2ZRDA

Msreca q196n adp form iv
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
330
structure length
322
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLREPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 91
structure length 322
sequence length 330
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrdA01
1W44A 1XMVA 5KU1A 3LNCA 1S1MA 3TE6A 2O52A 1DAHA 1IONA 1TF5A 4Z1MA 2EYQA 2R6CA 4UJ5A 1RIFA 2WWFA 3FKSD 4LHXA 4Q18A 5EZ5A 2JJ1A 3U3JA 2J7KA 3NTUA 3K70B 1WDTA 3VFDA 4EPWA 4I99A 4HB0A 5KNDA 4D0NA 1G9XA 2IS6A 3AQ4A 4XWAA 4ACBA 2I1QA 2V4ZA 1ZW6A 1Z0AA 4K81B 4MGIR 4TQUS 4BPBA 1KZ7B 2DHRA 3LDAA 2NZ8A 1R6BX 2CVHA 1W4RA 4BE7B 3C5CA 4ON9A 2QQEA 4OJQA 4RD6A 3X1YA 5BWMA 2AWOA 2NPIA 4ZIRB 5BQ5A 2F43A 3TVDA 4D6PA 1G8PA 5A0FA 2CBZA 5JEEA 4XIGS 2OBLA 2QMEA 4OJKA 3QIAA 3W6NA 3LW8A 4XTCS 1NMZA 2LKCA 4PO1A 2OCAA 4NE2A 2H92A 5GADl 2EVWX 5L8VA 1II8B 5E4FA 3K0FA 5IDVA 5EXSA 4DDTA 3O8CA 4KYIB 2MSCB 2WPDA 4HLDA 4DLZA 1P6XA 4U00A 3OFND 6Q21A 4RD0A 1CR4A 5SZKB 3W90A 2EFDB 4US2R 1XJ0A 4QJ5A 2IYUA 1Q12A 1Q44A 4EIWA 4BFUA 2HYIC 2ZAOA 1CEEA 4JMPA 5GVRA 1G6OA 3EA0A 5G41A 4N1AA 3ZYCA 2OBNA 4NBSA 1WF3A 5DI3B 4AG6A 4QGGA 2RH5A 2FA9A 2OEPA 4TYQA 1OIVA 3HU1A 3PUXA 4MYCA 4MQBA 2F7SA 3THYB 3K70D 4C2TA 2G83A 1HH4A 2VEDA 1G6HA 1AGPA 3GD7A 3E1SA 4DSOA 5JWOA 1RJ9B 1G5PA 1G4AE 3RABA 1Y3AA 2C5LA 3KQNA 1Z0FA 4QXAA 1B0UA 5FPYA 4IDPA 1Q22A 2WMOB 3RC3A 4LV5B 1NVUQ 1DAFA 4NYIR 2BOVA 1GP2A 2FSHA 3EG5A 4K46A 4PZLA 1IAQA 4Q1CA 4D4MA 1OHHD 4V0LA 4CF7A 5J4YA 1E79A 4P33A 1ZRHA 2YKGA 1RJ9A 1B23P 4TWZA 3FKQA 1GL9B 3F3YA 2LCFA 2XB4A 3QQ5A 3WP0A 3U3RA 3THWA 2FH5B 2X2FA 1UKZA 4YDHB 1KSFX 3CLVA 4B48A 1E69A 4PC6A 4HB4A 2ZSAA 3LBIA 1VIAA 3QG1A 5G3ZA 2WJYA 5CIWA 1IBRA 1O87A 1SVWA 4MKHA 4W5HA 3IQXA 4PQYA 4ACAA 1E2GA 1P61B 3L8YA 4M9SA 1UBCA 4AI6A 1UADA 3CPEA 4PSKA 5EE9A 4B43A 3MD0A 621PA 5H70A 1KO8A 4PPQA 2ZRCA 5KHOC 4M1OA 3DHWC 3X1DA 3EPLA 3C8UA 1RVDA 1HA3A 3PEVA 3WYFA 1KK0A 2O0HA 1ODFA 2ZTSA 2ODNA 4IW3B 5EXPA 4O2RA 3EC1A 1UDWA 1GNPA 3CWZA 1T5LA 1U8YA 1N25A 4HDCA 1L4UA 2ZRMA 1NNEA 3GJ6A 3NIBA 1JALA 2JIZD 3DOEA 4URUR 2QA5A 2JLXA 2XGJA 4URXR 1P9RA 1N6RA 4KVGA 4HZIA 5GVSA 3ZZUA 2FG5A 4IHQA 1NIPA 4DB2A 3IO3A 3AB3A 1YZGA 4AKHA 4CEIA 1UKEA 3BD9A 3B1XA 5FBLB 2W00A 1I2MA 1TF2A 4P32A 1E1QD 4V0MA 3GEIA 3NVAA 3P26A 5G3YA 4PQRA 4ZDWA 3FE2A 1CULC 1IJEA 4YMSA 3QEJA 4BLRA 5BN4A 5FH9A 2P6NA 4GNKA 2W0SA 2WSMA 2IXFA 1KHTA 1QDEA 4WA7A 3V4FA 4DC9A 2D7DA 4LHVA 3N5CA 2DCUA 1XD9A 4LCBA 1FUUA 1Z0IA 4FCWA 1HTWA 2JJ1D 2YOGA 3ECCA 2VPPA 4DIEA 1AK2A 4TQAA 3THOA 1W47A 1TPZA 1E9DA 1I4TD 2BKUA 3QENA 5FOSA 3X1WA 4LV8B 3I3SR 3MWJA 4ZKDA 5JLJA 3I62A 1BOFA 3QXCA 2ZRDA 4OHVA 2Q6TA 1X8LA 5EP2A 2VP4A 1AA9A 5FL3A 1HEIA 3K9NA 2QG6A 3A37A 1NF3A 2GZHA 2VBCA 2WIAA 2QY9A 2NO7A 3T1QA 3ZIAD 2YNMA 3N70A 3SFZA 2C03A 2ORWA 3A36A 2O8FA 1EK0A 4B47A 1KO5A 1LVGA 1A7JA 1XDBA 2EWVA 1YR7A 4QBHA 2YV5A 2VP2A 4DCVA 4AK9A 3LQQA 5IF9A 3RS7A 1W0JD 4B3GA 1HQYE 2JDID 3CX6A 3K0AB 3U7EB 5JCZA 2DYKA 4JLOA 2B92A 5SZHB 3JVUA 1F2TA 1IY0A 1CF4A 4GZLA 1KI9A 2AXPA 2IYSA 4GP6A 1V43A 5EUMA 2HXYA 3WXMA 2H7VA 3OIYA 5AJZA 2RGXA 2ODWA 3RWMB 2Q9AA 1TQ6A 2ODBA 5L3SA 1FP7A 5EE1A 1YJ5A 2IYLD 3KDSE 4C0LA 4JSYA 4C30A 4B3FX 5CITA 3QBTA 4CEHA 3K0SA 4ABYA 1S2MA 1E0JA 5LBIA 2SHKA 1HUQA 2ZRBA 1R0XA 2ATVA 4KYUA 4HAWA 5EE5B 4NL4H 3QKSB 2ZR7A 2W0MA 1J90A 2ZE6A 3IO5A 4UXHA 4IJMA 5CM9C 1XTQA 5FPHA 2EWWA 1UFQA 4PO9A 1XBTA 2VIIA 2W2VA 3FMFA 1YU9A 4ARZB 4G01B 3AUYA 4Q7MB 4O2LA 2O8BA 2UVQA 1MABB 1XD8A 2R62A 3QKRA 4HAUA 4JBWA 4QJ4A 4JL8A 5ANRB 3MLEA 3OZXA 1K6MA 1G8FA 2ERYA 2HCJB 1BS1A 3SNHA 4Q4JB 4ERNA 1G7CA 4F92B 1SKYE 1TQ4A 2FSIA 4G5OA 5FTJA 1P5ZB 1TU4A 4PC1A 4KSBA 4BLPA 1OB2A 4HAZA 3S1AB 4EJSC 1KDOA 4I1UA 4OBEA 4HI0E 1AS2A 1CS4C 2VF8A 5HZKA 4PSVA 1COWD 2IBMA 3EAQA 3GJXC 2ZRJA 3S1AA 5FTNA 2OCPA 3TNFA 4QGHA 2MMGA 4PO8A 1GVNB 1XTSA 5JHGB 3T34A 4NYMQ 2GJAA 1W5TA 5HKKA 2XXAA 2YYZA 1RRFA 221PA 4JSTA 2CLCX 2ZJAA 1MO5A 4DT1B 3M0EA 4DSUA 2OLJA 1ZUNB 3I5YA 3AKCA 4HDQB 5P21A 4EDHA 3B1ZA 3LLMA 3NHBA 4RZ2A 2VSOA 4PTLA 4PC2A 3HP1A 2KSQA 4R2HA 4WBSA 3DKPA 4IFEA 3CF2A 2CEAA 2OO7A 3VR2A 2AK2A 1GOTA 1JJVA 1JNYA 2ZUBA 5KDDA 2P5SA 1NKSA 2X2EA 4GBMA 1GZSA 5BYKA 5FUYA 2BKEA 3PENA 1ZM3A 1SVKA 4KLNA 1E1RA 3AKYA 3FB4A 2P65A 3LH5A 4IXNA 2GJKA 2VO1A 3TUZC 2YHSA 2P3SA 1DG1G 4PXAA 4PZYA 2JLZA 2VH5R 2RGEA 1XU4A 2ZVPX 1DG3A 3THXA 4BFZA 1Z6AA 2GK7A 1Z29A 5CK4A 4KI0A 5CM8B 1KNXA 4DLRA 1KI6A 1G1MA 4JKIA 2WZQA 3NKVA 3R7WB 5FTKA 1KK1A 1QHSA 5IK2D 1Z07A 5G40A 3D7MA 4C0QC 4CEHB 1CRPA 1NN1A 1YHNA 3LV8A 3CUEF 3DOFA 4D81A 5HPYB 3CX7A 2JJ2A 4LBYA 3K9LA 3R8FA 1D2MA 2ZRKA 1VG1A 3GQBA 3A1TA 4DCTA 1FL9A 5DYGA 1Q3TA 2HEIA 2IYWA 3LLUA 4DDVA 1RKBA 3KUDA 4G3XA 2IWHA 2GK6A 4KU4A 5IHPA 1A4RA 1TUIA 4XD7D 3RRMA 4Q5IA 1VG0B 4EQ6A 1Z6XA 1CJVC 3LAWA 2Z5FA 2QMUA 3KXIA 2BDTA 4TYYA 2G6BA 3NHAA 1E79D 4F91B 4YMUA 2D06A 1QHNA 5JI2E 3LA6A 2QZ4A 2CHVA 3HU2A 4JYBA 2WOOA 3WNBA 3FHCB 5LD2C 4A6PA 3A1UA 5HZHA 4HUTA 2GTPA 3MAAC 1OW3B 3B7GA 3OIVA 3EA5A 2V9PA 4FD2A 4KFRA 1GRNA 5KDLA 3TQFA 2ZS7A 2NO6A 3ICEA 4LJ8A 2VF7A 3F8TA 2CJWB 5F9FA 2VP5A 1W2HA 3LD9A 1ZMXA 4TL8A 4B32A 4H1UA 3SE0A 3VU9A 4KHZA 1GTVA 3BH6A 4KV9A 2EFCB 2F1JA 4OI1A 4HZUA 1VG8A 2ANBA 2O8EA 1IN4A 2RCNA 1G18A 1JR3E 3LBNA 1XZQA 4A2WA 4DWJA 1Q1EA 1M8PA 3FKSA 3IIKA 3WYGA 2D7CA 4QFMA 4YMTA 4Q1DA 3T1TA 5EXXA 1XTJA 4Q48A 2GVDC 3PR1A 4LX0A 4GL2A 3NDBB 4XSHA 1KKMA 1JJ7A 4URZR 4AKIA 4MKIA 3CNOA 1S96A 3BERA 2QRZA 3SU8A 5AUOB 3TUIC 2REXB 4QC2A 4QM6A 4Q03A 4Q4AA 4BFWA 1WP9A 5IRCD 3T06B 2B7BA 2DFNA 3VR3A 3R9WA 5FOVA 1KI2A 4U02A 3U6KA 2WKRA 1ZM4A 2Q21A 3CRW1 4BLSA 1QHXA 1RC8A 1SKQA 4TT3D 1XFAA 5FBRB 1Z8FA 1EFRD 4PC3A 3RS4A 5JSZA 4JT4A 1YQTA 2QM8A 2NMVA 2H57A 1NRJB 3EZ7A 1EFTA 4YXWA 3WY9A 3EC2A 3KKNA 4ASUD 3RWOA 3L0IB 5C18A 1DTSA 4XWOA 4PR0A 2B21A 4C9BA 1IY1A 1W0KD 2JLSA 2RGNA 4II7A 3KKMA 1N0VC 1JXMA 1M7BA 3I8XA 3FMIA 4C0JA 2WTUA 1TF7A 2OLKA 1KKLA 2R65A 2J45A 2QP9X 2BMDA 3B78A 4RFSB 3SZRA 5J40A 4BFXA 2VYFA 1T6NA 4W7SA 5JECA 1PZNA 1I4DD 1GKYA 3KTAA 4I4LA 2GF0A 4KBGA 3QPUA 3X2SA 4JJKA 4PAMA 4XTRA 4IEEA 4A0HA 1KJWA 2OV2A 4HAYA 1GKIA 4JLPA 2W6IA 2W83A 1JPNA 2XTMA 2BCGY 1OH7A 2ZU6A 4D0LB 2XZLA 4M1SA 4Q47A 1VIYA 2E9SA 3GLHA 1E1QA 4DB4A 3U5ZB 2R9VA 1NVXQ 1KMHB 2EFEB 2QP3A 3BWDD 1W36D 4DXAA 1NN0A 3DZDA 2B7CA 5K8LA 1TMKA 2VP6A 1ZCBA 1E2KA 1U2RA 5CDFA 2A9KA 2UKDA 3BB1A 2ZJZA 1BYUA 4S2EA 3DL0A 4O3MA 5GJWC 5C4MA 1OIXA 4JJZA 5CYPA 4M1WA 4U7DA 5FOUA 2IA5A 2QSYA 1XB2A 1XRJA 2ONKA 3UMSA 2IUSA 2ZSFA 5FL7D 4B2LA 4QBIA 3EX7C 4OK6A 4LHYA 3I1FA 5B58C 3AF1A 1H8HA 2WWHA 1WBBA 3PFIA 3QUSA 1DBSA 5TVKA 1YR6A 4RZXA 3W8RA 3W8NA 2QORA 5KO2A 1XEWY 2AKYA 4XH9B 1GKUB 1KO7A 3BAFA 1BMFD 2JAQA 5JEDA 5JI3E 1NY5A 1AGRA 3WNDA 4LBWA 1A2KC 5L3VA 1QVAA 5JRZA 2ZJ5A 5IT5A 4EJSA 3TH5A 1JAHA 1N2CE 1S9DA 2J0VA 4HAVA 1VCMA 3DO6A 2O0JA 2HCBA 1G8HA 1GNQA 3L2OB 3UIEA 1Z2AA 3T15A 4TMKA 1GG2A 3PV0A 1QHIA 3M6AA 1QG4A 3VKHA 1KK2A 5DHAA 4TZ0A 1Q3HA 2E1RA 2ZUDA 1W2GA 2RHDA 3ZLJA 1Z47A 4LJ7A 3M4YA 2C8VA 4DBLC 2PJZA 2K5UA 2QTFA 3UG6A 3PUZA 521PA 2REBA 4QBFA 1N5IA 2AWNA 3VX3A 4ZDKA 4P3YA 4YC7A 2FEOA 3RVBA 3EIEA 4MRSA 5D3MB 2FE4A 4OHZA 2CNWA 5LDDC 2WKQA 4QHSA 2J0SA 1F2UA 1VYTA 1OH8A 3G5UA 2E87A 1UEJA 1N5LA 3ZD7A 1ZVQA 3AGPA 2F1IA 3UMFA 4GI7A 2AX4A 4MRPA 2R6DA 1PUIA 1U9IC 4LBVA 1AZTA 1WCV1 121PA 1D6JA 3CBQA 3PUYA 4Q21A 2GRJA 3HJNA 1E0AA 2DB3A 4M4SA 5FR2A 1DE0A 3BC1A 4TMXA 3OAAA 1AQYA 5FOWA 4GMDA 1AIPA 2V8OA 1IN7A 1DVRA 5L3SB 2ZRIA 4IDQA 2IUUA 4NU0A 1IQPA 1ZNZA 2ZI5A 2WAYA 2WSSA 3R7WA 3T12A 1S0UA 4I1VA 4ZI2A 4ZCIA 2QAGC 2W6JD 4QL3A 2O8DA 3PIRA 1OXUA 2O0KA 1T8UA 4Q7JB 4EQ6B 1WMSA 2ZRPA 4BRWA 4BUJA 4LJ5A 4FW9A 1DEKA 1T3LA 1K5DA 3AP2A 1XXHA 3ADKA 3SQWA 3P32A 1JQJC 1KO1A 5M04A 1M7HA 1N0UA 1U9IA 2OUKA 4XVUA 4G5RA 3BIFA 2IL1A 2KBEA 3QXJA 5E7MA 3A4NA 1H8EA 1HY3A 2AR7A 2FPLA 3REGA 4A0GA 2CMKA 2IYYA 1GRRA 3BK7A 1CIPA 2RKOA 1D9ZA 1M1YE 2DWQA 2D62A 1NBME 3K09C 5BW8A 2HLDA 4D80A 3NH9A 4HUQA 5F3WB 1E9FA 3WRYC 4H9GA 3ZVNA 1OF1A 1IXSB 2V7QA 2GKSA 4FCTA 5JRJA 3KB2A 4DUGD 3TRFA 1KJZA 1W1WA 2C99A 3VR5A 3SHWA 3BH0A 4W5JA 4KJZA 2BBSA 2EFHB 1FNNA 2Q9CA 2QGNA 4BZQA 3I61A 5JS8A 3P27A 4Y0AA 4C2UA 2R2AA 2W58A 1ESMA 1ZUIA 4BRUA 1SQ5A 4XVQA 3Q7PA 5FTMA 1CR1A 1Q20A 3SN6A 4M1KA 3OHMA 4KVAA 3T35A 2CK3A 1OH6A 1KJYA 1HYQA 2H5EA 4YONB 3GJ3A 1N3BA 4NDZA 2G9NA 1HE1C 3K09A 1MO3A 5EJEA 1XEXA 2WHXA 2PX0A 1G17A 1TUEA 5TDHA 2WBLC 3E70C 3IPYA 3IQWA 1MV5A 2WIBA 3NBZC 1OIWA 4MYUA 1P9WA 4RKEA 4QKQA 1UAAA 4EUNA 5EE3A 2CDNA 3IKJA 3QKRB 3HR7A 4LDJA 1XXHB 2YZ2A 3QXXA 4Q4LA 4Q66C 5FI1B 1K8RA 2A7QA 4PPGA 2Z4SA 1P2VA 3SJBA 1A2BA 3JZAA 1U94A 1T0HB 4XOIA 2YWFA 3UKDA 3Q8XB 4JL6A 5HKKD 4R7ZA 5DI9A 3U7HB 1SVOA 1COWA 2PLFA 3B82A 2X1VA 1ZIPA 3A58B 4KFTA 4DDUA 1VHTA 2IS4A 4G1UC 3CH4B 3DM5A 4M9XA 3X1ZA 4CRWB 5EXTA 1PVOA 4PSAA 2ZRHA 1E2QA 2XB2A 2WWXA 4EPXA 2X19A 2P6RA 1P2UA 4CDGA 2ZR0A 1TQDA 1R4AA 5AUNB 4P31A 3HYTA 5JWRA 1H8ED 2BMJA 5DSZA 5E7IA 3QE0A 4GOXA 4RFVA 2Q0HA 3ZQ6A 2GAAA 1BIFA 1G3QA 3ND9A 2IYRA 4A0RA 4FCVA 4ZCLA 1BO6A 5DNYB 2FX3A 1FMLA 2JJ8A 5UKDA 3P1JA 1G5TA 3AM1A 1P2SA 2HF9A 4QHYA 2NTYC 3Q5EA 1NLYA 2QI9C 3EIQA 1ZD9A 2CE7A 1IXZA 2WV9A 2KE5A 4UNRA 4DLSA 4FWIB 2R6GA 3I73A 3FYHA 1L2TA 4GRAA 3ADDA 3LX8A 2YOFA 1ZCAA 3QF4A 1XF9A 2CCJA 3OEED 4EFNA 1P7CA 1OXTA 4OQLA 5FTLA 2XSZD 4NCHA 1P62B 1ZD8A 3QG5A 2HT6A 4JVMA 1AN0A 2WWYA 3KB1A 1LNZA 3GLGA 2NO9A 4AIIA 3PXGA 3WMEA 1ZUHA 2ZAMA 1I2DA 2XAUA 3QBVA 3ICQB 5C4GB 4MYTA 3W3ZB 1R8SA 1G4UR 4QOSA 4BFTA 4FWTA 1NKTA 4L15A 4OQMA 3KZ1E 5K8UA 2JDIA 3AVTA 3T5DA 2QAJA 2BWJA 2OFXA 4K8OA 4HATA 3NC1C 2J3EA 3GLFB 1D9XA 2J46A 2VHUA 2WVJA 3GJ0A 3IIMA 5DISB 2O8FB 2G77B 3C5HA 2GJ9A 2ODEA 1QHHB 3KL4A 3OEEA 3RS3A 4CT4B 1KSJA 3K0FB 1JI0A 1KSHA 1PUJA 4NCNA 4Z8YA 4B73A 1JR6A 2Z6VA 1DS6A 4C0KA 2WJVA 1Q0UA 3CNLA 3B13B 5EZ6B 1ZNWA 3RDPA 2G3YA 4HSEA 4F4CA 5HTKA 2YWEA 2CXXA 4PAOA 2Q3HA 1OLOA 3ZH9B 3PCRB 1QHYA 1JECA 3DZ8A 2O8CA 2N46A 3I8SA 1ZP6A 2ASEA 1R5OA 4I81A 4G0NA 2WJHA 3F5FA 2PCJA 1J8MF 4IRUB 3GLFE 4IDHA 5KSPA 721PA 1NVVR 4D4JA 3O8DA 4AYWA 2QE7D 4UNNA 1D2NA 1MKYA 2DWOA 3PG5A 2PCLA 1QZXA 2GCNA 2W2TA 5AJVB 2QT1A 2QBYA 2FZLA 1AJEA 4DRZA 1NL3A 1HT2E 2H1LA 4AY2A 4MA4A 4NH0A 1OE0A 2V6IA 2CLSA 2WWGA 2V55B 4G5SA 4TTQA 2C9YA 2FSFA 1CJMA 2HUPA 1V5WA 2IS1A 3QXSA 4FMDB 2MSDB 2XTNA 1ETUA 1OXVA 1PLKA 4KAXA 5C46F 3FMPB 2ZYWX 4Q4JA 2XEXA 4MGYR 5EP3A 1GUAA 3IEUA 2Q9BA 4A4DA 5LD2B 5KSOA 1TX4B 2ORVA 4TLAA 1E99A 3EARA 4Q7LA 3CR7A 1XPOA 1OXSC 3U61B 1XJQA 2BEJA 2OT3B 1Z2CA 2B6HA 4IVPA 1ZNYA 4TMTA 3H2YA 1E2NA 2CL7X 2P0EA 3GLIE 3THWB 3GJ5A 4Q7KA 4B3DA 4PPNA 2ZI9A 4TYNA 1EFCA 4BASA 2JLYA 2ANCA 4OK5A 3A6PC 2PBRA 1E9CA 3OF5A 1P9NA 1OXXK 1PV4A 1F60A 3WP1B 2PJRA 4QG7A 5CK5A 3VHXA 1IXRC 4F38A 4LK2A 3U44A 3U3KA 3B60A 3QPVA 1SXJA 4DDWA 1YZNA 4OQFA 2ZVQX 3WHKA 2PT7A 3SS8A 4OKSA 3AVVA 3EXAA 3MG9A 1TAGA 2R6FA 2V7QD 2YC2C 3GJ8A 4TLBA 3PEWA 2NQ2C 4WZ6A 1YZUA 5H68A 3TSZA 2JLUA 3TAHA 3PEUA 2G1JA 2QL6A 3DMNA 1G8GA 4JVSB 1AM4D 4LJYA 3VKGA 4POAA 3W5IA 2ZXUA 1AS3A 4P0TA 1W36C 2WJGA 2OZEA 3SJCA 3I5XA 1XXHE 1YE8A 5AUPB 1NI3A 3H84A 4ZCMA 1GWNA 4OQNA 1CBUA 1HE8B 4FMBB 4NMMA 5F9HA 1U81A 3B1VA 4HB3A 1ZBDA 3GLHB 2QEQA 3CKLA 1J70A 2ONJA 1AKYA 1HURA 1TADA 1DAMA 4GOKA 3ZGXA 2ZI6A 3PEYA 3TLXA 2ZU0C 1T91A 1XP8A 3LBHA 5KUTA 4LUCA 2L0XA 2GNOA 3BB4A 1Y63A 4JLVA 3K0CA 4Q1FA 1LS6A 2CL6X 1Z3IX 1U90A 3AV0B 1CP2A 4XJXA 2NIPA 2OCBA 1E96A 1XCMA 3P4YA 4JT2A 3CONA 3EPJA 2REOA 4BQSA 4LJ4A 3U44B 5FBQB 1UEIA 1VTKA 4Q9LA 4HLUA 4YQFA 3V00A 1OPXA 2D4HA 3DKVA 4NP6A 4A8JC 2B8TA 3AVPA 1P72A 4JLBA 2VHJA 3SFVA 4B2IA 5FR1A 3GFTA 3KJHA 5DN6D 4YDSA 4PPFA 1II0A 3LY5A 2FNAA 1DAEA 1LF5A 1H8HD 2ZI3A 3BFKA 4IEIA 2WM9B 1QHGA 4PC7A 2ZSDA 5JFGA 5FL7A 4NYJR 1QG2A 2G1KA 4E09A 3OFNA 4TSFD 2AD5A 1SXJE 2YWHA 3IDQA 3QSYA 1U8AA 4V0NA 1TQ2A 1XZPA 2QAGA 3P20A 4A8JB 5KOYA 3MRSA 1N5JA 1Q1BA 2RGNC 2ZEJA 3FDIA 3BBPA 1FTSA 3KJGA 1G3RA 4WXPA 1R5NA 2YINC 4LJAA 4R9UC 1N6NA 2QAGB 2VTKA 5TB5A 4A8JA 4IVRA 1Z63A 3TJZA 4D2IA 3V9PA 3DMDA 3HYRA 2Z4RA 1D8TA 2RHMA 4B74A 4UNQA 4KITB 3LQRA 4MDEA 3G0HA 3LFUA 1IN5A 5K8IA 2JA1A 4OYHA 1U8ZA 1YRAA 3K0AA 1R0YA 4DHEA 3JZMA 4LY6A 3QNUA 3QJYA 2LKDA 5IK2A 3RHFA 1W4AA 2QNRA 2GILA 1PJRA 2CJWA 3C41J 3Q7QA 3LRPA 4EAQA 1ZYUA 2ORIA 2FU5C 2ZJBA 3FPAA 3CPJB 1FX0B 4A2PA 4DLWA 3FMOB 1HQCA 4Q1AA 2GZAA 3FTQA 2AKAB 1OFHA 3ZVRA 4O25A 5CLLA 4FMCF 5FOXA 2A2ZA 4GOJA 4MGZR 2QUZA 1XPUA 4JBXA 4M1YA 2A78A 1JEDA 3HPQA 1J2JA 4IXMA 4TMZA 1LTQA 2Y8EA 3QVUA 3U3MA 2WOJA 1WRBA 3C4JA 2IK8A 4HLQB 4C0BA 2JCSA 2NPFA 3B2EA 1TU3A 4NCIA 4QGFA 4CEJB 3UATA 5DE3A 2VSXA 1TL7C 2ZYUX 4Q02A 1EX7A 4QNRA 3O8RA 2VHCA 4NCJA 1K5GA 2GBLA 2WMNB 1Z83A 4Q9JA 2OESA 1ELOA 2Z0MA 3SR0A 3ZZ0A 2FN4A 2NZJA 1LS1A 2KWIA 4B33A 2Z43A 2KI5A 3GLGB 3KUCA 3QF7A 2QN6A 3SC3A 5AJYA 2BCJQ 3FOZA 3RS0A 1QVRA 2CHQA 4IOLA 2AXNA 1NVVQ 2GCOA 3HWSA 4R71A 1GM5A 4IDNA 3VNUA 4RFSA 5KNBA 3NWJA 4KODA 4DLVA 1VCNA 3TSOA 3N2IA 5SZIA 4Q4HA 1EWQA 4ZO4A 2BHRA 1P4SA 4KXFB 1W0KA 4MGKR 4DLYA 4TMVA 1U98A 4DKXA 2HT1A 3RANA 2Q3MA 3KXKA 1C9KA 3X1XA 4D0GA 1FFHA 2YWGA 1E2PA 3EZ9A 3D31A 1KYIA 5TXGA 3PJRA 3SEAA 4CZ2A 5BN3A 5JSZB 5AR1A 3LO5A 3Q3JB 4RCYA 5TARA 2ZUCA 3CX8A 4MUAA 3VNVA 1N6KA 4WXRA 2C9CA 2GETA 2GF9A 4NYIQ 4LYFA 4BLQA 4WZAE 3DVLA 1KI4A 1Z06A 3UG7A 4C7OA 4MITA 4F4IA 1NP6A 4NONA 1KY2A 3DEFA 5JJLA 4X8OA 4XD7A 2PL3A 2UZIR 2XX3A 3DDCA 1AA3A 1P60A 3GEHA 3IPXA 4IOKA 1E0KA 3VQTA 3AF0A 1RFLA 4V0KA 1T3HA 3LXRA 3GLHE 1VMAA 4WZBE 4NCKA 4QGAA 2A30A 1AS0A 4DCNA 5CLQA 4DEXA 2PX3A 2H16A 2DFTA 2RGCA 3K9GA 2GXUA 2VHTA 2ZREA 1G3IA 3AUXA 3NBFA 3TKLA 3BS4A 5L3QA 2F1RA 4RD2A 5GJBA 1ESNA 4B6EA 1OYWA 4C3ZA 5B30A 3IHLA 4D4KA 4ZDIA 1YZTA 3CZPA 3EWSA 3TR0A 3W34A 1W36B 1EG7A 4XSGA 4PAQA 4HUQB 4D4LA 2QU8A 1BH2A 3K0CC 3TW4A 1F2UB 3CF6R 4OQXA 3EIHA 4JLDA 2VP0A 1KMQA 1GL6A 1T3SA 2ZS9A 5E7JA 4PHFA 1FTNA 3B9QA 1F48A 4Z8XA 1SZPA 4TSFA 1ZU4A 4RZUA 4F4JA 2V3CC 4IDOA 1JBKA 1NG1A 3T1OA 5TMPA 2IYXA 1D5CA 2ZE8A 4CEJA 4LZZA 2ZJ2A 2DBYA 2X8AA 4OHWA 1DARA 1VG9B 1IJFA 4GZMA 1KY3A 4C0AC 1JEEA 4N0DA 1Q1QA 3I4LA 4ZPXA 4N0EA 2O8DB 1M2OB 3IHWA 4FI3C 4EFLA 2WWIA 3HDTA 4GMXA 4Q9HA 3LVQE 1OB5A 1LW7A 3HR8A 1A1VA 3VMFA 4TZ6A 5B64A 1E2JA 2F9LA 1GAJA 4BFSA 3H0KA 3U4QB 2ECKA 3LW7A 1SXJC 1CJUC 1Z0JA 2FGKA 2WAXA 4M2LA 3TK1A 1W4BA 4Q01A 5KPJA 2PH1A 3DPUA 2V54A 3MWYW 3KKQA 3BXZA 2N1BA 1IOZA 2YOHA 4EFMA 4HLCA 3QF4B 3SJAA 3AVUA 1X8JA 1KOFA 1XMIA 1YZQA 3K8YA 4YMVA 1DADA 5KDOA 1OSNA 1W49A 1Z6TA 5J4LA 2CK3D 3QKUA 2D2EA 4R98A 4WAUA 4CEIB 5LPNA 2I1VB 3ZS9A 4UKDA 2PZGA 2ZETA 2GCPA 2KB0A 1G291 4M8NE 5JMTA 2QMHA 2J59A 4TQ9A 2XJ4A 5LB4A 3QY0A 3WBJA 3ZS8A 4LJ9A 2GEDA 4TMWA 4RD4A 3RSOA 5CB8A 2BIFA 4BLTA 1KDRA 1GL7A 2IXGA 5H1YA 3AEZA 2VSFA 2CCGA 1US8A 4P4SA 1E2IA 1C1YA 1XD2A 1G5RA 2GJSA 2WICA 1DAGA 4CGZA 5J5CA 5TY0A 2FJUA 3T1VA 5FBVB 1E2LA 3M1IA 3C16C 3SYLA 3ZVLA 2DFLA 4WVFA 4B34A 4Z51A 3KX2A 2ZJ8A 2QTVB 3KJIA 1C4OA 2HYDA 3IBYA 3W3AA 3W6PA 4Z1MD 1X8KA 4LJ6A 3J81k 1CKEA 1VCOA 1OFTA 1G7SA 3RSLA 1MOZA 3TMKA 2BJWA 2XNSA 3UWOA 4TTPA 2HV8A 1NLZA 2OAQ1 4Q9IA 2BC9A 3ZZTA 2OBMA 2IWRA 3RNLA 3ADCA 2HDNB 2BV3A 4LV6A 4D82A 2FFQA 2BM1A 1E9AA 4KO8A 4A2QA 2FFAA 3U6BA 2WSSD 3ONWA 4PHTA 5A4JA 1KK3A 1OFUX 5FPKA 1G7TA 1FNMA 1MRSA 3H86A 1FZQA 1E0SA 5GJCA 1FOEB 4MRRA 4BFVA 4CVNA 1GDDA 1JB1A 3K53A 1AQUA 3CM0A 4FINA 1YRBA 2A5JA 5JZVA 1LV7A 2HF8A 3UANA 2CLDX 2ZR9A 2BBOA 421PA 2OG2A 4BFYA 3NEJA 2V1UA 3GMTA 5BN5A 3A4LA 2C98A 3Q5DA 3MGCA 1GITA 3L0SA 3AVYA 2OE2A 1KI7A 1N6IA 2GESA 2ZYVX 1SVIA 1EFHA 4LYJA 1FP6A 1XMSA 2OXRA 4P4TA 4F93B 1SULA 1M74A 1G16A 5AUQA 3EWAA 4DZZA 3CWQA 3SYNA 2VQSA 3GEEA 1KDTA 4B3XA 1F3OA 4AWXA 2H8KA 1E2FA 4L9SA 3FVQA 1W0JA 3D3QA 1T5IA 5E3HA 4A1FA 1A5TA 3NEYA 4MDFA 4L16A 1O3YA 4MYHA 2ZQ5A 3TUJC 3WMGA 1TTTA 1Z0KA 1CJTC 2F6RA 2O5VA 4IOMA 3EPKA 3RLFA 1KMHA 4AG5A 2WPDD 1Z28A 3GJ4A 4OL0A 1ZAKA 5CB6A 3KKOA 2QROA 2ZJOA 5DGXA 4DIDA 3OE7A 3RRYA 5F98A 2JIZA 3CH5A 1P2TA 2JGNA 4LOAA 3SBDA 4MRVA 4A0FA 3H1TA 3TSWA 4LPKA 1EFUA 4WW0A 1RRGA 3BORA 1OH5A 4Q4AB 1BMFA 3ASZA 1ZD1A 2J7PD 2QPTA 1F2TB 4KCGA 4NPHA 1CU1A 1NMYA 4Q9KA 1TEVA 2VHQA 3GJ7A 4L8GA 4UQOA 4I1OA 2J1LA 2ZANA 3ETLA 1QHHA 2JATA 3PUWA 2DR3A 4DSNA 2V1XA 2IF2A 3ASYA 2QE7A 3UMRA 4RD3A 1OKKA 8OHMA 3KQKA 3GLIA 4YMWA 4BEJA 3ZD6A 4RVCA 3E2IA 1G64A 1XCGB 4UNSA 1XJCA 2JLWA 2RGGA 2QBYB 1E4YA 2RB4A 1E9EA 4EPVA 1EGAA 1KDPA 2ZRLA 2EW1A 1W5SA 1KAOA 3FGNA 3O47A 4M22A 4QM7A 3AVQA 1Q21A 1UKVY 2GHIA 4TLDA 4TYPA 1SKYB 5FPSA 4B6FA 2IYVA 3U3OA 4G5GA 1J8YF 4LC1A 3IBGA 4GFDA 4PANA 4KSCA 2OFOA 3SJZA 1UJ2A 1ZNXA 3QKTA 4PHGA 4DT1A 5L3QB 1IN8A 3PITA 2IYTA 2XXAB 3KQLA 3CRVA 1G3MA 1VPLA 4V0ME 3U7GA 2CL0X 1GFIA 2DPXA 5FOTA 1EWRA 1XTIA 5JWHA 3TAUA 1MO6A 3TR5A 3A1WA 3VAAA 1FW6A 1UPTA 2H17A 1JQLB 1R0ZA 4E03A 1SVMA 3AGQA 4H1VA 2XOKA 4AYTA 2A5FA 4C0HA 4HZUB 3UPUA 2QQ0A 3BB3A 2JLQA 1E98A 4PHHA 5J4KA 1ZM7A 4ZKEA 5KTYA 3CRRA 3DM9B 4MKGA 3WRXC 4DUGA 2CHGA 3U7FB 1MR3F 2P5TB 1ZU5A 4B44A 4TL9A 1GILA 5D3QA 3B8HA 5FI0B 5FPTA 3VTKA 1WA5A 4DLXA 2XSZA 1SXJD 1RPZA 2NOAA 2BMEA 4DVGA 2A5DA 3AKEA 3GLIB 2RGBA 4TL6A 1NN5A 1XD2B 2KJQA 3CNNA 4JS0A 5G53C 3C15C 1LFDB 1P3JA 4AKGA 1KI6B 1D2EA 4UJ3A 2HXSA 1DO0A 1KI3A 2PEYA 3ND8A 4JLAA 1CRQA 1S4QA 2RMKA 2BJVA 4OI0A 3FWYA 4Q4HB 2QSZA 4BZPA 1U0HC 1WQ1R 2PT5A 2QPOA 4NYMR 1M7GA 4E07A 2WKPA 2GCOB 1U0JA 1MO4A 5EUQB 2GXQA 3AF2A 4F7WA 2P6UA 1SHZA 3OESA 1MABA 1UBEA 3MCAA 2IX3A 1T0JB 4HAXA 2IC5A 5HE8A 3KXLA 5AJWA 821PA 2WJIA 1VYUA 1RYFA 1VHLA 2R6AA 3SDZA 5BYJA 4TL7A 3SHFA 4ZDJA 1GSIA 1US8B 4CT5A 3W5JA 4DCSA 3VKWA 1HT1E 2OILA 3D8BA 3PVSA 5J47A 1WE2A 1M34E 2BVNA 2IXEA 3KTAB 3B5JA 1ZC4A 3MJRA 5L3RA 3MMPA 4V02A 3BJIC 2X77A 1L8QA 1G8YA 2EYUA 3C14C 3P4XA 2BEKA 4RSGA 5AWFC 3EW9A 4O0MA 5CJPA 1LB1B 4LBZA 3VHLB 3K0EA 1TNDA 2OCYC 2H18A 4X8LA 2D74A 1DAKA 1WXQA 1QBKC 4JVLA 4KFUA 4US0R 5LB2A 2FF7A 4B3CA 1KZGB 4DLTA 1MRNA 2J0UB 4NYJQ 4Q19A 3THYA 1T9HA 4A15A 4FXPA 2C96A 2D2FA 4J0QA 3D6TB 2VRWA 4IKEA 2FGJA 5JHHB 1ZIOA 1J99A 3AP3A 2IHYA 5EP4A 2AD1A 2VP9A 1ANKA 1KSGA 1XX6A 3PQCA 1E9RA 2TMKA 1AZSC 3MUFA 2ZIAA 3B85A 4JYCA 3CRMA 5E95A 3UXMA 3VR4A 2FFHA 4URVR 4DEYA 5JS7A 4KBFA 4MRNA 3HPRA 4V03A 4RKFA 4DSTA 3KQHA 3A8TA 4EKDA 2ZRAA 3QPWA 3AVOA 4Z54A 5C2JB 3A1VA 2UZ3A 1W4CA 4ZIRA 2NG1A 1DPFA 5DI3A 4NZYA 3ZDQA 2Q3FA 1G7RA 1A82A 3AH8A 4JLMA 1NBMD 2AHOA 2IW3A 1Z5ZA 2OXCA 1MH1A 2GXSA 2IF0A 2YJTD 4GDFA 2XJ9A 4LYHA 1VYVA 3VU9B 2GAOA 2PEZA 3LVRE 2C2HA 3A1SA 4BLOA 4FMDF 4A36A 4MUBA 5JBQA 3JVVA 1XPRA 1RW4A 2J87A 5KSZA 1KI8A 1E1RD 1UF9A 2QT0A 1UBGA 2ZROA 1YZLA 3MWKA 3C7KA 2W2XA 2P2LA 3SQXA 2AN9A 2ZE5A 4HB2A 1UM8A 3SOPA 3BRWD 4GSYA 3QOFA 4WIAA 4PQFA 4HEJA 2IS2A 2FOLA 2JASA 4JBYA 3CZQA 4B3BA 4U5XA 5TV2A 2YC4C 1SGWA 4AKEA 4X8HA 3W6OA 4C4PA 2XNDD 3B1WA 4CW7A 3Q9LA 4B35A 4QRHA 1L4YA 3AF3A 4A92A 2J0UA 1CJKC 3FFBA 1KTVA 2AK3A 3MWLA 2B8WA 4OHYA 5KNCA 2EQBA 1J7KA 4CYMA 5CYOA 1XEFA 1E2DA 1NSTA 4WOPA 3CO5A 4EPRA 4UXIA 1EXMA 1E2EA 1PLLA 2FV8A 5HR5A 5DH9A 2NO0A 4BEBA 4JLJA 1VCIA 4MKFA 2GZDA 4N3NA 1E94E 4RY2A 3IGFA 5HE9A 3ZJYA 2I4IA 1S1CA 1DAIA 2AFHE 2FFBA 4C0SA 4E22A 4BGDA 5ELXA 3WNCA 5B2ZA 4V0OA 1XCPA 1SHKA 3AP1A 4CIDA 2G0TA 1CTQA 5JCPA 3U4QA 1N0WA 1N5KA 2ZE7A 2RGDA 3EZ6A 1NY6A 3L82B 3N2EA 5FFMA 1FQKA 1EFRA 3OEHA 4QBGB 4HLUC 1E2HA 5HCIA 2XNDA 4NHOA 4LSGA 4LI0A 4Q00A 3OE7D 1X1RA 2G0NA 3BFVA 1OT3A 1T4GA 2A5YB 1SVSA 2MSEB 2OHFA 4A9AA 2BBTA 4URYR 4US1R 5F2EA 1S3SA 3G82C 5DIFA 5FBWB 4ESHA 1NN3A 4RCZA 4OHXA 2J5XA 1KO4A 3SYKA 3ZVMA 4Y0VA 4B71A 1ONBA 3W9YA 4BECA 1R10A 2BBWA 4LHWA 1RYHA 5EP1A 1YKSA 3R9IA 4GP7A 2ZRNA 3MJHA 1UKYA 1MT0A 1DO2A 2ZSBA 1OKKD 4JVNA 4TN1A 5DO9A 2J41A 2QTHA 3GFOA 4OI2A 1EESA 4QJ3A 1JPJA 2FPKA 3K1JA 1L7VC 1LF0A 2DFKB 2IT1A 2Z83A 4G5QA 4BZXA 4FN5A 1NBMA 1OV4A 5DN6A 2G88A 1KGDA 4UNPA 4JKYA 2GJ8A 4JLKA 1X86B 1X6VA 2GA8A 4C7OB 2RGAA 3GP8A 2QMOA 1G20E 2HLDD 3I92A 2BMFA 2FSGA 3HU3A 1UDXA 5SZJA 2PZFA 2F3TA 2LWIA 3B1YA 2O8BB 1XEXB 2VA8A 1GIAA 3QI2A 2GWHA 3F0TA 2ZM5A 1H65A 3ZIAA 2R8RA 4E5UA 1RZ3A 4JZKA 4OI4A 3TQCA 2ZI7A 1CR2A 1JXOA 3AVWA 2EFGA 1NLFA 3CW2A 1CXZA 1I4LD 1XWIA 1YVDA 1Z08A 2OFWA 2ZYTX 3L0PA 3LXXA 4RJLA 1VDZA 3Q85A 4D26A 1IY2A 1FQJA 2F3RA 2QM7A 3VR6A 1U0LA 2J9RA 2OSBA 3NG1A 2WJJA 3OEHD 4ARZA 2IHBA 1R7RA 2W6ID 5EE0A 4P4SB 4AC9A 3L0OA 4M9ZA 1CLUA 3QKSA 5HCNA 2ATXA 1GNRA 3I32A 3E5HA 2VLIA 4M21A 1TEXA 2PLRA 2JJ2D 3ZQJA 4EPTA 1F5NA 2ZJYA 5KPDA 2IYQA 3KQUA 4Q1EA 3BOSA 4AYXA 2EU8A 5C1BA 3B6EA 2GVZC 4NTZA 5D3MA 3FFAA 4B76A 1XMJA 3WMFA 2HJGA 4A6XA 3R20A 3AKDA 5FUXA 1NG9A 2ZRFA 1SVLA 5J4HA 1P73A 2RAPA 1XNJA 1P75A 3CF0A 3UK6A 1BYIA 4XWKA 1R0WA 5DYIA 2XOKD 4JLNA 3V4RA 2ZI4A 3NBXX 1KIMA 3SI7A 3TVTA 3GLGE 2XZOA 1VECA 1XEWX 4LGMA 2F55A 2CE2X 3H4MA 4IOJA 3VX4A 1N6LA 3K9HA 4XVRA 1ZC3A 3R8CA 4TLEA 2DWPA 3NBYC 3T5GA 3TIFA 2DY1A 1DOAA 4Q1BA 2F1HA 2FMXA 1RRCA 3FHTA 3CB4A 2O8CB 2QPAA 4JL5A 4EJSB 1T8TA 2IEZA 2IEYA 3ADBA 2FEMA 1XTRA 4LRWA 1IHUA 1E6CA 1AKEA 3TBKA 4W5WA 1BKDR 1NSFA 4B75A 3R9XA 1HV8A 4TTRA 4UXJA 4PZZA 1KAGA 3IILA 5FUVA 5H8WA 4ZV4A 3BFXA 3OAAD 1S3GA 3REFA 1ZJ6A 4M1MA 3RYTC 4R2IA 2NGRA 3GFPA 2ZRGA 1RRPA 2F43B 2MMCA 4ESVA 1NIJA 1S9HA 1FPMA 4LWZA 1W7AA 2KBFA 3NH6A 3EASA 1ZM9A 3K70C 1UBFA 4M1TA 4PFSA 1NVWQ 3CR8A 4EPYA 3LWNA 3WHLA 3KFXA 3MSXA 2C78A 3GCGA 3MFYA 2JLRA 2P67A 3U2QA 3Q72A 1E3MA 2QENA 1N6HA 3GPLA 3EZFA 1IN6A 1F6BA 1VKJA 1R8QA 2ZSEA 1WB9A 4MH0R 3THXB 1Z22A 2VL7A 1OHHA 3QVVA 4KFSA 4GPTA 2ZS8A 2PMKA 4IVQA 3TGPA 1E4VA 3IEVA 5KSYA 1R2QA 2GEUA 1OFIA 4A82A 2OAP1 4X8MA 4ZI3A 4W9MC 1R5BA 2W6JA 1YZKA 4DCUA 4P4UA 2AL7A 5CJ2A 4TLCA 5JJKA 2QGZA 1Z0DA 1G3UA 1N6OA 1Z6GA 2C77A 2JLVA 1IM2A 5KYKA 1KI1A 4ITRC 3EZ2A 5GJVC 1SXJB 3OIUA 1ZINA 2PZEA 2F9MA 1YR9A 3CPHA 3RRNA 3U60B 4LHZA 1RE0A 4GT1A 3QEOA 5DLQC 3KFVA 2CCKA 3A4MA 3OIWA 4OK3A 3NDPA 4DLUA 2XTZA 4IFBA 2AFIE 4L5BA 4L4UA 5CDFE 1E9BA 1ZM2A 4M9QA 4TYWA 5A5GA 3UWKA 2J0QA 3RS5A 1G21E 1NMXA 2CNWD 3LX5A 5EQTA 3RRZA 5B57C 1CR0A 3KJEA 2C04A 2FDCA 1Q1ZA 3NC0C 2IUTA 2WWWA 4ILEA 2V6JA 3TW8B 1X3SA 4TT3A 1E2MA 2GBLC 1W46A 2C95A 2HJVA 4L9WA 5K8TA 1PLJA 3VR1A 4D25A 2N42A 5J4VA 1JAIA 1N6PA 1Z6YA 1KNQA 4HDOB 1GRQA 4LC0A 4AURA 4I1SA 2R44A 2ZITA 3T61A 3PUVA 2GEVA 2QRNA 2GXAA 3L43A 4B2PA 1EX6A 4M53A 4RD1A 4LYAA 4LPSA 2OM2A 2A3RA 1DELA 1W48A 3I72A 2O8EB 3AF4A 3WBKA 3CRQA 1FMJA 4QNMA 1XTKA 2JEOA 2ERXA 3SBEA 3EPHA 2BM0A 2GDJA 1FUKA 3IUYA 1NJFA 5CIQA 4FMCB 3RS2A 2D3WA 3IIJA 2FZ4A 2ZPTX 3RC8A 4M0LA 3NXSA 4NKRA 5JJIA 4BWYA 1QF9A 3QXHA 2FWRA 2I3BA 2YVUA 4JIMA 2FPMA 5AK0A 3KKPA 1E9SA 1Q57A 2J7PA 2PMDA 4HYYA 5DHFA 3O8BA 3B9PA 2IYZA 4QHTA 3BE4A 1WBDA 3CIOA 1G19A 2CVFA 1S8FA 1X1SA 4ASUA 4YLGA 4URWR 1QRAA 4YXWD 1II8A 1LY1A 3FHOA 1U99A 1G41A 1M6NA 5AJXA 1JR3D 1YR8A 1FX0A 1JR3A 1II9A 1OJLA 1OYYA 2QP4A 4PX9A 4S35A 4DJTA 3L8ZA 2A5GA 4RZ3A 1NJGA 3GLFA 5BXQC 2NO1A 4AD8A 3RAPR 4KLZA 3BGWA 4FIDA 3AVXA 5FUWA 2XZPA 2XITA 2C9OA 3BH7A 3WYAA 1E32A
chains in the Genus database with same CATH superfamily
5K2OA 1W44A 3FRJA 2FWPA 1K06A 2X1MA 3PVCA 4OBWA 3SEFA 3ZV4A 1KBOA 3I04A 4AJJA 1NLMA 4MYDA 1TF5A 1Y4DE 4Z1MA 2DH5A 4JCOA 4UJ5A 4RA6A 3URKA 2C4TA 4INAA 2NP7A 3OX1A 2WWFA 1ISPA 4Q18A 3L49A 5K0FA 2JJ1A 4IGKA 2R5WA 2J6BA 3K70B 2FWJA 4EPWA 1U8XX 4FI3F 2HF7A 4I99A 2XYPA 4FGUA 1YE3A 2H5LA 4IIXA 1XTZA 2G67A 1MN6A 2C0PA 2YV1A 1U6IA 2NZ8A 3B51X 2CVHA 5KJFA 4LXXA 5ICSA 1Z4OA 3WIVA 1OZFA 2JCGA 4RD6A 4UHDA 1TK9A 4ZIRB 5ABPA 4KYVA 5IH7A 1G8PA 3PPVA 2CBZA 1C29B 3C0KA 5JEEA 3KQQA 1ECBA 1J33A 2PWBA 1EVIA 4OJKA 3C7AA 3LW8A 1M2VB 3FDXA 4B3SB 4L6IA 3B20A 3AUTA 2W11A 5H02A 1JEOA 1E3JA 2WJPA 3VOAA 2GARA 2HHAA 1X77A 3LWZA 3NHYA 1D1QA 3W6ZA 4MVJM 1SOMA 1YULA 4DDTA 2CN1A 1L6RA 3IQEA 3D8UA 2WPDA 4Z99A 4DKJA 1UOOA 3KYBA 1S4MA 2HQ1A 3PPWA 3TLGA 1TC1A 3ST7A 1YVUA 3EUEA 4D5EA 1TMGE 5SZKB 4CM4B 3OM1A 1FRNA 3G0DA 2W7TA 4YYZA 3EODA 4RM2A 4CG3A 3AFGA 1Q12A 4O2BF 2HYIC 3O3CA 4N65A 4HO1X 3EA0A 2K2WA 1AHNA 1K68A 1W5EA 1WF3A 3A3YA 3BILA 3D0RA 4KMSA 1D6SA 4PLCA 5DI3B 1WDLA 4ZWNA 4J4TA 1A9OA 4AG6A 1ZA1A 3WYDA 1Y48E 4JP2A 5F1YA 4XOUA 1OIVA 4WZBA 1OZGA 1W25A 2IYAA 2R1TB 2PPLA 3EIFA 1P6QA 4MQBA 3VSDA 4MR9A 4F2WA 4F96A 5CB4A 3DEYX 1Z13A 2GMWA 2VWQA 4FN4A 4CFSA 3D81A 4C2TA 1TAQA 1N2XA 2I2WA 2VEDA 2I3AA 4YRAA 2EEPA 1Q83A 3GD7A 1KFJB 1CRWG 3E27A 4XIJA 4F5EA 3VKGA 2HDOA 3RFFA 4DY6A 2D5CA 1FRQA 3RH0A 1M2HA 1GPNA 2QPLA 3JQ8B 2WT9A 3PFKA 3WZLA 1STOA 3DNFA 3SBXA 4EYOA 2O2ZA 1UBJS 1F3LA 4LV5B 3DA8A 4X6XA 1K4KA 1NVUQ 1DAFA 1S7CA 4IJWA 4NYIR 5JZSA 1H4SA 2BOVA 3PL5A 4FE4A 4Q1CA 4F5ZA 3WQRA 2AG1A 2PUFA 2QOEA 1KJJA 1EB8A 2WYHA 1RJ9A 3B52X 4TWZA 1Y8RA 3MT8A 3SNKA 4E94A 1PTJC 1T8WA 5B1YA 4AG3A 3WP0A 1Y6FA 2QZZA 2BZ0A 1KDVA 5A3QA 5K3FA 2WRZA 1LEHA 2OK8A 3QNWA 4HN4B 3ZHUA 2X2FA 1KSFX 2XECA 3E22A 4XCVA 5JAMA 1DBPA 2WT4A 1WAMA 2Y68A 1KH3A 5C7OO 2G76A 1E69A 4EHHA 2BPOA 5CG2A 4OV6B 2BGRA 1OILA 1WZUA 4PC6A 1SJ9A 3D59A 5A9SA 2VJOA 4BP9A 2Q5EA 1ENPA 2EJBA 2WJYA 3K3PA 1JHZA 1KQPA 2D8AA 2PBFA 3A9SA 3GAAA 4W5HA 5DLEA 4AZ3A 3UV3A 4PQYA 3PQFA 3X43A 3L8YA 1JA9A 4KR0A 1UBCA 4Y2QA 2WF8A 3ZDYB 3MMZA 4E1BA 2DPGA 1LLDA 4PSKA 3F90A 3VUEA 2DTXA 3ANSA 3MD0A 1O95C 4B3IA 1JFSA 4PPQA 3JVDA 3TX6A 1P4AA 4M1OA 4CIBA 4Y0NA 4X6YA 5E6UB 5CBPA 3EPLA 2P27A 1OX4B 2OGUA 1GZDA 1HA3A 4OHFA 3OG9A 3SS9X 2HWWA 2O0HA 1RI2A 2OSVA 1GZ4A 1K1EA 3INRA 1LW6E 1SG6A 1UPAA 2O50A 5EXPA 3DR5A 3M6XA 5AVQA 2GZ1A 2OMKA 2R00A 3K7EA 4K6OA 2GM4A 1T5LA 1X7ZA 1WUYA 3B6ZA 3C5WP 4QARA 5GZ3A 4Z9XA 5REQB 1NNEA 3PPXA 1FSGA 2FR8C 3MJ4A 1VL5A 1LDMA 4RQTA 2FUKA 1DTWB 4ZVRA 4KLAA 3GNSA 5TT1A 4URXR 1A5AB 1XNQB 1DGQA 2II6A 4KVGA 5BW4A 2DUNA 1JDTA 2Q41A 5GVSA 2OZLA 3MGGA 5C5IA 1KWKA 4IS2A 3V1NA 1FP2A 3AB3A 2E0IA 1YZGA 4XUEA 3FXAA 3INNA 3BD9A 4YBRA 5DNUA 2WZDA 4TLLB 1DIHA 1XEAA 3NHRA 1E1QD 2OHVA 3QLTA 3P26A 4KQIA 4P32A 4V0MA 1JQEA 4UUPA 3HXQA 2BFPA 3KB8A 1IEXA 1UR5A 4WK0B 4B09A 1N32B 1GA6A 1IWOA 1SA0B 3QEJA 4BLRA 3H9QA 1OWLA 2W0SA 3BGVA 5IABA 2EKZA 5ARDA 4E12A 1FTGA 1KHTA 2XMDA 1E77A 3F5SA 4OVKA 3EFOA 2JKVA 3GW8A 3W5VA 3ORRA 3V4FA 5BN4B 4UQLA 2D7DA 1U8TA 3N5CA 3RTDA 4LW8A 3GCZA 4LCBA 2ABWA 2XYQA 3EVEA 3PEFA 4FCWA 2I62A 4DIEA 3D7SA 4MRMB 4TQAA 3WISA 4GOLD 3THOA 3IP9A 3RYCA 4C14A 1W47A 1G8SA 1HPLA 2I7VA 2BKUA 1I4TD 3RYFA 4YAKA 5K0TA 1OGYA 2FEXA 5JLJA 2I71A 4D4HA 5BSHA 1DWOA 4GYYA 3QXCA 4IV0A 2X40A 2JFVA 3JQAA 4JUFA 5DGDA 3SIWA 1X8LA 2PYDA 2X0FA 3F8WA 2VP4A 5REQA 1YZFA 4EARA 3U1TA 1P7PA 3ICVA 2QG6A 4M1ZA 1XNRB 3A37A 1NF3A 2GZHA 2I6SA 2R85A 3RIYA 3NWEA 2QY9A 2VVTA 1ZEMA 3HS3A 3VR0A 3ZV6A 5T6BA 1PR2A 4HS9A 4IIBA 1VLHA 1RXUA 1U28A 1VLLA 3MGAA 4OXKA 1E5DA 1QVVA 3BTVA 3I6IA 1R74A 4KN8A 4OFWA 4UUMA 5U4QA 4C7KA 3HHEA 5KJ6A 2VSYA 3H8JA 3A36A 2PH7A 3SXPA 1TK2A 3JD2A 3P0IA 1P18A 1N1DA 2HAEA 3TL3A 1JFLA 2BZ1A 3L0BA 5T4BA 4BQNA 3OD5A 3LQQA 2NU9B 5IF9A 3FPEA 1UL1X 1I3NA 1XROA 3ECAA 4I5IA 2QTNA 2JIRA 1R6XA 2QTCA 4R1QA 5K0NA 1YDMA 2ZJ7A 2COKA 4QYIA 4F4FA 4L76A 4Q9AA 5G4LA 3ZK8A 5JNRA 3LC1O 1Q84A 5BQPA 2E49A 3EY4A 3IPLA 3HJBA 2E82A 2W2KA 3ACDA 2NV6A 3WYBA 2UUOA 3WXMA 4BNVA 3RWMB 1JJAA 1TQ6A 4PNHA 1VGVA 3L8GA 4MQ5A 3RQIA 1Y6RA 4DQ0A 3D6FA 3UBTA 1YBFA 3OLCX 1ZY2A 2ON6A 4C0LA 4GM0A 1QV6A 2CHFA 4JSYA 5G1OA 4C30A 1EIWA 4G0XA 4M6WB 5B1HA 5CITA 1VXOA 1UJ4A 2ZIUB 4R1NA 4NOLA 1D2CA 2H9YA 3PVZA 4H4DA 4J0HA 4ABYA 2Q0SA 4XGNA 5TRTA 4CR8A 4M7PA 2ZRBA 2Y0DA 3K2IA 5EE5B 4BLWA 2FUCA 5KQMA 5DM70 1J90A 2VH1A 4I1RA 2CJYA 4QPNA 4CCYB 1KJ8A 2EBHX 2P9ZA 4QU5A 5CM9C 3TI7A 2XDQB 4YJ2A 1RZRA 1XBTA 1E6EA 1T29A 2YFQA 3FMFA 4U7TB 4Y9UA 4L2IB 1Z82A 3B6IA 4UVDA 5LQJA 2H0AA 1YDGA 5JYEA 3AFMA 2H52A 3KSAC 1ZK3A 1PQUA 2HA2A 4AJPA 1XYYA 3QVLA 2SICE 2GTHA 2J9YB 4W1QA 4WY8A 1I1HA 2W2LD 3A7EA 4LEIA 4ZC8A 3QKRA 1PZEA 4HAUA 2QVZX 3JQGA 4HC4A 4JBWA 3LZCA 2VSNA 1DJPA 5I7FA 1A72A 4NEQA 4BP3A 1T5TA 1LDNA 1CZHA 2FPPA 3FMVA 1G8FA 3IB3A 1AB5A 1KH2A 3I2YX 2YN2A 5I9TA 4U9HS 4R3NA 1KY4A 1H1TA 1W8IA 2JNWA 4EP1A 4YRMA 4F92B 5CM2Z 3L1KA 1FEZA 5FTJA 3IUEA 5CVVA 3ESBA 3KJZA 4NOJA 4QWWA 1U2DC 2X22A 4RL6A 4TV8A 3DWIA 1KDOA 3PNYA 2D0DA 4EJSC 4FDLA 4J0IA 3KETA 2GNAA 2VF8A 4Y2GA 1NU6A 4BVHA 5T5QA 1COWD 3GJXC 2RGYA 2OCPA 4QGHA 5FEUA 1XTSA 3FWNA 1YIAA 3H1PA 2DJIA 1VRCA 3MQ2A 5HKKA 2XXAA 1TAHA 2RHBA 3IMFA 2PLAA 4WBNA 1W94A 3O03A 4MS1B 4TOIA 3M0EA 1AKMA 2B34A 1P2BA 2H2FA 1PZFA 2IGTA 1ZUNB 1YC5A 2ZVJA 3UK1A 3ZV5A 2I7DA 2VRCA 3OEYA 2V3WA 4HDQB 1JEQA 1HI9A 1CSEE 5A3SA 3S28A 2EJVA 3KXDA 3LLMA 1UT8A 3NHBA 2BAGA 4RSHA 4RJJA 4PTLA 3MT0A 5KJEA 3HP1A 3O21A 4R2HA 4TSKA 4RGYA 4YJKA 5T67A 3K1AB 3CF2A 3V8RA 1J09A 2CEAA 2D0OB 3FCCA 4GC5A 2J32A 1VXRA 4RPHA 1GOTA 1USWA 3EG9B 3BCSA 4BNLA 1KZ1A 3TB6A 1QFXA 5BNWA 3D4PA 1RBYA 2RHCA 2P5SA 2R00C 2X2EA 3GT0A 3HEBA 3MJTA 4MR8A 5T4HA 3V55A 4CG2A 5BYKA 1ZM3A 4KLNA 3O4IA 1CB0A 4U6NA 2PGOA 2CF6A 2DECA 4LVOA 5KMGA 3KQTA 5KIAA 1BXRA 1Z4LA 2DR0A 1OX6A 2EBWA 2GZ2A 4DA4A 2NUPA 2VO1A 2HMAA 2P3SA 1QLHA 1RWKA 1CVLA 1YL5A 2XOEA 3EGWA 3K9CA 4IJ5A 2GQ0A 2RGEA 2VH5R 4KQJA 4PXAA 4Q7EA 4YMIA 3FFXA 1XU4A 2ZVPX 2HRRA 3RARA 2XB8A 2Q1YA 3Q7RA 4HH3C 1Z6AA 2HUNA 3R1IA 2J3LA 4XGIA 4ZHSA 5CK4A 4KI0A 3PNKA 3QTTA 4DLRA 1KI6A 1G1MA 4JKIA 1BAPA 3NKVA 5GV7A 4MUEA 1P44A 1KA9H 3T94A 1KK1A 2A0FA 1B0PA 1CZRA 2HIAA 1L4KA 4JDPA 1NN1A 1YHNA 4TUYA 5DCLA 5A4AA 3DOFA 3QOXA 2JFNA 3LT5A 1ZXLA 1XFDA 2MTBA 3CX7A 2JJ2A 4ZCQA 2OHXA 2P0YA 4TS9A 1UFVA 3GFGA 3WB9A 1FL9A 1PJBA 2HEIA 4DDVA 1QPBA 2VN8A 1ZRMA 5IHPA 4DBLE 1A4RA 1TUIA 1DC6A 1LX7A 2AJLI 3N8HA 3CG4A 4FQ5A 1VG0B 1P1RA 1PTJA 4JAVC 4JODA 4Q5IA 4BB9A 2V98A 4ZYUA 5FF9A 1S2NA 4HVLA 3LAWA 1DKQA 1SBCA 2C4UA 1RI4A 2HRBA 3KXIA 3OO1A 2J6HA 2PMBA 2PKQP 4AIRA 4TYYA 1DOHA 1FYFA 3OBBA 3UMVA 1Z73A 3FUVA 3GLUA 3I39X 3FNEA 3WDMA 3LA6A 1J0DA 1CDOA 2CHVA 4I8DA 4JYBA 4PG5A 3FHCB 3PQDA 5SYMA 3D8RA 2BL4A 1O8BA 5KKCA 3MAAC 2AFHA 4GKAA 5I5EA 1NC1A 2V9PA 3BMQB 3MNFA 3OPYA 3TTVA 3WICA 5J5VA 2JVIA 1LKZA 4UDOA 4EEXA 2YNMC 3EWIA 1LPSA 1P4HA 1FQOA 4ZCPA 2VF7A 3C8MA 1L7AA 1S5PA 4O33A 1SC6A 3QYAA 3MK31 1W2HA 4N5IX 1HDZA 3ABQB 5DBIA 5FOQA 1ZMOA 2EX1A 4TL8A 1WDMA 3Q1KA 4ZI7B 1JPVA 2AQIA 2V5AA 4WACA 4EX7A 1GTVA 3FHLA 3G8YA 4YJ2F 4N9WA 4KV9A 4ZYYA 4GWGA 1I1NA 5ESXA 2QD2A 4F06A 1UDRA 2FMUA 3LZ6A 2YQ5A 4B8ZA 4PONA 4RK6A 1E7SA 1JR3E 3FTDA 1OWOA 1P1KA 4P3PA 5FPPA 1M8PA 3T1TA 5K20A 1NYRA 3DAGA 2J8ZA 5EXXA 1LK0A 2JBWA 4TKVB 4LX0A 4XSHA 4URZR 3H99A 4KJXA 1VJ5A 2OD2A 1IBCA 3QLEA 5LMUB 1S96A 5IT9A 3ZQ6A 5DXFA 3FH0A 5GOZA 1V4VA 3LPLA 1Z5WA 3GUUA 2BFDB 3PD7A 3SU8A 3U48A 4C7VA 3E15A 4YNBA 4CT0A 4RHXA 4QC2A 4QM6A 4Q4AA 3BN3A 4BFWA 5IRCD 4JK3A 2B7BA 4JX9A 2P62A 2GKGA 3ZWVA 1HNWB 1VPTA 3LXMA 5B1IA 5LP6F 2WAMA 2WC1A 4Y2JA 5C8ZA 4AF8A 2CLKB 3CRW1 2PSJA 5ALTA 4DCOA 1OBHA 4TT3D 1RC8A 1XFAA 5FBRB 1Z8FA 1EFRD 1MQSA 3E7WA 3I45A 1V7QA 3MUNA 4L5CA 1ACMA 1YQTA 3NRJA 4JT4A 3RK1A 4R2WA 2IH5A 3EZ7A 1OU0A 4YXWA 4ASUD 2Z6AA 2ONZA 3OU7A 1UMDB 1PJ8A 3N6XA 4D9JA 4XCXA 3L0IB 1RR6A 3DBLA 1R8YA 1DTSA 1TZCA 2AJDA 2WB4A 4N3BA 5T57A 4EHFA 5KB3A 3DKKA 1NUSA 4YROA 3OFSA 4II7A 3F2IA 4J6FA 3KKMA 4OH1A 3DYIA 5H7XA 5KOJA 2HM7A 3E22B 1A5ZA 1QGED 3KD3A 1TF7A 1J1IA 2JH8A 2C00A 3OA2A 1Y37A 3G9UA 3PDIA 2WWRA 3LFHA 2BMDA 4O4HF 2F3SA 5J40A 1CQXA 4W7SA 5CA0F 1KGSA 1GKYA 1JFFA 3KTAA 4CV3A 4D8YA 1YNOA 4WJKB 1E5VA 3HRIA 4JJKA 1OFUA 2OV2A 3AT1A 3SBOA 2NUTB 2W6IA 3FUXA 4IMJB 3KHSA 2KLHA 5I7SA 1V7ZA 4HNSA 4X7RA 4P3NA 1GFWA 1DKUA 2BGLA 2BEUB 1E1QA 3PF8A 1KMHB 4P1ZA 1W36D 3BWDD 5JY1A 4DXAA 5I6DA 1L5QA 4Q82A 1TMKA 2VP6A 5KX5F 3QFTA 2AG6A 3NNDA 3S4YA 3DONA 4CTJA 2GYUA 2MDTA 5CDFA 1Z0SA 4HDKB 4GUAA 2ZTHA 5CD1A 3DL0A 3LL4A 4C7XA 2DHDA 4F6CA 3AHHA 1NXXA 3OUZA 4OXQA 1JSZA 4YHHB 4JSRA 1BW9A 5AVKA 2H4WA 4CM8B 2WYWA 3KE8A 2PA3A 4OEHA 3U4CA 3VNAA 3ZDDA 2IUSA 2FQ1A 2ZAGA 5AH0A 5FL7D 4QBIA 2NADA 1IHOA 1U1CA 4FFRA 3S44A 3L5KA 2VF4X 5B58C 1FYEA 2Z8YM 1HR0B 3H9BA 2QLFA 3I37X 5HM8A 4KR6A 1V6CA 5TVKA 1DBSA 3GRFA 3DE6X 4AJ1A 2E4WA 4RZXA 4NMLA 1DBIA 5LP6B 3AX6A 3P9KA 1XDWA 4HTFA 1GKUB 3BAFA 4J0FA 4RHFA 5ESRA 5C8XA 4NPCA 1HZZA 2DU8A 4F1KA 1TM2A 2JRLA 1QH0A 4L95C 5EKSA 4DREA 5C8VA 5IT5A 4RKYA 1IBLB 1AQLA 4MP6A 1W59A 4BVKA 2R7NA 4RS4A 1S9DA 5JDCA 4G0UA 1VCMA 5KX5B 3C3KA 1AH2A 2VT3A 2HCBA 4TS3A 3BMCA 3E2MA 5HS6A 3R75A 3OZ7A 3WWDA 2NAFA 3GG2A 3PNPA 3T15A 3DMTA 1BX3A 1GG2A 1N5OX 1R0LA 3PV0A 1QHIA 2M6SA 4I46A 1E92A 1K6EA 3IAFA 3IT3A 3PP8A 4UHHA 2GZSA 4CM6A 1QG4A 1NPTO 3OTOB 4TZ0A 2ZUDA 3RYFB 1A4XA 1W2GA 1ZN9A 5KC8A 1X7XA 3U4DA 2XNCA 3CLTC 2C8VA 2OK7A 1VLJA 4J4HA 1KEZA 2DX7A 1QE5A 1OCEA 3UG6A 3MOSA 2DQKA 2O2JA 2V7PA 2G4VA 3VX3A 4ZDKA 3QUTA 4P3YA 3ZCPA 5KAPA 2C2YA 5D3MB 2YY5A 4IP0A 1ZG3A 4DNFA 2CNWA 2OQ2A 4NESA 4WUTA 3REOA 3DHYA 4F8JA 3LGAA 1N2CA 4QHSA 1F2UA 2UYGA 3MVEA 1GZVA 1O4WA 1CZNA 3G5UA 4EG8A 3SF8B 4C3VA 1V7PC 2Q4BA 4XVCA 1FIUA 1ZVQA 1VKNA 3BL5A 1D7OA 4ISCA 4QG3A 5AW6A 2Z57A 4MRPA 4WKCA 4ZAGA 3ZWXA 5BSGA 1SIUA 1MB2A 4IS3A 1PJTA 5FD8A 1AXRA 3O90A 3T6KA 4OTZA 4G2TA 2OFFA 1ZN8A 4WKPA 2H2AA 4M4SA 3SIRA 4ER6A 5A5EA 4DDHA 2F48A 2FMKA 5ALZA 3E9EA 1D1SA 5LQAA 2CDAA 3AEQB 1QK4A 2V8OA 2VHYA 1QIIA 4IDQA 1NUUA 5AVVA 5L3SB 4NU0A 4ZRMA 2X3YA 2WAYA 3AOEA 1IDN1 2QDXA 2W6JD 3QYFA 4X94A 5TMBA 3PC7A 5EIEA 1JQAA 3F78A 1ODTC 3IV6A 5ES4B 1CE8B 4NE9A 4JFAA 4UBLA 4HGQA 1UIMA 1BX0A 3RFXA 1MVOA 2I54A 3G5AA 3H4IA 4WK6A 4BRWA 2B0CA 2H2DA 1Y8QA 2D00A 1I1QB 4LJ5A 1U3FA 4FW9A 1DEKA 1PD1A 1T3LA 2XGMA 2XYGA 3FLAA 4MUIA 3IC5A 1BJRE 3ADKA 3P32A 4TRJA 5H0IA 5JALA 2AQ8A 4XVUA 1C30A 1N2SA 1UK9A 4I50F 5E7MA 4Y2TA 4HUJA 1H8EA 3SE7A 1D6MA 4ZYVA 1GRRA 1VJDA 2ZGVA 2Z4TA 3NJRA 1UJ5A 1CIPA 1LNSA 1YTUA 2O48X 2X0RA 3ETCA 2D62A 1BJKA 1RCFA 1YK1A 4RMHA 4KDFA 3U9SA 1Y7IA 3LSYA 1K9SA 2IHNA 2JAXA 2NTVA 1OF1A 1EZZA 2V7QA 2GKSA 2V7WA 4FCTA 5JRJA 2UZ4A 3OF3A 1VMIA 4JUBA 4QQKA 2FZVA 4FEAA 3SHWA 1PP4A 4UTPA 2BSXA 3TXXA 1ONPA 1Y4UA 2BBSA 5DNDA 1TRHA 3ZBQA 1N1EA 4WV3A 1UPUA 1RQGA 3HVRA 4BRUA 3MJEA 2ORYA 4FOOA 1SUSA 3EF1A 3N2ZB 1PCXA 4QT0A 5EL0A 4LVNA 4AUNA 3PX7A 3MRTA 1U0NA 2CK3A 3BWCA 4FDTA 1B26A 4V39A 4YONB 4DA8A 2P0AA 1ZI9A 3BXXA 3GJ3A 1FBTA 2IZZA 3BXPA 4B35A 3R44A 1MO3A 1P8AA 5EJEA 4OLBA 1X74A 5T8KC 3V8EA 3T5CA 1HDEA 1RAHA 2WBLC 2WLSA 3IPYA 3FPLA 4AKSA 1HYGA 3ZE2B 4RKEA 4MWDA 1RTTA 2JBAA 4JJ7A 2SKCA 2QTMA 5EE3A 3RNOA 3IKJA 3P9PA 3P9RA 4LDJA 1XXHB 4V3BA 5FI1B 3TPFA 4RTMA 3HO8A 1K8RA 3LPCA 5ELLA 1TC2A 1ZMTA 2Z4SA 4PPGA 5FA6A 1P2VA 1L4FA 1IG3A 1Z0UA 1M0WA 1DLIA 1MC8A 2AUNA 1RI3A 1HF3A 1U94A 4BC1A 1IWPB 3UKDA 5HKKD 3TGLA 2I6FA 1C4WA 4BDSA 1R9GA 4CMEA 1G98A 1G59A 3Q40A 4GDMA 1C3OA 3C3YA 4JDUA 3NYWA 3K73O 3P94A 2YXBA 3BGSA 3QPAA 4FEGA 2JIOA 3A58B 2CKDA 4YJ3B 4KFTA 4DDUA 2IS4A 1WDKA 3CH4B 4M9XA 4CRWB 4AS2A 3DP9A 3OIFA 2GBPA 4O08A 4D45A 4BKUA 2CXTA 2BGUA 1RMYA 3NKFA 3SR4A 3C3JA 3U4GA 5AUNB 2RDMA 5DCYA 3ESAA 4EA6A 3DR3A 3QE0A 2BM8A 3DLIA 2B5VA 4ZU1X 1P91A 2Q0HA 4PYMA 4QUHA 4HYEA 3TL2A 4G5XA 2GAAA 1BIFA 5TQ0B 1G3QA 3FDZB 4RPLA 2PXAA 2FXIA 1ZI6A 3DDUA 3R7BA 3ZC3A 1MEOA 1BO6A 3KQUA 5I4CA 5IDYA 1A9PA 3FYSA 3HY4A 4LDZA 2GFQA 2GHQA 3QU4A 1MORA 2O0LA 3Q5EA 2DE0X 2F90A 3EIQA 2OVFA 1ZD9A 2WV9A 2YVQA 5BW5A 3A6PC 4QX6A 4ENWA 1J21A 1R9JA 4XX0B 1QH8B 5BOSB 2VF2A 1V6SA 1L2TA 3SYRA 3LX8A 2W5UA 1XF9A 2CCJA 3A0UA 1U1IA 1ZHFA 4GPIB 4EW3A 2HX1A 5KREA 4RDCA 2HGZA 1W4LA 2WNHA 3KZOA 3ZGNA 4X66B 1QIDA 4NCHA 4YFVA 1U0EA 4F2HA 3T7IA 3TSYA 5I7AA 4RTSA 1SC9A 2DQZA 5B6JA 1PL7A 2IP4A 2O07A 3NVKI 1AN0A 1D09A 4KQHA 2ODQA 3GLGA 4WK2B 5FBKA 4UE3S 4CTKA 3WMEA 1ZUHA 2QRJA 1I2DA 2XAUA 2J6CA 4EO4A 3GMSA 3ICQB 3FPJA 1JSXA 1R8SA 2V6BA 1G4UR 1UOEA 2B8NA 4FWTA 3I5AA 1CNFA 3MTQA 4DQDA 4L15A 3E61A 1PX0A 1T25A 2JDIA 4HDAA 5J1TB 1MH9A 2QAJA 4HATA 5LKAA 2J3EA 1EUYA 1SKMA 1D9XA 5DNVA 1QIHA 3IIMA 3ZTTA 5LMNB 1U3UA 4DPLA 3OD1A 4B73A 1JI0A 1KSHA 2E6KA 1YA8A 2R7MA 2YZNA 5KYUA 4OQYA 5C7YA 1JR6A 3CBGA 4OO3A 3ETDA 2Z6VA 4DIUA 3RAJA 1LTKA 4FCCA 3QVTA 4M9UA 2Z98A 1CQIB 5IYZF 4HSEA 2HQSA 3HJRA 3GQBB 3ZW7A 3FOCA 4Y3UA 5HTKA 3T9BA 4F4CA 2DUWA 2YWEA 3R6LA 2B20A 2CXXA 4PAOA 2VPTA 2Q3HA 1V8BA 4X61A 5EKDA 2GD1O 2C4VA 4JC8A 3TTSA 2WZBA 2D59A 1TKAA 2YCLA 1ZP6A 1HXHA 1P1HA 1XCLA 5F2NA 1Y9EA 3BUSA 3F5FA 2PCJA 2VRNA 5ADVA 1MDFA 1NVVR 4D4JA 2E89A 4AY5A 4WTOA 5KYNA 1H2AS 1T2NA 2AE1A 3KKZA 2PX5A 3O8DA 1WSWA 1EEXB 1CW2B 1EXNA 3WQSB 4NENB 2LIPA 1P5FA 2GCNA 4BAZA 1UAYA 3Q7EA 2C4NA 4QDOA 5JDIA 3BSWA 1QV9A 1AUPA 2H5JA 3HV0A 2G4CA 3KOMA 3KZMA 3WLRA 2A57A 4RBNA 1VLZA 4G8CA 3L3BA 4S05A 1V16A 1XZKA 1FTWA 2QLBA 5CCEA 1IVYA 3FOZA 1EM8A 5JRDS 3EGXB 2V6IA 1H4TA 3SS7X 2CLSA 3G8AA 2V55B 4G5SA 2IS1A 1V5WA 3I05A 4WQMA 4R54A 3QE4A 4CR6A 1ADYA 4RF5A 5TLSA 2FPRA 2AVDA 2Z8ZA 2DPYA 3BWVA 1Q0RA 3DC7A 2VJMA 4KAXA 3RT1A 1DTEA 3VAYA 5C46F 1ZSNA 4CTMA 4UM9B 1DUIA 2YZKA 1MT3A 3GA7A 3L7MA 4MGYR 5EP3A 2O05A 4A4DA 5KSOA 2RHJA 3QW4B 5EWMB 1NBWB 5H5JA 1VKZA 1OXSC 3U61B 3STUA 4BNWA 1XJQA 4OF4A 4EI7A 3GP5A 2BEJA 3LDGA 1P74A 3IAAA 4IVPA 2KHZA 5LZ2A 3GLIE 1QH1B 3GAFA 4EY3A 3TNYA 1DJOA 1YCFA 1V95A 1PJAA 1QV7A 2ANCA 4XCQA 3ZWOA 2E5FA 5ALEA 1P9NA 3HWWA 5HQ3A 2PJRA 4YRPA 4IMIB 2ENWA 4P98A 5ECGC 5CK5A 5I01A 4F38A 1P0CA 4F3NA 3MD9A 3QPVA 1DIAA 3FWHA 2X0JA 3BXGA 3OJWA 1YZNA 2Q62A 3PDUA 4ZARA 3S2EA 4HF7A 1JH9A 3WHKA 2I2BA 4OKSA 3EXAA 3MG9A 3AVVA 2N9UA 3U3ZA 4J0CA 4BNXA 1M75A 2YHUA 1U4NA 1K0FA 3TSZA 4L7VA 4KGVA 4NG5A 3A2KA 3LP6A 3TAHA 3KOOA 4REQA 3K6KA 3BZWA 1A7KA 3W5IA 5AIBA 3SI7A 2ZXUA 4P0TA 1TW2A 3SJCA 1XXHE 4FBGA 1S2DA 4TTSA 3C1TA 3H84A 1NRXA 4F4DA 3AYXB 2QI9F 4DWOA 4QQRA 3ETGA 1XR3A 1FFCA 3OLQA 3EEFA 2NSHA 2FEKA 4HB3A 3ABSB 5H83A 1J5XA 2GFHA 2GPSA 1EE1A 5ESWA 3O92A 1ZXBA 3CKLA 1JYFA 5HKOA 3WJAA 3UXYA 1JILA 2JZCA 4BEVA 5BY2A 4MV6A 4PVDA 4GOKA 2BW0A 3ZGXA 3VNBA 3TLXA 1XP8A 2RHHA 2YIVX 4C07A 2L0XA 3EIOA 3V48A 1CJBA 2GNOA 3KUUA 3M49A 4M0CA 1VKHA 2J9ZB 1OI4A 2XUJA 1TQ8A 4MK4A 4MVCA 3W3AD 2Y71A 4M0MA 4EHBA 1FFXA 2OQIA 3VR6H 2BFBB 5I8WA 1Z45A 2ZDGA 1JEJA 1CP2A 1ORIA 2P68A 3AV0B 1DV2A 3M3HA 4XJXA 2OCBA 1XCMA 3E84A 4EB6B 4NIMA 4JT2A 3OZVA 3OICA 4MV9A 4ZQHA 4BX0A 4RTPA 3U44B 3M1YA 5ELMA 2JI8A 2EQAA 3CWCA 5JFTA 3DKVA 1J22A 4DLAA 2O7QA 3IURA 3V3KA 4V1CB 5K4GA 3WGTA 4JEIA 1V9SA 2RI0A 3KJHA 2CXHA 3NTQA 3JAKB 4HADA 2IGBA 5ALQA 5TNXA 3ZTYA 4LZLA 2WUFA 3DBRB 3LY5A 4A8HA 4F3RA 4BO4A 1AQ6A 1H8HD 1LF5A 4FKBA 4WA8A 5MFZA 2XYHA 3HQ4O 5KNCH 4MV0A 5KTNA 3I04M 4NYJR 4MZXA 4DTIA 1QG2A 3KWFA 2OD9A 3CZAA 3OFNA 1MHPA 1NJ6A 3HLYA 4KR3A 1OAAA 1SXJE 4NZOA 1U8AA 4NFSA 3E81A 3QEKA 1XZPA 2QAGA 3GB9A 3QZUA 4A8JB 2HF2A 5ITVA 1XDZA 3AIOA 3MRSA 5JAZA 4BC0A 1N5JA 1XALA 5KOYA 1OY1A 3WL8A 2H1FA 2HJHA 4X6UA 3K5IA 3SLKA 3KJGA 2Q7DA 3U4HA 2Q6IA 4WXPA 1FMCA 1R5NA 1GLVA 3H2GA 4LJAA 5FQOA 5TB5A 2PYIA 5CBKA 1JLLA 1O08A 4W6ZA 3M5CA 1JLKA 3TJZA 1LRKA 3NETA 3DMDA 4NCAA 1OZAA 4AFNA 1VA4A 6ABPA 2VK2A 2VDRB 2RHMA 1T9GS 3QX9A 2FDXA 4MVJI 3A1CA 4MKZA 4KITB 3CVXA 1SBTA 4LOKA 3OFJA 2NT4A 1XAIA 1IN5A 3B38A 4KXNA 1J4AA 2R7LA 5K8IA 1QMPA 3BRSA 1IPFA 2ZBQA 2D5AA 1OROA 4U7GA 1Z4NA 1L7RA 3KT3A 1FDTA 4EL0A 4UD2A 4DHEA 2AI2A 4OFBA 4AJLA 5IK2A 4V1CA 1IY9A 4LIPD 2QNRA 2IX3A 3C41J 4N41A 3W5HA 3GUVA 1G9SA 4BO5A 3UC9A 2V6FA 1ZYUA 4HGPA 2ORIA 2FU5C 4A2PA 1BTOA 5HF9A 4MNTA 3KTOA 4C5CA 2CXNA 4I5EA 1N9GA 4PNZA 4D9CA 1JI3A 2V3VA 1XZJA 3COZA 1CF9A 1B6SA 4O25A 4ZT3A 2PJDA 5BV7A 4PLVA 1CX9B 2HY7A 4FMCF 1JN0A 5G2OA 3Q98A 2ZSHA 4DR1B 5CTJA 2A2ZA 4DM7A 3H0EA 4BX2A 3I6BA 1YZYA 2IELA 4KRXA 1EUCB 5FFNA 2EZ9A 4KWIA 4RA9B 2GM5A 3VOTA 2LNDA 3MCTA 1Q91A 2W2OA 1JW9B 3WBFA 1NUTA 3V5NA 3A1NA 3KJQA 3NVDA 4X54A 3EZXA 3F1KA 3VSAA 1WRBA 3H2ZA 1SXPA 3O38A 3RU7A 3G7NA 1TU3A 4NCIA 4EMTA 2JFZA 1VE1A 4HY3A 1WKBA 4Q02A 4TVSA 2VHCA 3T8YA 1K5GA 4Q93A 4CQMB 3HP4A 2GBLA 3JRXA 4UM7A 2OESA 1IWBB 2Z0MA 2WIDA 3QKWA 3SR0A 5JJ5A 1XJ5A 2RK3A 2HK7A 3O82A 4P36A 4RTLA 2IHVA 1JU9A 1GA4A 1A69A 4GYJA 4JWTA 4WH0A 1MAHA 4EUHA 3K32A 2NUTA 5AKEA 4LF4B 1SA0A 2SNIE 4E2ZA 4OXNA 3VU8A 5U4XA 1ID8A 3RS0A 3MELA 4R3UC 4N3AA 1DG9A 2CHQA 3Q15C 4IOLA 4B45A 2AXNA 2JGIA 4U0JA 1ZESA 2PDAA 2X5XA 3VNUA 3TOZA 4DLVA 4PZ0A 5EVJA 4N7JA 4BX9A 5CLHA 1JA0A 3TSOA 3N2IA 4NBWA 3BM5A 4WKOA 5B53A 2QNIA 1Q1AA 1ONNA 4ZO4A 2BHRA 3W3AH 4CLXA 4RZIA 1O58A 4JYPA 4LFCB 1AQIA 3VH1A 4DCJA 4DLYA 4ZEMA 3T3GA 2AN1A 2D3TA 4DOMA 4JC0A 4L9RA 1N8NA 3X1XA 2I33A 4DMUB 2L82A 2OL4A 2RB5A 4UTNA 4RHCA 1XI2A 1XHFA 1I0LA 5BN3A 2ZIWB 5TARA 2JKYA 3CX8A 4J49A 4ENSA 1N6KA 4WXRA 4ZAVA 1G2IA 5FJIA 4LYFA 4A8PA 1JDBB 1SG0A 4P92A 5HF6A 2FWAA 4EA9A 4JI2B 1QJCA 4H1TA 1YI0A 2Y0EA 4H6XA 2OQVA 1OA1A 1T2VA 4D74A 4L8VA 2CFOA 4OYRA 1KY2A 3OQHA 2IYFA 1QZTA 4QTYA 4H7KA 1XVVA 4O63O 4IH1A 2V9CA 3L6CA 4L02A 3WGGA 3D8NA 3DZBA 5HGJA 3AF0A 1RFLA 2NQ8A 3BSSA 3LXRA 4PCVA 1LSJA 1OUMA 3P2IA 5E0OA 3HXMA 2A3NA 5BNIA 3SP1A 2NNLD 5F3DA 2OA0A 3M4XA 3IUSA 4MAFA 3SXUB 3C6KA 4MLPA 3UHOA 1JFTA 2RGCA 4MA5A 3ITDA 3KJFA 4RJKA 3IQZA 8LDHA 3EXEA 3Q3CA 2PMWB 4ZTZB 4K9MA 3QHQA 3AUJB 1G3IA 4R5HA 5IULC 2QTBA 4KQEA 5BOVA 3JY6A 1U8UA 5L3QA 3H11A 4UEWA 3STVA 2J09A 1T1RA 1H5UA 4U6QA 4ZVTA 3NOVA 4B6EA 4BMOB 4C3ZA 4ZDIA 2GB4A 2VHVA 3CEHA 4I7EA 1RWOA 5C1DA 5JH7A 1W36B 1JDNA 2QVBA 1TT5A