI0A 2WOJA 3LXRA 4E03A 2FOLA 2V7QD 1Q3HA 4CT4B 1KIMA 2NMVA 1UPTA 5LB4A 4NCNA 3KUDA 1A2KC 3OIUA 3AVUA 4MDFA 1R8QA 1SKYE 4EPXA 2XTZA 1N6PA 4XJXA 4F92B 2FPKA 1E69A 3B1YA 3FHTA 1Z2CA 1TUIA 2L0XA 5AWFC 2C8VA 4A6XA 4XOIA 2R6AA 2EFHB 5BXQC 3B9PA 1YKSA 4RD6A 3TBKA 2GAAA 1P7CA 3HU2A 721PA 1WB9A 1Z8FA 3V9PA 4HZUA 2G0TA 1M7BA 2EFGA 4V0LA 4G1UC 4JYCA 1N6IA 4LGMA 5L8VA 2VHUA 4CEHB 2H8KA 2AFIE 1CR0A 2F6RA 3M0EA 3NBFA 1ODFA 4A8JC 1LW7A 3LW7A 1CJKC 2D7CA 1KY2A 2P3SA 2YJTD 4M4SA 4R2IA 2XTNA 4XSGA 1XP8A 5CM8B 3UK6A 1NF3A 1WA5A 1OE0A 3WBJA 2FMXA 4TL9A 5JZVA 4JBWA 2JATA 3VMFA 4O2RA 1U98A 1CS4C 2E9SA 4MRPA 3AVQA 3SE0A 1OW3B 3L0IB 5DI3B 5KO2A 2YNMA 1LNZA 2OM2A 3UXMA 4BFUA 4TZ0A 5D3MB 5JEDA 1YHNA 3CKLA 4IHQA 4PHGA 5C4GB 3TW4A 1UKEA 4MYHA 2CHVA 3W5JA 4JT2A 4M1MA 2R2AA 1HY3A 1SULA 1OYYA 3QKSB 1KZ7B 3HU3A 1KSJA 4U00A 4Q1BA 1VCIA 2VL7A 2CE2X 4LBWA 2QGZA 3UMSA 4WZBE 2AD1A 1HH4A 2C78A 3AVOA 3FHCB 2KBEA 4WW0A 4DCSA 4LOAA 2QP3A 4DSUA 2IXGA 1FX0A 4URUR 2PLFA 1W47A 2VP5A 4CEIB 2G6BA 4GDFA 1KMHB 5FPYA 5FL7A 2ECKA 1CR4A 5C2JB 2Z0MA 5CITA 4CF7A 3RLFA 4EQ6B 2O8DB 4UKDA 3QKSA 3IO3A 4DEXA 3QXJA 3PUZA 1VYTA 3AVYA 4OHZA 4HB2A 3IHWA 4QKQA 2REBA 1AK2A 1DTSA 3LD9A 4Q4LA 2P0EA 2J7PD 1SVOA 3QUSA 4EUNA 1VMAA 3ZVRA 5FPKA 4LYJA 2H57A 4M53A 3SC3A 2JDIA 1R4AA 2WJYA 1OKKA 1U9IA 2Z4RA 4Q9LA 3NDBB 1N6HA 2ORWA 1KMHA 3EZ6A 4KSCA 3ZS9A 4Q1AA 4A82A 4EFMA 3K8YA 2O8DA 1GRQA 3H2YA 3AH8A 3K70D 3VNVA 3LNCA 5IHPA 2YC2C 3P27A 5DHAA 5JRJA 4BE7B 5JCPA 4B43A 5KHOC 4KU4A 1WF3A 2FNAA 2OCPA 2VPPA 2FSFA 1F2UB 2CJWA 2IBMA 2RGNC 3OAAA 4PPQA 2ZSDA 1JAIA 1TQ4A 1DO2A 4NDZA 2ZRIA 3BB1A 4FD2A 3RNLA 1EK0A 1YVDA 2A5JA 3IGFA 4YDHB 1XEXA 3T1VA 5DLQC 121PA 3QJYA 2A7QA 2ZAOA 5B57C 2J46A 1NVUQ 1S3SA 1VIAA 3SFVA 3G0HA 4F91B 1XTRA 3IEVA 4ESHA 2CL0X 2J1LA 1SHKA 3PV0A 2IYZA 3I1FA 1XMIA 3LLMA 4FI3C 4CEJA 2BCJQ 1D6JA 1VCOA 2RGNA 3TQCA 5AR1A 2PCJA 4DCNA 2R44A 3LBHA 4JSYA 3RWMB 1W36B 5DH9A 2ZRPA 4PO9A 1JR3D 4ARZA 1K6MA 2BBWA 2JJ2A 3K9LA 4JLDA 1HE8B 1BYUA 1D2MA 5B64A 3GJXC 1CP2A 3RS3A 3PVSA 1KO4A 4LJ5A 5CDFE 1UBFA 2I4IA 1XPUA 5JHHB 2IT1A 2XSZA 3P32A 2OBMA 2ZRKA 1FQKA 2GJAA 2QP9X 4L16A 5AJYA 4BPBA 4HAUA 4GOXA 1QHNA 3C7KA 4QGHA 1QHYA 4JLJA 4NTZA 3VR1A 2FFAA 3HR7A 2WKQA 2IXFA 5HE8A 1QHHA 3JVUA 1Q3TA 2FSGA 3OHMA 4DDVA 1E0SA 4Z8XA 4HAXA 4IOKA 2H7VA 1E79D 1KI7A 3MFYA 3EC2A 2WPDA 4C0SA 5D3QA 5J40A 4DSTA 2ZI7A 2X2EA 4BWYA 5KNDA 1E4YA 4ABYA 1GWNA 1Q1EA 1FQJA 4OQNA 5H1YA 1TL7C 4NKRA 3ZZ0A 2AK3A 3AB3A 3E1SA 2VHJA 4URZR 1Z6GA 1CR1A 2YWGA 2XNDD 1U9IC 1PLJA 1NMZA 2D06A 2YOGA 3FYHA 3ZDQA 1S2MA 3X2SA 4XH9B 4K81B 4DLUA 1X1SA 4HDCA 3CPEA 1OB2A 3TLXA 3GCGA 3T35A 1A2BA 1EFRA 3DM9B 1VCNA 2P67A 2G77B 3SS8A 3KQKA 1GKYA 4FMCF 4KI0A 5KSPA 3AKCA 2NPFA 3W3AA 3EZ7A 2EFCB 3A1WA 4TTPA 1VG0B 3GJ8A 1ZAKA 3CNOA 4NE2A 5JJLA 2IA5A 3CRVA 2C9CA 1ZYUA 3MWKA 1QDEA 4KHZA 4GT1A 3I4LA 5FPTA 5FTMA 3B1ZA 3RWOA 2PT5A 3ECCA 4GP7A 2GHIA 2ODBA 1COWA 3OFND 4OQXA 3T1QA 2FFBA 1OH8A 1H8HD 4TYNA 4L9SA 1RFLA 1VKJA 4C30A 3AUXA 4QGAA 4PANA 2ZRFA 1Z0AA 1HYQA 2I1QA 3BAFA 3I92A 4MUBA 1Z06A 4IFBA 4U02A 5TY0A 1EFTA 2OXCA 4Q9KA 2W6IA 1SHZA 4TMWA 3J81k 1Q57A 1XD2A 4Q5IA 3GEHA 1SXJE 3ZYCA 3BK7A 5FTLA 5FPSA 4MRRA 3ADBA 1NVVQ 1E2LA 4HB3A 1O3YA 5FR2A 4F38A 5DI3A 2JLQA 1UBCA 2OFXA 5K8UA 5GJBA 4Q9IA 1XZPA 4MYUA 3DZDA 1WP9A 4RZUA 3EIQA 3GEEA 3LVRE 3AVPA 2KI5A 3SDZA 4P4SB 1ZUHA 4Q4JB 1Z63A 4TTQA 4FWIB 3P1JA 3TR5A 4CYMA 5CB8A 3L8ZA 4PSAA 2HXYA 2IS4A 1ELOA 2OV2A 2PH1A 3GJ4A 1E2QA 2J9RA 2QPAA 1XMVA 4WIAA 4HB4A 1Q1QA 3AVVA 1CJTC 2BMEA 1KO7A 4JBYA 4Q00A 2XEXA 2IUUA 1SXJC 3C5CA 4MRNA 5IF9A 5FBLB 4MUAA 2FJUA 1PLLA 1KO1A 1CTQA 1ZD8A 3RS4A 5K8LA 3CBQA 3DZ8A 3VU9B 4DCUA 1E1RA 1W2GA 1COWD 2BVNA 4QFMA 5FOVA 1KAOA 2O0HA 2BMDA 1E1QD 4Q7KA 1Y63A 1VG1A 2J59A 4TLBA 4UJ5A 1J2JA 1E32A 1ZCAA 1G8HA 2DHRA 2IYSA 1ZM9A 3EARA 4LBZA 3W8RA 2JJ1D 4NHOA 1EWQA 1KI6B 2XNDA 2DFKB 1OIWA 3FMOB 4XVRA 2NZ8A 1L4UA 5E7MA 1JJ7A 2Q3FA 4Q7JB 4LBVA 5HZHA 3FHOA 1YZQA 1EGAA 5AJVB 3SI7A 1XFAA 2ZSAA 4ZDKA 3LO5A 5BQ5A 3RC3A 4KFSA 5DHFA 1D2EA 1X8LA 3O8DA 3BE4A 1KI8A 1D9XA 2O0KA 5P21A 2XXAB 4Z1MA 3T5GA 1YZUA 1RRGA 3B2EA 3R9IA 2ZJ8A 2C77A 4ZDWA 2IYUA 2QMEA 4ZKEA 1E9BA 2IS1A 3Q72A 1U0HC 3CF0A 3U6BA 1MO4A 2WBLC 4M9XA 1AN0A 1F2UA 1Z83A 1ZW6A 2CJWB 3U61B 3T61A 3DMDA 3QE0A 4LHXA 2MMGA 3L43A 4UXJA 4E09A 2GXUA 4EPRA 3VKHA 2UKDA 3WXMA 5IK2D 3V4RA 2ZJZA 1VHLA 3U3OA 4IOLA 4TQ9A 3NBZC 5CIQA 4EFNA 1DS6A 1E9EA 3CF6R 1ZM4A 3EPHA 3GLIE 1G5PA 4D25A 1GITA 3TUJC 3CRW1 1N6KA 2R6CA 2ATVA 4B3XA 4PZZA 3X1ZA 1JAHA 2PJZA 3OIWA 5JSZB 2H5EA 1P6XA 4DHEA 2J0VA 2QBYA 1IBRA 4HAZA 5E7IA 3WNCA 1ZMXA 4YXWA 1QVAA 1KYIA 3FVQA 4KFRA 3QKRB 4UNSA 3GLFE 4HYYA 4MYTA 1D2NA 2XSZD 2GVDC 4N0EA 4B32A 1K5GA 1M8PA 3CIOA 2JLVA 2W6JA 4LJ6A 1NBME 3P26A 2PZFA 2HJGA 4WAUA 1W4CA 2J5XA 2HJVA 4DT1B 5K8IA 4HUTA 5FTKA 4XVQA 2ZETA 4M2LA 1YRAA 3QPWA 3K0FB 3PJRA 1WDTA 1OLOA 2E87A 4Q4AA 4JIMA 2QBYB 1GL6A 2A2ZA 3FKQA 1EXMA 4RJLA 1RC8A 3ONWA 4X8HA 3THOA 5FOSA 3Q7PA 1C9KA 4F4CA 2RGXA 2C03A 4BASA 2F9LA 4JJZA 1GIAA 1NLFA 3TNFA 4A2WA 3NIBA 3B78A 4K8OA 3EZ2A 5A0FA 1NLYA 1R0WA 3NEJA 4TN1A 2IS6A 5G53C 4OHVA 2QAGB 1W0JD 3R8FA 1YJ5A 4BLPA 4B3FX 4I1UA 4Q4AB 1M2OB 1BMFA 2ZVQX 4FW9A 2QMUA 4RFSA 2J41A 621PA 2CCJA 4QJ5A 4ITRC 3OEHA 2BM1A 2BBOA 2IL1A 1CU1A 3ZJYA 3BH0A 4KLZA 1P60A 3NH6A 4MKHA 3B8HA 2IW3A 3Q5EA 1GNQA 3W6OA 3EWSA 1W46A 2D4HA 4IDNA 3OEED 1NG9A 4DLYA 1UDXA 2WTUA 4NPHA 1NLZA 4DSNA 3K0AB 2B92A 1SXJB 3GD7A 4NP6A 5JEEA 4KAXA 3KQUA 1KJZA 1X6VA 5TARA 2GDJA 5FBRB 3EASA 3C16C 1WE2A 4RFSB 5K8TA 3K09A 1P73A 4C0AC 3AVWA 3TVTA 1P4SA 3DMNA 2HF8A 3TAHA 4A0FA 3QG1A 1W5TA 3NBXX 3QXXA 4M8NE 2O8FB 3KKQA 1XTIA 3PEUA 3QG5A 4A92A 4V0MA 4D4JA 3SJAA 4O3MA 1UAAA 1RE0A 2QPTA 3D3QA 3U44A 4ZKDA 3A6PC 2ZITA 3A1VA 2AN9A 5J47A 3CUEF 5LD2B 4Q21A 5B30A 1LB1B 5G40A 2BDTA 1Z0DA 3M1IA 3TQFA 1NN3A 1Q21A 2ZM5A 3RRZA 3ZH9B 1FOEB 4M9SA 3EZ9A 1X86B 4DZZA 3O47A 1G64A 3AVTA 4JYBA 2FN4A 1G291 3WYGA 1JB1A 5FL7D 4KV9A 5DGXA 3AF1A 2WWHA 2BM0A 2O8EB 2GKSA 2GXAA 2GILA 4IXMA 3EPLA 3FOZA 4Q48A 4ASUD 5J4LA 5DE3A 4EJSA 4OI4A 2BC9A 3ZQ6A 4PTLA 1AKYA 2NO9A 3WY9A 2O5VA 1T9HA 2YWFA 4B76A 1KO5A 3HPQA 2OZEA 5H8WA 1ZIOA 3U4QB 2RH5A 4TZ6A 2LWIA 3WMGA 2PBRA 3GLIB 1QRAA 3RC8A 3AUYA 1KAGA 5AJWA 1M7HA 1AGRA 4IOJA 4QOSA 5KUTA 1AQYA 5L3QA 1ZUNB 3IIJA 4GMDA 1OHHD 1M6NA 2IC5A 4IXNA 1WBBA 3LX5A 4UNPA 3UKDA 1KGDA 2ZI6A 4LI0A 1OB5A 1V43A 4C9BA 4LJ9A 5LD2C 4D26A 4ZCIA 4D2IA 3GQBA 4B6FA 4V0KA 3T1OA 4M9QA 2J45A 3LVQE 1CIPA 2EFEB 1A82A 2CL7X 4B2PA 4Q66C 2XOKA 4C2TA 3OEEA 4CT5A 1PJRA 5FUYA 3VAAA 4A2QA 1ZP6A 5E3HA 5FBVB 4BFZA 1A5TA 1P2TA 2C9YA 2FX3A 2ZJBA 4JVNA 4BZQA 2RB4A 5UKDA 2ZIAA 3WYAA 4EPTA 4D81A 3EC1A 1CRQA 2Q0HA 1T0JB 4DXAA 3TVDA 1KI4A 3U6KA 2GZAA 1YZKA 1N2CE 1F60A 2VHTA 4KYUA 4RD4A 3BIFA 2FG5A 1G21E 2AD5A 1E0KA 3G82C 3FTQA 3BH7A 3KJHA 5F9FA 4O0MA 1FMLA 3HDTA 1JR3A 2H1LA 5F98A 1IN5A 1E2KA 1UKZA 1WCV1 2WV9A 1P9RA 2KB0A 2PMKA 3ZIAD 5JSZA 5GJVC 1FPMA 5HKKA 1TADA 1LV7A 3BD9A 4JLPA 5GJWC 1XJ0A 4YXWD 4DLVA 1FP6A 1PLKA 2VSFA 5KYKA 4RCYA 1G7TA 1X1RA 4PQRA 3ZD7A 2ZU6A 3IIKA 4AKEA 3PUVA 1ZC4A 5KPDA 1P75A 3DPUA 4GOKA 5J4HA 4LWZA 4UNQA 3I72A 5A5GA 4H9GA 4LJ7A 4DT1A 1XF9A 5HKKD 2VP6A 1HURA 3MRSA 3CO5A 4QG7A 2IYXA 2IF2A 5FL3A 1US8B 3N2EA 3Q9LA 5KOYA 3U7GA 4YMVA 3RS2A 5EQTA 4XD7A 2G1JA 3IIMA 1J8YF 2QAGC 2Q21A 3AP2A 4DLRA 2LKDA 3E70C 5FBQB 3X1WA 3KUCA 4UJ3A 5HZKA 4CRWB 4DCVA 4ZIRB 3CPJB 3Q5DA 2ZE5A 8OHMA 1O87A 4US1R 2QP4A 2F7SA 4QBGB 5G41A 2ZTSA 2FSHA 3CR8A 4KCGA 3NEYA 4ZO4A 1OFIA 2C99A 4PHHA 1JR6A 4XD7D 3A58B 3DO6A 1I4DD 3I8XA 2JCSA 1N3BA 5JWHA 2X8AA 3GP8A 1F2TB 4PC2A 1Z28A 1XXHA 1XPRA 3CWQA 4PPFA 5JLJA 4JLAA 2QAGA 4FMCB 1HA3A 2B21A 2C2HA 5FBWB 4IOMA 3TKLA 2ZEJA 2ZRJA 1VCMA 5C18A 1ESMA 2RGEA 3NXSA 1KNXA 3A4MA 1KKLA 4XSHA 1II9A 1FP7A 1VHTA 2PLRA 4XTCS 3ND9A 2HYIC 3N5CA 1RYHA 4X8OA 1KSGA 3VQTA 1XTSA 4Q1EA 4F4IA 1KSHA 5FPHA 4QXAA 1IN8A 4ZCMA 2WAYA 5CLQA 2D2EA 3SHWA 1NVWQ 3S1AB 4M22A 1R5BA 3KL4A 1AGPA 2NTYC 3AKDA 1SXJA 1SKQA 3AP3A 4PZYA 1TNDA 3PCRB 2PJRA 2GZHA 4LBYA 4EDHA 2OE2A 3FMIA 1ZJ6A 5IT5A 3GMTA 4LUCA 2F43B 1HQCA 3B6EA 1VDZA 1RKBA 1R0XA 2QNRA 2QTFA 4MQBA 1E2GA 2R6GA 4DEYA 2Q6TA 4ON9A 4YONB 1VG9B 2GEVA 5FUWA 2NO0A 1IJFA 4ZI3A 1Z29A 3JZMA 2O52A 3U7FB 3EA0A 2EQBA 3SHFA 3U44B 3NC1C 4H1VA 4RKEA 4EIWA 2ATXA 2ERXA 2IWHA 4OJQA 1PZNA 3UIEA 2WKPA 3NWJA 1OFUX 2CL6X 4JLMA 1FTNA 5EXTA 2FE4A 1DAMA 1U0JA 4UNRA 1DEKA 1G8FA 1QHSA 3EAQA 2A78A 2GCOA 2Q3MA 1CULC 2QMHA 4TQUS 1CKEA 4ASUA 2NZJA 5BN5A 4BQSA 5JS7A 4JKIA 4M1KA 4Q01A 3QNUA 5KSOA 1IHUA 2XJ9A 2H17A 1JECA 3ZVMA 1S3GA 2OLJA 1Z47A 3TIFA 4YMTA 1CR2A 2YOHA 5G3YA 4B48A 1H65A 1E1QA 3C5HA 1AQUA 4M9ZA 4QGGA 5EE0A 3SBDA 1R6BX 3WMFA 1L4YA 2JJ8A 3X1DA 4A4DA 1G4AE 2D3WA 1II0A 1IN4A 1E98A 3BERA 1Z08A 2V4ZA 1XEWX 1AA9A 3CX6A 4XIGS 2Q3HA 2R65A 3TK1A 3GJ7A 2QQEA 2WICA 3MLEA 1ZU4A 1SZPA 2W83A 1NSTA 1X8KA 1Q1BA 4NCJA 1J90A 5AUOB 3AGQA 1NBMD 4G5SA 4BZXA 3WBKA 4TL8A 3NBYC 3SYKA 4DJTA 1A7JA 1UBGA 1KHTA 3OE7D 5LBIA 1G41A 2FF7A 1GNRA 1R0ZA 4AURA 5JRZA 2H92A 2W2VA 1XD9A 3IQWA 1IQPA 3PIRA 4PHFA 2Z6VA 1R2QA 3CNLA 4L5BA 4KVAA 5TB5A 4JMPA 2A30A 4HZUB 4EPYA 1ZM3A 2Q9BA 4GPTA 3V00A 3UANA 1E96A 1ZD9A 3MAAC 1OXUA 5EE9A 3GFTA 2GZDA 3PQCA 1OFTA 1Z6YA 3VR4A 5KSYA 3TE6A 2OHFA 1G8PA 2BKEA 2X2FA 1VG8A 4RFVA 4Y0AA 4HLQB 2CCKA 4R2HA 3AKEA 3W6NA 1DE0A 1UEIA 5AK0A 1KJYA 2AR7A 4LJ8A 1W44A 1T3SA 4LYHA 1G6OA 2VF7A 4B3BA 4MKIA 3ADCA 4GL2A 4G3XA 2A5YB 2OCBA 3H4MA 2C5LA 2BJWA 1ZUIA 2OCYC 3M6AA 1K8RA 4WBSA 4GP6A 4KJZA 1WRBA 3FGNA 4AIIA 1ZRHA 5EXPA 3K9GA 1N5LA 1US8A 5J5CA 1N5KA 1NKSA 2HDNB 4DCTA 4QM7A 4LJAA
chains in the Genus database with same CATH superfamily
1T5DX 3UJ7A 5TGDA 2MHCA 2WVGA 3HGMA 3LHIA 2FPLA 4K88A 5K20A 2D0IA 2Q27A 3HEAA 4JJGA 1LK7A 1HFKA 4OHXA 4WFQA 5TQVA 1HGXA 3IURA 1AQ6A 4EP1A 1GD1O 3KAJA 4RLFA 1X7WA 3LKZA 2C2GA 4OFXA 1K0UA 1YJQA 3M4XA 4FKZA 1GADO 1GPH1 4YV2A 4EAQA 4I55A 3W2GA 3AR9A 4V2IA 1J09A 1P0MA 2ZKLA 3DAHA 5F4ZA 1V35A 3IVMA 1QGAA 4MP3A 4KO4S 4CIDA 3MWJA 1FC0A 1MRNA 2JASA 2QTBA 3QQPA 2J48A 4YCNA 1QQAA 2DBYA 3CGGA 1ZGAA 1G20E 3SM3A 3WNBA 2HQRA 2P35A 5DLPA 3JAKA 2WF5A 2A9OA 4K86A 2CZCA 3H9BA 4I2VA 4EG0A 2CDRA 1V39A 4L76A 1KDYA 3KSRA 3MS2A 4UTPA 2I2CA 3VTKA 3DVAB 1GARA 4H7EA 1AURA 3DFIA 3GIWA 1XVUA 4ZA2A 1PG0A 2P4SA 5GIPE 2EZUA 2Y1OA 2G7ZA 4GVPA 1AHNA 1CXZA 3ZIUA 3RDPA 1DSSG 3W90A 3FIJA 1N3IA 2F17A 4LF4B 1IXZA 1M6YA 3PQ3A 3GRAA 1L3CA 1W87A 2IHBA 4DV4B 1Z4JA 3MWYW 3MRVA 4FFWA 2OSBA 3DVRX 4RZQA 3PKJA 3I6BA 1SK9A 3HACA 4UTNA 4M0FA 4P4TA 4MYCA 1X0VA 3BIOA 4PX9A 1A4IA 4U4AA 3RREA 2J9ZB 2E1PA 1BG6A 1TQ6A 2BCEA 2G76A 2IDMA 4D6XA 4GM4A 1AV7A 4D96A 1N2JA 1ADGA 3DOCA 4F12A 3BORA 1I4TD 1K8YB 4TLAA 3KPUA 2X19A 2IXEA 2X8LA 3QE2A 3FBGA 3DVAA 4O02B 3TQSA 2Y93A 1NF9A 4JVMA 4J9UE 4L6CA 5BNZA 1Z7EA 2OG1A 3KSZO 1MAVA 4K6FA 4ZOQI 3PEYA 5K6RA 1A9ZA 4FN4A 4PSKA 4Y1FA 3GVIA 1KK2A 2AYZA 2P5SA 2UUOA 4C07A 4LZOA 4JD5A 2GN8A 1Y5IA 1E7MA 3QOXA 1FDVA 2ZRCA 3DEFA 2NAPA 4Q24A 1YZGA 4R8SA 3ROXA 2H6EA 4K40A 4XZ3A 4QXQA 4V0OA 2FEPA 2XVZA 3ZY2A 2ENWA 3SJCA 1R10A 5IJ0B 4QUBA 3FAKA 4J0QA 3VVMA 3CZQA 5A05A 1AXRA 1BXRB 4AWXA 2QUZA 1NJ8A 2OLEA 2A9KA 1Z6ZA 3TH5A 4JFRA 2IHZA 1E1KA 2O5EA 4MR8A 3R6TA 1RZRD 1O5IA 1T3TA 4XJVA 2G4LA 4E21A 2ZSFA 2BGWA 2QJRA 3L0PA 5I9NA 1UT6A 2EJUA 3ECSA 3PHBE 1RBYA 4IIDA 4ZO6A 3H5VA 4G5OA 3Q3GE 2C9DA 3RWBA 3DXFA 4KUEA 3ESZA 1OGIA 4A8JB 1VPWA 1V96A 1JKJA 4Z9BA 1MVOA 4W7HA 4CQLA 4MGZR 2C07A 4CODB 2HBRA 2AQ8A 1B16A 3IE2A 1R00A 1I3KA 3ZNQA 4QNRA 4JI6B 5G4KA 1Q7RA 2ENUA 2PTHA 4BX9A 4TKVA 3NWOA 4DC9A 5IBPA 2P9QA 4JJ4A 4U7TB 4Y9UA 2NU8A 3DZKA 1BXRA 2SHKA 3CRQA 2QMOA 2FN9A 2JB9A 3FPAA 4MV1A 2RGRA 2ORED 4AF8A 1QPBA 2VDLB 2EARA 2Z43A 5LN1A 1MFZA 5DHPA 1II8B 3FHJA 1KS2A 5AQEA 4GI2A 4JVSB 3HN7A 2D0DA 2GSDA 3MBKA 5KTNA 4EHHA 1F8YA 4FMDF 1J8MF 3BTOA 3B60A 5J2TB 1WW2A 2WM2A 4A8JA 1P5ZB 1NRXA 2QNIA 5CGZA 2VEOA 3A1FA 3SZRA 4AG6A 4EJFA 1FIUA 1HT0A 3F5QA 4YAOA 3CF2A 3U31A 1IBKB 4HEJA 4BTLA 4WE3A 4LOJA 3ND8A 4PCAA 2JIZD 4G5QA 4EM6A 1COZA 4EG5A 5BPFA 5B1IA 4ANFA 3KKZA 4QXRA 3COZA 3V8BA 3E58A 1MA0A 3EQ8A 3H11A 4ILEA 3L6EA 4H4CA 4OMFG 1CD5A 2Q8QA 2QG6A 4FWBA 4MOWA 4DJ5X 1UC8A 2WT8A 4GI7A 2Q7XA 2H9YA 4DG8A 1WW3A 2J9GA 2O19A 4AMBA 4BLRA 1VL1A 1E4OA 1BYIA 3OHPA 4HOYA 8MHTA 4N7JA 2PANA 3UH0A 1SCQA 5TDHA 1ZX1A 2ZIWB 4IRUB 4J6FA 4KN9S 3V7FA 1RKQA 1TJ3A 4GLBA 2W6MA 4REMA 1RJWA 2OAGA 2P5TB 4LYAA 3RVOA 1JFVA 2NZWA 3D9QX 4C22A 2FZLA 2VXBA 2IKQA 3IQFA 3MGGA 1QZ3A 1TI7A 4B80A 1GDDA 4ZHQB 2P0AA 1G3IA 1QZXA 2CNWD 3KJGA 3ADPA 4PX5A 1U2RA 4UPVA 4A3SA 1JQJC 3Q7EA 3QLTA 5AKJA 4DPLA 4ICIA 3V3KA 5HYVA 3NALA 3CX3A 5AUQA 4OM7A 3MELA 1RXYA 3GLGA 1V4BA 4RPJA 2AJTA 3NP9A 1TEXA 2WIBA 4KXUA 2JVKA 4GNKA 2DCUA 1NIPA 2GTIA 1BFKA 2CVOA 2VH1A 2ZSBA 4M7PA 1OZGA 3L1IA 3JVDA 4ZTBA 2QJTA 4W1SA 3LG2A 2ZUDA 3KYDA 5EIXA 4HN9A 3RBZA 1WD5A 3L0BA 4HXFB 1XCBA 4LV5B 5ICFA 4YHBA 1W0KD 3QLJA 4JYMA 1CE8A 1U8FO 3G1WA 4KBYA 3WHLA 4C4TA 2F1RA 3DUFB 4QVKA 3EG5A 1KI3A 1NY6A 4UVIA 4J0EA 5KYUB 4KOAA 3AI7A 3OOHA 3KK0A 4EG4A 2XCRB 4G07A 1P5FA 4MEAA 1Z15A 1NU6A 1AX9A 5FOSA 1M67A 1XRRA 4NR0A 2P2LA 2OYCA 4QGSA 4JSTA 4YUWA 2XYGA 2OBXA 2IYEA 1CZNA 4R9UC 1CYEA 2QR5A 1CPYA 1OGYA 2B94A 3A9TA 4JI4B 2FA9A 1QH1A 3HGQA 1FS6A 1VLQA 1XJ5A 2MSWA 4EHJA 4OFWA 4IKEA 2R00A 1H2XA 5G1OA 2Q6LA 4EA8A 1U04A 3CSDA 5F9MA 1C0LA 1YA4A 3T3OA 3KLOA 3R2JA 2N46A 1NN1A 2NSJA 5EJ2A 3AESB 2PWBA 2FFRA 1MC1A 3DDHA 3K0BA 3KJNA 5TR9A 3T3PB 3VR2A 1L9KA 4BCBA 1OTHA 3O03A 1G9SA 3T41A 4IMJB 3WGQA 4I3FA 5AOAA 1HSZA 3ZK8A 4GOJA 1CW2B 4WBNB 3QIAA 2FW8A 2J31A 3NHPA 1GFSA 4BB5A 5GAJA 4BKOA 4BNUA 4BO1A 2HF2A 4CI0B 1C9EA 3HDQA 2PX5A 4OJYA 1E7SA 2R5FA 5BT9A 6NULA 3VOAA 2WVJA 1YRHA 3VPCA 1E3EA 1CF9A 1TT5B 2OMEA 4IIBA 4Q9AA 1S8NA 3E5MA 4EY7A 4KKXB 4KAJA 3NNSA 5LQDA 2IV7A 1Y37A 3H2BA 4C7KA 1G59A 2W2TA 3E9NA 3ZE6A 2FN3A 5L7TA 1NVDA 4LISA 2ZUTA 3GRVA 4YP7A 4YMLA 2ZRDA 3ZD6A 2A0UA 1G38A 1X8XA 4LDQA 3IEIA 4RC9A 4LJRA 4JFAA 3F97A 1N1MA 3EEFA 4KNWA 3VSCA 1CBUA 1OXKB 3MBOA 4WBNA 1MW9X 3GH1A 1TC1A 4C0LA 4CG3A 1W25A 4KSBA 2AN1A 1T2FA 1X7ZB 3A0UA 1L5FA 4UFNA 3LECA 1KIFA 1KC1A 2JLYA 4ALJA 4WASA 4NBUA 1EXVA 1TT5A 3IXLA 1RYNA 1WCIB 1PT7A 2VP2A 2ZJAA 2OHHA 3O9ZA 3P7MA 3TLYA 5LQCA 5DYGA 4FJ2A 3LBFA 1KJJA 1DP4A 2QQ0A 3LT4A 2JGLA 3TW6A 4GFDA 3VTZA 1YFJA 3G5MA 1J07A 3BB4A 1T9GR 1HKUA 1ZS9A 3DSRA 5BWNA 1DL5A 4OXYA 1U8XX 2ZXUA 1JIUA 4R1TA 3R7DA 1A5BB 4MMXB 4ZCTA 3LOPA 4GRAA 2CNOA 2W2KA 4XD2A 1CIJA 1HEYA 3O9VA 4H7PA 3BMOA 2C5EA 2ZR7A 1N2ZA 2G17A 3H42B 3RFFA 4AX8A 2B6HA 1LVGA 2EL7A 2ZWOA 3UTDA 1RCUA 2FUEA 1T3GA 3CF4G 3LDFA 4J9VA 5JXGA 4FXPA 1QO9A 4JP2A 1RWBA 5TEWA 3QWHA 3MEQA 1PCXA 4A10A 3U37A 1XCPA 3TFQA 5A4MS 1JDVA 1NBHA 4QREA 3FX2A 4X97A 1BMDA 1N25A 3WL5A 3WLAA 4ZYUA 3ENQA 3MUOA 2KSQA 3T4PA 3CLTC 3E5RA 3O1LA 3B1KA 4FT2A 4LDJA 1XZQA 2AA3A 3D4BA 4IDOA 4FFRA 5D1HA 3TMAA 4FGSA 3BXXA 4YAUA 4NV1A 3JX9A 2C4NA 1ZH6A 4AJ2A 3I52A 4PAGA 4D0LB 4O8ZA 4MKFA 2JIPA 2J3LA 4KFTA 5CW2A 1F0YA 1ZHFA 2AWOA 2GD1O 2GKGA 4R7TA 1BWSA 3NCHA 5BUSA 2VH5R 3IP3A 2M1ZA 1CF4A 4O0LA 3GROA 4TS3A 3W0LB 4EYOA 4MHOA 3R76A 1UJNA 1E0DA 4JI7B 4GZMA 2AUTA 1E3DA 3V1LA 1A9XB 2A9PA 4OHWA 5CXSA 1E2DA 1YUNA 2P40A 2W4IA 3DDCA 1LSJA 3GVXA 1U6KA 2FPUA 3GMIA 3S8YA 2XYVA 3AEKA 1QIFA 2JAXA 1T26A 3PGKA 4L57A 2JZCA 3N2NA 4OYRA 4KREA 4CV3A 2BH2A 2OEPA 1KDRA 1GAEO 2F8MA 2CYCA 4LVCA 5BVHB 1KAHA 1C4OA 1E4EB 2WM8A 4D9CA 1Y1TA 5JT1A 2V1XA 4MW6A 2PCLA 1GOTA 1ODCA 1MJHA 4QO8A 4YLGA 2Q7DA 3ZHYA 4LECA 3JQAB 1MRSA 2UVPB 1FP4B 3BQNB 2JGNA 3LUAA 3LFTA 5F2EA 1Q44A 1PD0A 3GAZA 3CINA 1M75A 5KNDD 3D6VA 3RH0A 1AM4D 3TL6A 5JJIA 1U9CA 4Y9RA 4P5DA 3GGGA 5AI5A 1YE8A 1HEUA 1V16A 4LWQA 2H52A 3EFEA 4R1PA 4K28A 3GOQA 4KTTE 4QDJA 2DBVO 5B2FA 4II7A 3EIEA 4CKWA 1PK7A 1ZGHA 3CN9A 1O6FA 4HRXA 1U8YA 1WHSB 5LQRA 3PFBA 1GV0A 2OZPA 3DNPA 3IV9A 1JEOA 1H9BA 5BVHA 1G42A 4UAJA 2VHWA 5EMJA 1FCJA 4Z4EA 2W2LA 3AUTA 1J2RA 1FSSA 4H3VA 4ZHQF 2ZU0C 5LP1A 1GXSB 5IDVA 5FO1A 1O5TA 3DMRA 1XRJA 3NOXA 3OD5A 3IILA 2W2OA 2YMPA 4A9AA 3D3WB 4XVUA 3FLEA 3HBMA 3LT2A 3LDGA 3ZGVA 3W3AD 1P1CA 1RLUA 2ZYGA 5CH3A 1NC3A 5C1DA 2HWUA 4OKIA 4DWJA 2A59A 3B5EA 1K92A 2J3QA 1NOKA 3DOIA 1P4JA 2WU3A 1JT9A 1RXEA 3NJ4A 4UTXA 1BKDR 1C1XB 5FD8A 1FUUA 1XA0A 2I2WA 2X1MA 1EDDA 1U5AA 3C3XA 4WBXC 1JFLA 1AG9A 3AF0A 2GRJA 1P0FA 3L1KA 4KGDA 2JGFA 3R3ZA 3TDKA 2VIIA 1E18A 1UOQA 2AN3A 1ZSVA 4MUXA 4HN2A 4MULA 2Q1XA 3RBAA 4WNAA 1P2SA 2RHWA 1TIPA 2Q8PA 5EUBA 3Q7SA 2RH9B 2GI4A 1KMCA 3QGMA 5JQGA 3TPFA 5BR8B 3V6LA 1NPYA 3D3WA 3IHLA 3L7CA 1WO8A 2OMKA 5FNVA 1V4VA 3WLEA 1VL5A 3BC1A 4YUZA 3O92A 1SNYA 2P6OA 4QC2A 4UQOA 4EJSB 3COVA 4CTJA 3TE7A 1DAGA 3C0KA 3VHLB 5KREA 5T6MA 3GDGA 1ZVMA 1JKXA 3DBVO 3II6X 4Q6BA 5JANA 5DK6A 3C3WA 1Q19A 5AVVA 2F1IA 2CF6A 1T9DA 3P5SA 3NLLA 1A9PA 1G3RA 4LVOA 4NEHB 2PGXA 4L72A 1NPTO 1HDEA 3IRUA 4HFNA 4B7UA 3WQHA 5KYXB 3KXIA 3GLIA 4Y9SA 2PRYA 1Z22A 1QOQB 4OQLA 4IFEA 3DC7A 4LXUA 4WNAB 3GJ6A 2QN8A 1NUSA 1OA0A 4M1OA 1OXTA 5FUBA 4D80A 4YRRA 4EX6A 2XY4A 3W5BA 3B6ZA 3V5NA 3QNWA 4V02A 4NMMA 1P19A 1UM8A 3ETNA 3N2GB 4CMIB 2Y2VA 1NDUA 4LZJA 1UBKS 2K7ZA 5IC6A 1F6DA 1E9RA 2EYQA 3B3FA 3I8OA 4C4XA 3ABRB 3ESQA 5KAPA 4C7XA 4CLHA 3DR3A 4P0QB 2VDQB 4D44A 1YJAA 1TMYA 1MB9A 1N2HA 2CLOB 2QU7A 4ZVNA 3VGPA 3EEOA 1M1YB 1YFKA 3WAJA 2BDUA 4MLZA 1KEEB 4ND1A 5IUNC 1X2BA 2Q4TA 3LGXA 3R0XA 3V8PA 1AZTA 3AZOA 3SS7X 3ZH9B 4ZYVA 3IH5A 4IHJB 5KC9A 1G5TA 1ADBA 3FWYA 3O1IC 4DQVA 3EX7C 4ZEOA 4ZI5A 2F9MA 1GGKA 4DIBA 1OXSC 1XBTA 3HUTA 1NYLA 2PWPA 3PEWA 5A1JA 4P80A 1E2FA 2WVHA 4Z9AA 1B8UA 1C41A 2H1CA 3AWDA 4CU2A 2REOA 3OU7A 5G1NA 2Q3LA 5SZHB 1OAOA 4Q05A 5DNAA 3QRWA 3KKKA 1GILA 4CKXA 1XMQB 5IM5A 2QM7A 4NS1A 3F3SA 4WEOA 5CFZA 2UUPA 1WVMA 3C6KA 4W5OA 4D45A 4DNPA 3GOHA 1ESEA 1JQKA 4F11A 3P4UA 4DYVA 4U7FA 1JQBA 1NR7A 1OF1A 5L3VA 2XD9A 4E4RA 3DE3X 4CWAA 4POAA 3WDMA 3DMGA 1W8IA 2BUAA 3BIXA 2YINC 1U2PA 4K9RA 4N3NA 4YRJA 1Q0QA 5KNCA 1K0FA 1SBYA 2XOKD 4KEAA 2XB9A 4FC7A 5BV0A 1N5JA 3JR7A 2ONKA 1JJVA 5AUNB 2X15A 1IHPA 2C88A 2ZXEA 3LIPA 3T9BA 1WUTA 2XNCA 2P3LA 2V7PA 5T57A 3W4KA 1MENA 1BN6A 4GXQA 1IN1A 4RXUA 3QX8A 3KR2A 3NYRA 2YY6A 3QNMA 2O2EA 3JXEA 3PUXA 3T5CA 4I5IA 2Z4TA 2RHOA 4EEXA 1Q1GA 1C9JA 2R60A 2ZATA 1X7DA 1TJ4A 4BJHB 5AVUA 3OLVA 1EHIA 1R6AA 1A77A 1B41A 4GXRA 2AUNA 1XHFA 3GA5A 2OFFA 1Z3IX 3REQB 4ZDIA 4BMXA 2R8PA 2ZE6A 2BCGY 3J7AC 2OXRA 1A7AA 2VNJA 4MJ3A 5TMDA 3QF4B 4ZEWA 2O7VA 1G7RA 2BTOA 2R25B 4JI2B 1A9YA 5BSMA 4R0MA 4EZEA 2ZUVA 3RAGA 3ZNOA 4LPSA 1NQWA 1HDYA 4O4LF 3AERA 3RRYA 2XX3A 3F47A 4AMVA 5JH7A 3W5DA 3K0CC 5FJIA 4BUJA 1JW9B 2BLLA 2PTGA 2XYPA 4WADA 4F7WA 1LF0A 2V7TA 4XUDA 2D5CA 5JR3A 1P6UA 4QNNA 4B4VA 3F9CA 3KKNA 3QYFA 5H4HA 2YIVX 2YXPX 3MIZA 4M3NA 3T15A 4OJMX 4D4LA 1WCYA 2ZM6B 3ZU5A 4IDPA 2W8BA 3P4YA 3GCWA 1EMDA 2WILA 1Z39A 2VJKA 2PX6A 4AKTA 5MF6A 2QU8A 4NK4A 1P91A 2Q2OA 2FJ0A 2WZDA 5DMHA 4ZZ2A 1TQHA 4X45A 2PMEA 3RVSA 3MCWA 3IXQA 1EI9A 3RSCA 4OYYA 3HFRA 2C2YA 4F4UA 5AI8A 4R2JA 3BCSA 2XZLA 3MIIA 2AN5A 1TGYA 2KWIA 1D5WA 4BNDB 4XE5A 2JFXA 1CEQA 5KI6A 4CETA 1Z62A 3P2JA 3WRWA 1DKNA 3AM3A 2R2GA 3NHSA 1I0IA 5CW1A 1XNQB 2WF7A 3L7IA 5AJTA 4EB6B 1AJEA 3Q2OA 2CY0A 3NRCA 4TSFA 5FBKA 1C2TA 3FRIA 2W8BB 1R8SA 2JK0A 3GUZA 1XUOA 5FI5A 3VR4D 2YMQA 1FVOA 4TMFA 3N75A 3SVZA 3AFIA 2X2OA 1QHXA 1TM5E 3B3QA 4HYTA 3IHKA 4LCEA 4EJSC 4EEKA 2IUSA 4U39A 3BRWA 4AMZA 2VUIB 3F7OA 2BOVA 2RGUA 3U7QB 4ETNA 3KSUA 5IX8A 3RYCB 1L8OA 1AQNA 4G8BA 4ZT6A 2O3UA 3TLCA 4QUHA 4DDTA 3ZXXA 1CDDA 4X91A 1ODSA 3CPSA 1MIOA 5H0IA 1K4YA 3WGOA 1O94D 1KWGA 2J3EA 4ALMA 2XH8A 1U8ZA 1L5QA 4JYPA 1ACJA 1LSUA 1U2SA 2GBLA 3COPA 4W8HA 4G0WA 4PZAA 1BU8A 3SLKA 3VKUA 4EKNB 5JZMA 4P81A 3N5KA 1EH5A 1IE3A 3C8MA 2VF4X 4JEUA 4QRHA 4BMYA 2OVBA 5BO5A 5E0OA 1DQZA 1XTQA 4B17A 1E5XA 1ZUWA 3I0NA 1RLMA 2DTDA 1NG1A 5AXBA 5TQ2A 3JRNA 3VAZA 1U94A 1AS3A 3EQ9A 5K99A 4BB9A 2LKCA 1VTKA 3H2GA 3I8SA 3OM0A 1DEHA 4GG1A 1DAOA 1JHVA 1ICEA 4TZKA 3O0TA 3MJRA 5EE5B 5J4VA 3DHEA 4E5SA 2XKKA 1OXXK 4GD3Q 2AQIA 2CLEB 3S55A 1ZCJA 2J6BA 4A0HA 4PS1A 1B6TA 1KP3A 5E4FA 3FOFC 4H7IA 1WB6A 4TVOA 2ID9A 5E38A 5T67A 2QY6A 4JKYA 4G09A 4DA6A 3LBYA 3CUVA 3Q9UA 2IEZA 3DLPX 3JQGB 1D7AA 2FPMA 4NATA 1DJOA 1XT6A 2PRSA 3FDJA 4YT5A 4CQMB 2RHLA 4YT2A 2H51A 1MQ9A 1PZEA 2CSXA 1XELA 2XKJE 1FFCA 3O4HA 2NXNA 3LWZA 2QSJA 5FNVF 5K3FB 2EEZA 4D57A 2N1BA 1RKXA 5F1KA 1NGSA 5DXJA 3B85A 2CJYA 5KU1A 1WV1A 4LXTA 3C85A 5JAOA 4FQ8A 1WPGA 3N8NA 5DZSA 3LUKA 2O8EA 3KYCB 3BSWA 3QE3A 2PBZA 2GK7A 1TYZA 3SX2A 4K6MA 4HG2A 1MAUA 5EXSA 1CUHA 1MQSA 1PP4A 1H2YA 2AEJA 1GAWA 2AFVA 2X76A 4MGYR 3OIDA 1DC5A 5C1BA 5L3SA 2IX9A 2XDAA 2Y1LA 4KXMA 1GZ6A 1IWOA 2IW1A 2AFHE 1R4NB 2CHFA 3TLJA 2DYKA 3GCDA 1TJYA 3KZCA 2Y4OA 5LPNA 3KKPA 3LC7O 1KPGA 2GPTA 3D8TA 2WRZA 4KLRA 4HAVA 4L0CA 2HQSA 4G1EB 2ESRA 5HP4A 1CWUA 3M9LA 5CLGA 3D64A 4Y8VA 4C20A 4HWOA 5TMBA 3U3KA 4DGQA 3IEMA 1ZN8A 2RGDA 3AEXA 4H4EA 1VJCA 1NE7A 3GT7A 5TV2A 1DAEA 2A1TS 2W6QA 3FF1A 3FTCA 1SHUX 4JQZA 3ABOB 3LC2O 1ECFA 3UMCA 1U2QA 1D09A 4BZZA 1T5IA 2BFOA 3KQNA 2DB3A 3Q9SA 4D79A 2C4VA 4A7PA 4NU6A 3VC7A 3MS7A 1E8NA 2BGIA 4OKSA 4DA0A 5EJ5A 4CVNA 5L3SB 4IZOA 4QUAA 1BDIA 2ZZMA 2I76A 4L4YA 5DP2A 2IE8A 1E6CA 5CM2Z 2M98A 1NWCA 3OPMA 2VPXA 1RPJA 1OH6A 1E66A 3PLRA 3AG5A 2LRHA 1RAAA 1XJWA 1EDZA 2BV3A 4P31A 2HJWA 5FTJA 5IBQA 3QKRA 4KUHA 3OZAA 3IKLA 3KB1A 3FCYA 4UXIA 2C57A 2D1YA 4ENQA 1P31A 3PLNA 2HBZA 5E1BA 3AB8A 1I2DA 3VOTA 2IH5A 1TU4A 4C4OA 1T9ZA 1BS2A 2DWUA 2HU7A 4C4RA 3Q7QA 1EM8B 3RBVA 5CJ2A 5LVAA 4TMTA 4RKWA 5DN9A 4BNKA 2G5GX 3PK0A 1GUYA 1TJ5A 4F3TA 1DUSA 1JHZA 2I2AA 2CMKA 4L7QA 4ZXPA 3SNKA 2IYYA 4IVRA 2W0MA 3OBIA 1LXCA 1B73A 4B74A 1RQLA 2KX7A 2QT1A 4MRSA 2J85A 2EF0A 5EEGA 3E9YA 5BRNA 3RC7A 1JZQA 3W6UA 2ZSIA 1W34A 2XDQA 1PT5A 3QVVA 4RIEA 3ZWVA 2FPGB 3EOBI 1RXCA 1F8XA 5IZCA 2OQ2A 1MG5A 4NL4H 1VDMA 4MITA 5AVSA 2JVJA 4LG1A 2WTBA 1VBFA 1ZGJA 4HC4A 3GEMA 4WJZA 3U13A 4HQ6A 3PJFA 2FSVC 3V8RA 2ZRBA 4XI9A 3V4VB 1GNVA 4YCAA 1J8FA 3QX3A 1O6ZA 1ENZA 2V3CC 1Y1RA 2FW6A 1OSNA 3HYLA 3RF6A 1LDNA 4HTAA 1DT5A 1VJGA 5J4KA 3IXMA 3O6VA 4RF4A 1G16A 2VUTA 3ADKA 1DBSA 4B6PA 4ZN6A 1T1GA 2HRQA 2FH5B 1ZA2A 3BA6A 4KSYA 4RGBA 5ARDA 2NNLD 4Y2XA 3WICA 4C76A 1OPXA 2Z5GA 3FVTA 5A7HA 4ENRA 2JPDA 1RQNA 5I3ZA 3E05A 3I5UA 4P3OA 2H7YA 1Y7PA 2CMDA 4R98A 3UV6A 1SU8A 4DJEC 1M2HA 3UUGA 3KQTA 2LDBA 4MVJF 2BFEB 1SBZA 3RYHB 1XEFA 7ADHA 8ATCA 1NFRA 4UUNA 2DH5A 2OOKA 2VF2A 1E60A 4JNKA 4A5OA 1H8HA 1XEAA 1E64A 4HPJB 4A6EA 4FVTA 5IULC 3K70C 4WZ6A 2OCAA 4L2IA 3W4IA 2EGGA 4QHTA 3NKVA 1X0XA 5A03A 1TTPB 2WZQA 2GN1A 1ZH4A 3MTAA 5LLSA 1A96A 3C8DA 3RCBA 3ROTA 1XVIA 4U8GA 2GJ8A 2GYUA 3V9AA 5JNTA 4F6LA 5AESA 3H3JA 1BDMA 1H1LA 4G26A 3BEOA 4P4UA 4FMBB 4TSKA 4QRIA 3SC4A 1VJRA 3WIVA 1AUPA 5HZGA 4ZVVA 2CB0A 1C4XA 2PQ6A 3H1FA 1JGTA 4JXZA 4IJ6A 1NXPA 2G83A 4MYSA 4Q3BA 2HA4A 3G5LA 2BGMA 3ZDXB 3NAMA 4DF3A 4PS0A 1JLHA 1N0HA 1OOEA 2ZI3A 2W7TA 4N47A 1BZYA 3QPAA 3WWDA 1M83A 4ZQIA 4DN6A 3NDRA 3W8NA 2BWJA 3GJSA 4MDYA 5EIFA 4D97A 3UMFA 5HRUA 1ETUA 3RTBA 4OF4A 1R3DA 1WMAA 1E20A 1CQIB 2IYVA 2Q5IA 1AMUA 1T8TA 2I6SA 1E5DA 3BE6A 3FM9A 3QKIA 1Z73A 3REGA 4AU1A 2BKUA 5FLXA 1BCSB 2YJGA 4ZCSA 3H04A 4IH9A 5COAA 4HX2A 2NW6A 3I3SR 2YL2A 2VTBA 1AKEA 2PX0A 2V9PA 1ODIA 2I67A 1QIHA 1X39A 4YMSA 3IT1A 3L4KA 2X0EA 2C9OA 3DMFA 1UJ4A 1S4QA 4X8LA 2IEAA 5A4KA 2P6MA 3OIFA 1GTSA 1WETA 3BCRA 2QTHA 5BV2P 1PWEA 1PG2A 2ZSEA 2ILTA 1U0GA 2OORC 2J30A 1PV1A 2B5OA 2JKVA 4B4UA 3BS4A 4QFCA 1VL8A 5EE1A 5K8CA 4D9MA 5B2EA 3L5KA 4XCQA 1GDHA 3UOGA 1Y7HA 4PGGA 1PF7E 1DVRA 1XNJA 2NU8B 1N0WA 1R66A 4H6XA 3BD7A 3UOWA 4D0RA 5JDCC 5BN1A 3I6QA 3I61A 3MA0A 2OXFA 2WD7A 1BJTA 3BA1A 4DPKA 3MRXA 1BCSA 3LOUA 3H1EA 1A95A 4I9FA 2GH1A 3QKTA 4F06A 3LY8A 4PONA 4ZI2A 4DM3A 2WU0A 4LE2A 4I4TA 1EZZA 4R1SA 3JRWA 3Q10A 2ZOSA 1G8KA 4DJDC 1TF2A 3TGPA 2IYQA 3DNMA 3WGZA 4B79A 4LF7B 1R3UA 1H8ED 3F4KA 4MUKA 2OBFA 1WXDA 1U0OC 3P19A 3TZBA 1NONA 3QQ5A 2GX6A 2IRWA 4N3AA 4AS3A 2B8NA 2QTVB 3PFNA 2V45A 3EN0A 3G2PA 4CL2A 2NV6A 2Y1DA 3LWNA 4FOLA 5BSWA 5CB6A 3RD5A 3EZFA 3JQ8B 4LHYA 4EGAA 3L0SA 2HEIA 1HI9A 2XQIA 1WQ3A 4GLOA 4K9QA 4O4HA 4HZIA 1T91A 4MW2A 1H8EA 3FNHA 4RETA 3IUYA 1ZSNA 2QRJA 1Z0IA 3GGOA 1EUCA 4I1VA 1TVEA 2XNSA 3H1AA 5JADA 1QANA 1DEAA 2J9FA 4C2BA 1TX4B 1QP4A 1SHTX 2EYUA 4RY2A 2VZEA 3NRBA 4CKZA 4QXOA 4JUFA 1G17A 1K86A 2VDWA 3HWRA 1YHZA 1T9AA 2DWOA 1EEXB 1OI4A 3KQMA 4JC4A 3WJAA 4BNMA 1XD8A 2DWQA 2CNKA 2NV0A 2WMYA 3FCXA 4OU5A 1LS1A 4DYDA 2IYLD 5I8WA 5F5LA 2IIPA 5GV7A 1FUEA 3TG8A 4G84A 4B81A 1I36A 5LMCA 3U4GA 2C42A 2QRMA 3DE2X 3R0QA 1Q0TA 2GLTA 3D7NA 3LL7A 4MTCA 4V38A 3LLCA 1QO0D 3FR8A 2W2XA 1KVSA 4CMCA 5E9QA 1E6KA 2A92A 4JU8A 4ACBA 1BVRA 1K89A 3KQQA 5AKXA 3KZMA 3KJIA 2YHIA 3I28A 1IK4A 4A5SA 4JVLA 4IHJF 2CLCX 4F6RA 2DBQA 4CMHA 3E2MA 2JGMA 4WINA 3LUCA 4KKVA 4WK6A 5EJ4A 4Z4GA 4EO4A 4BN0A 4FFPA 4Q0MA 2B2XA 2HCFA 1Z6PA 1ATZA 2JG3A 3E81A 1R6TA 4FP9A 3PGA1 3TTTA 1L4GA 2WWYA 2WSSD 2G8LA 1BHO1 1B7GO 4P53A 2OUIA 1N7JA 1CRWG 1YCFA 1HBJA 2QROA 3ND7A 1JQEA 4IDDA 4NYJR 5DW0A 1JR3E 1NUAA 4S1NA 1KGSA 1QCCA 3N7AA 4WCFA 5DX0A 3KNZA 2ZBPA 1J7KA 2KPOA 1JHPA 4LWOA 4TXHA 2QTRA 3CRMA 4UUOA 4YJ2B 3WIBA 3ZWMA 4ID9A 3D8NA 5JFGA 1M10A 2VWPA 4X1KB 4YROA 2PUEA 1GTVA 4KO8A 1UFQA 2Y1WA 3MD0A 1OBCA 3MTDA 3ZHRA 1BH6A 4FNAA 2QYOA 5IWCA 4CTNA 1ZCFA 1KMQA 2FUNB 3MJ4A 1L5VA 3SWWA 3L8YA 2QLLA 1Y4AE 3NFYA 2FW0A 3VI3B 4JL8A 1I8TA 1A7UA 1H66A 2B8EA 2G3YA 4WI1A 1GZHB 1XKXA 4TRMA 1IQRA 2EQ5A 5JNWA 1UKBA 1VFPA 2GPSA 4M46A 1E2JA 1W1IA 4EMSA 1EVJA 3K2EA 2VT3A 4E7OA 1WKCA 1ZAYA 4FYIA 4H1UA 3TB4A 1A9RA 1C0IA 2RSLA 1QK3A 2V8OA 4JR1A 4K8RB 3ZXIA 2Q1UA 4PF1A 3ASUA 3DOEA 1C5KA 4G1VA 2VSQA 3GF4A 3MSCA 2O7QA 5TGZA 2YN0A 3QVMA 4LHWA 4MW0A 1O96A 2NO7A 5WRFA 2W4MA 3DLTA 2NPIA 3IDSA 3CISA 1KSFX 1LBIA 3C4VA 4B73A 1NP7A 2Q2NA 4BN5A 2H2AA 3KDAA 3V1MA 5A4JA 3ZWBA 1RZRA 4YMWA 3EVTA 3EWAA 1B15A 3HNPA 2VHYA 4MVCA 1R9JA 4JKOA 4LHSA 1NSFA 1MT3A 2CFCA 3Q7IA 3EGOA 1FYXA 3SQMA 2PX4A 3GJ3A 4OTZA 5LMNB 4YR9A 1GPYA 3I0MA 1U3UA 1F1JA 1AS0A 1V6CA 4WVFA 2ZI5A 4X92A 1ISRA 4UZEA 3DE4X 3QYAA 3TRFA 1EHCA 2IYOA 3I5MA 4B87A 4IGFA 2R6DA 3PUWA 1MO6A 3S27A 5I7AA 1IRXA 3JQ6A 4OSPA 3HP1A 4RVHA 4UQPA 2HRZA 1V6AA 2IF0A 1LPBB 1N75A 4AZ3A 3UQZA 5LC1A 2ZKIA 3HNOA 3QENA 4BCDA 2A0YA 4OLBA 1K7EB 4TTRA 4ZQHA 1DXQA 3F0TA 3F6CA 4ZOEA 2QIOA 1EFLA 3O0DA 4BO2A 3K9HA 4FEYA 10MHA 4RK1A 1L7VC 4HFJA 4DBLE 2VSOA 2VVTA 3G5TA 1FLDA 3SZMA 4AKGA 3ABSB 3RRFA 2J3MA 4R1NA 3S6JA 2Z3VA 4ARZB 2JKZA 4HH0A 4U0JA 5CXXA 2ZANA 3WWOA 1KOFA 3FMFA 4L75A 3TSZA 2ERYA 1T5BA 4YQFA 1T4GA 1KQNA 3JCZA 4BPRA 3KUKA 4D8YA 4GBGA 5HQ3B 4KN6A 1ZVKA 5JD3A 5F4BA 1G2QA 1XB2A 1S2DA 4OGWA 3MPOA 4L78A 3CCCA 4QYXA 4NBTA 3DO5A 4AZ3B 3CVUA 1GZ3A 2QQGA 2XGSA 4RYDA 1KY4A 1CLUA 4MO9A 2ZVDA 3KB2A 4KACA 1TU0A 2OV4A 2JKYA 4Q02A 1XWIA 1N9GB 3ER9A 1W1WA 4BJ3A 2RKOA 5C8YF 3CH6A 2VJNA 5C37A 2ZIFA 5EJ8A 3OE7A 2FEMA 4UBLA 4BFCA 3PT5A 3CJQA 1PUIA 5L53A 1AS2A 2BJVA 1YZLA 3O1HB 1QIMA 3NPAA 4WKGA 3AOEC 1UBEA 4RS3A 4YREA 3T06B 2JI4A 1Y7TA 2F64A 4QU8A 1E2PA 4RKQA 1LD3A 4AW9A 2FEXA 2PWYA 2VK1A 3L2OB 4WZBB 1YTUA 4NYIR 1PWZA 3PXGA 2CHUA 4YCLA 1J33A 1FDUA 3JTMA 1HV8A 1RBQA 2XUAA 3OI7A 4PRYA 3TR6A 1Y9JA 2WSIA 4BX2A 2NQ8A 4AJOA 5ELXA 2NTJA 1UEJA 4LCBA 5GM1A 3GWGA 3MGKA 3I05A 4J8PA 3HXMA 5AM1A 2I54A 4CQLB 1L4LA 3AIKA 1PT8A 3HYRA 1FSZA 3KV3O 5AM2A 1TIKA 3I04A 4R71A 2DQKA 3GN1A 3V4FA 3Q8MA 3R9XA 3IP8A 3TNDA 2ZQZA 2OCXA 4KMRA 4F1WA 2CXUA 1TOAA 2VJYA 3MQ4A 4O2AA 1U8CB 2GS9A 4KQMA 1F9EA 3K4QA 3AVUA 1PW5A 1R8QA 2FG6C 4JELA 4P3PA 1ARZA 3S5JA 2DULA 4AL4A 5FV4A 3EQ2A 5E9WA 3ZK9A 4XDGA 3RUEA 1O4WA 1Z2CA 2WZCA 3I01M 3KS9A 5CFNA 1E5QA 1T2NA 5IXSA 1D0VA 1VI6A 3H9UA 4NVRA 3T3NA 1W52X 3KHSA 1YKSA 5IC5A