2ZREA

Msreca q196n atpgs form iv
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
330
structure length
320
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 92
structure length 320
sequence length 330
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zreA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zreA01
1LV7A 2FG5A 4QGAA 5DN6A 3R9WA 4D26A 3K70B 3FTQA 1LFDB 5K8IA 1YR9A 2A2ZA 1IOZA 2EYQA 3ZZTA 3UG7A 5JZVA 3O8BA 4RZXA 1PLLA 2HYIC 1FQKA 4UXIA 1RE0A 1ZVQA 2GZDA 2ORWA 3BH0A 2QE7D 2OLJA 3N2IA 5GJWC 5B64A 4PZZA 5AUPB 3KQNA 4FXPA 4V03A 4QBGB 4D4MA 3UWKA 1XTSA 4ZKEA 1PUJA 2F43B 4JVMA 3NBZC 3T5DA 2UZIR 1NRJB 1SKYE 2Q3MA 2P67A 4OK6A 1CR0A 4NL4H 1GAJA 1UFQA 1YRBA 1M2OB 4GP6A 3GEEA 4IKEA 2J7PA 2VSFA 1AZTA 1N6KA 4HSEA 1NY6A 3BOSA 3B9QA 4PHTA 1A4RA 2ZE8A 2V7QA 2F1RA 2EFDB 1U94A 3PQCA 4Q7KA 3RSLA 1PZNA 1N5LA 5JRZA 1E9EA 1KI3A 3CRW1 2OUKA 4JJKA 4CEJB 3X1XA 4Z51A 2D4HA 3SJAA 3B7GA 2XTNA 2ZE5A 3T35A 4AD8A 1KK1A 4TYWA 3PG5A 5J5CA 4V0ME 2IWHA 1BO6A 3TJZA 4LV6A 1P60A 2V3CC 2OCPA 1CXZA 4G1UC 2CL6X 2ZJAA 2J0UA 1AN0A 1G9XA 2ZSFA 1RW4A 1XMIA 1R8QA 2O0JA 4OQXA 5D3MB 5FPTA 1KSHA 5JWOA 1NKSA 1VCOA 2D7CA 2ZI5A 2FF7A 2O8DA 3U60B 1VKJA 5L3RA 1WDTA 2GTPA 2G3YA 1T9HA 3IGFA 5CYOA 4U5XA 1XMVA 4QM7A 2GK7A 2RKOA 2DWQA 2WTUA 3I8SA 5JSZB 4AKIA 1XTIA 3KKOA 1Z5ZA 1UKZA 4BLQA 2O52A 1FNNA 4PO1A 3ND9A 3O8DA 4JL5A 3GJ5A 2GAOA 4TTRA 4AG6A 4DRZA 3LAWA 3FMOB 4U7DA 1G1MA 4S2EA 1OE0A 3EG5A 1ELOA 4MDEA 1ZCAA 5K8TA 3PVSA 3C4JA 1EFRD 3LLUA 3RNLA 1ZINA 4TYPA 2JLZA 1SVSA 2CL0X 2FMXA 2DFNA 2R2AA 4EIWA 4CT5A 2G88A 2ZRHA 2ZR7A 3QKSA 1XFAA 5J4HA 3EW9A 2IS1A 4LX0A 3IUYA 5B2ZA 2IF2A 5HTKA 1H8HD 5EUMA 2VHJA 4ZCLA 3GLHE 3VR3A 3VR5A 2G77B 2E1RA 1DOAA 3ONWA 4MRRA 4CVNA 3EZFA 2FPLA 4TQ9A 2ZEJA 2OCBA 3CF2A 1WCV1 3KFVA 1DAMA 1IY2A 1N6IA 2EFGA 5HCNA 4E03A 4QBIA 4BLRA 1M34E 4BEBA 1VYVA 4PC2A 2ZUDA 2EW1A 1XJCA 3L0SA 5EXPA 5K8UA 4LYFA 4FCWA 3MG9A 2ZI9A 4M9QA 2Z4SA 1FPMA 3V00A 1AM4D 1A2KC 4DWJA 1YZTA 4V0OA 2QP4A 1NIPA 4PC1A 1X86B 1Z06A 4RFVA 3SNHA 3ZQ6A 2PEZA 4PQRA 1D9XA 2NIPA 2ZRJA 3B9PA 1XNJA 4DSUA 4BRUA 1VDZA 1BH2A 5L8VA 4AYXA 4Z1MA 4AYTA 1XD2B 1MO3A 1N5IA 1C9KA 4PPQA 1OF1A 3FHTA 3CPHA 1S0UA 3AUXA 5IT5A 1YKSA 2CVHA 4B44A 1RRPA 5LPNA 3CH5A 3KDSE 1SHKA 1P3JA 3ZH9B 2BDTA 3U61B 4B32A 4D82A 4G0NA 4DCSA 2FSHA 5L3QA 2HXSA 1RJ9B 1TUIA 1DEKA 2HV8A 1MO6A 1L2TA 3L8ZA 4V0LA 4M2LA 3Q7PA 4M53A 3W9YA 4IDNA 2BBWA 2EYUA 2PLFA 3OEHD 4IDPA 1M1YE 1YZKA 5DYIA 2VHQA 2JLWA 4TZ6A 3K09A 3ADKA 3EPJA 4WXPA 2DHRA 2OBLA 2ZRIA 1IY0A 4KFSA 3TGPA 4NYMR 3UWOA 1KOFA 2WBLC 3GFPA 2GJ9A 5FTMA 3BWDD 4OI2A 3QIAA 2FH5B 3BB3A 5CB6A 5FUYA 2ERXA 5JS8A 1U8ZA 1G3IA 3K1JA 421PA 3BB4A 4JSYA 5KSOA 1JR3D 4QGHA 2PJZA 2NPFA 3TE6A 4UQOA 4XWAA 2GEDA 3LVRE 1FOEB 2H18A 4QKQA 3KQKA 3RYTC 3P32A 4ARZA 1A2BA 1R0XA 2ODNA 3I61A 1KDTA 4W5HA 4FI3C 5C4GB 1ZIPA 1Q22A 4DDVA 2ZS7A 1KKMA 2V7QD 1ESNA 2WIAA 4JS0A 4OHXA 4DIDA 3CRVA 4AKGA 1D6JA 4K46A 3LBHA 4TMTA 3RS4A 3ADCA 3EIEA 1MRNA 2C8VA 1G8PA 1XPUA 4MYTA 1W0KA 4XSHA 4DSNA 4P3YA 2RGDA 1NBMD 4A2WA 3EAQA 1LVGA 1CF4A 2KE5A 3AM1A 3X1DA 4F38A 5AJZA 4C30A 2GCPA 3NDBB 1EFTA 2IEZA 4JSTA 4AG5A 3MJRA 4FWIB 3AB3A 4C4PA 1FMJA 1RIFA 4JL6A 3IEUA 4Q19A 4A0FA 5BN4A 3RC8A 2R44A 5D3MA 1ZAKA 4NHOA 2D2FA 1GZSA 4WIAA 5D3QA 3AVPA 1XMSA 1VIYA 2IC5A 2ONKA 4H9GA 1E2KA 1SVKA 3BS4A 3BE4A 4RD2A 4MKIA 721PA 2AD5A 4PQFA 3EA5A 1W36B 1N6PA 4LWZA 3GLGA 2VP6A 4ACAA 1NMZA 2QN6A 3L0IB 2FFAA 2JJ8A 4Q4LA 3RANA 4A8JB 2ZI7A 4JVLA 2ZJ5A 2O8FA 1ZU4A 2KSQA 1P2TA 3HP1A 1KO7A 2QTHA 4CEHB 1U9IA 1YHNA 2J0UB 4LZZA 1AGPA 4C2UA 5FPSA 5JMTA 2FFQA 3QXXA 2XNSA 3WMEA 1NJFA 4DB2A 4HLCA 3TW8B 1VG9B 2B8TA 3FKSD 5IHPA 5DISB 1Z0DA 2VL7A 3LO5A 1N0VC 1R5NA 4Q5IA 1OPXA 4FD2A 3IQWA 2WSSA 1WQ1R 3CR7A 2PT5A 1HT2E 2XNDA 3ZD7A 1TQ2A 3WHLA 3KTAA 5FBVB 4RKEA 1HY3A 1UADA 5HPYB 3KJGA 4HAVA 3U3KA 2H1LA 4J0QA 5TARA 3FOZA 5DE3A 3RRNA 1FX0A 1J70A 2NPIA 3FFAA 2KBEA 4I81A 4KBGA 2HEIA 4LBWA 2ZETA 3KJHA 1F2UB 4GNKA 1FUKA 4KLNA 1E1RA 1HYQA 2GDJA 3QEOA 4TQAA 1KAOA 3U4QB 4JYCA 4O3MA 3NH9A 1MRSA 1Z6TA 2FGJA 2JA1A 2GWHA 1W4BA 1JPJA 1Z29A 4PC7A 3A1SA 3WNDA 1ZUIA 1W48A 2JDIA 3WNBA 1U98A 1AIPA 3QG5A 4AIIA 1G7RA 5TB5A 4LHVA 1WMSA 4ZDKA 1PUIA 1N6RA 1G4UR 4HDOB 2LCFA 3AP2A 4Z1MD 3SJCA 4ESVA 3VR2A 2V1UA 2ZSDA 3D8BA 3U4QA 3FGNA 2FV8A 2P5TB 4GBMA 4TQUS 5H70A 5FR1A 3GLGB 1ONBA 3KQHA 4R9UC 1G8YA 1UPTA 4AK9A 1PVOA 2YVUA 3TUJC 5ELXA 3RC3A 5C2JB 4KCGA 3WBKA 4RFSA 4TL7A 1OXTA 1UF9A 4IRUB 1Q3TA 4MGYR 4LOAA 1HEIA 1LF0A 1OYWA 3B1ZA 2IYXA 4IVQA 2RHDA 4IOKA 2YV5A 1U0LA 1ZNWA 2GJAA 3K9NA 4B75A 1GUAA 4EUNA 3A58B 4GT1A 1Q12A 1YQTA 1XF9A 3PUZA 2JJ2A 3MWJA 1CEEA 2EQBA 1Z3IX 3UANA 4GZMA 4Z54A 4B2PA 3NBYC 1AK2A 1E2JA 1K5GA 2LKDA 4Q1DA 2GJSA 2W2VA 3M0EA 1I2DA 2BBSA 3OIWA 3ZYCA 2B6HA 5G53C 2QG6A 1DG1G 1E9RA 3B6EA 1D2EA 4UNRA 2CHVA 5EJEA 1TU3A 1JR3A 2H17A 4FMBB 2BBOA 2GZHA 5DO9A 2J3EA 3NKVA 4YMSA 4PR0A 2G0NA 3AKDA 3H84A 4OBEA 1X8JA 1CIPA 5DSZA 3HYTA 3GJ6A 3ZVMA 2QNRA 1G8HA 2Q9CA 4Q01A 3F5FA 1XZQA 4KVGA 4BZXA 5JHHB 3KKQA 3AVUA 3CNLA 1B23P 3LDAA 4DUGD 2OHFA 2Q6TA 2DWPA 3UK6A 2LWIA 4I4LA 1CJTC 1EWRA 1N25A 2RHMA 5CB8A 1NBMA 3T1TA 1X8LA 3NXSA 1E2QA 2C98A 1JEDA 4JLOA 1TNDA 4U02A 4NYMQ 2A5YB 4GMXA 1YRAA 2W83A 2X2EA 1XEFA 1GRRA 2I1VB 4CEIB 3AVYA 1QG2A 2BV3A 4ARZB 1RFLA 4BZPA 1IN6A 4N0DA 4O2RA 2A78A 2GBLA 1RC8A 4NYJQ 3QKUA 1G21E 3MGCA 1P61B 2ZYVX 1EWQA 1VHTA 3R7WA 3SDZA 2ONJA 4C7OA 2GA8A 3UIEA 4A0GA 4BPBA 1OHHA 1E9FA 1XJQA 3WXMA 1W7AA 2QMHA 3ZS9A 1P2SA 4WOPA 5DHFA 1FTSA 4RFSB 4PO9A 1VYTA 4I1VA 4KHZA 5EXSA 4RJLA 3ZGXA 3X1YA 1R2QA 3W3AA 2FZ4A 4LHYA 4HYYA 3VX4A 5CLQA 5EUQB 4HB3A 1SXJB 2O0HA 4UNQA 3FPAA 3VKHA 2IF0A 3GLHB 4PXAA 4K8OA 2HYDA 4HAZA 5KSZA 4V0NA 5C4MA 3AVQA 3FMFA 3OFND 3BFXA 4D2IA 2OXRA 1IXRC 3IQXA 1R10A 4DDWA 5KO2A 4Y0VA 3QXCA 5FBRB 1IN8A 2G1JA 3ICEA 2OZEA 1GRQA 1N0UA 5CDFA 5F2EA 4LJYA 2WJVA 5EP1A 1E1QD 2CXXA 2QA5A 2GCOA 3AKCA 2H5EA 1G7SA 3SYNA 4LJ8A 4PC6A 1FP6A 3EASA 4JLPA 3LWNA 3RS2A 2A30A 1M8PA 5EP2A 2J9RA 3GD7A 1OXVA 5FTJA 3E1SA 4TYYA 3L2OB 1LW7A 5KU1A 1XTJA 2GF9A 1QHYA 2R8RA 2J59A 3L82B 2DWOA 1DAHA 5HKKD 1HQYE 3HDTA 5G3YA 5DI9A 5JCZA 5DI3B 5FL7A 1MABB 1MOZA 1UJ2A 4JT2A 2CDNA 1KJYA 2QMOA 3DMNA 1PJRA 4OQFA 1XZPA 3QBTA 4AY2A 4P4TA 2EU8A 2BCJQ 1US8A 2JDID 3LW8A 2WWHA 4YXWA 2Y8EA 2RGNA 1HE8B 2VF7A 4BWYA 1A1VA 3B1YA 2JIZA 1CKEA 2ECKA 5HE9A 2HCJB 1NJGA 1XEWX 1CBUA 3BORA 1T0JB 1AZSC 2H57A 4IOLA 1Q1QA 3FB4A 2EFCB 4P0TA 4BFWA 1IXSB 1NLFA 4UNNA 1U2RA 2QT1A 4DHEA 2J87A 1VCMA 1OB2A 4DB4A 3SOPA 2W6JA 5FTLA 1J2JA 3KUDA 4CW7A 4MKHA 4PAOA 2CMKA 3QPWA 3ZVRA 1YR7A 4F93B 3B60A 2FU5C 1ZJ6A 2NO6A 3D31A 4JVNA 2BMFA 3RDPA 1NN3A 1Q1BA 2C04A 3QKRB 5CITA 1S8FA 2W6ID 3AF1A 2QSYA 3U3JA 2W2TA 1KO4A 3B1VA 4LUCA 1CJVC 3K0AB 5JJLA 4TTQA 5DN6D 1E3MA 3PENA 4EFNA 3JZAA 4LV8B 5FOUA 5A4JA 4KYIB 5JI2E 1E94E 2A9KA 4Q4AA 4ZDWA 2GK6A 4JBYA 2RAPA 2YOFA 5DIFA 5KPDA 2YWFA 5E95A 2YJTD 2WJHA 3B13B 1K5DA 4GOKA 1NMXA 2XOKA 5CK4A 5EXTA 4KFTA 1OXSC 4ZO4A 3SI7A 2SHKA 5KSPA 4LJ4A 2GETA 1US8B 2P65A 5BN3A 2FFBA 2ZI3A 4LJAA 4HLUA 2XB2A 3BD9A 2QMEA 1TEVA 4D80A 2P6NA 3HU2A 1I4DD 2QY9A 2V1XA 1G41A 4MYUA 2J0VA 4Q1BA 4KV9A 2WKRA 3OF5A 4M4SA 4N0EA 2REOA 4WAUA 1ZYUA 2Q3FA 1SVLA 1XBTA 3W8RA 3A1WA 3TR5A 1BS1A 4LYJA 4Q9KA 4OI1A 5DI3A 2ATVA 2J7KA 3CONA 4M0LA 5G3ZA 2KB0A 3Q7QA 1R5BA 4IFEA 4ZDIA 3U7GA 4PSKA 1E79D 1GKYA 2DB3A 1HA3A 2GCOB 2QT0A 2ZQ5A 1GNRA 2W0MA 4EPTA 2XZLA 4V02A 1YR6A 4X8LA 5SZHB 3MWLA 1CU1A 1FX0B 1ZRHA 4F4IA 3GJ8A 3W34A 2WOOA 5P21A 4ZIRB 1VCNA 4OI0A 3UXMA 3H1TA 1BMFD 1OH8A 2WWXA 5AJYA 1U0JA 3VNVA 1DAGA 2JCSA 2CJWA 4L9SA 1QVAA 2GXUA 3I5YA 3HU3A 1P9RA 1OHHD 3DMDA 4R98A 3TKLA 2O8BA 3N2EA 1U8YA 1KTVA 4F4JA 1S1MA 1KMHB 1S2MA 2C77A 4B2LA 1KMHA 1E2GA 3MLEA 1C4OA 1GFIA 1E2PA 1MR3F 1T5IA 2WJJA 4US1R 2VBCA 3ASYA 2OV2A 2OG2A 4TMZA 1TU4A 3CRRA 3GLHA 5FOWA 2JLYA 2R6DA 3KB1A 5CIQA 2MMGA 3EPHA 1EFRA 3RVBA 4P4SA 2IHBA 4URUR 4LJ5A 121PA 1KY3A 4XTCS 1X3SA 2OESA 1AA9A 4PQYA 1XCPA 4CRWB 2OFOA 1GDDA 2AXNA 3B1XA 4QJ3A 2ZXUA 1Z2CA 4NYIQ 3HU1A 2QORA 3CF6R 3CNNA 3QVVA 3U7HB 1RRGA 4PSAA 3RS3A 1TX4B 4CDGA 3OIVA 3SR0A 5FBQB 1CR1A 3NHBA 1KY2A 2NO1A 2PX0A 4DLUA 4GMDA 5LB4A 3W8NA 2Z83A 3O8CA 2RH5A 5KNDA 3MCAA 2Z5FA 3TAHA 3WMGA 4NU0A 3ADDA 2RMKA 4YDSA 2ZRGA 1W0JA 3PR1A 1W44A 4I1SA 1KHTA 4JLKA 4IXMA 1ODFA 1VCIA 5AUNB 2CHGA 3KZ1E 1KO5A 3QKRA 1GL7A 4GI7A 5E7IA 1G3RA 3LA6A 3ZJYA 4C0SA 1XCGB 2BOVA 1NVVR 4ERNA 3PITA 3MJHA 3QQ5A 3DOEA 3FVQA 1E2IA 3ASZA 3TSOA 3AP3A 1W2GA 2ZRNA 2BJVA 5HR5A 2HLDD 4MGKR 4C0JA 2CBZA 2IXGA 2I4IA 4BZQA 3ND8A 2WMNB 1NN0A 2VPPA 2YWEA 4NE2A 1DELA 4Q1CA 1COWD 3KFXA 2O8DB 1ETUA 1XEXB 3LXRA 3I32A 1Z0AA 2ZRAA 2O8EB 5TVKA 1N3BA 1KJWA 4HLUC 4KODA 4IJMA 2QL6A 4QXAA 2ZAMA 3V4RA 2H8KA 3EIHA 3MWKA 4KJZA 3NVAA 3I62A 1FNMA 2WOJA 3DPUA 2DFKB 4YC7A 4MGZR 4OYHA 1II8A 4TLCA 2R6AA 3EC2A 4OK3A 5B30A 4WVFA 4IDQA 1E96A 4DZZA 2ZU0C 5EE1A 1DAKA 2H16A 4AWXA 3NC0C 4HEJA 2NO7A 2OILA 4OJKA 3VQTA 3L8YA 4FMDF 5DH9A 3SQXA 2OBNA 1KAGA 3I1FA 4QL3A 3BXZA 2CJWB 3DO6A 1DVRA 2QAGA 2VEDA 2OXCA 2XOKD 4QNRA 3X1WA 4G5GA 4M1SA 4FN5A 3GLFE 2DR3A 4RZ2A 1V5WA 3CO5A 3AP1A 4EDHA 2HCBA 1GM5A 3O47A 1R7RA 3GLGE 2IS2A 1XCMA 3U44A 2WKPA 1NN5A 4G3XA 3CB4A 1B0UA 4TLDA 4B6FA 4UJ3A 2P6RA 2TMKA 3EIQA 3TW4A 2K5UA 5EP4A 4ZIRA 2RGAA 3DVLA 2NO9A 3H2YA 4JBWA 3A36A 1OFHA 5H8WA 4KVAA 2J5XA 1W5TA 4I99A 1ZM2A 1M6NA 1IJEA 1P62B 4LC1A 1FUUA 5FUXA 3IDQA 3K0FA 1W0KD 1KSGA 1U9IC 3W90A 2RGEA 1N2CE 4JLAA 3I3SR 3M4YA 2V54A 5C46F 4OHVA 2R65A 2GRJA 5GVSA 2QQ0A 1AQYA 4QRHA 4W5JA 1F3OA 2XX3A 3THXA 2YC2C 3DDCA 4BASA 3G0HA 1GTVA 3CF0A 4LYAA 1SXJD 1UBFA 3LVQE 4Y0AA 1QBKC 5LBIA 2IYZA 4RD3A 3RRYA 4F91B 2D7DA 2PLRA 5KSYA 1BMFA 4HZIA 2YZ2A 1OXUA 4B35A 1Z6GA 2ZS9A 1DARA 1KI9A 4M8NE 1NG9A 4LRWA 5SZKB 2O8CA 1L4UA 5TDHA 2FSIA 1YJ5A 3U2QA 1MH1A 1GKUB 2EFEB 4HB2A 2AFHE 4ON9A 4PAMA 4RVCA 5FPHA 5JFGA 1AKYA 4A6XA 2IT1A 5KNBA 4RCYA 1EX7A 1IHUA 2FSFA 4L5BA 3QENA 2IXEA 4ESHA 2GBLC 4TYQA 2ZREA 1S9DA 4XVQA 3WNCA 1NG1A 2QMUA 5FPYA 3PXGA 1VG1A 3CX7A 2QI9C 3IBGA 1ZIOA 3WMFA 2RGBA 1PV4A 2ZUCA 3MD0A 4POAA 2WMOB 1XXHB 3TSZA 2OCAA 1XXHA 2IYUA 1KI1A 3GQBA 1Q0UA 3BFKA 1BKDR 5B58C 1Z08A 4D25A 2ZI6A 3ZIAD 3EPLA 2FEOA 2JEOA 3R20A 3QY0A 1T5LA 5F3WB 2IHYA 3PEYA 1JR3E 4GDFA 4L9WA 3K9HA 1QHIA 3DKPA 1GKIA 2WSSD 5FI1B 1EESA 3EZ2A 1LNZA 2Z4RA 5A0FA 1P72A 1G3MA 4M1KA 1YR8A 2AK2A 3GJ4A 5EQTA 5DGXA 3KKMA 1T4GA 2AKAB 5FTKA 2X19A 1G3QA 4CT4B 4M1WA 3TUIC 2OAQ1 2WSMA 4LY6A 1XTRA 5AJWA 1IN5A 4MRVA 4YONB 4OKSA 4DLYA 2VSOA 2B92A 1YZUA 3HPRA 2NTYC 4JLMA 2QAGC 5JECA 1CS4C 2GEUA 1IM2A 5LB2A 5CM9C 1FTNA 5BXQC 3AVTA 4CGZA 3KX2A 3DZDA 4QHYA 3SBDA 2QEQA 3ZLJA 1G5PA 3WRYC 4PHHA 4ACBA 1O87A 1AA3A 2BCGY 1DAIA 3TMKA 4D6PA 3LBIA 2HJGA 4GRAA 4HUTA 5JEEA 1GILA 1SVIA 3CM0A 4JKYA 1S3SA 2CCGA 4M1OA 1KI4A 1OIVA 1Y63A 3K70D 1IJFA 3Q5EA 3WRXC 1COWA 4A92A 1KI2A 2F9LA 4WA7A 3GLIA 1VG0B 2QAGB 3WP0A 4TTPA 4JLNA 1TEXA 3AF2A 4IXNA 1Z6XA 4OL0A 2E87A 3LBNA 4TLEA 2DCUA 1H65A 1JI0A 2AWOA 4MQBA 4IW3B 4A15A 4D0NA 2CHQA 2ZSEA 3LD9A 4R2IA 4UNPA 3AH8A 5J4KA 5KYKA 1P7CA 2GNOA 5KTYA 2PZGA 5CJPA 3GMTA 1F2TA 4LI0A 2IK8A 1KNXA 3T1OA 1OFIA 4BGDA 1SKYB 4IDOA 2RGGA 2JJ2D 1OV4A 4TYNA 3FWYA 1NVUQ 4NCKA 1U81A 4ABYA 4MYCA 1J8YF 1DADA 2ZU6A 2QPOA 4KXFB 4K81B 5J40A 4M1MA 1TMKA 2WVJA 5CLLA 2BJWA 4DEXA 1Z83A 3TVDA 4DCVA 3X2SA 1II0A 4JZKA 4TL8A 4PPGA 1JPNA 2H7VA 2F1HA 821PA 2YWGA 2F1IA 3KKNA 2R6FA 1E2FA 1MKYA 2ZJBA 2V8OA 3QUSA 4Q1FA 3HJNA 2OM2A 1ZBDA 1TQ4A 3BRWD 5KDLA 1IN4A 3EZ9A 2F55A 3ZZ0A 3R9IA 2VP2A 4CZ2A 1KO8A 2WWYA 2JLXA 1ZM4A 2J41A 1Z47A 1QRAA 1M74A 5E7JA 3U7FB 4QBHA 4DUGA 2F6RA 2BM1A 1QHXA 3A1VA 2WPDA 3CW2A 4IHQA 4RCZA 4BE7B 2OSBA 4BFTA 1QG4A 2JLQA 2XITA 4FW9A 4QNMA 5SZJA 3QOFA 4OJQA 1G64A 1ZD8A 2VHUA 4DLRA 4Q66C 2G6BA 3EWAA 4UXHA 1OFUX 3E5HA 2QGZA 5H1YA 2NZJA 1OB5A 3FMPB 5E7MA 2GXSA 4HATA 5TXGA 2IYYA 4EPRA 2GXQA 2QAJA 2WJGA 3BGWA 4TT3D 5FUVA 5E3HA 2XZPA 5EZ5A 1QHHB 2ZRBA 1X1RA 4QHTA 2E9SA 3H0KA 2MMCA 1KJZA 2IYSA 4Q7JB 3B1WA 3K9LA 5E4FA 4M9SA 1Q44A 3E70C 2ZRDA 2MSDB 5C1BA 4TLBA 1R4AA 4KITB 5FOXA 2WKQA 2ZITA 3QI2A 3SS8A 2IYTA 2EVWX 2VO1A 1RKBA 5JS7A 3ETLA 3N5CA 2P2LA 2QRNA 1TF5A 2NGRA 3DKVA 3S1AB 2A5DA 1A7JA 1G8FA 3VMFA 4EKDA 3CBQA 3ECCA 2G9NA 4XVRA 5GJVC 1OH6A 3B78A 1J99A 2ERYA 1XX6A 3AVOA 3OE7D 1P9WA 2R6CA 1N6HA 4DEYA 1SVMA 1M7HA 4ZCMA 2IX3A 3RS5A 1LTQA 1ZC3A 4US0R 4MUAA 4LJ9A 1G7TA 3L0OA 4HUQA 4CEJA 2VP9A 3R9XA 1S1CA 4URVR 3PCRB 2QQEA 1E1QA 1RJ9A 2FGKA 4B48A 2JJ1D 3FMIA 4KAXA 4P31A 1SZPA 1WRBA 4Q18A 2PL3A 4R7ZA 4RKFA 4C3ZA 2P6UA 1HV8A 1N6NA 3C14C 4FIDA 1JAHA 2QUZA 1L8QA 4B74A 4D0GA 3IPYA 2YHSA 1XEWY 2BMDA 5FFMA 3F0TA 2FFHA 5K8LA 1NLYA 2CL7X 1WA5A 2G0TA 1CP2A 221PA 4C2TA 3VAAA 2XXAB 3CX6A 2V6JA 1G6OA 1HT1E 2D74A 4O2LA 4B3DA 4HAYA 3Q72A 3A4NA 1MO5A 3FFBA 2MSEB 4A4DA 1AGRA 2IYWA 3KXKA 5TV2A 4PFSA 4DT1B 4YXWD 2CNWD 3NDPA 4IOMA 4OK5A 3T1VA 2AX4A 2IYVA 5JWRA 2A5FA 3RS7A 5AK0A 1RYFA 4PPNA 2PX3A 4LBZA 3U3OA 5B57C 4OI4A 1GOTA 2ZRPA 2Z0MA 2AHOA 4A2QA 1F2UA 2PBRA 3GJXC 3TIFA 3THWA 2D06A 3NG1A 3EX7C 2FA9A 3FE2A 5LD2C 3KJIA 1EGAA 1KGDA 2W6JD 2FWRA 3D7MA 4KSBA 2UKDA 2YWHA 3W5JA 5KHOC 1P6XA 2CCKA 3EPKA 3NWJA 3SFZA 2C96A 2PMDA 1E32A 2X2FA 3RABA 4NTZA 4BFZA 2DYKA 3P1JA 4HAWA 1E9SA 5CK5A 3OHMA 3C16C 3CR8A 3S1AA 3BFVA 2GCNA 4FMDB 4OQNA 4Q02A 3U44B 2LKCA 4KBFA 5IK2D 2NO0A 3C5CA 3DOFA 3CZQA 1KMQA 1R0YA 4NYJR 3LY5A 4G01B 2RGNC 3OIUA 1G8GA 4KLZA 2ZE6A 2VYFA 3IO5A 2R9VA 2NG1A 2CE2X 4KYUA 1UDXA 2ODBA 4M9XA 1SVWA 4ZV4A 4M1TA 3T06B 3PEVA 3KUCA 1RVDA 2YOHA 3THOA 1AQUA 1R0ZA 2Q21A 4QOSA 5JSZA 1CJMA 3D3QA 1E4VA 4GOJA 1WP9A 2OLKA 2WWIA 4Z8XA 2F9MA 2WJYA 4HDQB 1E0JA 4IFBA 1Z6YA 2ZRKA 4MRPA 1VMAA 4ZPXA 4LSGA 5BN5A 2GJKA 3LX8A 2O0KA 1SVOA 4BLOA 1JBKA 2F7SA 4LCBA 1DBSA 3SE0A 4A36A 4NBSA 3IO3A 4JT4A 4XIGS 1ZP6A 4Q00A 1KDPA 2WPDD 3OAAA 3QG1A 1JQLB 1WB9A 4FCVA 1XU4A 3AEZA 3CKLA 3AVWA 1E79A 2ZROA 3TRFA 4KSCA 1E0AA 2XSZD 4B71A 4F92B 4PTLA 1CR4A 3EXAA 2OFXA 4XD7D 1T3LA 4DDUA 4Q21A 5JJIA 4YMWA 3SQWA 3B5JA 1KYIA 1G291 2ZRCA 4ASUD 1D5CA 2B8WA 4HAUA 3HWSA 1R6BX 2IUUA 1VYUA 1RRCA 4AI6A 4BFVA 5EE5B 4GOXA 6Q21A 4O0MA 2GESA 5TMPA 1VPLA 3HYRA 5AJXA 2PT7A 1SULA 4B3GA 5FOVA 2QM7A 4NCIA 1JJ7A 1Z63A 4ZI2A 3B2EA 5HZHA 3SJZA 1SGWA 1G5RA 2L0XA 4WXRA 3GCGA 1T6NA 1I4TD 2FPMA 3W3ZB 4DLWA 1NF3A 1UM8A 4Q4HA 2R62A 4NCJA 4B73A 4N1AA 3AF0A 2BIFA 3K0EA 2D3WA 3PV0A 3QXSA 4TSFA 2VRWA 2AD1A 2WWFA 3RLFA 1NMYA 2C5LA 4DCNA 4BLPA 1X1SA 1JNYA 3AV0B 3TK1A 3W6PA 3LQQA 3U5ZB 2YC4C 4FMCF 4ILEA 2YYZA 3IKJA 1KK3A 3N70A 3KQUA 1II8B 1XTQA 2F3RA 5BYKA 3RRZA 2ZJYA 2ZE7A 3V9PA 3P26A 4XWOA 1W5SA 3ZD6A 3I72A 2C9OA 3H86A 3QF4A 2G1KA 3AKYA 4TZ0A 4EPWA 3B8HA 4TWZA 3Q9LA 4EQ6B 4GPTA 4EPYA 3EWSA 3NBFA 3QNUA 2RGXA 3IILA 4Q7MB 4PHFA 2GILA 1G16A 1O3YA 3K09C 3NEYA 3UMRA 1TQDA 1Z0JA 3P20A 4DLTA 1W0JD 1OH7A 4EJSA 1SXJC 4XJXA 1EK0A 2P5SA 3FYHA 3CWZA 1NBME 4BUJA 4QBFA 2GJ8A 4UJ5A 3U7EB 3QPUA 3MUFA 4WZBE 2OAP1 1WXQA 4JLJA 2A5JA 3A1TA 4D81A 1KZGB 1T8UA 1UEJA 1LF5A 5AUOB 1G17A 3QSYA 2HLDA 3PEWA 3PUVA 1BIFA 2J46A 1I4LD 1E2HA 2WAYA 3GP8A 4RD0A 2XXAA 4GP7A 3IEVA 1YE8A 2ZS8A 3K0SA 2BC9A 3RSOA 5A5GA 4P33A 2HT1A 2OO7A 1CTQA 3SBEA 5TY0A 3T12A 5BQ5A 1JJVA 4D4LA 3GLFB 3GEHA 3EA0A 3NEJA 4JVSB 2CK3A 1NIJA 1R8SA 4JKIA 2DFLA 3PUYA 1XWIA 4C0BA 1G20E 4D4JA 2IL1A 2QENA 4MKFA 2P0EA 3GJ7A 3CH4B 3MMPA 4A1FA 1NP6A 1OSNA 1W36D 2ODEA 2ZSAA 5CM8B 2HF9A 1CLUA 4TN1A 1NSTA 2QPTA 3LFUA 3BC1A 2OEPA 3WHKA 3DM9B 1P4SA 1AS3A 3AF4A 4A82A 4Q4JA 3AQ4A 1ZMXA 4HLQB 1E9CA 3GFOA 1D8TA 5FL3A 2I3BA 3I4LA 4G5QA 2C2HA 2WV9A 4LV5B 1P9NA 2V9PA 1KZ7B 1R5OA 3G5UA 1H8EA 3K0CC 5JWHA 1KNQA 4TL6A 2CEAA 4DLZA 1ZM3A 2C03A 2PZEA 3P4XA 4DBLC 1RZ3A 1KIMA 2VP5A 3L0PA 2REBA 4BQSA 4Q9IA 1DS6A 1Q57A 3RWMB 1QF9A 2AKYA 1X8KA 2XTZA 2IS6A 4LJ7A 1WBDA 4L15A 4V0KA 4Q47A 4G5OA 1ZC4A 3HR7A 4Q7LA 4TMVA 4YMUA 2HF8A 2AN9A 1TF7A 4KFUA 1JEEA 2XTMA 2QTVB 3T1QA 4GL2A 1Q1EA 4A6PA 3SFVA 3KXLA 3VU9A 4LC0A 4OHYA 1JECA 1OYYA 1SXJA 1XB2A 2GKSA 3A4MA 4UKDA 4X8OA 1Z0FA 3LV8A 4QJ5A 1PLJA 4MITA 2F1JA 4TMWA 1OJLA 2UZ3A 4JJZA 4ASUA 2AWNA 3CRMA 2IXFA 4A2PA 2C99A 4HDCA 4L8GA 5IF9A 1TQ6A 3F3YA 1E2DA 2RB4A 3O8RA 4V0MA 4JBXA 4EJSB 1T3SA 4BLTA 2QM8A 1N6OA 4LBYA 5L3QB 2HXYA 1NN1A 4QJ4A 5HE8A 1JALA 4LYHA 2ZJOA 5J4LA 3LX5A 1NVXQ 3Q8XB 1OIWA 3P4YA 4N3NA 4UXJA 2CLDX 3QXJA 3SYLA 3P27A 1CRPA 1DAEA 1BOFA 3T61A 4DCTA 2ZYUX 1T91A 3ZIAA 2KJQA 1YZNA 3R7WB 621PA 4Q9HA 5H68A 3CWQA 3PIRA 4TSFD 2PCLA 1GWNA 4JIMA 3JZMA 4Q03A 3PEUA 1UBCA 4PO8A 1SHZA 3FHOA 4Q4JB 1E69A 2UVQA 2ZYTX 3UPUA 4EFLA 3QVUA 1T0HB 1DG3A 1CULC 4NYIR 3Q85A 4R2HA 4AC9A 1F2TB 4CEHA 1A82A 1QDEA 3KL4A 1G7CA 5AJVB 1QHNA 3SJBA 2KWIA 2G83A 1OT3A 2B7BA 2NOAA 4KU4A 2QROA 1UKVY 2A3RA 2EWWA 1G5TA 2WWWA 2QP9X 1GSIA 1N5KA 4PSVA 3FHCB 1GG2A 3I73A 4IDHA 3TQFA 3SZRA 5KOYA 4C7OB 2RGCA 1HH4A 1NY5A 5EE0A 4CYMA 2W58A 3ZVLA 4MRNA 1LS6A 3GLIE 4D4KA 2X1VA 2J0SA 3U6BA 1GNPA 4MA4A 3Q5DA 3IHLA 2QTFA 2BWJA 3BIFA 4R71A 2HJVA 2J7PD 4JLVA 3OZXA 3A6PC 3CUEF 3DEFA 1RPZA 2AL7A 1XDBA 2H92A 3AVVA 1GP2A 5GVRA 4EPVA 4C0HA 1NLZA 1S4QA 2GZAA 4NCHA 4NH0A 3OEEA 4B3XA 4QC2A 1E4YA 3AF3A 3AGQA 3GJ3A 1CJKC 3ZQJA 1YZQA 4QGFA 5JEDA 4BFXA 4H1VA 3ADBA 3I5XA 1J7KA 2PCJA 1DAFA 1ZM9A 3C8UA 1JQJC 1FW6A 4OHWA 3QE0A 2IUSA 3K53A 4MYHA 4NKRA 4AURA 2CK3D 2XAUA 4MRSA 4PX9A 2ANCA 4B33A 1YU9A 2D2EA 4C0AC 2VLIA 4B43A 2ZYWX 3VHXA 5G40A 1SKQA 2FJUA 1EFCA 3PUXA 3IPXA 4P4SB 2GHIA 2WHXA 3TUZC 3FDIA 3IIMA 4M22A 4BRWA 2BKEA 3I92A 3WYAA 2W2XA 1DTSA 3ZDQA 5KNCA 3LXXA 3NBXX 4PC3A 4XWKA 3V4FA 4M9ZA 2ODWA 4URWR 3CX8A 2GAAA 3LRPA 4US2R 4W5WA 1E0KA 1MT0A 3BB1A 4LK2A 4BEJA 1R0WA 1U0HC 1F60A 2ZRLA 1ZU5A 3MSXA 1BYUA 4CIDA 2IYLD 3KJEA 1OLOA 4XH9B 5KPJA 4DSOA 3E2IA 1GIAA 2J0QA 2HUPA 4DCUA 4JLDA 4HLDA 2VA8A 1KO1A 1P2VA 5BW8A 2WAXA 2W0SA 1W2HA 4PPFA 2BMJA 5EP3A 4URZR 4X8MA 4JYBA 5JI3E 4A0RA 2X77A 1EFUA 5UKDA 1AS2A 3A8TA 1UBGA 1H8HA 4W9MC 3BJIC 2FNAA 3TH5A 2YINC 2Z43A 5CDFE 5EE9A 5L3SB 1IN7A 2YKGA 1E9BA 2J45A 2D62A 1QHGA 2ORVA 4KFRA 4TT3A 3CZPA 1T3HA 2BVNA 1NKTA 4FCTA 3QF7A 4KO8A 1XD2A 4LHZA 4GSYA 3AGPA 2A7QA 2JASA 2OFWA 2QP3A 1P5ZB 3VX3A 3C7KA 3K0FB 1Q20A 3BAFA 5GADl 2NMVA 4DXAA 1KI6A 2V6IA 2OT3B 4S35A 4OQLA 3WP1B 1CRQA 4XVUA 1RRFA 5EXXA 2HDNB 4Q48A 5GJCA 3RHFA 1ZUHA 4JMPA 3QBVA 2O8FB 2XB4A 4B47A 1VG8A 3REFA 1VHLA 4ZKDA 1E2EA 2IW3A 1L4YA 4X8HA 5GJBA 3CNOA 1Q3HA 3OE7A 3CPEA 3WYFA 3TBKA 1JXMA 4O25A 4Q4AB 1AKEA 4C0LA 2PJRA 1G18A 4LGMA 4E5UA 1Z07A 1XP8A 2KI5A 3AVXA 5KDOA 2IS4A 4FMCB 5J4YA 1E0SA 4WZ6A 4HZUA 4MGIR 4DC9A 3THYA 1KK2A 2JJ1A 2IEYA 4B2IA 3GLFA 1XRJA 3W6OA 1QZXA 1IQPA 3SYKA 4BECA 5CYPA 2OE2A 2Q9BA 3OEHA 2FPKA 1U8AA 2REXB 3F8TA 2FE4A 3J81k 4LPSA 3MRSA 3LLMA 5FTNA 3CPJB 3VFDA 1KDRA 1E9DA 1G3UA 2XZOA 2KBFA 1P73A 5AUQA 4A0HA 2JATA 2NZ8A 5JRJA 3GJ0A 1ZUNB 2IYQA 1ZD1A 1E2LA 2CNWA 3U3RA 1U99A 1V43A 4G5RA 1UDWA 1XD8A 3C41J 4HB0A 4PZLA 3SN6A 4WZAE 1XTKA 2GVZC 4HB4A 2BEKA 4QHSA 3TQCA 4NDZA 2ZRMA 4ZDJA 3M6AA 2ZVQX 3PJRA 1C1YA 1D2MA 1MV5A 1N5JA 1TADA 5DLQC 3X1ZA 4UNSA 3EARA 4E22A 2ZAOA 5CJ2A 3PFIA 3W5IA 2ANBA 1CJUC 1JXOA 1IAQA 2VSXA 3Q3JB 1JB1A 1W4AA 1OKKA 2O8CB 3TVTA 3OEED 4IOJA 4NONA 5L3VA 1MABA 5CIWA 3WY9A 1FMLA 3WBJA 2J1LA 4DLSA 2ZRFA 3KXIA 2FN4A 2IWRA 2EWVA 3THYB 3OIYA 4RSGA 4WW0A 4M1YA 4C0QC 3HPQA 2ZI4A 3VHLB 3VNUA 2QBYA 3ICQB 1DO2A 1E98A 3VR6A 1Q21A 4BFUA 3REGA 5FI0B 1XPRA 5IK2A 4DJTA 1I2MA 3A4LA 2AFIE 1YZLA 4NP6A 1NI3A 1KDOA 3AUYA 1WF3A 5M04A 3EZ7A 5F98A 3EC1A 2QSZA 3GLIB 4Q1EA 4U00A 5SZIA 3RWOA 1NNEA 3AKEA 5FOSA 2FOLA 4DIEA 2O8BB 3DZ8A 2I1QA 3TSWA 5AWFC 4PAQA 1W49A 3VR1A 1FFHA 1XJ0A 3C5HA 2JAQA 3KKPA 3KTAB 1QVRA 5KDDA 1Z2AA 3EZ6A 4MKGA 3NH6A 2DY1A 3ZZUA 1GITA 1GL9B 3LW7A 1UEIA 3IIJA 4G5SA 3VTKA 4QGGA 5FH9A 3C15C 2C95A 1GVNB 1SXJE 5JLJA 5DNYB 1T8TA 3VKGA 1XEXA 1Z8FA 3FKSA 1ANKA 1LS1A 5F9FA 3K0CA 4NPHA 5ANRB 2VF8A 4YQFA 1P75A 1HUQA 2PZFA 1F6BA 2NQ2C 3DHWC 4IVRA 1DPFA 2BBTA 3L43A 3OAAD 5J4VA 3T5GA 4XSGA 2WM9B 1F5NA 2ORIA 2XNDD 3K9GA 1DE0A 2YNMA 4LJ6A 4DT1A 4BLSA 1UKEA 4A8JA 1Z0KA 2R6GA 3W6NA 1ZW6A 3JVVA 4EJSC 1FZQA 1VECA 2XSZA 2QBYB 2F3TA 1N6LA 2ASEA 3VR4A 3VU9B 2N46A 3GFTA 3K0AA 4XD7A 4YDHB 1E99A 4B3CA 2Z6VA 4HI0E 3MAAC 1Z6AA 1X6VA 2DFTA 2Q9AA 4E07A 1E1RD 2PH1A 4Q1AA 4JLBA 2GEVA 4NCNA 5J47A 1DO0A 3B82A 5HZKA 2XJ9A 1UAAA 3SU8A 1AJEA 2BMEA 1OIXA 4RD6A 2O8EA 4TMKA 2B21A 3CLVA 5EZ6B 1U90A 2ZPTX 2IUTA 1W47A 1FL9A 4RZ3A 4B76A 3UMSA 2BEJA 1ESMA 3SHFA 4AKEA 2GF0A 4C9BA 2XJ4A 4CEIA 4URYR 1P2UA 4P4UA 3GPLA 2CLCX 3RRMA 4YLGA 2Q0HA 2IA5A 3R8FA 3TNFA 5FUWA 3JVUA 1ZD9A 2V55B 4I1OA 4PANA 3NTUA 1J90A 5JHGB 3WYGA 1N0WA 1YVDA 1GRNA 1KI7A 1KK0A 4DKXA 2ZR0A 4HZUB 1K8RA 3BH7A 4TMXA 1E9AA 1M7BA 1S96A 1W4RA 2WWGA 3B85A 1CR2A 4QG7A 4CF7A 4TL9A 1NSFA 3QPVA 4B3FX 1TTTA 1OXXK 3BK7A 3THXB 1J8MF 4LDJA 1XD9A 3NHAA 3TLXA 4B6EA 1XXHE 3R8CA 1HURA 4AKHA 1MO4A 1YZGA 5BYJA 3MWYW 1HE1C 4AYWA 2VHTA 3BERA 5JJKA 2PMKA 4EAQA 2GXAA 2ZJ2A 1HQCA 4DSTA 2FZLA 2CLSA 1G6HA 2CCJA 3T34A 2QRZA 2CE7A 4RY2A 4I1UA 2QE7A 8OHMA 3CRQA 3M1IA 3DM5A 4H1UA 4YMVA 3IBYA 1W36C 5HCIA 1EX6A 5L3SA 4L16A 4RD4A 5FR2A 4FWTA 2V4ZA 4NMMA 3NC1C 4PHGA 4A8JC 4IEIA 1TPZA 3RS0A 2ZIAA 1Q1ZA 1G4AE 1WBBA 4Z8YA 1OKKD 4BFSA 2JLUA 4IEEA 1LY1A 4EPXA 4BFYA 1KI6B 1ZM7A 2EFHB 3FKQA 1M7GA 2FX3A 4Q9LA 2ZANA 2C9CA 3LH5A 2JLVA 2N42A 2ZVPX 1EG7A 1OFTA 2BKUA 4QFMA 5F9HA 1IXZA 3SC3A 1Y3AA 5JCPA 1KKLA 4FINA 1OH5A 5FPKA 3RAPR 3BBPA 4A9AA 4LHWA 1RYHA 4TLAA 5FOTA 3IIKA 4JL8A 5IDVA 1K6MA 3QF4B 3U6KA 3KB2A 3NIBA 4Q4HB 2Q3HA 3QEJA 4P32A 4YMTA 4DLVA 2DBYA 521PA 1XPOA 3ZVNA 1JR6A 1EXMA 1Z22A 1S3GA 2OBMA 3QKSB 3H4MA 1ZNYA 3ZS8A 1FQJA 4F4CA 1UBEA 2XEXA 4EFMA 3UKDA 4ZCIA 4W7SA 3LQRA 4KI0A 4II7A 2WJIA 2IBMA 5JBQA 4DLXA 1NVVQ 4ZI3A 2JLRA 4LHXA 5LD2B 3UATA 4DVGA 2P3SA 4XOIA 2VHCA 4MH0R 3TAUA 2ZTSA 1NL3A 1KI8A 2JLSA 3T15A 2XGJA 2AXPA 1E2NA 3A1UA 2VP4A 4GZLA 1H8ED 3KQLA 2AR7A 2HT6A 2VQSA 4L4UA 1IY1A 3OFNA 1II9A 1QHHA 3IHWA 1TL7C 1OW3B 2PEYA 1EFHA 1KSFX 2VIIA 1G19A 1E2MA 3I8XA 1S9HA 4HUQB 2CVFA 5DYGA 5FBLB 5KUTA 4E09A 1XMJA 2BM0A 4LPKA 3U3MA 1VIAA 4MUBA 1HTWA 5DHAA 1D9ZA 1IBRA 4D0LB 3QXHA 1NVWQ 1W46A 2O5VA 1QHSA 1TAGA 4LBVA 2ZUBA 1GNQA 4C0KA 1Z0IA 4RZUA 4OHZA 2C78A 2VP0A 5AR1A 2VTKA 4ITRC 4F7WA 1D2NA 1TUEA 2DPXA 5EE3A 4QM6A 1ZCBA 5FBWB 3UG6A 3HR8A 2BHRA 2OCYC 4WBSA 3SHWA 4MDFA 4XTRA 1BYIA 3PUWA 2IYRA 1E6CA 4HAXA 3D6TB 3VKWA 5HKKA 1LB1B 2N1BA 2C9YA 4B3BA 2ZJZA 1Z28A 2WZQA 2FSGA 3LNCA 4URXR 5FL7D 5LDDC 5IRCD 2WIBA 2YOGA 2JGNA 5G41A 1L7VC 1TF2A 2ZM5A 4OQMA 4PZYA 3TR0A 2ZR9A 3UMFA 2B7CA 3G82C 1FP7A 4B34A 1W4CA 3K8YA 1A5TA 3DL0A 4M21A 4RD1A 2F43A 2JIZD 4NZYA 2QPAA 1JAIA 1WE2A 1ZNXA 2GVDC 2W00A 1PLKA 2QZ4A 3GEIA 1F48A 2FEMA 1AS0A 3A37A 3THWB 2VH5R 2ZSBA 2QGNA 2QU8A 1IONA 3SEAA 4EQ6A 1SQ5A 5C18A 2A5GA 3CIOA 3BH6A 2AK3A 3K70C 3MFYA 1KSJA 4GFDA 1UKYA 4IVPA 2ZJ8A 2FDCA 3OESA 2X8AA 1ZNZA 1W1WA 2WICA 2ATXA 2MSCB 3QJYA 2RCNA 1VTKA 3QKTA 2W6IA 4Q9JA 5BWMA 1GL6A 4DDTA
chains in the Genus database with same CATH superfamily
3JR3A 4P2GA 4RK1A 2VYVA 5DN6A 4QT4A 3R9WA 4M8SA 4PX3A 3Q8KA 4D26A 4AIRA 4KSYA 5K8IA 4NRDA 3B51X 5JZVA 5EXDA 3ID6C 2QR2A 3DTNA 3KIPA 1XMPA 3NOQA 4ZJUA 1WSBA 5LJIA 4RGVA 3Q11A 1A98A 2OLJA 3IOYA 4ALLA 4IMJB 3RB8A 1JEYB 4AO8A 4PZZA 5I7OA 3KJQA 1I3NA 1QE0A 4OMUA 2I1LA 4FXPA 3ORFA 1NJ2A 4PYOA 4IVNA 4CCYB 4D8VA 1BZYA 4HKTA 1BHQ1 3EE6A 2CXQA 4QSMA 3T5DA 4ZOLF 3M34A 3BJZA 3BKWA 2E3JA 3IVCA 2I4MA 1DMRA 2ZLBA 1UFQA 4KUEA 3GV0A 4GP6A 3RUPA 2Z9DA 1N6KA 3EXIB 4C0XA 2P5UA 4D8UA 4WKGA 1A4RA 2R5NA 1ZMRA 2ZE8A 3DMRA 2EFDB 1FE8A 3JAKA 1QQ5A 3PQCA 3ZE0B 3EC7A 1CDDA 1MX5A 1R6DA 4JT9A 4YAOA 3SX0A 3UAVA 4HC4A 4W9RA 4JJKA 4KVFA 1E5VA 4CEJB 1B74A 4CQMA 1SD1A 3NRJA 4KTVE 2OV3A 3B7GA 3KPYA 1JG7A 4DQKA 2XTNA 4FM9A 1U2PA 4AD8A 4PO3X 4H17A 3FOCA 3NALA 4IR7A 3ZHUA 1NVDA 3BXFA 4QIHA 4ZVVA 2NT4A 1R9GA 1YTLA 5J5CA 2IWHA 5EHIA 4XZ3A 1YUMA 2JAHA 3KVRA 4LV6A 3MK31 3RV4A 4YI5A 2CL6X 2J0UA 3FLAA 4FZ5A 4CCSA 1SB8A 2YJ4A 3S1LA 5FPTA 1V37A 5D3MB 3VNBA 1MDFA 4RJIA 3CCCA 5JWOA 1VJ5A 3LQFA 1WS6A 1NKSA 2ZI5A 3VUFA 2Y77A 2YXNA 3HE3A 3NB0A 5CTAA 2YV4A 3PDWA 3U60B 2G9QA 1NR7A 2GTPA 2MJLA 4IIFA 1Z13A 3TI7A 4C14A 4IIYA 1QQ6A 5KNCD 2DLCX 3IGFA 1OA0A 3SZMA 3ICOA 3PE6A 1LW6E 2GK7A 2DWQA 2CNOA 4N0QA 1X1DA 3ZNPA 4AKIA 1L9KA 1UBTS 1J21A 1V2HE 1SOAA 2R4QA 4BLQA 4DV5B 1JDNA 4NWIA 4PO1A 1YJ8A 3K3PA 1PR5A 2QJTA 4DJ5X 3GJ5A 5JNSA 1TVKA 2RJNA 1LNQA 3BULA 4U7DA 1PDWA 1G1MA 2C3PA 1E20A 5JANA 3ZI0A 5K8TA 2GEBA 3PVSA 2A9VA 4N3BA 3S40A 1Y8AA 2YWBA 1U6IA 1EFRD 3PQEA 1OFUA 3CQ9A 2FR1A 4I4TA 4KG7A 4MLCA 4V0QA 3RNLA 4YT8A 5A4DA 3MRXA 5BW4A 2QUHA 1TJ5A 3LO8A 2K7ZA 2JLZA 2OXFA 1GTMA 2G9RA 2CL0X 4ER3A 3GLRA 4XYLA 4X92A 3TFOA 1K9SA 1Y9DA 2G88A 1BWQA 2NADA 4W7HA 5K99A 2DQ4A 3IV9A 3JQGA 3D5QA 1O9BA 1XFAA 1JT9A 4I1IA 4P7JA 3UAYA 2GPSA 5C80A 4XLZA 4EKIA 1JKMA 2Y92A 9LDTA 5HTKA 9ABPA 2EWMA 5EUMA 1FQWA 3M8KA 4ZCLA 1GGKA 1PWXA 3ESBA 1XZKA 2H2FA 2B8JA 3QBEA 1BWRA 4Q1VA 5AI5A 1GAQA 1UZMA 2I54A 2HQ1A 3NNNA 4FE3A 5BP7A 3VGJA 1PQWA 2NZ2A 1RP7A 3QU2A 5AKGA 3JALA 2QNBA 5HTOA 1WZNA 4OOEA 2NZXA 2X1LA 2XEDA 3D6MA 4TQ9A 2QIPA 1WCV1 1IY2A 1NYLA 1RAIA 4QBIA 3N2KB 1M34E 3L04A 1VYVA 2VYNA 2YJZA 2EKQA 5TS3A 1WB5A 5K0LA 4EMBA 5KU7A 3EEIA 1DWPA 4LKRA 3CN7A 3PT5A 3C39A 3O0TA 1KIAA 3L0SA 1KP3A 1Y6JA 1WULS 4FCWA 1N2BA 4E4YA 3W5BA 4P9NA 2BFPA 4DNPA 1IOWA 1QRTA 1FPMA 1IIRA 1O94A 3V32A 1A2KC 4DADA 3G2KA 5CVDA 2WRZA 5FRDA 4H4DA 4L95C 5AMXA 1UANA 1NIPA 4RFVA 3QXGA 2PYZA 3AUKA 2HDWA 1U7ZA 3FWPA 1NM5A 3MC1A 2H2IA 1XNJA 3EUWA 4BB0A 4AYTA 4DQUA 4F4UA 4YJ2A 1SVUA 2A14A 1G38A 2JKVA 4NE7A 1N5IA 1NQAO 1OF1A 5A4MS 3ICWA 3AUXA 1ZO8A 4JBHA 3ZHZA 3H1BA 2EOAA 3OOYA 3JQ9C 3PDIA 3T4PA 4JFRA 3ZWDA 5BSEA 3CH5A 3KDSE 4BL5A 4EA7A 2C5GA 1P3JA 3A3NA 2L18A 1KERA 1GG8A 4B32A 1UM9A 3G0OA 3H16A 1FYEA 1SM4A 4P4GA 1F6WA 1HNNA 4Z99A 2HV8A 5TGDA 1GUDA 3Q87B 4YN3A 1VBMA 5LUBA 2XLBA 2ZT6A 1A3CA 3AUAA 4GG1A 2ATIA 3MTGA 5HW0A 3COJA 2FMUA 1YR1A 4MO2A 5CXUA 4NY1A 3E1GA 4BO9A 5JQGA 1IBLB 4XIJA 4GVLA 2G8NA 4W5RA 3L84A 3ADKA 3CV3A 3AEYA 4RM3A 4X1KA 4WXPA 2PSFA 2OBLA 2YH2A 4ONEA 3BF7A 3RU2A 2O7RA 3G2PA 2F8SA 4EUKA 2I7DA 3UWOA 5JCOC 5KOJB 4OLBA 3WQHA 4XGIA 1E3TA 1JFVA 3P0RA 3QE9Y 3ZNNA 4OI2A 5HUQA 3VVCA 1VSUA 3WV4A 1BE1A 3NX4A 3EVFA 2R1UA 3R5JA 5JS8A 3OZWA 2IPLA 2OLEA 2H2DA 421PA 4CKBB 1K8YB 3LF1A 3Q8WA 3JQAB 4CR8A 4D9KA 4ZAFA 2C7QA 2Z58A 3H5IA 5EKXA 1EI9A 1L1RA 3TE6A 4FDAA 2VFAA 4QXRA 4QAJA 4E11A 3QVWA 2AI1A 2B37A 1OAKA 4LOKA 3PIDA 4OMDA 2VF4X 3GJTA 5FJJA 3RYTC 3P32A 4DOMA 4YCDA 2PH5A 4F8EA 5HWSA 4YJGB 3IURA 5TMEA 3S4YA 1V1RA 3DPSA 1JH9A 2E4WA 4RHCA 3FHJA 2I78A 4L5YA 4OHXA 2V7QD 4WJKB 2QHXA 4DIDA 4DR7B 3CRVA 2LR0A 2ZR8A 1WDKA 2ZDGA 3HDYA 3RPEA 1O6GA 1MRNA 2C8VA 4XSHA 5TRTA 4J03A 3GRPA 1TPYA 3K1YA 4LRYA 4DTCA 1XMXA 1U2ZA 3IH5A 4HXFB 1UXIA 2AC2A 2DKFA 3AW8A 3X1DA 5DDIP 2PWPA 2XXBA 3H5TA 5C7IO 1BKYA 1EFKA 4C0WA 4CDRA 3LUBA 3MJRA 2O5CA 1CFZA 3AB3A 4C4PA 1RIFA 3IEUA 1QCDA 5AJWA 1XLTC 3SIRA 5LQMA 5LCXA 3T5TA 4AB1A 2BAGA 1ISMA 4EY6A 1NHGA 4NHOA 3QUTA 4LG1A 1EX1A 3GQBB 1XMSA 1XZHA 2F2TA 1H1TA 3OX4A 3PWSA 1C2TA 1SVKA 3BE4A 1E7QA 2JFNA 4ZHQF 1QYCA 4UAGA 4ND8A 4YJ3F 6REQA 4J16A 3AB8A 1ZXXA 1X7YA 3GLGA 3RFTA 4NBTA 2HMYB 3DZFA 2XXAA 2CDCA 1NMZA 2QN6A 4KP7A 3OECA 4ACAA 1KTIA 2FFAA 2JJ8A 4YBZA 3RANA 3AEKB 4M6WA 3H6GA 3VO8A 4P86A 4P5DA 1UFKA 1H66A 2O8FA 1KVSA 1H05A 4WFQA 3WL8A 3UMCA 5I4BA 2DHQA 1I3CA 2X86A 1FP1D 2ST1A 2G0AA 2JKYA 2ZTLA 4LZZA 5ALRA 1AGPA 4C2UA 1YQXA 2A7XA 2WUVA 3EIXA 4BMPB 2FFQA 2WTBA 1I7SB 4JJEA 2VT3A 4G5XA 2YBEA 3S2UA 3DMTA 1JXAA 4NF2A 3O73A 4XFKA 3D1VA 5EERA 2D54A 4Q3BA 4TSRA 5B1SA 1N0VC 4KH1A 1R5NA 4X84A 1J4AA 3K5HA 5CB4B 4K3UA 4FD2A 3HN2A 3AHHA 3IQWA 1VLLA 3LI2A 5H02A 3ZWKA 1E1MA 1TUBA 2Q5IA 2XNDA 3QELA 4XQCA 3GLUA 5KINB 4RGQA 3WHLA 1KWGA 5FBVB 1ZOOA 5J2UF 1UK7A 4YRAA 4MQ4A 3SF8A 3I5MA 2C3YA 4LXIA 5ALXA 2JAWA 3U3KA 3NM5A 1R8YA 3FDXA 3PF9A 3UZUA 4GMHA 3ZLUA 5DE3A 3FOZA 1PTKA 1Q83A 3VR5D 4J2TA 2Q1WA 3MT9A 1C30A 4UBLA 2KBEA 4KBGA 4BMDA 4J0IA 1GPDG 1Q0LA 3FCSB 4LBWA 4UE6A 1KVTA 4E3WA 1RQPA 3KJHA 3L8FA 3UEOA 5L53A 1FUKA 1EG2A 4WESA 2HL6A 4U2EA 1PV1A 4HJXA 2GDJA 3QEOA 1ZK4A 1BHJA 3KDAA 4WN3A 5K0FA 3NH9A 1RCTE 1Z6TA 2DHCA 2Z3ZA 2P3LA 3JXEA 4JX8A 4WSOA 1ZLXA 4YRCA 4Q3KA 2Z3WA 4WUVA 4RF2A 4QUAA 2CVQA 4CMJA 5KX5A 1XELA 2VZ0A 3DBLA 3TCNA 1V7ZA 1WMFA 5DTQA 3LYLA 5K8VA 4URHA 2JDIA 3AEUA 1AIPA 3WNBA 4YYEA 4CCYA 1VE7A 2G72A 2QTVA 1KZHA 1PQPA 4XB6B 4C01A 4Z9BA 1VL8A 2OECA 1E62A 5DW0A 1WMSA 1P6UA 1PUIA 2VPXA 3FXAA 1GQOA 5KJ6A 1F8YA 1N6RA 1BEZA 4F04A 5KJCA 3LUGA 2Z9BA 3AP2A 1WZUA 3HC7A 3SJCA 2OZLA 4UFPA 2FMFA 1EE1A 3PJEA 5H83A 5BOSA 3OCUA 5E6UA 4FNGA 5IHXA 2Q9UA 3U4QA 2CXRA 2P5TB 2PDAA 1NNI1 3GZ4A 4WH0A 4AF7A 4GBMA 2HA7A 4EUFA 2ODQA 1EAMA 2PJUA 4R9NA 1ONBA 3KQHA 4ZOLA 2PFGA 4WY8A 1Z5GA 3VSDA 1PVOA 2YVUA 4Y18A 3RC3A 3SG0A 2X9NA 1TDJA 4RFSA 4QDJA 5HEKA 3JQAD 2SKEA 2GX6A 3DLHA 4LOAA 1HEIA 3GP5A 2AI3A 2BEUB 3R7DA 1U1IA 2IYXA 1B43A 1U9JA 2IU3A 2P6MA 4IVQA 4UTRA 5ICSA 4WCFC 3N75A 1ZNWA 4EUNA 3IAS1 4GVXA 4R1TA 4EA9A 2Q4TA 1YQTA 1NUSA 4ZMBA 1DIHA 1CEEA 5CNMA 1I7DA 3I04A 4GZMA 4Z54A 1TIBA 2QGFA 3UGKA 1E2JA 3PRJA 3M1LA 1K5GA 1YOVA 4C06A 4HWSA 1V6AA 3K9BA 1XTPA 2GJSA 2FPPB 1HM5A 2VDVE 3BZWA 3GDOA 2B6HA 2C3MA 4AL4A 3ZW8A 4C5AA 4RUKA 4ERXA 3OQOA 1DG1G 1OZAA 1E9RA 1A97A 1QFYA 2J5KA 3B6EA 4UW9A 4N8SA 4BMXA 2AC7A 1D2EA 2YW9A 4X3CA 3RLIA 4UNRA 5JASA 5EIFA 1RJEA 4L78A 3OKPA 2R96A 3DEJA 1AHPA 1WHTA 3ZY3A 4PR0A 2GD6A 3LRXA 4OBEA 1M75A 1X8JA 4Q93A 5JROA 1CIPA 1BN7A 2J8ZA 2OORC 4FI3F 5BV8A 2EKZA 5JCJD 1U4NA 2GN0A 1U3FA 1B6RA 1XRQA 3JQBC 4LQCA 4E6EA 3RIEA 2Q9CA 4IGEA 3F5FA 2W71A 2ZYIA 3GP3A 2OZLB 4NBWA 4NV0A 4CLEA 1R6AA 2B1GA 3MOIA 3ZE2B 3TRKA 4HS4A 2I0FA 4DUGD 5EJ7A 2Q6TA 2DWPA 5ALMA 1CJTC 1N25A 1EB8A 5FJIA 3FDJA 1W94A 4GQAA 3AERA 2HU7A 5CB8A 3T52A 2PGNA 5ADWA 1D0VA 1V11A 1TNDA 4NYMQ 4O4HB 1O95A 2X0NA 3DOOA 4GMXA 4W6ZA 2W83A 4WWHA 1XEFA 4F4HA 1I14A 3INNA 5IUKC 1RHRA 5ARBA 3GLVA 1FSSA 3WLPA 1YE5A 2BV3A 3AYZB 1MP0A 4JR0A 3DE4X 3GA7A 4HG2A 4ARZB 4YECA 2CYBA 4GRIA 4KKVA 4N0DA 1Y42X 4X91A 3ZLTA 3EOBI 1EEHA 3DVAB 2HU5A 4QNNA 3WGKA 2ZYVX 2EHDA 2H3HA 3K6SB 3G8CA 3DHYA 3CCBA 2ONJA 1KJIA 2GA8A 1IK4A 4Z3DA 4BX3A 5IM4F 4XLTA 4A0GA 4RV4A 3ZQ4A 3WXMA 5ALJA 4BJ5A 4UM5A 1P2SA 1UEXC 1FTSA 3GOQA 4P58A 3G2MA 1JV2B 1VBKA 4RJLA 2CV1A 2CYCA 1R2QA 3HYLA 1ZVMA 1MUUA 2JGFA 2QUJA 2ZKIA 2D0PB 3IUMA 1QVZA 3JQRA 3IR7A 1MAVA 4LHYA 5JXJA 4HB3A 4UUAA 1SXJB 5BWCA 1QE3A 1ZPDA 3OF2A 5IUJC 2NU7A 4OKNA 1QZ3A 1V35A 1Y1QA 1YNOA 4TV8F 4PXAA 5JAPA 1C0IA 2BFBB 4G0MA 1ZS9A 1I7LA 5KSZA 1AHIA 4V0NA 2JCBA 1H6AA 1WX1A 5C4MA 2OBFA 2JRLA 3OFND 5TMDA 1IWOA 1XLWA 1QHFA 2NAFA 3A28A 3BFXA 1IXRC 1OYVA 4PX2A 5KCMA 1H4QA 3FBGA 3V9AA 1VLMA 4NPAA 4LTNA 1OC4A 1Z6ZA 1TJ4A 2NZVG 2RK6A 1IN8A 4CM7A 1PIWA 3PI6A 1RIIA 2V0CA 5E1OA 1N0UA 5CDFA 1T8WA 3C6QA 2XMZA 3V8RA 4LJYA 2IPNA 2WJVA 5H81A 1E1QD 4XE5A 3AKCA 2YMLA 5AVSA 3PGKA 1FXSA 3NJ8A 4G89A 4B40A 3DTVB 3IQZA 3W1EA 5ITSA 4C78A 3AG6A 2A30A 2R8PA 4JJ4A 4Y9DA 2NZWA 3ILVA 2NQTA 5EP2A 1OXVA 2YWCA 2FK8A 3TM5A 2AW3A 3MTQA 1TZBA 5EPUA 1QHYA 2R8RA 1QZUA 4H60A 2X42A 3L82B 1KZ1A 4QXOA 3KUUA 1ZBQA 1KOJA 1UBUS 4WK4B 5DI9A 4TTJA 5IDWA 4PZEA 1JHAA 2PFSA 2R97A 3HLTA 1UJ2A 4YGYA 2W43A 5FL7A 1YDHA 3GZNA 1KJYA 1P5HA 2I22A 3TSYA 4DQLA 3FNEA 5K8CA 1TECE 4OQFA 1XZPA 2WTMA 4G0QA 2X8JA 3QBTA 4XR9A 2AOTA 2JDID 3BE5A 3HEAA 4YXWA 2XE8A 2QXUA 1HE8B 2RGNA 2ETXA 2VF7A 3AUJB 5AQEA 3UWSA 1AUQA 3G6WA 1EFDN 3QUCA 1NJGA 1T4MA 5E1MA 3JVIA 5F2OA 1T0JB 1OFGA 5DU2A 1Y34E 2H57A 4RENA 4IOLA 3BX1A 3FB4A 1RQGA 4BFWA 3V8EA 1IXSB 3HGMA 4MPPA 1U2RA 4YJFA 2IV7A 2WKSA 2WF5A 3CO0S 4DB4A 3SOPA 2W6JA 3A05A 1X1QA 2HFKA 4MP3A 4BPRA 5FTLA 4CW7A 1L5WA 3O91A 2QZ9A 1A7UA 4NBKA 1AC5A 3QPWA 1Z0SA 2C1EA 5HGJA 3WI7A 4BO5A 2FU5C 1ZJ6A 2RHCA 3D31A 4BX2A 4JVNA 2BMFA 2Q2NA 5ALEA 3JQAA 1NN3A 2H65A 3MWEB 1QIEA 2AFHA 3S2ZA 3SQOA 2QSYA 3U3JA 4MRMB 5J43A 2NTEA 4E5NA 1T1IA 3E9DA 2VWQA 5JJLA 4ZP1A 2H1CA 2CXSA 1JLHA 2VYVD 5DN6D 3RASA 2FZGA 3HKCA 3I0NA 4LFBB 4M9CA 1IDN1 3LY9A 1D4AA 3T7SA 3VGPA 5B2EA 4YJFB 2O3QA 1O6CA 1JFLA 1U31A 1X13A 5I4CA 2GK6A 2IIBA 3WSWA 5KPDA 1B2LA 4B6RA 1RQ2A 4K9RA 3B13B 1WXDA 3PC3A 2B82A 2XOKA 3OTQA 3L01A 3F7MA 1MJHA 4KFTA 1OXSC 1TM3E 2CFTA 2IV3A 1AA6A 2GETA 2YXDA 2P65A 2FFBA 2CJPA 1W85A 5DYTA 1IMOA 2D8MA 4BNIA 2NYAA 1TEVA 2ZIEA 5IAJA 3L7BA 5IFKA 2XMBA 2ZIVB 2QY9A 2V1XA 4MYUA 3TKAA 1WUJS 3I42A 3U7QA 4KV9A 4WAUA 2AJDA 2GM4A 3ZQKA 2Q3FA 4DUYB 3O4HA 3U40A 3WK6A 5GQSA 1XBTA 4QPNA 1E58A 3TR5A 3TD6A 4LYJA 2ID7A 5CDTA 3T3OA 1BVRA 1ORHA 4Q9KA 4P36A 2ATVA 3LUKA 5G3ZA 1C4KA 4QLOA 1M5TA 1OZGA 1XKTA 4NU8X 5ESDA 3TZQA 4CQMD 5JU6A 3M4JA 2CZGA 4RTRA 2VWGA 1EDZA 2IYFA 4ZDIA 1UZLA 5E4JA 3P9KA 2GCOB 1KJQA 1Z0ZA 5AI6A 2ZQ5A 4EPTA 3JQEA 2XZLA 4V02A 4W5QA 4PU0A 4P34A 4X8LA 5SZHB 2ICAA 1RQNA 2O6LA 1ZRHA 2GVNA 4QGBA 2VTEA 2QVXX 3GG9A 4L2IA 4HVLA 3GZTB 3T9CA 3O75A 1DUVG 5P21A 1THZA 5KTPA 3KJNA 4DLBA 2XLCA 3EZNA 4J4BA 1K8QA 2VDWB 4I0WB 5B1HA 3UXMA 4OSEA 4LWQA 9MHTA 1FRFS 3ZUPA 4BO4A 2O23A 1FFEA 3VNVA 1DAGA 1Z9BA 2AR0A 2JCSA 2W6MA 4L9SA 4MMXB 3I5YA 3BA1A 4INZA 4G1CA 2J5RA 1LZLA 2REQB 3M9XA 3O90A 2X3YA 4R98A 5DOZA 3TKLA 5LQUA 3TG2A 3A9SA 1JEYA 1R0BA 1KMHA 3O26A 3IB6A 4K6HA 1C4XA 1YQGA 2XD9A 3VPSA 1LQTA 1E2PA 2P27A 3HH8A 4F71A 2UZ1B 4OA5A 3HJFA 3QHQA 2XDQB 2WJJA 1P0FA 1Q91A 2JGJA 2XKAA 3PHCA 4WDQA 1ZEMA 3MS2A 3ASYA 1NNUA 1PZEA 1QWSA 3R3XA 3Q2KA 3K35A 2PU5A 4TMZA 4GKAA 3GLHA 3X43A 1U8FO 2OGWA 1Z16A 4G07A 1K1EA 5CIQA 2RD2A 3EPHA 5DX1A 3RVBA 3NIDB 1F1BA 1O7JA 4P4SA 1W34A 3HJUA 4E12A 5TF0A 3DZJA 4FNMA 3I6YA 5H3LA 2Q8PA 4EG8A 4XTCS 1V4NA 5EYPB 3RIYA 2OESA 4LISA 4CM8B 4RTMA 2CBXA 4N9QA 1RZRA 3DKRA 2I2CA 4RJTA 2I8CA 4CRWB 1A9OA 4YRPA 3SSMA 1P1JA 4QJ3A 1E5XA 3G0DA 4LFCB 4KXXA 4ENRA 2ZXUA 1Z2CA 1P1BA 2YCLA 5DM0A 5EWLA 4NYIQ 2HMAA 1FXWF 4JXXA 2QORA 4Y1RB 4CKWB 2JJYA 3QVVA 3ZDZB 4ZVUA 2PR7A 1N7JA 1QB8A 3ELWA 3BQMB 1U4SA 2NQ8A 4WLFA 3RS3A 3UK2A 4S1PA 3OM8A 3I12A 5KTNA 4KDEA 1SC6A 2G82A 5HXAA 1FRZA 3SR0A 3HCRA 2FQWA 5A1TA 3CT4A 4DLUA 2Z83A 1U8TA 3CLKA 2RH5A 5SV2A 5TQ2B 1OCEA 5KNDA 1QFJA 1PSDA 4CDMA 2RMKA 4YDSA 2XIQA 4LVOA 5AW6A 5LKAA 1W0JA 3PR1A 5IAAA 1V8ZA 4BP8A 3EXG2 3P5BA 4CG3A 5HJ5A 1DEXA 3OQNA 4O0LA 1V48A 1AKMA 1A9TA 2G70A 5HQJA 5HQ3A 3E3MA 4FFNA 5IN4A 1KA9H 1U1CA 1X8XA 3VM6A 5F1KA 5I7HA 2VZEA 3O2JA 2XV1A 2YYAA 3QQ5A 4O1MA 1E2IA 3TNDA 3TSOA 1ZH0A 3F71A 4L74A 1USGA 4D4GA 1QLJA 2QTZA 2HLDD 4JXJA 4MGKR 2IXGA 2I4IA 4BZQA 2WY2D 2MTBA 3D5TA 3FPFA 5B7GA 5E4YA 5FA8A 4M49A 1RKUA 4NE2A 5KHAA 5A0VA 4WQMA 4KV7A 1TLLA 3KQPA 4QOGA 2D0IA 2ZRAA 1FXUA 1N3BA 4KODA 3GUCA 4IJMA 2JGEA 3EIHA 4DV1B 3TEJA 3IP8A 3MWKA 4KJZA 5A03A 5F7XA 3CUWA 3AM4A 1ENZA 3NVAA 2WOJA 1PVVA 1WAMA 2GPJA 4C4SA 3GNTA 3GZJA 4OYHA 3ZX4A 3C8MA 4TLCA 4U8GA 3QOYA 4WVFA 5CCDA 4LF5B 4IWXA 2ZU0C 1EFPA 5EE1A 3L0BA 4AWXA 3S3TA 1KYZA 5KVAA 4HEJA 3BRSA 3VO2A 1HE3A 4XJVA 2OILA 4K86A 2KX7A 1JAYA 1BW9B 2EZ8A 4YIHA 4FMDF 1X7ZB 1CF9A 2RKWA 3SQXA 4R5HA 1ZCFA 4G09A 3W4JA 1ISRA 4KIJA 4O2AB 2CJWB 3WGOA 1DVRA 1RE1A 3HXMA 4Z4QA 2VEDA 1GU1A 2XCLA 3EGCA 3X1WA 1E7WA 4K9PA 3WHPA 3DBRA 3LDGA 1VMKA 3GLFE 4FOTA 4FN5A 3Q7SA 3T4EA 4RZ2A 4FSDA 1JLSA 2VAPA 1LK7A 1DZ3A 1WU8A 4NZNA 1R7RA 2IS2A 1T4DA 1IHOA 2CUTA 3EUAA 3BRWA 4ZHQB 2RK4A 1A8IA 2P6RA 3LXMA 3EIQA 3OCCA 4L57A 2K5UA 5A5DA 1X2BA 2Q6VA 1SIUA 1EUZA 2I6UA 2LZ0A 3DVLA 1RXCA 2W4QA 3H2YA 4JDUA 4EB6A 2UUBB 1M67A 3N8IA 5EIEA 1WMDA 1ZM2A 4JOCA 2R6JA 1WVIA 1ORIA 4LC1A 4M7PA 5EIWA 1R15A 1JHOA 1BG6A 3DE3X 3KYDA 3OVMA 4KLAA 1KSGA 3JAMA 1M83A 2O1XA 3D9QX 2CLHB 3F6SA 2NZUG 3I3SR 3RYIA 1CLEA 1XDSA 2J48A 3H9QA 1Q7CA 4HZGA 4OXKA 5GVSA 4XGQA 4QRHA 3ZDYB 2UYHA 2P79A 2W6ZA 1I24A 1U8EA 2Q1SA 4HNSA 3THXA 1PEDA 4RVUA 1K27A 2YC2C 4HWRA 1MNQA 2D5BA 3DMGA 3IP6A 4IIXA 3WWPA 3ZI4A 4J4HA 4LZOA 5LBIA 1RYBA 2IYZA 2PNFA 4YRBA 1EGMB 4AROA 3DEYX 3RRYA 3R7WB 2QPLA 3ONEA 2YZ2A 1OXUA 2C7GA 2P35A 4MO9A 2WP8J 4X63A 4B35A 1DARA 2A67A 4CKYA 1IYZA 1MORA 2J67A 2O8CA 1BFKA 1UC5B 1TCAA 4CWAA 2CLLB 1GPUA 1XALA 1UT6A 4Z7NB 3BFJA 3CN9A 2VCHA 1FTYA 1OTHA 2EFEB 3EW7A 2AFHE 1I1HA 1PFQA 1CE8A 4ON9A 1EVJA 2LW7A 1AKYA 5EGSA 4CF3A 4EMSA 2GF2A 1EX7A 4I5EA 2AC4A 2I6XA 4V2IA 4RZIA 3CX3A 3MZ0A 1QKJA 2DPYA 2W2PA 3TOVA 3TB6A 3X2EA 3DWIA 3EBOA 3SC4A 1P3Y1 3H65A 2EP5A 2QMUA 5FPYA 3PXGA 3FCXA 3CX7A 3KVVA 1QGYA 4NBNA 5L7TA 1ZIOA 3A6KA 3MINB 4NX2A 2PXAA 2ZUCA 4POAA 2WMOB 4D57A 2OCAA 2BTOA 1URPA 3GQBA 3I01M 3GVXA 3N7TA 4KKXB 3PK0A 1BKDR 3H9UA 4P3PA 1V5IA 2QI9F 4QDTA 3TCKA 3EK2A 3ORQA 3MJDA 1IBCA 3ACCA 1T5LA 5F3WB 3PEYA 4ND8B 6REQB 2J4CA 1JR3E 1YDMA 3FGPA 3L18A 4L9WA 1RWQA 4GDFA 1RZRD 1ZR2A 1QHIA 1Y7IA 2WSSD 3FFXA 4KQXA 2R7LA 5FI1B 4G1FA 4Z3OA 4A15A 3LPNA 1LNZA 1QJ4A 2D4AA 2Z4RA 2Z8ZA 3DYVA 4KXUA 1P7ZA 3E9NA 3AK4A 1U2DA 1Q17A 3LKVA 1PR2A 1P2BA 5IG2A 1YR8A 1KBQA 3ICVA 3PLNA 1WCWA 4PBRA 3GJ4A 5EQTA 2CNKA 5DGXA 4EY8A 2ZWVA 1T4GA 4NOLA 2POCA 3NBKA 3QW2A 2AKAB 2MT9A 2OORA 3QW4B 2X19A 1N2GA 4CT4B 1YZYA 4M1WA 3KM0A 2NXNA 3TUIC 2R86A 2KLBA 2WSMA 1XTRA 5A7FA 2ID9A 1Y7HA 5KHLB 1R00A 2PUTA 2A9PA 4WKCA 2O2SA 5EPEA 1B0PA 2ZW9A 4GO1A 2PX5A 4QUDA 3RV3A 1PO7A 1V1JA 3HPRA 3FN4A 5B6IA 1HDYA 3OWXA 4IXWA 2VNSA 5CFZA 1A8QA 1FMCA 3DULA 2AKEA 3MJVA 5CM9C 1M34B 1FTNA 4YJ3B 2ZUSA 3AVTA 4CGZA 1Y5MA 5FCDA 4GU5A 3VU8A 1DBRA 3BMCA 3KX2A 5CLIA 3V97A 3DZDA 4QHYA 3GFQA 3PF8A 5TNXA 3SBDA 5LNK1 1G5PA 4QWWA 5ES3A 3TB4A 3WRYC 4JSRA 1P8AA 4MUGA 1W29A 3CZ5A 1AA3A 1BXZA 5AVVA 4D6PA 3RF7A 3TMKA 1KEEB 3ZDRA 4HUTA 2FK7A 2I99A 5DLPA 3CM0A 3IDFA 4JKYA 4RH1A 5ADHA 3RK1A 2CJFA 3U31A 3T7JA 3WRXC 4Y9UA 4WA7A 5J5AA 1G5FA 1JLMA 1VI5A 3HRIA 1VG0B 5HA5A 1PNOA 2PKRA 1GGJA 4IXNA 1NXQA 4KR0A 1JSLA 5LOVA 2VYCA 3RBVA 3F7TA 4R68A 1U0EA 1NOKA 2J32A 2B35A 4BO7A 3L1VA 4HTFB 1QORA 3FMVA 2OYRA 3JRWA 3LPCA 3HL4A 3GMTA 1DC3A 1VLVA 3D0RA 1GV1A 3KPUA 2HPAA 5EKTA 3BKXA 4PQEA 4ZQHA 3TFQA 4N39A 4LSZA 3ZWWA 3BICA 4RE5A 1SKYB 3FDFA 3CBGA 1NVUQ 1PR1A 1R0KA 2Y9PB 3PLRA 4NCKA 1U81A 4ZCPA 4DIKA 1J8YF 2NO4A 4XQ0A 1YUBA 1PYGA 4XGKA 2ZU6A 4RIFA 2H1WA 4IKOA 4K81B 5HMLA 1QIGA 4MUYA 4B45A 5J40A 3OTGA 2CLOB 4RL6A 4RPCA 4M1MA 2A9JA 4TRNA 5K6AC 5CLLA 4MYRA 4U2KA 2D2IA 2CKMA 1VE9A 2BJWA 5H82A 4L50A 1TA0A 1VJRA 1Z83A 1QC5A 1QIJA 1RKVA 2QAIA 3EUEA 3FSGD 3LHDA 4H08A 4UPDA 4TL8A 3T5CA 1JPNA 4CQNA 4CLHA 2PL1A 2Y1FA 4X1OA 2FMKA 3WTCA 2YWGA 3KKNA 4K9DA 1OLXA 1E2FA 1R4NB 1D1SA 5B7PA 5FB3A 2XE6A 3WKBA 1TQ4A 3BRWD 2CFCA 2C7PA 3ZY4A 4EHJA 1N1MA 1RRMA 3UJHA 4EHLA 3KT6A 3ZZ0A 3IEPA 1TKCA 3BSYA 3BD7A 4G0ZA 1U4OA 4XIIA 3RTEA 4I08A 4F11A 2JD0A 5BO5A 4GOLD 2BFCB 5LZ9A 2YXBA 4O59O 3OLCX 1JU9A 3RBAA 1WV0A 4DUGA 3ME5A 4MQEA 4NU6A 2B25A 1EVQA 2NVWA 2WPDA 3A1VA 3CLTC 1QLHA 4IHQA 1QG4A 3MOGA 4FE7A 2XITA 5DT9A 4FW9A 1S2LA 1A0OA 3FZEA 4F2DA 4FB4A 1IXYA 3GRUA 4JH0A 1RP1A 5HMMA 5G2OA 2GN4A 4YCLA 3QOFA 1N32B 1G64A 5BNTA 2JIBA 4JI1B 5EOVA 1CETA 1XLVA 3EWAA 4UXHA 5F35A 1OFUX 1V9CA 3E5HA 3LQ4A 3GLQA 3QPCA 4XWGA 5CNJA 3TSAA 2NZJA 2CV2A 1E66A 1TKRA 1L5YA 3FMPB 1WOMA 5FLKA 4ARIA 3OE1A 3RFFA 4Y2HA 4PG5A 3CW9A 3EZLA 2HWXA 1X80B 3OLXA 2XZPA 3PNVA 1X1RA 1I36A 4YCJA 4QHTA 4I3GA 2MMCA 3B1WA 3TYXA 1FMTA 1YS1X 1TTPB 3WAJA 2V9CA 2YFKA 1MXFA 3QYAA 2BEWB 3HJBA 2WQ7A 3LHIA 5MF6A 1OA1A 4TLBA 1F51E 5FOXA 2WKQA 5CX4A 2C0QA 4PLHA 5FULA 4JEHA 4B4KA 2EVWX 1RKBA 2ZTMA 1P1FA 1OLXB 1EUDB 3L02A 4LTMA 2K2QB 2C54A 1TF5A 7MDHA 3S1AB 2PUFA 2OAGA 1A7JA 1G8FA 1MB2A 2QN2A 2E7ZA 2WA1A 1HDCA 3CBQA 5EJGA 4CIXA 1CUVA 4WASA 2PKXA 4WZZA 2XRYA 4I66A 1OH6A 2ERYA 2V6GA 3H2SA 1N9ZA 3MBIA 4JI8B 2R6CA 3NT2A 4AX8A 2R6R1 1ZUD1 1YMQA 3KYBA 3LGSA 2GSWA 1M7HA 2IX3A 2CEKA 3RS5A 2W2NA 1ZC3A 4US0R 4BVEA 3O6VA 3L0OA 4CEJA 1LPOA 1MQ8B 3ZH2A 4MYSA 4RVNA 3UUEA 1E1QA 1RJ9A 2FGKA 4B48A 3U9LA 4DMLA 4KAXA 1WRBA 3JAWA 2PL3A 1UPCA 1QPGA 1MB4A 2PA3A 2VDKB 3L79A 1YJCA 3P4UA 2P6UA 4CN9A 2I2XB 4WPGA 4E2XA 4YNBA 1JAHA 3IKMB 1L8QA 1MJGA 4FGWA 1E2UA 3JPWA 2ATEA 3FTCA 2EKBA 3P2JA 1HT3A 3MIZA 5IKPA 5KYNA 2I67A 1RWXA 2VCYA 2CNDA 4QUJA 1NUPA 2EF1A 2FFHA 2HGZA 3GLKA 3HKBA 5AXCA 4A0SA 4AZ3A 5H9WA 1U1DA 3ITNA 4IV0A 4C2TA 1X39A 4MUFA 3ZHTA 4ALIA 1G6OA 4M7OA 3TDKA 2GN8A 4O2LA 2E18A 1BOOA 2Y0BA 5AM0A 3MTDA 4X3OA 4BATA 2JB9A 5B3KA 3RFVA 4HNGA 4UOZA 4NCXA 4C3UA 3FFBA 6Q21A 1IEQA 5TV2A 2P9YA 5C51B 5DBGA 3L93A 1RWMA 4B0OA 5I9SA 2QLTA 4FJ0A 1CERA 1XA0A 2A5FA 1LRKA 3RS7A 4QGSA 1RLMA 3GAFA 4W8OA 4W9NC 3UJ9A 4QTYA 3GT0A 2R68A 3W78A 3GJXC 3TIFA 3THWA 2D06A 1JSCA 3X1MA 2FA9A 3TDNA 1ISSA 2OTCA 5DMXA 1AHNA 1EGAA 2BM8A 2W6JD 2FWRA 3URKA 3W5JA 2YWHA 5KHOC 2D0DA 4MHOA 4EG4A 3DXYA 1VBFA 2C96A 1DEHA 2FTKE 4OL9A 4IIEA 3O9VA 3T94A 4NTZA 4YK7A 4JXKA 1UM9B 4MMYB 2Z1NA 1IATA 3KTOA 3DL2A 4JP8A 1LKZA 1LJLA 3KT0A 1E9SA 5CFRA 5M7EA 1GPKA 4LZPA 4DA7A 4HF7A 4B3HA 5JZOA 2UUAB 4F60A 1GU7A 4OQNA 2WFLA 1U9ZA 4NG5A 3V6MA 1YOBA 4DPMA 1PKXA 3PWTA 1NNLA 1QJCA 2YUTA 1TKAA 3DOFA 2P78A 4OHCA 4TRJA 1P45A 1KMQA 4Y2JA 2VYFA 4IZ6A 2Q0XA 2XH8A 4IMRA 4C6TB 3ZDDA 1IRXA 2AG0A 1IH8A 1DRUA 1M1YB 2CE2X