2ZRDA

Msreca q196n adp form iv
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
330
structure length
322
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLREPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 91
structure length 322
sequence length 330
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrdA01
3AF3A 3ADCA 2AWNA 1UBFA 4BZXA 1HH4A 5K8TA 1UFQA 4RFSA 4TYNA 5IRCD 2WJJA 2WPDD 4I81A 3NH9A 1MO3A 2FV8A 2F43B 2O0KA 4PZLA 2YYZA 5KNBA 1NLYA 4RD6A 3U7EB 4MYUA 2BDTA 2J5XA 2DWOA 3BFXA 3NBYC 1W5TA 1CR2A 2H18A 4AYWA 3THXA 3S1AB 3GLHE 3K0CC 1XMJA 1Z0FA 4LUCA 5DO9A 3I72A 4PSKA 2PX0A 4LHVA 4QL3A 4MH0R 2AXNA 3B85A 5JRJA 1W44A 4HEJA 1NRJB 3SR0A 1XEXB 1P6XA 4HAWA 1ETUA 3O8BA 4PPQA 1KO5A 2KI5A 5TXGA 3GLIA 3FYHA 4AY2A 1BYUA 2GA8A 3U44A 1E1RD 1UKZA 1F5NA 4TT3D 3N2EA 5CLLA 1W48A 2CBZA 3CRW1 5KHOC 3MFYA 1EFUA 1T3LA 2HUPA 4RCYA 3HU1A 1Z8FA 2ZSFA 1IY2A 4M2LA 2ZI7A 3O8RA 1J7KA 1YR8A 2WJYA 4B6EA 3GJ8A 4DDTA 3EASA 3CNNA 1DTSA 3GLHB 4LV6A 1NY6A 5GVRA 3UATA 4PC6A 2CLCX 5C4GB 4LX0A 4RKFA 4OHYA 1FMJA 2F9MA 2RKOA 3W8RA 2PJZA 2QU8A 2FOLA 4RFVA 1M7HA 3AP2A 4QHTA 3P32A 2Z43A 2CMKA 1NLZA 2QSYA 4JJKA 4AG5A 2ZRPA 3K0AB 5DH9A 1HYQA 1CXZA 1ZUNB 2C2HA 4D26A 1AS2A 4B48A 1ZCAA 3ZH9B 4GFDA 2WAYA 1GM5A 1M1YE 4XWAA 3KFVA 2V7QA 3CBQA 4BWYA 3MWJA 4URZR 1EWRA 5J4KA 2XOKD 3K8YA 5HKKA 4JBXA 4ZI2A 1NL3A 4IVPA 1XX6A 5DIFA 5JLJA 2EYQA 1OIWA 1VYUA 1OW3B 5FL3A 3W6PA 2C99A 1HE8B 1ZU4A 2IXGA 3CWQA 3EA0A 1NVVR 4C0LA 3KJHA 5FL7D 1P9NA 3T1QA 2OBNA 2CDNA 1SKQA 3NBFA 1I4LD 1S3SA 4OI1A 3K1JA 3KZ1E 2KWIA 5FTNA 3CRMA 2A5JA 3BJIC 1B23P 1OB5A 2N42A 1ZCBA 2OLJA 2ANCA 4JLVA 3WBJA 1W0KD 1E69A 4IHQA 5J47A 2D2EA 4P32A 1JECA 1E96A 2ATVA 3E1SA 2F1IA 1KKMA 2Q3HA 4N0EA 3SQWA 2V4ZA 4IOLA 4A92A 3TR5A 2ONKA 2C9OA 4KBGA 2WTUA 2QMHA 2XZOA 2I4IA 3KQNA 3CWZA 1Z0IA 1RYFA 4G01B 2IX3A 2ZRCA 2R44A 4TLDA 3KX2A 3QBVA 4XD7D 4Q4JA 1KI6A 3MRSA 2WJHA 3QI2A 3E70C 2JLRA 2WJVA 3I62A 2VLIA 2IBMA 3IPXA 4QNRA 3IKJA 3QG5A 2K5UA 1IONA 4EPWA 3V4RA 4JKIA 3B7GA 2CL7X 3F5FA 1AIPA 2R8RA 4F4JA 5H68A 1CS4C 2ORWA 4LV8B 1ZM2A 3F8TA 3DOFA 3IPYA 2QM8A 2W2XA 3I73A 3CR7A 3LWNA 5CJPA 2EW1A 4HLUC 2ZRBA 1MABB 1PZNA 2DHRA 2WM9B 4ON9A 2CNWD 5A0FA 4W9MC 1T0JB 1P73A 1NG9A 3V00A 2EWWA 1R4AA 5C18A 1QHIA 4B32A 3QF7A 4JVMA 1T0HB 1JXMA 1S2MA 3RRYA 1XTIA 4E03A 3GLFA 2G6BA 3DMNA 5GJWC 4D6PA 4PC1A 1E1QA 2IEYA 2A9KA 1G7TA 2CEAA 2JLUA 1DO0A 4JSTA 2R65A 4LOAA 2V6IA 1XJ0A 3ASZA 1E1RA 4KBFA 1E94E 2QUZA 3L0OA 3QKRB 4KVGA 2JLYA 1E6CA 4BZQA 2HCJB 4TQAA 4A0RA 2GETA 1D2NA 4F4CA 3B8HA 2BBTA 3JVVA 3K0FB 3FHTA 1CTQA 2R6FA 1V5WA 5AR1A 1S0UA 1ZD1A 4MKFA 3VX4A 3UWOA 4OQNA 5C46F 3EC2A 1MR3F 2IS6A 3T1TA 1DO2A 1L2TA 5FTKA 4DSOA 4DT1A 2ZSEA 4YDSA 2IWHA 5FOUA 3KUCA 4DLZA 3SJZA 4FIDA 1X3SA 1U94A 3AP3A 5FH9A 4G0NA 3FMPB 1ZVQA 3AP1A 2ZROA 3U4QA 4W7SA 4WVFA 1GTVA 2GZHA 4DLWA 4DDWA 5F9HA 2W00A 2Z83A 3W6NA 4CEHA 4MGZR 1SXJB 1M74A 4BZPA 2XOKA 1G3IA 3QPUA 1CJMA 4J0QA 5L8VA 1TU3A 3NHAA 2ZRHA 2BWJA 4I1OA 2IEZA 3SE0A 4C4PA 1NSFA 1VHTA 2QI9C 1KK3A 3D3QA 3NHBA 4UJ3A 3IGFA 1YZLA 3K0EA 1BOFA 2BBWA 5CDFE 3T5GA 2QN6A 4NKRA 3WHLA 1CF4A 3NBZC 2ZRAA 3QPVA 421PA 1OLOA 4ARZB 5IHPA 1KSFX 1T91A 2VF7A 2ZU0C 3AH8A 2OXRA 4PHHA 2FF7A 3LX5A 2F55A 5AJZA 3L0PA 2IYXA 1JPJA 5JCPA 5JI2E 1Z47A 1EFRD 2JLZA 1TF7A 2W6ID 5IT5A 1GL7A 3C16C 4OQFA 2ZTSA 4R2IA 1T3SA 4XH9B 2ERXA 1E32A 5EE5B 4YMTA 3A1UA 4PO1A 1P2SA 3DO6A 3VU9A 4QGAA 4L15A 2AK3A 3CPJB 5DYGA 3UMSA 4P33A 3X1WA 3AVOA 4Q7JB 3RSLA 1KMHA 2WAXA 2OT3B 2RGNA 3MWLA 3DDCA 4UNPA 5TB5A 1VG1A 1XTJA 1F60A 3KUDA 2OZEA 2CCKA 3TH5A 3WNBA 3GJ3A 2WSSD 3WY9A 5KU1A 3KQHA 3N2IA 4PFSA 2F6RA 4ZCIA 3TSZA 5JSZA 1RZ3A 2DY1A 1Q22A 1RJ9A 3K0SA 1OH7A 1PLJA 2CNWA 1GRQA 4PX9A 4HZUA 1UADA 1KIMA 2BEKA 2C96A 2VP6A 2ZS7A 521PA 4B73A 1S3GA 1M7GA 3A6PC 1DBSA 4ACBA 4A15A 2C03A 4FWIB 3R7WA 5EP3A 2FA9A 1WDTA 4Q4LA 3VR6A 1Z0AA 2WIAA 5FBQB 2PLFA 5B57C 5KTYA 4CEIA 3O8DA 2QAGB 4OHVA 3WRXC 4MGIR 2JATA 4KVAA 5FUYA 2XZLA 2MSCB 4JMPA 3U5ZB 3LBHA 4DLTA 2GCOA 2MMCA 1J90A 4A6PA 2D7CA 3AQ4A 4EKDA 1JALA 1T8TA 3FKSD 3TQFA 4DRZA 1E2QA 2Z6VA 4MKGA 2V1UA 4RZ2A 1SXJD 4TLBA 5F2EA 621PA 1B0UA 1JR3E 4Q1CA 4GOJA 1GL6A 4BPBA 4PTLA 1Q1ZA 4EPRA 4B34A 4PSAA 3EWAA 3KL4A 2FX3A 4LHYA 4DHEA 3AVXA 1YRBA 2ZSAA 4DLVA 1N0VC 1XPUA 4R71A 5HCIA 2O8BA 2W83A 1Z6XA 4AG6A 1XF9A 4TSFD 1Z08A 3CF6R 4B44A 4FMCB 1FUUA 2JAQA 4DC9A 1RVDA 2J46A 1N2CE 5FUVA 3HPRA 2ZM5A 2JGNA 1OKKD 1R0XA 4JLAA 1FTNA 5DISB 2ZJZA 1KO1A 1Q57A 2KBFA 3D7MA 3EIEA 1RE0A 821PA 3KKMA 2I1VB 2R6CA 5E7IA 4DCVA 1Z2AA 3THYA 2G0NA 2X2FA 5AUPB 2W2VA 2VTKA 1BKDR 3RC8A 1KJYA 3ECCA 1KOFA 1EG7A 1G64A 1R8SA 2GEUA 2IK8A 2NO1A 4Q9KA 2P5TB 3OFND 1QVRA 3A1WA 2JLVA 3SI7A 3WNCA 1TEVA 1IN8A 3CB4A 4II7A 4CEJA 2GXQA 4PC7A 2RGAA 4Q02A 4LZZA 2YWGA 1E98A 4RFSB 3PV0A 4PAQA 4D82A 2A2ZA 2DWPA 1ZM7A 2QROA 2PMKA 1SHZA 4KLNA 4GOXA 1XMSA 2DFKB 4JIMA 2X77A 2Q3FA 3OIYA 1QZXA 4KODA 4ILEA 1GNQA 4URYR 1YZNA 2ZVPX 3RS7A 4FN5A 3THXB 4G5QA 2JLSA 1L8QA 2ZSBA 1R5NA 3BB3A 1TL7C 4KXFB 1ZINA 3P26A 2OE2A 4FINA 2FZLA 3A4LA 4Q7LA 4C0BA 2CHVA 4F93B 1G8HA 1PLKA 4TTQA 1KJWA 2ODEA 4LBZA 1HUQA 5LDDC 5EE3A 1E2IA 2WSSA 2OO7A 3BD9A 3C4JA 1C4OA 2AD1A 3I92A 3GLIB 5CYPA 1UBEA 3QXCA 3TGPA 3ZS9A 3U44B 1QHHA 1YZGA 2FG5A 4W5HA 2V1XA 3TAUA 2YWEA 1X6VA 2VEDA 3AVUA 2QG6A 4V02A 4LJAA 1QHSA 5JWOA 2OCAA 1N5LA 3BXZA 2ZR7A 1DOAA 1IM2A 1TEXA 1CKEA 5CIWA 3I32A 1N5KA 2Q21A 1CIPA 3GFOA 3VTKA 4C0HA 2IUTA 3IBGA 1NKTA 1SVLA 1FX0A 3AV0B 4MQBA 4A6XA 1TPZA 2IXFA 2F3RA 5KSOA 4DSNA 1MRNA 4MYHA 3TNFA 3NKVA 2OAP1 4ZCMA 2RGCA 2BKUA 1A4RA 4DSUA 3B82A 2H92A 3CO5A 5KPDA 1U9IC 3CW2A 1JJVA 1ONBA 3RYTC 3DHWC 4W5JA 5CB8A 2P6NA 2J0VA 2BMDA 3FKSA 1R0WA 2XTZA 4AWXA 4LHZA 2XITA 4I1SA 4DBLC 2OBMA 4V0KA 1SKYE 2BOVA 2VP4A 4PAMA 1FMLA 3BERA 5CM8B 4B35A 2DCUA 1RRCA 3P1JA 2IF0A 4PHGA 3TKLA 5EZ5A 4BRUA 5JJKA 5ANRB 4TMTA 1J70A 1JR3D 4MITA 4A2PA 4D81A 1P62B 4GDFA 4MKIA 1QHYA 2RGGA 2PL3A 3LX8A 1F2UA 1XNJA 3B78A 4BFUA 3SBEA 2FZ4A 4C0SA 1KDPA 2BMFA 1EWQA 2FWRA 1I4TD 4EPTA 4JLMA 1H8HD 4YC7A 5D3QA 4DVGA 2O8CA 1OKKA 2V6JA 4TYQA 2ZJ5A 1R5BA 1EFTA 1FNNA 1DE0A 2X19A 4RD0A 1XMIA 4PPNA 1BH2A 1KYIA 2F9LA 4PQFA 5AUQA 5EP2A 3C8UA 2ZJBA 4L9SA 4JVNA 2FJUA 2WV9A 4MGKR 2FEMA 5BN3A 3ONWA 3W3AA 2GK6A 4NPHA 1Z0JA 2E87A 4JVSB 4Q4JB 1KI6B 4PC2A 3OFNA 5CDFA 5FPYA 4B2PA 4EJSA 3GLFE 1XPRA 4NYIQ 5L3VA 3WP1B 2SHKA 2WWWA 1RYHA 2RH5A 4TQ9A 4BLTA 4NONA 1MO4A 2ORIA 4LJ4A 4ZI3A 4LJ7A 4X8MA 2ZRNA 4RY2A 121PA 1G7SA 1JXOA 1NIJA 3PUWA 4GMXA 4BFVA 4URWR 1XEWX 3RS5A 2B7BA 2CVFA 4MRPA 1SVSA 2FH5B 1OFUX 1LNZA 2QZ4A 3UMRA 2VL7A 1CJVC 3Q5DA 4OBEA 2NGRA 3BC1A 3FTQA 1GFIA 2ZRKA 1IJFA 1UEIA 2FN4A 2ZRMA 4MGYR 4A2WA 3GLFB 3RVBA 8OHMA 5AJVB 4LGMA 1V43A 1TQ4A 5A4JA 3HP1A 5IK2A 3SFVA 3W8NA 5JHHB 2IYWA 2RHMA 1E4VA 2ZPTX 2A5GA 4H1VA 1ESMA 2JASA 3AF4A 4W5WA 4FD2A 5EE9A 4LPSA 4CVNA 4BLOA 5D3MA 2V9PA 3FMFA 3LQQA 2IF2A 3DPUA 3V9PA 5JRZA 1OIXA 2ODBA 2ZI9A 1WBBA 2GXAA 4AKEA 4M9ZA 4TMKA 1GZSA 4RD1A 3FMOB 4LY6A 4JLBA 3R9WA 1OXSC 1MKYA 3AVPA 3RS3A 4D4LA 3MD0A 3BAFA 4AYXA 2V3CC 3ICQB 3A1TA 2V7QD 3UG7A 2JDID 3FFBA 3KB2A 4MRRA 4FI3C 4I1VA 2WWIA 4U02A 3RRZA 2LCFA 2XXAA 2VHUA 3BIFA 3CX6A 4DT1B 2DB3A 4GL2A 3SU8A 1WBDA 2P6UA 3QUSA 4M1MA 2A7QA 1JR6A 5KO2A 1P2UA 4A0FA 1IN6A 2DBYA 3TSWA 4M1SA 3QXJA 4JT2A 3U4QB 3OIWA 1GNRA 4QGHA 4QBGB 3QKSB 4JVLA 4CEHB 4B43A 5BW8A 1OFIA 5JJIA 1T5IA 2O0JA 1ZYUA 4PZZA 3RANA 1YKSA 3MUFA 4G5GA 2R6DA 3QJYA 2ATXA 3TUIC 4M1KA 3ZQJA 1ZIPA 2XZPA 1E0SA 4EIWA 1W49A 1FOEB 1ZNWA 4D0LB 1JR3A 2ZRDA 5CYOA 1CR4A 2G83A 2ZQ5A 2RCNA 3B13B 4GMDA 5GVSA 2OFXA 4WZ6A 4D2IA 3LW8A 4FMDB 1FUKA 6Q21A 4OKSA 4ASUA 1RRPA 2Q6TA 1G5RA 1QHGA 1W5SA 3RLFA 2Y8EA 3X2SA 2J7PD 4V0ME 3L2OB 1H8HA 3DM9B 2WKPA 1W36C 1ZD9A 2YNMA 1D8TA 4H1UA 3EZ2A 1ZAKA 4QG7A 4YLGA 5TV2A 2Z4SA 1BIFA 2HJVA 3ZQ6A 1YRAA 4DCNA 5IDVA 4IOKA 5BWMA 3R20A 4I4LA 5CLQA 4Q01A 1ZMXA 3VU9B 4KFRA 4HB2A 1E9CA 3E5HA 3PFIA 4U5XA 2PLRA 3BORA 1KMHB 1GRRA 2WKRA 1AQYA 5G3YA 4OJKA 3HPQA 1S8FA 2ZAMA 1R0YA 2REXB 1LB1B 4DKXA 2G77B 2XTNA 2A78A 4D4KA 3EWSA 1LTQA 2ZYTX 3EPKA 2I1QA 3RC3A 1YR7A 3GPLA 1NN3A 1E1QD 4NYMR 3TW8B 5JSZB 2OESA 1RJ9B 3LLUA 4EPXA 5AJYA 1P75A 3VNVA 1ZW6A 4HZUB 1W1WA 1XCPA 1AKYA 2EFGA 3B9PA 4XOIA 4RCZA 1U0HC 2H1LA 4DB2A 1MRSA 4U00A 3K09C 2NO9A 1ANKA 3NVAA 4Z8YA 4C30A 3R7WB 5JMTA 3AUXA 1RIFA 2GESA 3MCAA 1Q20A 4NP6A 4Y0AA 3SC3A 4Z8XA 3MJHA 4TTRA 4XJXA 1VCNA 2VHQA 4CEIB 3BGWA 4IEIA 4OQLA 4R7ZA 5B2ZA 4U7DA 2OHFA 2OAQ1 2VHJA 4Q9JA 3SNHA 1U0JA 3ZDQA 1XCGB 2LKDA 4ERNA 3UPUA 1AGPA 2Q9BA 4WW0A 5GJCA 2DFNA 4D4MA 4GBMA 1R2QA 2GCOB 3U3KA 1F3OA 2BBSA 2VIIA 4OL0A 4PR0A 3KKOA 2JLXA 3B1VA 3U3MA 3QBTA 3Q85A 1HE1C 3MAAC 3QENA 5EZ6B 3W5IA 2ZR0A 2C9CA 2HCBA 2JDIA 4NMMA 3QEOA 1KDTA 2IWRA 2HF8A 2LWIA 4EPYA 1D5CA 1Q3HA 2OXCA 4JL6A 3KB1A 3GD7A 2DWQA 3QKUA 3H1TA 2ZE8A 4QRHA 4Q9IA 5TDHA 1ZC4A 1IY0A 2XEXA 1CBUA 1JQLB 2BCJQ 4HUQA 4B3BA 2ZI3A 3Q7PA 4QM7A 4ZDJA 1VG8A 3AVQA 2GHIA 2XNDD 2VSFA 2BJVA 2O8BB 1YR9A 3AKDA 1KSHA 2IHBA 2FSGA 2ZUDA 5KYKA 4OQMA 4JLJA 5JS8A 1N3BA 4JL8A 4ZPXA 1I4DD 2YZ2A 5FR2A 4M4SA 4D4JA 5FOWA 4XWOA 5HR5A 1A2KC 1XU4A 3ADDA 2J45A 1IQPA 3T1VA 2KE5A 4PHFA 3TMKA 2NZJA 3THYB 1WMSA 3CM0A 2W0SA 3FKQA 4YMSA 3RS0A 2EWVA 4Q1AA 5EXSA 1E9DA 2DPXA 2HLDD 3RS4A 3ZS8A 4TLAA 2J7PA 4C0QC 1GWNA 5C4MA 2Q0HA 3EPLA 2H8KA 2JCSA 4NU0A 4CEJB 2PT5A 4HAVA 4UXIA 5TVKA 3TAHA 3K0CA 1KKLA 1K8RA 1XP8A 1NVWQ 3A4MA 2ZR9A 3BB4A 1GSIA 2H7VA 3EA5A 4GNKA 4NCJA 1OE0A 3LVQE 1ZJ6A 2AHOA 1EFHA 4OJQA 4HUTA 1UBCA 3TR0A 4QHSA 2H17A 1XPOA 2QMEA 4DUGA 2NPIA 1VTKA 2XJ4A 5CK4A 5FOSA 4PSVA 2GRJA 1GNPA 1OYWA 4JZKA 1YR6A 2AFHE 4KLZA 4QBIA 3UKDA 3VKWA 4QJ4A 4K81B 1WB9A 2KBEA 2EFHB 3SFZA 3M6AA 3U7FB 2J3EA 2CK3D 2AL7A 5LBIA 2EYUA 1HQCA 4WBSA 3PEVA 5DHAA 4UNRA 1YVDA 3EARA 1KDOA 4B3FX 3DM5A 1QHHB 1IN7A 3VAAA 3PENA 4PPFA 1NVUQ 3PUXA 1GP2A 1DAGA 1HURA 4B75A 2DYKA 1XCMA 4C9BA 2OLKA 2ZIAA 1P9RA 1P9WA 1Z0KA 3IO5A 2IA5A 3REGA 5FPKA 1SVOA 4MDFA 3FFAA 1CULC 5LB2A 3DL0A 3Q8XB 2XB4A 3KQLA 1KNQA 5EQTA 2HDNB 2FE4A 3NEYA 1Z29A 2GTPA 3CF2A 4IXMA 1TF2A 1XDBA 2G1KA 2J41A 2JLQA 3EZFA 1FX0B 2QTFA 3P27A 3P20A 3X1XA 2IHYA 3PCRB 4ZKEA 5BYJA 2V55B 5AUOB 1OFTA 2EFEB 1CJTC 3GFPA 3HR7A 2D62A 3L0IB 3TJZA 5C2JB 4OI0A 2IYVA 4GSYA 5CB6A 2OFOA 4R98A 4ESVA 2NTYC 2L0XA 2EVWX 2JJ2D 3CX7A 5FOTA 3GCGA 1GAJA 4NYIR 4UNQA 3NEJA 1XB2A 2G3YA 3U6BA 2WWXA 1P72A 1OFHA 4QHYA 2GKSA 3TW4A 4BRWA 4LC1A 4G5SA 1N0WA 1R10A 5SZHB 4A0GA 4TL8A 1OH6A 2WJGA 1P2TA 2VP5A 1T6NA 2QA5A 1RPZA 1UDXA 2JJ1D 1HA3A 3NBXX 1GOTA 1PLLA 3X1ZA 3EIHA 2GNOA 1KO8A 2XSZA 4DIEA 2XNDA 3QEJA 3I61A 3ZGXA 2QP4A 4M1OA 4L9WA 4CIDA 1VMAA 2IYUA 3B1YA 1L7VC 1F2UB 5J5CA 1F2TA 2A5DA 1JEDA 2ZYWX 2VBCA 5AK0A 5J4LA 4E5UA 3CX8A 1ZM4A 4Q7KA 3G0HA 3WP0A 2WOJA 4QKQA 3U60B 2ZJ8A 1MO5A 3CF0A 3B1WA 3IQXA 2O8CB 4IDOA 3GMTA 4M1YA 3ICEA 4F91B 2ASEA 4YMWA 3SHFA 4Q1BA 4M9XA 4Q66C 4WZBE 4BASA 4D80A 3JZAA 5FPTA 3A37A 2CHQA 2ZRIA 3CKLA 4XTCS 1KZGB 2ZRLA 3CONA 3IHWA 1NMXA 1WXQA 3SN6A 3WYAA 2HLDA 1TQDA 2PJRA 4EJSB 1AK2A 1NVXQ 2XTMA 4HLUA 1ZU5A 3REFA 4MDEA 4R2HA 4TWZA 2FGJA 4DXAA 1W4BA 2CVHA 1AKEA 1VKJA 1BS1A 3O8CA 4GRAA 2Q9CA 3HYRA 1CEEA 4AK9A 2ZRFA 3ZD6A 1EFCA 1M7BA 2FFQA 4V0LA 4BLQA 5EE1A 5K8IA 5FTJA 4V0MA 5F98A 3QVVA 2GJ9A 1T5LA 1DADA 4BFSA 4EFNA 4DCSA 1VDZA 5L3QA 2FFHA 1FW6A 2FPLA 1PJRA 1M8PA 3EAQA 5AWFC 3BH6A 2VSOA 3LLMA 1DAMA 5LB4A 1IXZA 4FXPA 4JL5A 1SHKA 4YDHB 1FNMA 4LWZA 5JBQA 4HLQB 2IS1A 2O8EA 4XWKA 1JAIA 2FMXA 1G8YA 1L4UA 3UK6A 4DEXA 2YKGA 1Z06A 4TYYA 3OEHD 3TK1A 1IHUA 4BLSA 2WIBA 2CK3A 4LV5B 1CRPA 4JLNA 3J81k 1EK0A 3Q9LA 3B5JA 1XWIA 2V54A 1ZIOA 2YV5A 4GI7A 3EZ6A 2NO7A 2X1VA 1UJ2A 3NTUA 4B47A 1XXHA 1YQTA 5D3MB 3FDIA 3JZMA 3T12A 3U2QA 4A2QA 2YOHA 1QF9A 2A5YB 2VRWA 3CH4B 5SZKB 3SJCA 4AKGA 1FP7A 4DLRA 4QNMA 1II9A 4ZV4A 1G9XA 2QGZA 1G3UA 2B6HA 3U7HB 5FBWB 4YONB 3VNUA 1WA5A 3H2YA 3NC0C 1LS6A 2UZ3A 1E79D 4JT4A 2Z5FA 4K8OA 3FE2A 3CZQA 2XXAB 1COWA 2YWHA 2GEVA 3ASYA 3B1ZA 4AC9A 2WMOB 3VR2A 4HAUA 4HB0A 2A5FA 3F0TA 3GQBA 4GOKA 4ABYA 4NYMQ 3CRRA 5J4VA 2JJ2A 3EC1A 2N1BA 3EZ9A 3OHMA 4IDNA 2F3TA 4RJLA 2BKEA 4A0HA 4C2TA 2J0UA 3NIBA 1WE2A 1W7AA 2WBLC 3PUYA 4OI4A 3IILA 5EP4A 1Y3AA 1KHTA 2BEJA 1PUJA 4EPVA 1UKEA 3ZVRA 3OIUA 2QL6A 3PITA 1XEFA 2R6AA 1C9KA 4MRNA 3BRWD 2BBOA 2C77A 2JJ1A 3SYLA 1XD2A 3CPEA 4N0DA 1M6NA 1Y63A 1PVOA 4MRVA 5KNCA 1UPTA 3BK7A 1NBME 5KDDA 1WCV1 1D9ZA 2QENA 2EQBA 3OESA 4JLOA 1Z5ZA 4C3ZA 2GZAA 1J2JA 1SXJC 2UKDA 1MO6A 3CH5A 5TY0A 2WWHA 3VR1A 2ECKA 4DSTA 3TIFA 4ESHA 1G1MA 2E9SA 5FUWA 2HEIA 1E2DA 3VHLB 4V0OA 4KAXA 2Z4RA 3VR3A 4S2EA 4A9AA 1R5OA 3W6OA 1HV8A 2ORVA 4B2LA 3IIKA 4QOSA 3AVTA 3X1YA 4FCVA 4ZCLA 4M21A 1G19A 5HCNA 5A5GA 4KU4A 4KV9A 3QG1A 4L4UA 2D7DA 4Q4HA 2FU5C 1D2MA 4X8LA 3VKGA 2J1LA 2W6JD 3PJRA 3QXHA 2ZRGA 1KK2A 3LQRA 4EFMA 2ZUCA 2G1JA 1F6BA 1Q1EA 4LBVA 5DI9A 1KGDA 1XMVA 3SHWA 1HT2E 4X8OA 2RGXA 2FSIA 4WZAE 3QF4A 5IK2D 1KZ7B 1KSGA 1X8JA 1VYVA 2MSDB 2ZJAA 1RFLA 2YHSA 3PQCA 2LKCA 4IDPA 2GJAA 5H1YA 2GXSA 1IN5A 1T4GA 2RMKA 5EUMA 2BIFA 4N1AA 1LF0A 1CRQA 1PV4A 5HPYB 5BXQC 3EPJA 1EXMA 3IBYA 3OEHA 4JS0A 3LRPA 3AF0A 1E9EA 3IQWA 3DZDA 1LF5A 4K46A 1E2FA 2IC5A 3TVTA 3GJ0A 1UBGA 3U61B 2O8DA 2BM1A 4MRSA 4OHXA 4NTZA 4BE7B 4LJ8A 2QTHA 3K9HA 1VHLA 2HXYA 3M4YA 4HAYA 2EFCB 3CNOA 3ND9A 4IOJA 2NO6A 4RKEA 4YMVA 3KXKA 1S1MA 2WMNB 4PC3A 1KTVA 1RRGA 3OAAD 5DN6D 1KI1A 4EQ6A 1OH5A 3GLGE 3EIQA 1VCIA 4BFZA 4YMUA 3UANA 2TMKA 1OJLA 3TLXA 2AX4A 4OHWA 2B8TA 4KHZA 1E79A 2CCJA 1P4SA 4URXR 4PO9A 2A30A 1DAIA 1XTKA 1ZBDA 5EP1A 1KJZA 4D0GA 4NBSA 1SVWA 2J7KA 4LYHA 3IIJA 1N6KA 1FQJA 4HUQB 4ZIRA 5JZVA 3HWSA 2WWYA 1SVMA 1TF5A 3I1FA 3KKPA 2YC2C 4KO8A 1O87A 4JBYA 2GAOA 5FOXA 1A7JA 1E2NA 4ASUD 4Z51A 1E2HA 3GJ5A 2C9YA 2VSXA 1XJQA 1D9XA 2FEOA 2CXXA 5JCZA 1S96A 4ACAA 2PCLA 1VECA 2CE7A 4NCNA 4RZ3A 2VO1A 4CZ2A 1SKYB 1YZQA 2VHTA 2ZETA 4PQYA 5G53C 3VFDA 1US8A 1IJEA 4RD4A 1DAFA 2WWFA 3W3ZB 1UKYA 3KQKA 2XGJA 2QORA 2MMGA 1K6MA 3MGCA 5TMPA 2GCPA 4LYAA 1FL9A 1NBMD 1R8QA 2FFBA 1OXXK 4HB3A 3SDZA 3T34A 1CJKC 3LXXA 2C5LA 4KSCA 3LH5A 2ZI4A 3Q7QA 4HDQB 1JQJC 4KFTA 3TQCA 5JWRA 5HE9A 2REBA 4H9GA 4HLDA 1E3MA 1ZD8A 2PEYA 4C2UA 4M9SA 2RGEA 1IOZA 2GZDA 3CLVA 3IEVA 1WF3A 2QRZA 1IN4A 3NDBB 5L3SA 1H8EA 2JJ8A 2PZEA 3K9NA 4Q9LA 3I3SR 2W6JA 1W4CA 4B3XA 2FNAA 5LD2C 1GIAA 4I99A 1Z6TA 2B7CA 4QJ3A 1N25A 4IOMA 3W9YA 4LDJA 2BMJA 1P60A 4AYTA 1KO7A 2FPMA 3TE6A 5DE3A 5KSPA 1JNYA 1TTTA 4RD3A 3ND8A 4FW9A 1KAOA 3HU2A 5M04A 3E2IA 1JJ7A 4B3CA 4Q00A 2BV3A 4E22A 3AVYA 1AJEA 4UKDA 3LDAA 1QG2A 3THWA 2GBLC 1Z6YA 1AS3A 4TQUS 1VIAA 3HJNA 2QTVB 1C1YA 1U9IA 4QFMA 2HT6A 3ZVNA 2ONJA 1FZQA 2IL1A 5JEEA 3I8SA 1U81A 3I8XA 4M1WA 4A8JC 4DCUA 2GCNA 1G7CA 4TMVA 1G5PA 4XSGA 3H86A 3AUYA 3C15C 5FOVA 3C5HA 2ODWA 4FMCF 2HJGA 1GUAA 2ZYVX 3W90A 3WHKA 3OAAA 5EXXA 5DN6A 5FPSA 4NZYA 3QXSA 5E7JA 4PANA 2AFIE 1M2OB 4LJ5A 4BLRA 3ZD7A 2VP9A 3R8CA 4TMZA 1NY5A 2QT1A 3P4YA 2Q9AA 3K70C 2P2LA 4AURA 1E2PA 2DR3A 1Q44A 1SULA 3W5JA 5LPNA 2OFWA 4G5OA 4YQFA 5K8LA 5AUNB 2GVDC 2B92A 2ZI6A 4EAQA 2C98A 1Q12A 4UXJA 5G3ZA 3ZYCA 3M0EA 4CF7A 1IXSB 1RW4A 1GVNB 2YJTD 2CJWA 1AS0A 4IJMA 1NLFA 2FGKA 1F2TB 4URUR 3LNCA 4WOPA 3K9LA 3LAWA 3CNLA 1NP6A 2IXEA 1KK1A 3CRQA 4M1TA 4Y0VA 4P3YA 5CIQA 1XEWY 5H70A 5ELXA 4FCWA 4BGDA 1TU4A 2WSMA 4BEJA 3OEED 1GITA 2R6GA 4XVRA 3DKVA 1BO6A 4US1R 3H0KA 2HF9A 2ZU6A 3NC1C 4BUJA 3RRMA 1QDEA 5J40A 4DB4A 1W0JD 4A82A 3B1XA 1II8A 4DUGD 5GADl 1DG3A 1OIVA 3DOEA 4MUAA 5JI3E 2QAJA 1DARA 1U98A 4P4SA 1X8KA 1UKVY 1YHNA 3THOA 1NBMA 1G8FA 3VKHA 1G6HA 2C78A 5DYIA 3A4NA 3PIRA 4A4DA 1Z0DA 1G4UR 1XXHE 2WOOA 3PVSA 1PUIA 2WWGA 4JLKA 2QNRA 3CR8A 2AN9A 4TL7A 5JFGA 2ANBA 3QPWA 4M8NE 2JIZD 2P3SA 1QRAA 2OM2A 3SS8A 4DIDA 3RSOA 5L3QB 2OCYC 1P2VA 4Q19A 5JEDA 3QVUA 2O8EB 1JI0A 2AKAB 4B3DA 1N6PA 2PX3A 4B74A 4TZ0A 2OILA 1IAQA 2GBLA 2ZJ2A 3M1IA 5IF9A 2VP0A 1G18A 4PPGA 2ERYA 4DDVA 4Q7MB 4QC2A 4TLCA 1U99A 1XZPA 4AD8A 1QG4A 3TUJC 2QGNA 1M34E 2NPFA 1KMQA 1L4YA 5JS7A 1T9HA 2QT0A 2G88A 1U90A 3P4XA 1O3YA 2X2EA 1XXHB 2GF0A 3KJIA 3MMPA 4A8JA 4QGFA 1ZRHA 4MYTA 1Z83A 2BMEA 1XJCA 2BCGY 1KY3A 3HR8A 5DI3A 3C14C 1E4YA 4NYJR 4LSGA 3A1VA 4HLCA 4X8HA 3GJ7A 3RRNA 1OHHA 4O2LA 3NH6A 4BFWA 2UVQA 4XSHA 1T3HA 3IHLA 1BMFD 3T61A 4DCTA 4XVQA 3L82B 2QRNA 4LYJA 5DLQC 5HE8A 3I4LA 3MSXA 2YOGA 1N6HA 5KPJA 4LHXA 5FPHA 1RKBA 4ZO4A 1FQKA 5SZJA 2NOAA 1W4RA 3SZRA 1YJ5A 4NCIA 1P5ZB 4P4TA 4GPTA 2G9NA 1Q3TA 2REOA 3IEUA 2XSZD 4BFXA 1KAGA 5EXPA 1KI7A 4IEEA 5EJEA 2H57A 3SEAA 2J0UB 3IO3A 3PUZA 1JPNA 3WYGA 3VQTA 2GJ8A 3I5XA 4POAA 3ZZUA 3GLGA 2QMOA 3EXAA 1IXRC 1KI9A 3QSYA 4DWJA 4QXAA 1XD2B 4CT4B 1OT3A 2D4HA 4NDZA 4Q5IA 4WIAA 2PMDA 3T1OA 1E0AA 3EX7C 2B21A 4KFUA 1RRFA 1G8PA 4NE2A 5F9FA 1G291 2OCPA 1P61B 3W34A 1X8LA 2ZEJA 4EUNA 2ZSDA 1SGWA 1N6IA 4TL9A 3BS4A 1VCOA 1G5TA 2QE7D 1N6OA 1A82A 2VYFA 1VPLA 2D74A 2ZS9A 3KTAA 1WP9A 1QVAA 2ZANA 4US0R 1G20E 1LV7A 1Z2CA 3V4FA 3AGQA 3OEEA 1OPXA 4Q1EA 4DDUA 4HZIA 2VP2A 4JYBA 3IDQA 3DVLA 3HYTA 5KSYA 4NL4H 2ZE6A 4KITB 4GZLA 1NF3A 1EX6A 3EG5A 3VR4A 4E09A 1W0JA 1AQUA 3TSOA 2IYLD 3MLEA 1U0LA 1ZUHA 4JSYA 2QBYA 5AJXA 1VG9B 3GFTA 4Q4HB 4O3MA 2J87A 2XB2A 5J4HA 4P31A 3CIOA 3AVWA 4FMBB 1DEKA 1E9AA 3LW7A 3ZVMA 5G40A 1E2MA 2QP3A 3PXGA 2J0SA 3L8YA 4C0JA 3K09A 1CU1A 4AIIA 3QF4B 1WRBA 3B6EA 3PG5A 2NIPA 4O2RA 3ZVLA 2D06A 2JIZA 4IDQA 3FHOA 2WPDA 1LVGA 2FSHA 5E7MA 2F1RA 3K53A 1KY2A 4IW3B 2O52A 4RZXA 2HV8A 2CL0X 3AGPA 1G21E 1ZNYA 1E9FA 2RAPA 3LA6A 1XRJA 3BB1A 4GT1A 2RGNC 1MH1A 1OSNA 1Z3IX 2CE2X 1YZTA 2CHGA 4Z1MD 4HAZA 3T5DA 4LI0A 4F38A 1YZUA 2O8DB 4GP6A 4LBYA 4JBWA 4TTPA 5DHFA 2KSQA 1E2GA 2XJ9A 3KXIA 3RS2A 3KJGA 5EE0A 1UAAA 1COWD 3MWKA 4FCTA 1GKUB 1E0JA 2QQEA 1CLUA 4V03A 1OV4A 4TT3A 4ZKDA 4EQ6B 2VF8A 3ZJYA 1XD8A 3EZ7A 3PR1A 4CDGA 4Q21A 1SXJE 1UF9A 1BMFA 3QKTA 1E9RA 3GEEA 1AM4D 2CCGA 3NDPA 4Q18A 3IUYA 5DNYB 4FMDF 4L5BA 3ADKA 1ZM9A 2CLDX 3QY0A 4HI0E 4IKEA 4IFEA 5FI0B 4DLYA 3RDPA 2VPPA 4MA4A 1TQ2A 4PZYA 1U8ZA 4KCGA 4ZIRB 3SJBA 5FBRB 3FHCB 5BN4A 3RHFA 1N6LA 2O0HA 1TX4B 2N46A 3LFUA 3VR5A 3LD9A 4G1UC 3QKSA 4G3XA 4MUBA 4LBWA 4D0NA 3SYKA 3KKNA 2PT7A 2IW3A 2PH1A 4IRUB 1NNEA 3QXXA 4TZ6A 1AN0A 2ZITA 4C7OA 2R2AA 4BLPA 1NN5A 2PZFA 4M9QA 5TARA 4DLSA 3AKYA 4OQXA 5B58C 5HZKA 3ADBA 3LBIA 2P5SA 5BN5A 1P7CA 1US8B 2QPAA 5FL7A 5E3HA 2GILA 1AGRA 5FBVB 4JKYA 4AKIA 3NWJA 3AF2A 4RSGA 2F7SA 3X1DA 2ODNA 5JECA 3KQUA 3KJEA 2CLSA 1S9HA 1E2EA 4OK6A 4Q4AA 2O8FA 1OXUA 1DAHA 2QE7A 2ZUBA 2YVUA 2JA1A 3QNUA 2I3BA 4XTRA 1W0KA 1Z07A 3C7KA 3QOFA 4A36A 1T8UA 2IS2A 1R0ZA 1FTSA 3FOZA 2C8VA 2FFAA 3BE4A 4Q03A 4CYMA 1GDDA 2WKQA 5L3SB 1JEEA 3AEZA 2F43A 2A3RA 1OF1A 1TUIA 1ZP6A 1HTWA 4HDCA 1W2GA 2J9RA 1JBKA 4XD7A 1Z6AA 4IVRA 3WYFA 3PEYA 1Z6GA 2G0TA 4O25A 4A1FA 2CL6X 3O47A 3S1AA 4UJ5A 3DKPA 3LV8A 4HATA 1XFAA 2W2TA 4TMXA 4QBHA 1GL9B 4BFYA 1TUEA 4PQRA 5JHGB 1XEXA 1K5DA 2QPOA 5SZIA 3RWMB 4B6FA 2PBRA 2RB4A 4OHZA 3A58B 3A36A 1HQYE 4WXPA 5JJLA 3WMGA 4LJ6A 2BM0A 4B2IA 3FVQA 2RHDA 4M53A 1A5TA 1W46A 4MYCA 2J0QA 1S4QA 2IT1A 4FWTA 5EXTA 5FR1A 3T15A 2BHRA 2IYZA 4Z1MA 1G6OA 4QGGA 2YINC 5F3WB 3GLHA 4B3GA 2JEOA 5G41A 2QQ0A 2QSZA 1TAGA 2R62A 1OXVA 3B60A 1J99A 4P0TA 1R6BX 2J59A 1E9BA 1SZPA 2WVJA 1TMKA 3EW9A 4KSBA 1E9SA 1NMZA 2E1RA 2W0MA 1MV5A 4RZUA 4TMWA 2GJSA 1CJUC 1JAHA 1HT1E 3K0AA 1E2KA 2YWFA 3LVRE 1HY3A 1G16A 3EPHA 3CRVA 1ZNZA 3KDSE 1HEIA 4E07A 4KI0A 3LBNA 2EFDB 1N6NA 1MT0A 2IYQA 1G4AE 2NG1A 3UWKA 1DVRA 1E0KA 2OV2A 4KJZA 4BEBA 2ZXUA 4PXAA 3PEUA 3GJ6A 2YC4C 3HDTA 3RWOA 4F4IA 4F92B 2XX3A 5FBLB 1E99A 1GKYA 2CJWB 3OE7D 3MWYW 2XNSA 1ZM3A 4PO8A 5FTMA 3U3RA 4LPKA 1KI4A 2X8AA 4Q9HA 3QE0A 4NYJQ 3TVDA 2QY9A 2AXPA 2WICA 3AKEA 3OIVA 3AVVA 1LS1A 4TYWA 2FPKA 5E95A 1N0UA 1KK0A 4S35A 3F3YA 2EU8A 3H4MA 2XAUA 1FFHA 2IYSA 2C95A 4L8GA 3UMFA 2YOFA 1N6RA 3L43A 5CJ2A 3L0SA 1Z63A 1II8B 2W58A 1E2LA 1H8ED 2QEQA 2VHCA 4P4SB 4R9UC 3UXMA 5KUTA 2PCJA 3I5YA 5LD2B 5FUXA 3FB4A 4B33A 1G7RA 3OZXA 2HT1A 1DELA 2GK7A 4P4UA 1Q1QA 2RGBA 1VYTA 3RAPR 3GLIE 1EFRA 2W6IA 2GJKA 2ZS8A 3N70A 3OF5A 3TRFA 1G3MA 2BC9A 1VG0B 5FI1B 1VCMA 1II0A 2ZAOA 1NJFA 1N5JA 1XD9A 1SVKA 3H84A 4PAOA 1SQ5A 4IDHA 1NVVQ 4EJSC 2ZVQX 5KDOA 1MABA 1A2BA 1GILA 3FMIA 5J4YA 4BFTA 1Q0UA 1P3JA 1NN1A 2C04A 3SBDA 3ZZTA 5KNDA 3GJXC 3QIAA 1S9DA 4JLPA 4C0KA 3KKQA 4ZDIA 4Q47A 4V0NA 4LC0A 3CZPA 3BH7A 4A8JB 4EDHA 1YE8A 2R9VA 4CRWB 3C41J 4M22A 1X1RA 3G5UA 4NHOA 2ZI5A 3A1SA 1TADA 3UG6A 1XTRA 4LJYA 1Q1BA 5CK5A 1G8GA 4HSEA 3GJ4A 5DI3B 3QQ5A 5GJBA 3QKRA 2QMUA 1KI8A 3DEFA 4BQSA 2OUKA 4M0LA 4Q48A 4G5RA 3VMFA 3MG9A 2IYTA 5KOYA 3K0FA 3CPHA 4JLDA 4XIGS 3VHXA 3SJAA 4AI6A 3K70B 4GZMA 4TL6A 1WQ1R 2VA8A 2NQ2C 4ZDWA 3ZIAD 4WA7A 3R8FA 1GG2A 3GEIA 4PHTA 3WNDA 1K5GA 4RD2A 2GXUA 2HXSA 5UKDA 1EX7A 3R9IA 3D31A 2QAGC 2NMVA 3GEHA 1RC8A 3K9GA 1XTSA 2OBLA 4UXHA 2RGDA 3GP8A 1W2HA 2DFLA 3WBKA 3AF1A 4OK5A 4NCKA 2F1JA 2P67A 1G3QA 1NSTA 1QHNA 1DS6A 2JLWA 4LK2A 4O0MA 2UZIR 1KSJA 5E4FA 3GLGB 4NH0A 1KNXA 3KXLA 2AK2A 1SXJA 3N5CA 4DEYA 2P6RA 1DG1G 1CR1A 1E2JA 5EUQB 4LCBA 1OXTA 1IBRA 1Z22A 2IS4A 1W36B 1UEJA 2FSFA 4YXWD 4Q1DA 1OYYA 5H8WA 1W47A 1D2EA 2IYRA 5HTKA 4AKHA 2PEZA 721PA 1AZTA 2H16A 3OE7A 3R9XA 2OCBA 4Q1FA 2V8OA 1OB2A 2P65A 1DAEA 3BFKA 1JB1A 2Q3MA 5B64A 2OEPA 4JYCA 1ZNXA 1U8AA 4HAXA 4HDOB 4OK3A 4TSFA 3A8TA 4KYUA 1YU9A 3DZ8A 2FDCA 2BVNA 3KTAB 4ARZA 3RNLA 2GDJA 1I2DA 3BFVA 1QBKC 4HYYA 5DSZA 4WXRA 1NKSA 4TYPA 2ZJOA 3LO5A 4Z54A 1H65A 3FWYA 2BJWA 3T06B 1F48A 1NIPA 4QBFA 2NZ8A 3ZLJA 1SVIA 3SOPA 4UNNA 3Q3JB 1FP6A 1D6JA 4DLXA 3PEWA 1XBTA 1YZKA 2QBYB 3AM1A 4N3NA 2QP9X 4IFBA 3U3OA 1LW7A 5BQ5A 2WJIA 4GP7A 3U6KA 4D25A 4DJTA 2MSEB 2D3WA 1S1CA 3NXSA 1W4AA 4IXNA 2WHXA 1IY1A 2GVZC 4CT5A 3Q5EA 4DLUA 2NO0A 4B71A 2WZQA 1NI3A 2B8WA 1UM8A 3L8ZA 3D8BA 4UNSA 3U3JA 4I1UA 3WRYC 4KYIB 4LHWA 1DAKA 4XVUA 3UIEA 4NCHA 2VH5R 2ZE5A 4OI2A 3SQXA 1NG1A 1TNDA 2F1HA 3U7GA 5L3RA 1LFDB 1I2MA 2GWHA 4ZDKA 5KDLA 1X1SA 3TBKA 2QPTA 3VX3A 4EFLA 1Z28A 1U8YA 1GRNA 221PA 1ZUIA 3Q72A 4IVQA 3BOSA 4RVCA 1ODFA 3DMDA 1OHHD 3ETLA 1KI2A 3HU3A 4QJ5A 1NMYA 5FTLA 5GJVC 4BECA 1A1VA 1DPFA 3NG1A 2IUUA 2ZREA 4CGZA 3LXRA 1CR0A 3K70D 3BH0A 5HZHA 2P0EA 5B30A 4LJ9A 3T35A 5JWHA 4CW7A 1GKIA 1N5IA 1CP2A 2IYYA 1U2RA 5CM9C 1EESA 1KDRA 2AD5A 2QAGA 1KO4A 1Q21A 4UQOA 4KFSA 1MOZA 4L16A 4B76A 3G82C 2KJQA 2OSBA 2Z0MA 2IUSA 3CUEF 3LY5A 1G41A 1AZSC 3ZIAA 3THWB 1G3RA 4JJZA 3WXMA 5HKKD 2HYIC 1ESNA 2O5VA 3WMEA 3D6TB 2ZE7A 1AA3A 1BYIA 1LY1A 2D2FA 1W36D 2AWOA 1UDWA 1R7RA 3AKCA 4C0AC 4WAUA 1XTQA 5P21A 1EGAA 4MKHA 4ITRC 1VIYA 3FGNA 5DGXA 4HB4A 1ZC3A 2OG2A 4DZZA 5K8UA 2KB0A 2AKYA 2AR7A 3BWDD 2GEDA 4URVR 1AA9A 4LRWA 2GF9A 5C1BA 5KSZA 1XZQA 3IIMA 5AJWA 4C7OB 1FPMA 3AB3A 1QHXA 4TN1A 3WMFA 1NJGA 4YXWA 5CITA 2DFTA 1TQ6A 3B2EA 1NN0A 3B9QA 3KFXA 1X86B 1J8MF 2PZGA 4F7WA 3JVUA 3ZZ0A 4TLEA 4OYHA 3C5CA 2HYDA 1ELOA 2GAAA 2ZYUX 3MJRA 4LYFA 2H5EA 3PUVA 2O8FB 5FFMA 4Q4AB 1G17A 3SYNA 3FPAA 3TUZC 1J8YF 2QM7A 4QM6A 3BBPA 2ZRJA 1OH8A 1KI3A 3RABA 5BYKA 2ZJYA 2VQSA 4US2R
chains in the Genus database with same CATH superfamily
1ISHA 3AF3A 1E7MA 3M3HA 2AWNA 3CWCA 4BZXA 1HH4A 1T2VA 3OJXA 4MWTA 3R7FA 3NP9A 4LZWA 4RFSA 4W82A 2WJJA 5DCWA 2WPDD 3H3FA 5WRFA 3V7UA 2O0KA 4EF6A 3BCHA 1DIBA 4HDNA 5CDSA 2GEJA 4RKWA 1NLYA 2XNJA 3HSKA 4ND3A 3U7EB 4MYUA 1GUZA 4J90A 3NBYC 1P1HA 3IEKA 2CT8A 2UXCB 3FVTA 4KAAA 1LSOA 4Z7QB 3THXA 4HAIA 5AHRA 4EA7A 3WA6A 2CXUA 1BQ3A 1P81A 1P8AA 2E4WA 3NPAA 4Y6GB 2YN4A 3K1AB 5JRJA 4HEJA 3VO2A 1GU7A 2XMCA 3SR0A 3REOA 2AJBA 1T43A 1A7KA 3AINA 4QUDA 3ZKWA 1LTKA 3VZSA 4F21A 1KO5A 5TXGA 3FYHA 2QJRA 3MAJA 5I5GA 4DTIA 3B70A 1KEEA 4OHOA 1UKZA 1ODTC 4TT3D 4DV1B 3ZY4A 4MRMB 4QTUB 2HUNA 3NBUA 2D4AA 2JFOA 1EFUA 3L1UA 3MFYA 5BNWA 1Z8FA 3S28A 2ZI7A 5AXDA 3ZWCA 2HU2A 2WJYA 3L4SO 5DHSA 5LOVB 4DDTA 4EM6A 1DTSA 4DN6A 1USGA 3UATA 4J91A 3WDSA 1XTUA 2CLCX 4FFVA 1KAHA 4W1QA 4AY3A 5AKYA 4KQKA 4OHYA 1P7ZA 1MHPA 3M4JA 4QRDA 1D4AA 1IATA 2VNJA 1U8EA 3JQ7A 4RFVA 1M7HA 1I33A 3AP2A 3IUNA 3NTRA 2CMKA 2V4MA 2Q29A 3P32A 1M9NA 1RQNA 5F4BA 4JJKA 4YMLA 2ZRPA 4IH9A 1GZVA 1HYQA 1CXZA 1P74A 1WMDA 3AR5A 4TVOA 4B4OA 3H5RA 1EJ0A 1EVLA 2D2XA 4B0PA 4D26A 1YE3A 2JAPA 1RC0A 5CVEA 4EOGA 1HF3A 2WAYA 3G79A 2FEAA 5HDQA 5TQVA 5D85A 5LMZA 5LMCA 2NTNA 4XWAA 2ODPA 3ICPA 3KFVA 2V7QA 4E5PA 5MGBA 3F7TA 3LBFA 2HB6A 4B81A 1Z4PX 5T6BA 1G1AA 3KC2A 4FMPA 4FQ7A 5G2OA 2X9NA 5JLJA 2CJPA 1OA1A 4EY8A 1Y4ZA 4IF4A 4KQXA 5ITWA 5FL3A 3WC4A 3GGPA 2NVUB 3C5WP 3KZOA 4RE5A 3V1LA 3V6LA 4C0LA 3T1QA 3K32A 4RV5A 1HPLA 1R5JA 1IK4A 4OI1A 4EW2A 2X76A 4L57A 1IHOA 4C78A 3ABQB 2B25A 3RT7A 3M3PA 2C3PA 2OLJA 3JAKA 2BD0A 2EZ4A 4JQOA 1E69A 1KVRA 4IHQA 4ZHQB 4P32A 1CUVA 5T64A 3E1SA 2Q3HA 4KPEC 1CZKA 4N0EA 4JK3A 4MMXB 5IBPA 1KZYC 4FGKA 1F8YA 1V35A 1GQYA 3R9KA 3LQFA 2WTUA 1PQPA 4INZA 1K6JA 4E94A 1JU4A 1Z0IA 4LZLA 4PTZA 5CHYA 1OYVA 2ZRCA 1JLLA 1Q2XA 2XECA 1Y6ZA 3CUYA 2X3UA 4TLDA 3UJAA 3VVBA 5CA1A 2DQZA 3QBVA 3WSVA 2WJHA 3E70C 3ZWMA 1CC1S 4X93A 4TV9A 2IBMA 1QH1B 3EUEA 4QNRA 5CNIA 1EE2A 3IKJA 2O2CA 4IDFA 3VNRA 4BVBA 1XRLA 3BKWA 2CL7X 3QXGA 1TW3A 2R8RA 1LTHR 4GR5A 1DC8A 5H68A 1CS4C 4L2IB 2UUAB 3B3QA 1ZM2A 4LV8B 4ZAVA 4IXDA 1XVIA 3DOFA 2YJ6A 2W2XA 5K09A 3P2IA 5LWQA 3LWNA 5ALSA 4YY3B 2NUTA 5HGXA 4UNIA 1VKHA 4KQCA 2PHZA 3OT1A 5CT5A 3RU9A 4ON9A 1G9SA 1XRQA 5TGZA 4BNZA 3L7YA 5K8CA 4NZPA 5G4KA 5FDFA 4HO1X 4E1AA 4IUCS 3X43A 2JFPA 4ZTZB 2FN7A 3OPYB 4X94A 1IE3A 1S2MA 1BW9A 1GR1A 3A25A 3R3WA 2IU3A 4L5JA 4Q05A 4AJ1A 1WDMA 2PX4A 3TLGB 5BW5A 3GLFA 2B7LA 2B4TO 1J2TA 1M1NB 3E3MA 4J3NA 2A9KA 1V2HE 2CEAA 3CC8A 4PSUA 5E4TA 2R65A 4BNMA 3EHDA 1POXA 4KVGA 3RVNA 3WGMA 2HGZA 2G9RA 1X7HA 2GETA 4U9HS 4KRXA 3A1FA 1SD2A 2QGFA 2BBTA 3MF4A 4OM8A 4WY8A 4E6PA 1KFBB 2E3JA 3VHXB 4NXNB 4M89A 1N7GA 4MKFA 5GGXA 3DXXA 1NOIA 1CQJA 2AE1A 2P3LA 1LWOA 2DBRA 1VSBA 1WWKA 3EC2A 1T6BY 3L8GA 4GIBA 3EAFA 1JHYA 4KSYA 3T1TA 3AHDA 3P4UA 1PJCA 2J9ZB 3GLKA 3FGOA 2WM3A 3M70A 3GEGA 1L2TA 5LM3A 4X7RA 2AOUA 3HE3A 4DSOA 4J0HA 3OT5A 1U5CA 3AO0B 3SOZA 2ZSEA 3G6WA 3VV2A 3E5MA 4XUEA 4C6TB 3HXTA 2WIDA 6ADHA 4KREA 1PK9A 4L51A 2BFWA 2JGJA 6REQA 3AP3A 2FOXA 4AJ4A 2D1SA 5FH9A 1O77A 1ZVQA 5DT2A 1Z82A 1I0IA 4W7SA 3VYWA 5HP4A 3W6NA 3OF3A 2PXAA 4CEHA 3MCZA 5TQ0A 4C76A 2UXDB 2HZBA 2VHXA 1NI5A 2FVXA 5EUBA 5ARBA 2XE6A 3E9ZA 1FJ2A 2G0AA 4Y1EA 4I8XA 5L8VA 4O4HA 4TXNA 3NHAA 2ZRHA 1Q7CA 4I4CA 2VTEA 4TSKA 1C0IA 1M2NA 2CLHB 2IEZA 1DKUA 4BNTA 1VHTA 2RBKA 2QI9C 3R7NA 3ID6C 3ABOB 1KYXA 4UJ3A 1HFEL 3E5RA 2H2FA 3SBXA 1A50B 1MMFB 5EWLA 1KH2A 2BLNA 4XVHA 1X7WB 4MS4B 1A1SA 3K31A 5TQJA 2VZ0A 4NKRA 3WHLA 3IOBA 2HDWA 1CF4A 1JEQB 1EGVB 5JDIA 4CGYA 1OLOA 1BE1A 1ZH6A 3OU7A 3S2UA 1U8UA 4RJKA 5JUWA 2WU1A 2APJA 4FZJA 2FF7A 2F55A 3WWPA 4X64B 4DNFA 2I3AA 4G0VA 5F5LA 4UCFA 2AE2A 3C0KA 2JLZA 1TF7A 5ELLA 2RAFA 1CYEA 3C16C 4OQFA 2ZBVA 3EUAA 3OVMA 3KBOA 4GPBA 5EJ4A 1PQ4A 1E32A 3IC5A 3LGSA 1OFGA 3KQSA 1K5PA 4QGAA 1V5IA 3CPJB 4REQA 3AVOA 3RSLA 3IMFA 3HRHA 4MA5A 1LNQA 5KNDD 3L40A 4OX9Y 2VT2A 4H0FA 2QLNA 4JI6B 5LU9A 3K6SB 4D57A 3M9WA 2H1OA 2H0AA 5TB5A 1VG1A 1XTJA 1F60A 4DDMA 1G59A 3IVCA 4IFTA 3ESZA 3TH5A 3U1VA 1XN4A 1DXYA 4GEKA 4IQGA 4U2DA 3WY9A 5KU1A 5KX5A 1WNFA 1JU3A 1M1ZA 2Y99A 1Y8RA 3HI6A 4E1VA 1XVLA 1MH9A 2WF7A 4NDAA 4PM4A 3TW8A 5JSZA 1XAIA 3K0SA 4DA4A 2ZUVA 4R01A 4BVGA 1UC4B 2JIMA 4K9DA 1NASA 2YRFA 1IL0A 4PX9A 2R66A 4ZOLF 4C88A 2VHYA 4J0KA 4F6LA 5CB4B 1OYOA 3GFQA 3OC6A 4UVGA 1S3GA 1R3DA 4PYNA 1AO3A 4U7TB 2R4TA 3NOQA 1F38A 3GFFA 5KCMA 3OFJA 1QYXA 3R7WA 4COKA 2P6PA 1KF0A 2LVBA 1WDTA 1ZZGA 2X2OA 5FBQB 3GZNB 2JGIA 3OLZA 5D87A 3WGTA 4PNEA 2X4DA 5B57C 5KTYA 4KN6A 3FCYA 2HKIA 4F8JA 3AEYA 4LZOA 3T7SA 4GRIA 4DM4A 4ZCSA 3SCZA 1Q14A 2MSCB 1AT1A 1UKBA 2G08A 3NEAA 1DOZA 2GCOA 2HSDA 5FLXA 1QTQA 3RREA 3LE8A 1Z8DA 2JBAA 3MTQA 1ST3A 1BE0A 2D7CA 2IVFA 4RHFA 2B6NA 2AZXA 2FPSA 4LXUA 4PEVA 4YBRA 3FKSD 1AE1A 1E2QA 1JXAA 4IDGA 3S4YA 2V1UA 4RZ2A 4W9NA 1LZKA 2PH7A 621PA 2PIDA 5JPDA 4GOJA 2RGRA 2HK6A 3BGIA 2JHFA 3D3JA 2DXIA 4DRXB 1V6CA 2ACKA 2PZLA 5HOQA 2XGSA 4PSAA 1BROA 1L4GA 2EBHX 3A9TA 3EWAA 3QVXA 4JR0A 3UH0A 3KL4A 3ZHCA 2FY8A 3OZAA 5C8DA 5JVDA 4WPGA 1TYBE 1YRBA 4ZRDA 2C0PA 3O7MA 4BQNA 3I4CA 4DLVA 1FSGA 1BCSB 4U2EA 5J9FA 5HCIA 2QLBA 3AOGA 3T41A 2O8BA 3TD9A 1H23A 1N3LA 4TSFD 4ZJPA 4NECA 4B44A 2OQRA 1FUUA 4FMCB 4PLPA 3RIHA 3WWYA 4MW2A 2VPQA 3MUNA 3ZWWA 2W37A 1R8YA 2J46A 1QNLA 2ZATA 4P3KA 3JYOA 4AZVA 1E3LA 3RS9A 3HPRA 3FB1A 2JGNA 2NXJA 2CHEA 2FEXA 1FTNA 3GUCA 1C0KA 1TVKB 3WQSB 1HE2A 3IOMA 2JK0A 4NF2A 4FZ5A 4EYKA 3PSHA 3H2GA 2I1VB 2R6CA 4RXUA 2RGUA 1Z2AA 5EQDA 4BKPA 2QTCA 3THYA 2P9BA 4U5QA 1EXWA 3THSA 3RC8A 1TT7A 4BVLA 1CJSA 1KOFA 2DM6A 1U3CA 4RORA 1L7DA 3RC2A 3KFLA 3UC5A 1HOTA 2GEUA 2IK8A 3MFQA 1S3IA 4MVWA 4Q9KA 3S2FA 1Q91A 4RJIA 1QVRA 2JLVA 2VH1A 3SI7A 1R0SA 4Z0HO 1X7GA 1IN8A 3P0HA 2GXQA 4Q02A 5CFLA 4LZZA 1P77A 2P3OA 2JAUA 4E3ZA 2HI0A 2YWGA 1E98A 5EKTA 3ZJVA 3KYDB 3QYPA 4BKOA 2HMUA 4OLBA 2PMKA 4L6IA 3LVFO 4PW0A 4ZI7A 2JGKA 3H17A 2CNOA 1VHJA 3M7IA 1DL5A 3OIYA 4V3CA 4KODA 2X14A 1DGQA 1JDJA 4MCJA 4OB7A 3A9CA 3MCVA 5KEIA 4G5QA 1AHNA 4RPLA 2ZSBA 3BB3A 2I91A 3EDQA 4RDXA 3P26A 2FZLA 4NI5A 3FVVA 4Q7LA 4QT0A 4KE6A 4ZAXA 1G8HA 2C3MA 1PLKA 3C8MA 1T4CB 3NDJA 4UDYX 1YCHA 4BO0A 2J9XB 2Q45A 3QVMA 1E2IA 3D7LA 1HEUA 2AD1A 2JEZA 2JFGA 3NBKA 4MI6A 3ZWKA 3GLIB 2NSYA 4UEOA 4K87A 1ICEA 1SZCA 2HX1A 4AMUA 2FG5A 3WLKX 4ZYLA 4H2DA 3AVUA 3QGMA 1IZ9A 2NM0A 4KQEA 4OL9A 5KAMA 4LJAA 4R7GA 4B87A 3T9BA 1K7XB 1B1CA 3B6ZA 4LYDA 5JWOA 2A6PA 4L3VA 2LD4A 2VJCA 4PRYA 1L5GB 4BKQA 4LF9B 1CVRA 1VBKA 4UU0A 4MWSA 1KVUA 5E0OA 3PGKA 1TEXA 1XTZA 5IJ0B 1O97C 3I32A 5C35A 1HKUA 4C07A 3G8DA 3G1UA 3GDGA 3ZDCA 1PWYE 1RXIA 3F47A 4FHDA 5FHQA 1QG0A 1PF7E 1QR2A 2IUTA 2YWBA 3IBGA 3KUKA 4H7KA 4JITA 4JNCA 4KH1A 3MLAA 3ZIDA 4A6XA 4PLFA 3ZGNA 4ENTA 3MXOA 3VOSA 2R84A 1S7GA 5CH3A 3W4IA 3TTVA 4AF6A 3OZGA 1E89A 3AJDA 3LIIA 4ZCMA 4FJ0A 5DJ5A 2H92A 1MEOA 3TZHA 1Z18A 4AZ0B 1MN6A 3ILHA 4EENA 3QOYA 3IP3A 1ONBA 4MP3A 5CT4A 3EGVA 2D5LA 4W5JA 3V3KA 2VQDA 2P6NA 2J0VA 3BL8A 1AQ6A 3FKSA 4WUTA 2WPNA 8GPBA 4AWXA 1JW9B 4LHZA 5IMBA 1SY7A 1HNZB 3H18A 4H17A 3AG6A 4I1SA 3QQPA 4LCEA 4RF2A 4RIIA 3RASA 3F9IA 1AV6A 2BOVA 3RCBA 1FMLA 1UPBA 1QV9A 4YP7A 4HWOA 4A16A 3HBFA 4XASA 3T3NA 2HA5A 1IB0A 2Z5GA 1O8BA 3LWBA 1U7OA 3L7KA 1NMEA 3PJGA 4PHGA 4QQKA 4UM5A 5ANRB 4HNTA 1V48A 1JR3D 4MITA 3Q3CA 1ZJ4A 3W5SA 5E9QA 4D81A 1SUSA 3ONDA 1Y8CA 3WK6A 1HYBA 5H4HA 4GDFA 2VWQA 2WC1A 4JUAA 3WG9A 1QHYA 2RGGA 5JCOC 2HRRA 1MB2A 3LX8A 3IQGX 3R4VA 1HMPA 3CMMA 3UWMA 3SBEA 1MZPA 4RVFA 1KDPA 4LNHA 4CKEB 1OJ7A 2BMFA 1B8NA 2QR2A 3O95A 4AMGA 5F7OA 1IWOA 1I4TD 2B98A 4TSRA 2R751 3ZCUA 4EPTA 3PI7A 4R2LA 1WOMA 1P0FA 2V6JA 2ZWVA 1YDHA 2V6GA 1E1YA 3FUCA 2GN9A 1EFTA 1ZIXA 2VQ6A 2X19A 4MYSA 4P6VF 4YTEA 1BH2A 1DJNA 2CWDA 3TQIA 4EUKA 3RT1A 3RVPA 2H5JA 1ZMBA 4HQNA 3VAZA 1WMFA 3UJ3X 3L4EA 4MB0A 2G4LA 4MGKR 3RVRA 1M2EA 3I0MA 3ETGA 3ONWA 5JZBA 4W1SA 3QZUA 2CYAA 3ABZA 4HNAB 2JI9A 5DM0A 2M6LA 1W4ZA 4Q4JB 3O4VA 5CDFA 2OV1A 3F71A 4CF3A 4NYIQ 3RPEA 4B6SA 5L3VA 2SHKA 1SXQA 2QJTA 4U8HA 3M6MD 2WWWA 1RYHA 4JOCA 3UJDA 2RH5A 4E7PA 1JQDA 1IZ8A 1WLYA 3I01M 2VWGA 3TOZA 2L82A 3UQZA 2AN5A 3PC4A 4XZ3A 4A27A 2B3TA 4B80A 3V42A 4WCFB 1PX2A 4HQLA 4RY2A 121PA 4A5SA 5CRIA 1JXOA 1H5NA 4EGQA 1JGTA 4BFVA 4H7JA 4HH0A 4OOEA 2I8LA 3E27A 3FOWA 2PR7A 3L8CA 3V8VA 3FTFA 4LTDA 4Q9AA 1SVSA 1CY2A 1OFUX 1SQ6A 2FH5B 5J2TB 3HB4X 1AC5A 1ECFA 4TXLA 5MN6A 5EEGA 2I2FA 4OXRA 4U63A 4YS6A 1MT3A 3FZEA 3I04A 2ZRKA 1IJFA 1JG2A 1GGHA 2FN4A 2G70A 2YR0A 1RQXA 4JNKA 4MGYR 5DBGA 4RU1A 5REQB 4HDRB 1V43A 1TQ4A 3C87A 3M3DA 3W8NA 2P91A 3BHMA 3WWEA 2R68A 4G8JA 3ORYA 1ZR2A 1E4VA 1K75A 2ZPTX 4FYWA 1Z8NA 1FFEA 1QVZA 3I5MA 4H1VA 2ZB2A 4QNNA 4FD2A 4W5WA 1X0VA 5C80A 5KC9A 4YRQA 4LPSA 4CVNA 4AS1A 4XX0A 2V9PA 1LDBA 3EY4A 3FMFA 4ZT7A 3SOOA 1C9JA 3AR6A 2PRZA 3KELA 4J0IA 3WKBA 1DV2A 3AFOA 3GIWA 2SECE 2Z4TA 2REQA 3TQQA 2AJDA 1RWOA 3R9WA 6NULA 2YBEA 2RG1A 1MKYA 3B9BA 2WNIA 3AVPA 3CNQS 3P2YA 4EF4A 3DCIA 3V55A 3MLBA 1E7SA 1UP4A 3UG7A 3FFBA 3M1LA 2BZSA 5FNVB 3I6QA 2XVZA 3EIWA 4U02A 1WBJB 3RRZA 2XXAA 1NKVA 2VHUA 2A1TS 3CX6A 2WAMA 4DT1B 5CA0B 3TLAA 2DB3A 1JHUA 1LCIA 4DV2B 2I1WA 3SU8A 4GL2A 2E18A 4MR8A 2OXIA 2JIRA 1C0EA 2P6UA 1G4HA 2R60A 3QUSA 1GA1A 1C8LA 3Q2IA 3MYYA 3FMVA 3MJCA 1JR6A 1MVNA 3TSWA 1JNXX 1U1IA 1XHFA 4R4JA 2RJNA 3AZOA 4ENVA 3QKSB 1K2VN 4V1CA 5LFAA 3ENWA 1BG6A 2IHJA 2AC7A 1NXVA 4EG7A 1PTKA 4WH0A 3RANA 3ANMA 3O92A 4RBNA 4YAGA 5BY2A 5EKDA 4B17A 1NQ5A 3BD7A 2QV7A 5D5HA 1KPIA 3W1VA 1ORRA 5A4IS 2LCIA 1XLTA 3ZEAA 1JR3A 3BMOA 3U4IA 4QDZA 3K2QA 5CYOA 4JI5B 3AEKB 3HADA 2OFXA 3LTNC 1K2WA 2AZMA 2KS6A 2G06A 4J0EA 3OOYA 2CUNA 2G71A 3C7TA 5JNVA 4RELA 4YVFA 4AJIA 1FSZA 2Q6TA 4II2A 3PWKA 5TNXA 1Z4NA 5D3KA 4RVOA 2AV6A 1W96A 3OZSA 3VMMA 5JSFA 4I9HA 5DW0A 4DWOA 2FOIA 1D2CA 1XQ1A 5NULA 4FYJA 3WLQA 4EZIA 3P2EA 2YNMA 1LPMA 4H1UA 4RTNA 4RTJA 4YLGA 2JH8A 1N2CA 2Q5IA 2PRJA 4HXYA 1YRAA 4QJBA 4TV8A 2QE6A 4IOKA 4OA8A 4I4LA 5CLQA 4F97A 3VU9B 4EG8A 3GR6A 4PO3X 1IM8A 3TQHA 4DABA 4WINA 1E9CA 1X9GA 3E5HA 3LP8A 1ST2A 2PLRA 1L5NA 2F3QA 5G3YA 1AQYA 2K7FA 1VPWA 4ZXFA 4CMHA 2PO7A 2O4CA 3A1DA 4OQPA 5TVGA 3B1JA 3HPQA 2VXBA 3I9OA 1TVCA 4XJVA 1ZGZA 4Q16A 3CKMA 1VE6A 1JDBB 4CM9D 2XBUA 1V9CA 5CFPA 3QYJA 1MCZA 2J5RA 3SFTA 3T7KA 4Z7NB 1MNAA 2C5FA 2I1QA 4JUFA 2UDPA 2JIPA 1PJ4A 1OTHA 4BJ1A 5BUZA 3O8CA 1ZGCA 4NYMR 4NNJA 4G4JA 2OESA 3LCJA 5HYVA 3RJTA 2W5UA 1K6EA 3L79A 2WEKA 4HZUB 3PHHA 1XCPA 2EX1A 2SNIE 5ECGC 3B9PA 2GPSA 1ML3A 1SB9A 1U0HC 3E7WA 1OVMA 2PLWA 1BDJA 1OFVA 4OYYA 3NVAA 4P7BA 3R0ZA 4C30A 5JMTA 2P0AA 2AT1A 3ILXA 3QU7A 2FI1A 1ISGA 5IXYA 3ANTA 3MCAA 1Q20A 1T5DX 4FFLA 4FOLA 4NP6A 3M6IA 4X90A 4Y0AA 4XJXA 1VCNA 2VHQA 5EIBC 5IH7A 1TYAE 4IEIA 4OQLA 4R7ZA 1X7XA 5A62A 4X65B 3LL7A 5ALWA 4U7DA 1RE1A 1UMDB 1V9LA 5CT9A 3TZ6A 1FMFA 2AFVA 2O07A 4OHCA 2HHAA 2DE0X 1XCGB 1N0HA 2BAGA 2LRHA 3C85A 4ERNA 5DGCA 1IHXA 4YUAA 3W2IA 4GBMA 3TZLA 1A5ZA 2WKSA 2Y1FA 3BXHA 4FHCA 2EF0A 1L9XA 4K6CA 2JLXA 2XUAA 2OO5C 1U2EA 2YCLA 3QBTA 5EZ6B 3MAAC 3ZXIA 2ZR0A 2HCBA 2B1GA 5HOEA 1AF4A 4O1HA 1IUNA 2O57A 1UQUA 2AQKA 2C7RA 2X9VA 2B2NA 2HF8A 3O3NB 4EPYA 1Q3HA 4JL6A 1USWA 1AB5A 2ATCA 3ZUPA 4YPFA 1SRQA 4QRHA 5TDHA 5DHRA 3ZE6A 1P18A 1ZC4A 4ZQBA 3X1MA 3L6OO 2FLVA 1DXOA 1WCIB 2FKNA 4X24A 3TW6A 1XJWA 4HUQA 4CKWA 1KTIA 2PUCA 3AVQA 2I2CA 4C29A 1RIIA 2IUYA 1FIUA 1JVNA 3PF9A 4FBMA 3QEAZ 3FPCA 3DPIA 2VJDA 4HAOA 1KSHA 5ERGB 2IHBA 3DVAA 2B34A 3E18A 4V0SA 1QQAA 4UMVA 2FSGA 2ZUDA 4G5FA 5B3AA 3BIOA 3EZNA 4OQMA 5KYKA 3HR4A 4JLJA 2YZ2A 1M1YB 1WUJS 1V1MB 2G9UA 4MUHA 5FR2A 5LDGA 5JTUA 3C24A 4RNDB 3FI0A 1RI2A 5HR5A 5F23A 2O6HA 1BWQA 4R9VA 1DHRA 4UOEA 4ILKA 2KE5A 1ID1A 1YZFA 1ZGHA 4JGGA 3BE8A 1H4VB 4GLJA 4PHFA 3GN1A 1Z5GA 2AQ8A 4TWBA 2NLOA 1WMSA 4TKUB 4RK0A 3RS0A 4Q1AA 5EXSA 1PT8A 1U7UA 2XMZA 1Y7PA 3QELB 1MD9A 2IYOA 2Q46A 2XTAA 3LPNA 2P2SA 4BNJA 4LGCA 2Q0HA 2XVMA 3EPLA 4NU0A 3DD1A 4CDNA 2PT5A 3IP6A 1JIJA 3GUZA 4GPEA 4QT4A 3G9TA 1JKJA 3BB4A 3A4MA 4RIEA 3EA5A 1N0IA 4KWHA 4MWCA 4GNKA 1B8PA 3OT4A 2EGUA 2AHOA 3DMYA 1D09A 1A2QA 1T1IA 2RHLA 3GDOA 3ZWDA 5FJIA 1Y1LA 3PC6A 1YL5A 2H17A 3A3NA 4D02A 3ELUA 1PT7A 4LXXA 5T3YA 5BMVB 1XTTA 5GTDA 3I5UA 1I3KA 1O1YA 1U7HA 3PZBA 4OXKA 4M99A 3JALB 4PSVA 1F8FA 4E14A 4OYRA 3SF8B 1GNPA 1RI3A 1YR6A 1AHHA 3I9JA 4KLZA 4JFRA 4WERA 3I6ZA 1XZFA 3IV7A 4QJ4A 2JH9A 2EFHB 1QFXA 2JLAA 1R0RE 1LLFA 4IIJF 2D6FA 1E20A 1NV9A 3KB6A 1SCBA 3DL2A 4DPKA 3PEVA 5IZCC 4UNRA 1YVDA 3RU7A 1WP4A 1KDOA 3JATB 4RXMA 3PFFA 1DRKA 5AW0A 1OLSB 3PUXA 3TF5A 3VVLA 1GP2A 2H06A 2QUJA 2LPMA 5DSXA 2V6MA 1KC3A 2DYKA 1XCMA 3ZU5A 4G8BA 3MS7A 1Z0KA 5CVJA 3IO5A 3REGA 3ZY5A 1MENA 2IU4A 4HGOA 5MN5A 2ZWMA 1NDHA 1YDWA 1CULC 3FFAA 4GBED 4OP1A 4EW1A 1HC7A 5DX8A 5J2UB 4QYTA 1KNQA 1NVGA 3NIWA 3V1MA 1KFEB 2IY8A 4JJIA 2HDNB 4KQJA 2C00A 4ZVOA 1PDOA 5DXFA 4FEEA 5BQ3A 3PNSA 4J3JA 4U7JA 1Z29A 2GTPA 3QJ5A 3FJOA 5AM2A 1R3UA 1EKXA 9ABPA 5LXTB 1R27A 2J41A 2JLQA 1MAVA 1CUSA 1HOXA 2IHYA 4ZKEA 1HDCA 1TQ8A 4BNHA 1DEXA 2HRBA 1OFTA 1EK5A 1ZICA 3ESXA 4LWPA 3URMA 5IYZB 4RWZA 3HR7A 3L0IB 5C2JB 4MVJE 2A59A 3I28A 5B6JA 1MJ5A 1DP4A 3CCFA 1BXGB 1TVEA 2JJ2D 1M2OA 3PI6A 4E5KA 2JI8A 1QIIA 3PPWA 2C7VA 1JFRA 1FU8A 2R8PA 1GCOA 2AG1A 1OFHA 1J1ZA 3IJ5A 3DBOB 4N0MA 4NZ9A 4BRWA 1BOOA 3N28A 4LC1A 1XQXA 4MROA 5JH7F 2WJGA 1NOKA 2VNHA 4PZ9A 1P2TA 1UODA 1T6NA 4CKBB 3ET4A 1JHDA 5KSOA 4BBAA 4KXMA 4AZSA 4NRDA 1YHYA 2QXYA 4H7DA 5EMMA 2Q6IA 4IH4A 3RBVA 2E5LB 5K8VA 4DIEA 3QX8A 3E23A 4BKMA 2BGLA 3ER8A 3QEJA 3I61A 2MYNA 5KKNB 4M0KA 2V7GA 4MZDA 1WB4A 2J5BA 2QP4A 4UCXA 4YECA 4IAOA 2A5DA 3CNHA 4RC9A 2ZYWX 2EZUA 1NLUA 5AK0A 4N7RA 2P9QA 2XVAA 4Q7KA 5L53A 3G0HA 2NZYA 3U60B 1MO5A 4HNQA 2DLCX 3CF0A 3Q6IA 1PFVA 4XDGA 4DCPA 4BO8A 4IDOA 2DKFA 4MARA 4HX5A 1WUKS 2WFAA 3OWXA 4D6YA 4IHJA 1VGRA 3DB2A 4JD5A 4HGQA 2C88A 3PGMA 5CR9A 3SHFA 1BMTA 4M9XA 2B20A 4Q66C 3H8SA 3GLRA 3H7IA 5AM3A 5THKA 1K9SA 1BXKA 1MQSA 1QQ7A 2ZRIA 3IKLA 4WKBA 2EP8A 3CONA 4M0DA 2OZLB 2ZUWA 1NMXA 2DTDA 3HXKA 3NHYA 2DVMA 4NDNE 4AWAA 1LD3A 3Q6MA 5KX5F 1CUWA 3GUUA 1TM3E 2XYHA 1K7CA 4JC0A 2XTMA 3G0OA 4G84A 4K2AA 4UULA 1PSDA 3CLUC 4TWZA 4DXAA 3A6LA 1W4BA 3PPIA 1AKEA 1RABA 3EQ7A 3WYCA 5IU6A 4B3SB 5HHTA 1PNOA 2QUIA 1IWBB 1KGSA 4HJXA 4R1OA 2ZRFA 5CURA 5EA2A 4CF6A 4J2TA 3ZD6A 1M7BA 3GRYA 4B8ZA 4V0LA 5EE1A 4F5EA 4C22A 2O2DA 3IAS1 4DXHA 3KIPA 1DADA 2Q3EA 4EFNA 1E6MA 3PGXA 2VK8A 5L3QA 2H9IA 1JI3A 2IH4A 1FW6A 1TCVA 3X3HA 1QS0B 1M8PA 1T9GS 3EAQA 2HBQA 4NE7A 1IXZA 4UVHA 5K51A 1U04A 1I24A 1FNMA 3E81A 3NM6B 2X5XA 1KEKA 2IS1A 1V4NA 3K2EA 1G8YA 2OK8A 1Z06A 2CWWA 1CDEA 4E32A 4YV0A 4TYYA 1P7YA 3ICEA 1DQPA 1X7DA 1YB4A 5M2QA 4NOKA 2YV4A 2UVPA 2VCYA 3EMDA 1S3FA 3IB6A 3KTDA 2PAAA 1XZHA 1P0CA 3ZHXA 4P93A 1EK0A 1W1UA 2W6QA 3B5JA 2C7GA 1E1LA 1ZIOA 1WB6A 2WRZA 2Q0QA 3EZ6A 2NZWA 2X1VA 1KE1A 2VOJA 2PLNA 3U2QA 4A2QA 3LXMA 1PK7A 2YOHA 4Z9FA 4WDQA 1ISPA 1WPQA 2VRWA 2ZXEA 2IDMA 4IV8A 5A3RA 1CD5A 3FLAA 2XUGA 3UUGA 1KY5A 2QGZA 1G3UA 2B6HA 2J3LA 4F9TA 1J07A 3WOVA 1B26A 1WA5A 4FOSA 4BU0A 3H2YA 3QUQA 2NUBA 3L5KA 2UZ3A 3BGOS 4GX5A 1FYFA 3UMSA 3KOZA 2PVPA 1E79D 1KAMA 2NTEA 4K8OA 5EZYA 5AVSA 1WB5A 2FWIA 3FE2A 3WQQA 3WGIA 2LR0A 5KWJA 3L9WA 2WV7A 1N2HA 3T99A 1JAXA 2CFOA 4HB0A 4DG5A 2WTNA 2A5FA 3JAWA 1UPFA 1BX3A 1C0PA 2C4KA 4XJTA 5BWLA 5J4VA 2JJ2A 1HFWA 2N1BA 1U3WA 3MJVA 2OHHA 2GHQA 4A0HA 2J0UA 3HU5A 3MBIA 5ESRA 3HJFA 4F3CA 1K6XA 1SXHA 5EP4A 3BCUA 4CPDA 1U2PA 2AX3A 2BEJA 1UMCB 4N01A 3U7QB 4B4UA 3T3GA 4FFDA 2QL6A 2R6AA 2HIGA 5AXBA 1UBUS 4MRNA 3BRWD 2C42A 4Y9RA 2BBOA 1K8XB 3KPUA 4ZVKA 3SYLA 1XD2A 5T8KC 3HA5A 3CPEA 4N0DA 2O5CA 3GGGA 3DTNA 2QUHA 1PVOA 1U1CA 4I2VA 4RHCA 4DR1B 2JL1A 4B7AA 4Y2SA 2BGUA 4EHJA 4U7PB 3F97A 1NBME 3RVOA 4CU5A 4M36A 5KDDA 4YXFA 1ZUD1 1VSTA 1WCV1 1A9QA 1Y1SA 2BMWA 3FWKA 2EQBA 2EEPA 3CUTA 3HFJA 3OESA 4JLOA 4NAUA 5HX7A 2GZAA 2EAUA 2AVDA 2XXBA 2Z04A 3DOOA 3JYLA 4N5MA 4ZI7F 5AVJA 3FFXA 3H83A 5TY0A 2WWHA 4DMHA 1Y4AE 3KT6A 3TIFA 4EHAA 5FUWA 4CQLA 1YAJA 2H48A 4C3VA 1O03A 4KAXA 3I9LA 4XYGA 4PG6A 2R8YA 1WY5A 4GE3A 4A9AA 3W6OA 1D4OA 2ORVA 4B2LA 1VC2A 1V11B 2P2GA 1WPRA 1K8YB 1E60A 3IIKA 5A0TA 2V5VA 1XT6A 5L51A 1G19A 3CNBA 5A5GA 4KV9A 4CQMA 3SXPA 3L7IA 2W2QA 1VYHA 2YHAA 3IKTA 3VKGA 2J1LA 3QPAA 4HJRA 4Y9TA 5KINB 1XZCA 4D7AA 3QXHA 2ZRGA 2ECOA 1G5FA 4KBYA 1YDEA 4G07A 3GDWA 1DDIA 2ZBPA 3MERA 4JBGA 1KGDA 5IWAB 1H2FA 3UFBA 1ML4A 3FNEA 4QTZA 3ZK9A 2FSIA 3L46A 4PX2A 5DB4A 4JWKA 3ZZMA 4BBJA 5IK2D 4GR4A 1O97D 4OUDB 2ZJAA 4G9EA 4IDPA 3IE1A 2GJAA 1A77A 4Q93A 3UYKA 2GXSA 5EUMA 3EEQA 2BIFA 3DDUA 1Z2DA 4CMEA 1LF0A 4LK3A 5BXQC 2VTBA 3TPZA 3GA0A 4D9JA 4RVNA 3CY6A 3R3HA 1FFXA 3AF0A 5AHWA 2IOHA 5E1BA 1YQUA 3V8RA 3Q7RA 1ACJA 1E9EA 4LY0A 4OU4A 1F7VA 4K46A 4O4LB 3N74A 1UBGA 2O8DA 3ZWXA 2BM1A 2OGTA 1HFKA 2INGX 3JD3A 3NJ8A 2QTHA 3K9HA 1VHLA 2HXYA 3M4YA 4JUBA 2AJ8A 3ND9A 5DF1A 2NO6A 3IHTA 3S70A 3JQPA 1I13A 2O3TA 4DWVA 3IUEA 5JDCC 4EHNA 3DO5A 1RRGA 3G17A 1DBIA 1KI1A 5A4DA 1FVXA 1LI7A 4RK6A 4ZCPA 1BDMA 3GCZA 4JQCA 5LBTA 3D9QX 5KYWA 4TM7A 3E9NA 3UANA 5A2QA 1I9CA 4JBIA 2VT7A 5I4IA 3W4JA 4OXQA 4F6CA 1ULHA 2B8TA 3L0YA 1E79A 2NU8A 2UYHA 3G7NA 3INYA 4PO9A 2A30A 1U2ZA 2GA9A 3OTOB 1XTKA 3DYIA 2J7KA 3RC1A 3L1VA 3IA7A 2Q2OA 1MC5A 5ALRA 3ZOKA 3ZE1B 2EKPA 5JV5A 2E49A 5JZVA 1F2VA 3PE4A 2YX1A 2WWYA 4NR0A 3I1FA 5KVQA 5LQMA 4BTLA 1N92A 3EZXA 3UGKA 3IR5A 1O87A 4YRJA 5K0TA 5EFZA 5JXJA 1R4MB 2LE0A 1TVMA 2Z5VA 4IZHA 4R51A 2XOEA 2PGAA 2GPTA 2OPBA 3FNIA 1UINA 2XGGA 5AVXA 2GN1A 2Q2NA 4R6WA 5BWNA 1FQWA 3H13A 1T4DA 1XJQA 4QFBA 2VT6A 2FEOA 2OFFA 3ZTWA 1DT5A 5JCZA 4TRJA 3DULA 4BDTA 3TNLA 1FS6A 1D2AA 1T5TA 1VECA 2HM7A 5FLEX 2V7EA 2HC9A 3IVXA 1K63A 5BWOA 4KE9A 2ZETA 1VKNA 2O5RA 3QUBA 2G04A 5CB0A 5H59A 5JAZA 4L95C 4LMRA 1US8A 4AN4A 3LDHA 2WWFA 1UKYA 1XQYA 2QORA 2HQRA 3PWTA 3NT5A 2NV2B 2XMDA 3O5AA 3H0EA 5TMPA 5TPZD 3ULKA 4ZZ0A 4LYAA 1K7YA 3T94A 2PIAA 4MQEA 3AEQB 1OXXK 4KX5A 1COZA 1K89A 3FHJA 5CX1A 1A8PA 3LH5A 4KXVA 1U0BB 2A94A 1DB3A 1IVNA 4P22A 1TM1E 3SZUA 2UUOA 2WSIA 3CLVA 3D81A 1WF3A 2QRZA 3AHFA 1IN4A 3TOXA 2BLLA 3H5VA 3O4FA 4MLPA 3V3TA