2ZREA

Msreca q196n atpgs form iv
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
330
structure length
320
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 92
structure length 320
sequence length 330
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zreA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zreA01
2J0UB 4B3BA 1GRNA 4OK3A 4WAUA 2D74A 3KFXA 5J4KA 2CHGA 2FGKA 4V03A 2GKSA 3KUDA 3U4QA 4G5RA 4QXAA 2HJVA 1E9SA 4C30A 3CH4B 3Q72A 1W4AA 1VHLA 4B73A 2IS4A 1XZQA 1P61B 4YMTA 1VG0B 4URXR 4HLQB 1UBGA 4TL6A 4C0LA 2JASA 1L4UA 5DI9A 3RS4A 1BIFA 2B7BA 4I1UA 3VAAA 5BW8A 3HP1A 3QF4B 2WMOB 4CDGA 5JCZA 3L8YA 4UJ3A 3LX8A 4Q7LA 1T0JB 2ZI4A 2JLWA 1Q3TA 3CB4A 3QNUA 3X1WA 5K8TA 4B3FX 3RS5A 3VMFA 1NSTA 2WSSA 2ZE5A 3H2YA 3TQFA 2W00A 1W5SA 3C41J 2ZRIA 1OT3A 1US8B 2XNDD 3CRMA 5A0FA 4B35A 4QM7A 4AY2A 2IYQA 2V9PA 1XU4A 2QGZA 4F91B 4J0QA 2J41A 4OQFA 4X8OA 1X6VA 1M7BA 1RE0A 4B6EA 1NN3A 1Z5ZA 2GETA 1OLOA 1G7CA 1BOFA 3BE4A 3BB1A 1RJ9A 3BORA 3P26A 1E0AA 2ODBA 4TZ0A 2VRWA 4MRNA 1L4YA 3PUYA 4M21A 4DLYA 3I4LA 1W44A 1OPXA 4QBIA 3MWJA 3MJHA 4GT1A 4NCIA 3K09C 1JXMA 1M34E 1R8QA 2JIZA 3N70A 1NP6A 2BBWA 4JVMA 1MO3A 3A6PC 1LB1B 2CNWD 1KJWA 2J7PD 4WZBE 1D2MA 5JI3E 1R2QA 2EW1A 4E07A 3MWYW 1CJUC 1E9DA 4OI2A 2ASEA 4BASA 3D7MA 2ZRBA 1CR0A 2JLYA 4NU0A 2AX4A 2XOKD 3FFAA 5CB6A 4TMKA 4L5BA 1NN0A 2N46A 4E5UA 2IF0A 1WBDA 1Z6AA 2OHFA 2P2LA 2GRJA 4BFWA 1KTVA 5JZVA 3PCRB 4ABYA 1CJMA 3IPXA 3W3ZB 621PA 1MO5A 2ZM5A 5IF9A 1XJCA 2WWYA 3MAAC 1JECA 1TPZA 2CHQA 2FN4A 1ESNA 2CLDX 4Q03A 1X3SA 3WYAA 3SYLA 1EFCA 2WZQA 1E6CA 2NZ8A 1NN1A 2W6IA 3FDIA 1ZD9A 2OO7A 1MO6A 4IDOA 1IM2A 1K5DA 4TLEA 4TTPA 3EPJA 1ZC3A 1COWA 2DWPA 1FZQA 3KQLA 3NKVA 4O25A 4EJSA 4PPNA 2NQ2C 1KSJA 1X1RA 3GEEA 3TBKA 2CEAA 2BEKA 3GLFB 5CLLA 3FE2A 1G19A 1QBKC 3TW4A 1CULC 2B6HA 2WWHA 4R9UC 1ZUHA 4GOXA 2CBZA 4R7ZA 4RZ2A 3SC3A 1II9A 1PLKA 3A37A 2FMXA 2VHTA 5LBIA 3BOSA 3MLEA 4CEIB 5L3VA 1PLJA 1T5IA 3FMPB 4A9AA 2AFHE 3SE0A 3A1SA 2OG2A 4RFSB 3TGPA 2G1KA 1XEFA 4LGMA 1ZM9A 3NIBA 3ZD6A 3R9IA 1A5TA 1KK2A 4G5SA 3IQWA 4FMBB 1OH7A 2JDID 4LJ7A 1E0JA 2PZGA 1ZJ6A 2WWGA 5TVKA 4JBXA 5JBQA 1T6NA 2ZJ5A 1XEXA 2GZDA 3NHBA 2DYKA 4MH0R 4Q18A 4AC9A 4A2QA 3HU1A 4PC7A 2CL6X 4B74A 1S1CA 4A4DA 1RPZA 4JBWA 5FR1A 2J7PA 1G4UR 1E79A 1Z0KA 1TUEA 2WWFA 4V0ME 5FI0B 2P5SA 2JEOA 1WBBA 4I99A 1YZTA 3UG6A 2QNRA 3OEHA 1Q1ZA 4ZDIA 1CR2A 5HZHA 3KTAB 1IBRA 2ZQ5A 4L4UA 5G40A 3PR1A 2KJQA 4JT4A 3GLIB 1MOZA 4LV8B 2OFOA 1Q3HA 2WKQA 3F8TA 1D5CA 2R6AA 1GSIA 2IBMA 2VF7A 4FI3C 2P67A 3GLGE 4P31A 2O8BA 2NO7A 4A1FA 5SZJA 1NRJB 4LI0A 1OXXK 2PZEA 3TJZA 3PEUA 1XD2A 1AA9A 2YOGA 4OBEA 2ATXA 4Q9JA 2YWEA 4HSEA 2Q21A 2XEXA 1G9XA 2HDNB 4FINA 5B30A 3C4JA 1P9WA 1BYUA 1YHNA 2PT7A 4D6PA 4D4MA 4DWJA 3AF2A 2FSFA 3DL0A 4QNRA 5J5CA 1OV4A 4OKSA 1SVSA 1CR1A 1I4LD 4PAMA 2BJVA 2ZR9A 5KU1A 2HLDA 4G5GA 4NMMA 3P4XA 1U9IC 3L43A 3KKPA 1S3SA 2CCJA 3GJ8A 1A2KC 1N3BA 5EP3A 5IHPA 4D0GA 3FKSA 1ZIPA 2FGJA 1Z0JA 4Q02A 3IKJA 4M1OA 1ESMA 1W0JA 5BN5A 1QRAA 5K8IA 3PVSA 2I1QA 2GXSA 1CTQA 1OHHD 4NYJQ 2WPDD 4HUTA 1BO6A 2IYVA 4LDJA 4B32A 3QKTA 3B8HA 2F1IA 3QXSA 3WY9A 4QKQA 3C8UA 2XAUA 3AP2A 3GLHE 4DLRA 2CHVA 1XJ0A 5KO2A 2IL1A 4XVQA 2FG5A 4S35A 2WM9B 4AD8A 3QENA 4LJ8A 1YR8A 2Z6VA 1KI8A 1Z06A 1KHTA 2PMDA 1MABB 4RY2A 5G3ZA 4IKEA 3NH9A 3WBKA 2DFNA 1EXMA 2JLQA 2VP0A 3NG1A 5EZ6B 4HUQB 2C96A 2A7QA 2OFXA 2WJYA 5JS8A 3T34A 2ZS7A 5E7IA 4KYIB 4WXPA 3MSXA 2X1VA 4ZCMA 3LQRA 3ZQ6A 1KMHB 3V4RA 2GXAA 2V7QA 4PAOA 4BZQA 2IXEA 1XF9A 4LPKA 4DSNA 2IW3A 2X19A 2XXAB 3CPHA 4HAUA 1XB2A 3QBVA 4QOSA 3AVXA 2ONJA 2JGNA 2IYZA 2OBNA 4UXIA 1TEXA 4X8LA 4TMZA 2QPTA 5GJWC 3RHFA 3W5IA 4P4TA 5FOWA 2V3CC 1PVOA 2O8CB 2UZ3A 4P4UA 3VR3A 2GWHA 3EASA 3ADCA 3QKUA 2YJTD 1KKLA 2QM7A 3OESA 2J0VA 5KSOA 4OJKA 2H92A 4BLRA 2ZI5A 1W46A 3I32A 4B76A 1E32A 5HKKD 1G4AE 2NOAA 2DBYA 1R0ZA 5FBRB 2KSQA 5FOSA 4D25A 1IOZA 1J90A 4EKDA 3K70C 3QEJA 3BH6A 4IEIA 4C2UA 3W3AA 4LK2A 3WXMA 3FKSD 3MWKA 5TDHA 3LXXA 3EPKA 5FFMA 5C4GB 1HY3A 2ZSEA 1SXJC 1UEJA 2W0SA 4JYBA 2OCPA 2PX0A 4HAXA 2RMKA 3FB4A 1FNMA 2IEYA 2D62A 2XSZD 2QMEA 4D2IA 4EFMA 3FOZA 2Z4SA 3BBPA 2UKDA 3BERA 4JLOA 4KBFA 3WHLA 3C14C 3CW2A 1DELA 2J59A 5EE9A 1T3LA 2VHQA 2Z0MA 4B3DA 4L8GA 3IIJA 2H7VA 4YXWD 3RRYA 1JB1A 4V0LA 5EXXA 2KBEA 3K0EA 4DUGA 2OFWA 2ZE6A 3RC8A 1HTWA 3SHWA 4B43A 2IS2A 2C04A 3LH5A 4TT3A 1XPRA 4LHVA 5DGXA 2RGXA 2CK3D 2G83A 5D3MA 1H8ED 1KDPA 1CLUA 1KNXA 1QF9A 2ZYTX 4QGFA 4DLWA 5LDDC 1LY1A 1LTQA 2VP4A 4LY6A 1JJ7A 1LF0A 1BMFA 2JJ2D 4IDPA 1MH1A 1DS6A 1QZXA 2EWWA 2IHYA 3FWYA 4Q9IA 2I1VB 1R6BX 3DPUA 3QY0A 4TMTA 4LJYA 1XXHB 2CXXA 4WBSA 1Z8FA 4D80A 5L3SB 2FSHA 2IUSA 2OZEA 1JALA 2RHDA 2RGNC 2XGJA 3BS4A 1JQLB 4PO9A 3TAUA 2OM2A 1T91A 3BWDD 1X8KA 2PCJA 2BMDA 1TQ2A 4ESHA 1HA3A 4URUR 1U98A 4A8JB 3VNUA 3NTUA 4Q7MB 1Y63A 3LLUA 2MMGA 4Q48A 3K9GA 1TQ6A 4EPWA 3HU2A 2J5XA 1YRAA 1Z3IX 3MWLA 4M2LA 1KI9A 2FZLA 2A78A 3I8XA 2QMOA 4NYJR 5CK5A 1KI6A 3TAHA 2NZJA 4CYMA 3CR7A 1TQ4A 3VR1A 1YZNA 4MDEA 3B82A 1ZC4A 4ILEA 4PHTA 2C5LA 3MG9A 2CL7X 3TR5A 4E09A 5F2EA 5FOUA 3L0OA 3N2IA 4YMWA 3RVBA 3T35A 2C95A 1VCIA 3RWOA 1N6LA 1OSNA 3PUVA 4EPYA 1RRFA 2IT1A 2ZI3A 2KWIA 4QRHA 3VHXA 3QOFA 4C0QC 2QM8A 1LVGA 3NDPA 1NKTA 1QHSA 3TIFA 2ZYVX 1NL3A 2FPMA 3ZS9A 4HLDA 4I1SA 4LX0A 2VP6A 1TQDA 4Q4HB 4B47A 3JVUA 5JWOA 1HE1C 4LYFA 1RRCA 4PX9A 1A2BA 4S2EA 1PV4A 2BMFA 4HDCA 5DN6D 4TQUS 2GF9A 1FMJA 2LCFA 1TU3A 5EQTA 2CDNA 4M1MA 1JR3A 4MKIA 4MRRA 2HT6A 1JAIA 4URZR 3R8FA 2LKCA 2V6JA 3IBYA 2ZRJA 2X2FA 2XTMA 3NC0C 4PC6A 3I8SA 2JA1A 1P2SA 5A4JA 2BMEA 3CONA 2IYLD 3T06B 4CIDA 2ZITA 1XXHE 4BLPA 5CB8A 4O2LA 3CNNA 4AG5A 5DI3A 3DMDA 2UZIR 3K8YA 4NZYA 2PEYA 1AQUA 3V9PA 3I1FA 2FWRA 3EA0A 4H1UA 4TQAA 4DDWA 1B23P 2FOLA 4NKRA 2QQ0A 2Q3MA 4LHWA 4QBHA 1KK3A 1UKEA 4O0MA 2H8KA 4M1YA 2ZEJA 2QPOA 2WJVA 1E2GA 4JSTA 5CM8B 4IFEA 3EW9A 4TSFD 4HAYA 5CM9C 3BAFA 4FIDA 1Z08A 1NLFA 1Q1BA 5K8UA 4JLJA 4QHTA 4IOLA 2ZI9A 4PO1A 3AV0B 5DSZA 5FPTA 3U3JA 2O0KA 3AUYA 4N3NA 1P4SA 3PEVA 3IIMA 3DOEA 4V0KA 1KOFA 2GCOB 1UF9A 2FPLA 2ZJ2A 1X8LA 1QG4A 5DHAA 4YONB 4D0NA 1NI3A 1K5GA 2RGEA 2CE7A 3BJIC 3KXKA 2F6RA 4HB4A 4RD1A 2FFQA 1F5NA 4DZZA 1O3YA 4NTZA 3X1DA 3CRVA 2ZRFA 4C0JA 2AD1A 3FMOB 1OFIA 2ZJZA 5JEDA 3NWJA 4Z54A 2EWVA 1E9EA 4Q1AA 2I3BA 3EZ6A 4GBMA 1DAKA 4OQLA 2BWJA 5EXTA 4AG6A 4Q4HA 2JJ1D 3GLHB 3F5FA 4EIWA 2GCPA 1TTTA 3IPYA 1NKSA 2V55B 1XD2B 4LBVA 4ZDWA 5JMTA 4I4LA 1D9XA 4OYHA 4QGAA 1VCMA 2ZRKA 1XMIA 4Q1FA 3Q9LA 5GJCA 4D81A 4ZIRB 1WB9A 4CF7A 3LAWA 1CEEA 1AZSC 2IYWA 3MFYA 3BC1A 5FPSA 4G01B 3AVOA 3AVTA 1EFRD 1G8HA 4TYNA 4BZXA 2B92A 3CNLA 3NH6A 4OQNA 3KDSE 3ZVLA 4EQ6A 2D3WA 1RC8A 2O8FB 4Z8XA 1YZUA 3U7GA 1DTSA 1E2EA 4C2TA 4LSGA 2ATVA 4DJTA 1M2OB 2WWWA 1VIYA 1LNZA 3BXZA 4BRWA 5KNDA 4OHWA 2WJGA 3CRW1 4EPVA 4YMSA 5IK2A 3BRWD 3ZVRA 3IHLA 2PBRA 3GQBA 1NVXQ 1E3MA 1US8A 1ZINA 5JFGA 1M6NA 2C03A 5GJVC 3KUCA 4M4SA 3GLGB 3TSZA 3AP3A 2VSOA 1R5BA 4PR0A 2EFHB 2OXRA 4AURA 5FBLB 3QKRA 4AK9A 1IXSB 5B58C 2WJIA 3QXHA 4R98A 3RANA 4LJAA 2AHOA 1YZLA 2ZS9A 1XMSA 1KIMA 2VTKA 2ZETA 4CEHA 2ZRHA 2V4ZA 4FWTA 3O47A 3VHLB 4AKGA 1HURA 3REGA 5KSPA 4A92A 2F7SA 2LWIA 3IGFA 3ZZ0A 1CS4C 5TARA 2RGNA 1SZPA 5EP4A 1GRRA 2KE5A 1E9BA 2GCNA 2R2AA 1NJFA 4BFYA 1KJZA 1N0VC 3AF1A 4IW3B 2XZPA 1HUQA 2PJRA 2BM1A 3P27A 3ZQJA 4A0HA 5KUTA 2F43B 1E2HA 1KK0A 2OESA 3SI7A 2AXNA 4TL9A 4IXMA 1SVWA 3HJNA 3THWB 2ZS8A 3V00A 1NIPA 2RGDA 3WMFA 4B2PA 2BM0A 2F1JA 1SXJE 4ASUA 1UEIA 3B13B 4PQFA 5BQ5A 4ZV4A 3EWAA 4Q7KA 3DZDA 1G3RA 2HCBA 1F2TA 4DLUA 4OI0A 4MKFA 4D4JA 4F7WA 1GKIA 3C7KA 3AGPA 5JWHA 4JSYA 2HV8A 1ZM2A 2PH1A 4Z1MA 4DRZA 1A4RA 2EFCB 1J8MF 5EE3A 4BEJA 1KI4A 5HZKA 2D7DA 3A36A 3VQTA 4AYTA 4C0HA 3BK7A 5K8LA 4BFZA 5C4MA 1AZTA 1SXJD 2A3RA 3W6PA 3OAAD 1KZ7B 2HF8A 4OK5A 1IXRC 2W2VA 3AVWA 1XPUA 3GLFA 4ARZA 4M9XA 2JJ2A 4UQOA 4R71A 2IS1A 4WXRA 2PT5A 3K1JA 3X1YA 1XEXB 1AM4D 1U8AA 3EZ9A 4GZLA 3WP1B 4MUAA 3LV8A 5AUNB 3GEHA 3U5ZB 4RVCA 5EZ5A 2OV2A 1HT1E 4IDHA 3JVVA 5L3RA 1CU1A 3UG7A 1XEWY 4NCJA 3ECCA 3GLGA 3PFIA 2AR7A 4NYIR 1OH6A 2EFEB 5CJPA 2CJWB 2GTPA 2FJUA 1P9NA 4A82A 1KSHA 4N1AA 1F2UA 1ODFA 2X77A 3G5UA 2GXQA 2PLRA 2QE7D 4F92B 2XNSA 2D2EA 2NGRA 4LHYA 1NMYA 4HYYA 5D3MB 3LA6A 1G64A 4M1TA 4DLXA 1UAAA 1P62B 1DO2A 5FH9A 5A5GA 3OEEA 4TTRA 3NBXX 1KI6B 1NVVR 3TVDA 1SQ5A 1E1RD 3CF0A 3QSYA 3U3RA 2OILA 2B7CA 4G1UC 3G0HA 2EU8A 2WIAA 1P3JA 2CE2X 3HPQA 1YJ5A 4QGGA 3A1VA 4X8HA 1CJTC 4GDFA 4PSKA 4QBGB 1Q12A 4LV5B 4JLDA 5F9HA 4MYUA 2GF0A 1NIJA 2XNDA 3A4NA 4G5OA 3MRSA 1ZCBA 3L82B 4MGIR 2V6IA 3E70C 2FSGA 3OIVA 5DNYB 2N42A 5J4HA 2FDCA 3IQXA 4QNMA 1OXUA 4HLUA 4NPHA 4E22A 1ZNWA 2I4IA 2ANCA 3VR6A 1S9DA 3WP0A 1N6OA 4US0R 3VX4A 3W9YA 3PEWA 3U61B 3REFA 1Z6XA 521PA 3TK1A 1KKMA 2WKRA 5C46F 3H86A 3QXXA 5C2JB 2HJGA 1OIWA 1U9IA 4BEBA 1EWQA 2IYSA 1GNRA 4GI7A 3TE6A 1MR3F 4DCTA 4M8NE 2WBLC 2D2FA 2RGBA 4OHXA 2VPPA 4PZYA 1U81A 4QJ4A 1HH4A 2ZJOA 3LX5A 1R5OA 4FCWA 1C4OA 2BVNA 2RHMA 1FX0B 2N1BA 4NE2A 2P6RA 4URWR 5CDFE 2ZIAA 3PV0A 2JLXA 3X2SA 1X8JA 1MT0A 2JLRA 2V54A 1FOEB 3B1VA 4GMXA 5J40A 4C0AC 1YKSA 2JLZA 3CH5A 3D3QA 3K53A 1P75A 1FP6A 2VHUA 4I1OA 4AWXA 3IO3A 4PSVA 2QP9X 2AN9A 3R9XA 2E9SA 3QKSB 1Q44A 1FQJA 3L8ZA 4KFTA 2NPIA 2QAJA 1U0LA 4B3GA 2OSBA 2G9NA 1HYQA 1W2GA 4UNQA 4N0DA 1CF4A 1G3UA 1HQCA 1YR7A 3A1TA 3Q85A 5LPNA 1KMQA 1NY5A 5BWMA 1TADA 3RAPR 3U3KA 1VHTA 1E1QD 1PLLA 1VIAA 3AEZA 4NYMQ 1N0WA 4W5HA 4P33A 3SJCA 4DIDA 3CR8A 1EESA 3ASZA 3RDPA 1M7HA 1Z2AA 5FTNA 4BLSA 5FPYA 3CNOA 1GWNA 1E96A 1N2CE 2WICA 2EVWX 2YKGA 3B1ZA 1YZQA 2IF2A 1SULA 3EC1A 4CZ2A 3UIEA 2GZHA 1EWRA 3A4MA 3THYA 1H8HA 3WNDA 4TYWA 3ZD7A 2W6JA 4NP6A 3AQ4A 3L2OB 1GL6A 5EE0A 2IS6A 1SVKA 2A5GA 3VU9B 5FUVA 2WSSD 4KLZA 3GMTA 4DSOA 1E98A 1KI3A 1N6NA 4HB3A 5ANRB 3U3MA 2QMHA 4TLDA 1GZSA 1Z0DA 4OL0A 1IAQA 1CR4A 1SVOA 3BGWA 5HCIA 3RABA 2GVDC 1SVIA 1W36C 3B85A 3UWKA 5DLQC 1NVUQ 3TVTA 5B64A 2VIIA 4QJ3A 3A1WA 1KYIA 1A1VA 4DXAA 4ITRC 1WMSA 2CL0X 2RH5A 5IT5A 4OHVA 3DMNA 3KQUA 4JL8A 1U8ZA 5LB2A 2A5JA 3OEED 4Q9HA 2FFAA 3SYKA 2ODWA 2WKPA 2NMVA 1XEWX 2GDJA 2E87A 5DE3A 3B5JA 4CVNA 1K6MA 3EAQA 4NDZA 3Q5DA 1SVMA 4AI6A 3L0SA 5AK0A 3QVUA 1GIAA 1S2MA 2VP2A 3CX8A 1XZPA 3GLHA 4LZZA 2IA5A 3SOPA 3ZZTA 4C0SA 2RCNA 5J4YA 1EX7A 5E7JA 5KNCA 1ONBA 4E03A 3W5JA 3QBTA 2NO6A 5JLJA 2VLIA 1R8SA 1Q1QA 5FL3A 4A6XA 2NIPA 1GOTA 1BKDR 3U7EB 5AJZA 4DIEA 2EQBA 1R7RA 1T8UA 3EG5A 5L8VA 1OJLA 4GOJA 1G5PA 2V1UA 4URVR 3DOFA 4A2PA 5JJIA 3QF7A 2ANBA 1MRSA 1S96A 3ZGXA 2JAQA 4Q1EA 4LYHA 3VFDA 1SXJB 3GCGA 1P2VA 3I73A 3OIYA 2H18A 4M1SA 3VTKA 4BGDA 5KPDA 1E0SA 4X8MA 4Z8YA 3AP1A 3PUZA 2ZRPA 1DAEA 3SEAA 1ZU5A 1F6BA 5JECA 5JSZB 2R8RA 4BFTA 2J45A 3RSOA 4JT2A 4UNNA 2GK7A 2J0UA 4XSHA 2GJ8A 1QHHB 4OHZA 1KI7A 3NBYC 1ZVQA 3RS3A 2IYRA 1F2TB 1WP9A 3GJ4A 4HLUC 2REOA 1A7JA 5EP1A 2ZI7A 1PUJA 3B1XA 1J70A 3L0IB 4DEYA 5FOTA 2NPFA 2GBLA 3AH8A 1RYHA 2ZR0A 2GESA 4M9ZA 1W36B 4A2WA 1DO0A 2CNWA 2JIZD 1N25A 3LO5A 5DISB 4DUGD 2CCKA 1NMXA 2Z83A 2ZPTX 2ZSAA 3CUEF 3OE7A 4FMDB 2AD5A 4RD4A 2A9KA 1OXVA 1S4QA 4FW9A 4LBWA 4Q4AA 1KO8A 2R44A 3D6TB 1A82A 4HZIA 4OQXA 3THXB 2C9YA 4IOJA 1FTNA 2PEZA 1FUUA 4M22A 3FHOA 2JLSA 2XSZA 1F48A 4P0TA 3SYNA 4XWAA 1OFUX 4OI4A 3SN6A 5B2ZA 4DSUA 4PPQA 5AJYA 3ZYCA 4XWKA 1VECA 1W0KD 4B34A 3UK6A 3FVQA 4A6PA 1FW6A 2O5VA 2W6ID 3BFXA 5DHFA 4W7SA 5JHHB 4JL5A 5KTYA 4HAVA 1UBFA 1LV7A 2R6GA 4KITB 1E1RA 5G3YA 1N6RA 3LY5A 5DI3B 2BCGY 1SHKA 2ZI6A 2DFLA 4LCBA 4P32A 5LB4A 3T1TA 1QHNA 3LDAA 3IIKA 2F3TA 4EPRA 3AVVA 4DC9A 1GVNB 2NO1A 4NYIQ 4YMUA 2VH5R 2MSEB 2X8AA 1FNNA 2GEUA 4KYUA 4BQSA 2ECKA 1G6OA 2GCOA 2VEDA 5DO9A 3SHFA 3MJRA 1AK2A 3GJXC 1TF7A 2H57A 2ZRDA 3B1YA 2XZOA 1Y3AA 5JI2E 2WWXA 5TXGA 5JSZA 1XTJA 2E1RA 2XB4A 2P0EA 3M1IA 1NBMD 5HE9A 1LW7A 2QAGB 1YRBA 3W90A 2EYUA 2HLDD 2QTFA 2BBTA 4AIIA 1Q22A 1WDTA 1F60A 2EFGA 4PAQA 1E2NA 4JLPA 1BYIA 1WF3A 2RGCA 4Q21A 2OAP1 5JHGB 5FOXA 2YOHA 4LYJA 2YWHA 1J2JA 2QY9A 3LW8A 4QL3A 4XOIA 1I2MA 1KY2A 3KL4A 2ODNA 3ASYA 1U0JA 3O8DA 3RWMB 5GJBA 3LVRE 3BFKA 4LHXA 2VF8A 3ONWA 4YLGA 3T12A 4PPFA 2GEDA 3BH7A 3KZ1E 3IEUA 3KQKA 2FF7A 4KVGA 4JJZA 5TMPA 1GG2A 1Z6YA 1ZNZA 5EE1A 3SDZA 5JRJA 4EPXA 4EPTA 4ZCIA 2KB0A 1E2MA 4DCSA 4FWIB 4WW0A 1W2HA 1RVDA 4HAZA 3OF5A 1N5LA 4DLTA 1IN7A 1W7AA 1OKKD 4M1WA 2ZROA 1OFTA 2C2HA 3PUXA 1TF5A 5AR1A 1R0WA 3PQCA 4TMWA 1KDOA 2V7QD 4WVFA 3KFVA 4EQ6B 2JLVA 4RZUA 3ICQB 3TSWA 5BXQC 2FE4A 3WRXC 2QPAA 4F4JA 4MKGA 2DR3A 4OHYA 1TX4B 1XBTA 1G18A 3P20A 4GFDA 1T5LA 2QROA 3O8RA 4LWZA 1SKYB 1JAHA 1R10A 3C16C 1VYTA 3K0CC 1S8FA 2NTYC 1GNPA 3WBJA 1KJYA 4PQYA 2H16A 2JDIA 2ORVA 2BV3A 2P6NA 1MRNA 3R7WB 4QHYA 3LXRA 2CVFA 4PC3A 2BDTA 3C15C 3D8BA 2OUKA 4PO8A 1E94E 3KTAA 1G3MA 1CBUA 1NVVQ 3SZRA 2C9OA 3H1TA 1QVRA 2AXPA 3BH0A 3KJEA 3GJ7A 5DN6A 3LBHA 1PUIA 2FSIA 3CLVA 3U6KA 1E2QA 1E2JA 1M7GA 5LD2B 3UKDA 1VKJA 2Z5FA 4RD6A 3W8NA 2OCYC 3ZH9B 1ZM3A 2P3SA 3GJ3A 4JKYA 1YVDA 4YC7A 1E2PA 1TMKA 2F1RA 3F3YA 1DAHA 5E95A 1JR6A 3KKMA 3KKNA 2BJWA 1UBCA 4ZDJA 3ZLJA 4LPSA 3A4LA 2PCLA 2WV9A 5H8WA 2R6FA 2YVUA 3T5GA 2DFKB 5FOVA 3W6OA 3LLMA 2GK6A 4US1R 4B75A 1F3OA 1GNQA 2W2TA 1ZP6A 1DG3A 5AJVB 4NCNA 4TL7A 4EJSC 3C5CA 4GZMA 3A8TA 4BE7B 4OK6A 2OAQ1 3HDTA 2PJZA 1Q57A 2IX3A 2J0QA 1GM5A 4W9MC 1CP2A 2FNAA 1G5TA 1DARA 3E1SA 3QQ5A 1Q21A 5KPJA 1P2TA 1BMFD 1DAIA 2QBYB 2ZE7A 1RRPA 4YXWA 2ZRNA 3VR5A 1OHHA 2F1HA 4HDOB 2ZANA 4DB4A 2OBLA 1N5JA 2HYDA 1OXTA 3SS8A 4FXPA 2CLSA 2QL6A 2G6BA 5EXSA 2ZE8A 4BZPA 1RRGA 1OB2A 4DLZA 4HDQB 1T4GA 1Z0AA 2F9LA 3AGQA 1EFHA 2UVQA 5EXPA 2Q9CA 4IVRA 1G5RA 2QORA 2FFHA 2AWNA 2DWQA 4L9SA 1H65A 3TRFA 4U7DA 1Z28A 1AIPA 1MABA 3TQCA 1WA5A 2PMKA 1DBSA 2CCGA 2VBCA 2VSXA 2YYZA 2QI9C 3D31A 4KFRA 4L15A 4EFNA 1OH5A 2GJSA 3ZIAA 2HEIA 3TUIC 2BIFA 2MSDB 3R7WA 1KMHA 2QUZA 1IY2A 3KJIA 1IXZA 3TH5A 2CJWA 2GAOA 3K70D 5FR2A 4Q1BA 4KSCA 4EAQA 3WNCA 2ZAMA 3Q7PA 1RIFA 3KJGA 2O0JA 4TYYA 3KXIA 1XTQA 2P6UA 1HEIA 3K9HA 1R0XA 2C78A 4DVGA 3T1OA 4Q66C 1E9FA 2YHSA 1H8HD 4HZUA 3TMKA 3AKCA 2IYUA 1OKKA 3K70B 1XWIA 2YWGA 1E99A 4PC1A 1L7VC 3ZVMA 4PPGA 3EWSA 4MGYR 4JIMA 1JR3D 3QXCA 1T0HB 2C77A 3NC1C 2IWHA 2MMCA 5DYIA 5E4FA 4HAWA 3CF2A 3H4MA 2TMKA 1NSFA 3TR0A 2OLKA 5HCNA 1W36D 4A15A 3E2IA 2AKYA 3NBFA 4D26A 4U5XA 1LS1A 1E0KA 4CT5A 3GFOA 4N0EA 5M04A 1BH2A 2JJ1A 2QSZA 1FQKA 3QI2A 5FPHA 4KSBA 2GILA 3PENA 2GHIA 2NO9A 4JL6A 4F4IA 4F38A 4YQFA 5FTLA 4PZLA 4TZ6A 2ZRGA 1D2EA 3DKPA 2WHXA 3DVLA 5TB5A 1RZ3A 3M6AA 3AKDA 3U44A 4Q9KA 2J46A 5AUPB 3VR2A 2FX3A 1UKYA 3OIWA 1TF2A 3N5CA 3MD0A 1HV8A 1KSFX 1Z83A 3RRMA 3BD9A 4A0GA 3CO5A 4EFLA 3ICEA 2C9CA 3PIRA 2QA5A 3FMIA 3W8RA 2VYFA 1E79D 1ZM7A 4RZ3A 4XJXA 5IK2D 3T1QA 3EIQA 2O8FA 2IHBA 1DVRA 2BBSA 3FKQA 1NVWQ 4JLBA 1FX0A 4MUBA 3AKYA 1GDDA 4LHZA 4H9GA 4CRWB 121PA 1I4TD 1XX6A 4BFVA 4BUJA 2AL7A 4B3CA 3I5YA 4PQRA 4FN5A 3VX3A 5LD2C 4TMXA 2W6JD 3AF3A 5HKKA 2XZLA 2CVHA 2G88A 2D4HA 5JJKA 3AKEA 1NBMA 3H84A 1G20E 2FU5C 1FL9A 5EUMA 4D0LB 2GXUA 2NG1A 3LFUA 1WQ1R 4OI1A 1UKZA 1W0JD 2GNOA 3QKSA 4GMDA 1RFLA 1P7CA 1IHUA 4IVPA 5AUQA 3FMFA 4RCYA 1G16A 1E2LA 4IRUB 3SFVA 4O3MA 4JBYA 5C1BA 1L8QA 3ADBA 4JZKA 3V4FA 1NJGA 1AS2A 1XTSA 3FYHA 2FA9A 1SKQA 3SJAA 3RNLA 2ZR7A 3KQNA 4C4PA 1YE8A 1DAMA 3VKGA 4MRPA 1Z63A 3O8CA 1YR9A 3B60A 5D3QA 1ZIOA 3NEJA 1J8YF 1N5KA 3QXJA 1DAFA 2FV8A 4LJ9A 1U2RA 1DADA 5SZHB 3R8CA 4UXJA 1H8EA 3SBEA 1NMZA 1TL7C 4C3ZA 3O8BA 3OE7D 2GJAA 2BC9A 1UADA 1XNJA 1KY3A 1KDRA 5J4VA 4UXHA 2GZAA 1JJVA 2J7KA 5J47A 1SKYE 3OFND 4POAA 1ZRHA 4FD2A 1X86B 4MGKR 4QG7A 5CJ2A 1ZU4A 4DSTA 3SU8A 3K9LA 1EFUA 1JBKA 2D7CA 3CPEA 1NLZA 1S3GA 2X2EA 2C99A 3H0KA 5CDFA 5JCPA 4MQBA 3K0AA 4KO8A 3TW8B 1GKYA 4XH9B 3TUZC 1ZW6A 1QHYA 3IO5A 1P5ZB 4OQMA 4Z1MD 4ZDKA 5KSYA 2O8EB 1JR3E 2DHRA 1M74A 5E3HA 2R6CA 2O52A 2QAGC 4CW7A 4U00A 3PEYA 1IN6A 1XMVA 3KB1A 1BS1A 1IN5A 1SXJA 2K5UA 4RKFA 3GP8A 3MUFA 3I3SR 1XDBA 1YQTA 1E2KA 2WOJA 2Z4RA 3EPHA 4ZKDA 4JVSB 4DT1A 3BB3A 1IONA 4V0OA 5KYKA 5KOYA 5IDVA 4UKDA 3Q7QA 2QG6A 1CIPA 5FL7D 1T9HA 4KVAA 3HR8A 2REBA 5H1YA 1Z6GA 2QU8A 4Q19A 2QEQA 1WRBA 3CZQA 1ZBDA 1ZD8A 1II0A 3EARA 3QG1A 4JMPA 3HWSA 3RS7A 3GLFE 3LD9A 4QC2A 2BEJA 3EX7C 3AVQA 4QM6A 4CEJB 2Y8EA 4Q5IA 3EA5A 1M8PA 2Q9BA 3HPRA 4PHHA 3T15A 4EJSB 2J9RA 4M1KA 3CBQA 1GILA 2ZRMA 2PL3A 4TL8A 5BYJA 3OZXA 5BN3A 4RKEA 1SHZA 4JLVA 3SQXA 4KLNA 3AUXA 1G8PA 4YMVA 2BOVA 3QVVA 1N6PA 3RS0A 2ORIA 1KO4A 3F0TA 1WCV1 5DH9A 2GEVA 1GL7A 5TY0A 4KFSA 1OIVA 4PTLA 1GKUB 2ZJ8A 3QPUA 4DEXA 3SQWA 4M9SA 4IVQA 1G3IA 2C98A 4MYHA 1Z0FA 2VP9A 3KXLA 2ZRAA 5E7MA 3AVYA 3L0PA 3ZDQA 2XB2A 4Y0VA 1E4VA 4CGZA 4ESVA 4KJZA 4KFUA 1G7SA 5DYGA 2IWRA 1XTRA 2JLUA 4RD3A 2QN6A 4P4SB 2VSFA 3CWZA 3AVPA 5F98A 2GVZC 3K0SA 2W2XA 2QSYA 3K0AB 4DCUA 4LC1A 4MA4A 2YWFA 3GLIE 3ZS8A 1K8RA 4PSAA 5CITA 3KJHA 4TT3D 5AWFC 4LYAA 4G0NA 5G41A 1COWD 3IEVA 1SVLA 5FTJA 3LNCA 4GP6A 2IXGA 4WA7A 3SJBA 3CRRA 2ZAOA 1WXQA 1Z47A 2ODEA 3GLIA 5HTKA 2IC5A 3K9NA 4IOKA 1IQPA 1FFHA 4RFSA 3QPVA 5JRZA 1T3SA 1CKEA 2D06A 1JI0A 2PX3A 1ZUNB 4KCGA 3MMPA 1ELOA 2AK2A 2JJ8A 2G77B 3OIUA 4LBYA 5AJXA 1TNDA 2L0XA 1G41A 4XD7D 3VU9A 3RS2A 2JCSA 1E1QA 1XTKA 3PG5A 2XITA 1Z07A 2AWOA 5L3QA 3ZVNA 4II7A 2HT1A 4MRSA 3AF4A 3UMSA 5KDLA 2QQEA 3WNBA 1T3HA 1FP7A 1XFAA 3FHTA 4BLQA 4DCNA 2WJJA 4LJ4A 4IDQA 3JZAA 5CYPA 1VYVA 2QRZA 4KI0A 1UJ2A 2NO0A 2WPDA 2WAYA 4DDVA 1LF5A 2FZ4A 4HB0A 1EX6A 3W34A 4ERNA 3EZ2A 4XD7A 1IY0A 4A8JC 1E4YA 4LC0A 4LJ6A 4DLSA 1I4DD 4NBSA 4B44A 3DM9B 1AKEA 4HZUB 5H68A 4AKEA 4C7OB 2DCUA 2EFDB 4B71A 3NBZC 1VG8A 1JXOA 2ERXA 1OYWA 1OB5A 2GAAA 1UM8A 3ADKA 3SBDA 3HYRA 3TUJC 2WVJA 4PXAA 1QHXA 1ZCAA 4TLCA 4XTCS 2ZRLA 1D2NA 1D6JA 3EIHA 4URYR 1W0KA 3KX2A 3NHAA 1B0UA 2IEZA 1ZYUA 3QUSA 2DB3A 1P2UA 2VHJA 4NCHA 4OJQA 5CLQA 4TWZA 4IFBA 3FFBA 4KHZA 4B2LA 4HUQA 1CRQA 1OXSC 1W4BA 4LUCA 4TTQA 1NNEA 2BKEA 4ZI2A 1GTVA 1XJQA 2XTZA 2B8TA 4Q4JA 4YDSA 1QG2A 3M4YA 4TYQA 1HT2E 1IY1A 4P3YA 2YZ2A 3LRPA 3U44B 4DDUA 1Z22A 2Q6TA 4DLVA 4D4LA 3KKQA 2QENA 2XX3A 3A1UA 3ND9A 4US2R 4NL4H 4PFSA 1SGWA 1W47A 1M1YE 2WWIA 4QGHA 4R2HA 2IYXA 1KAOA 2V8OA 3JZMA 4M53A 3WYFA 2VP5A 2F3RA 4WZAE 1JQJC 4RSGA 3SR0A 1G8FA 1FPMA 3P1JA 2RGAA 3CF6R 4JYCA 4LRWA 1VTKA 5L3QB 4MDFA 4PANA 4K8OA 3T5DA 221PA 1KZGB 2W0MA 1UPTA 2HUPA 1PJRA 3U7HB 5HE8A 3I92A 4WOPA 4BFXA 4C9BA 1MKYA 3CM0A 4BECA 1Z29A 4FMCF 5EJEA 3J81k 3PITA 4A36A 1ZNYA 1XP8A 4B3XA 3AM1A 4NYMR 1Q1EA 3NXSA 1G8YA 4Q9LA 4WIAA 1DOAA 2HXSA 2P5TB 5F3WB 3LBNA 1E9RA 1V43A 3GD7A 5SZKB 4NHOA 2BCJQ 4XTRA 4BFSA 2SHKA 1GL9B 3ZJYA 1G7RA 1KGDA 1JNYA 1S1MA 5FUYA 4KXFB 2OT3B 1KO1A 2QP3A 2RAPA 2QBYA 3BFVA 2O8CA 4C7OA 3K0FB 1DAGA 4PHFA 2O0HA 4DBLC 5ELXA 4Q4LA 3X1ZA 1XCPA 3S1AA 3ZIAD 1O87A 1IJFA 2QRNA 4G3XA 4TLBA 4ACAA 4CT4B 2VQSA 1GFIA 1IN4A 2OBMA 4AYWA 1EK0A 2G0NA 4B6FA 2ZVQX 2ORWA 4RZXA 2RB4A 2DFTA 2AFIE 4Q4AB 4XIGS 2YC2C 3TNFA 2F9MA 1G7TA 4KODA 3NDBB 4JJKA 5J4LA 2ZYUX 3RLFA 3HYTA 1CXZA 2YOFA 3QEOA 4FCVA 2A2ZA 4W5JA 5B57C 3VKHA 4GPTA 4HB2A 2HF9A 3FPAA 1G17A 1E9CA 3GJ6A 1E2IA 1GITA 1C9KA 2XJ4A 2G3YA 3B9QA 3MCAA 2WMNB 4DDTA 1G8GA 3QKRB 5UKDA 3RSLA 2GBLC 3CIOA 5F9FA 4F4CA 4TN1A 2ZYWX 1AGRA 3AB3A 2FEMA 5KSZA 2ZU0C 1N6IA 2QAGA 4ZKEA 2FPKA 2VA8A 1KNQA 4CEHB 1II8A 1QHGA 1OE0A 1OYYA 3B6EA 3B2EA 3EZ7A 4W5WA 4L9WA 4BFUA 4RFVA 2R6DA 1YZKA 1E9AA 3U3OA 1AJEA 1U94A 3DDCA 1P72A 4JLKA 2O8DB 2Q3FA 1G6HA 3HU3A 2GA8A 1JPNA 1Q0UA 1NN5A 3U60B 1OH8A 2P65A 3PXGA 1EGAA 4JKIA 5KDOA 4ZO4A 3ETLA 3TLXA 2F43A 1KAGA 1YR6A 2PLFA 5G53C 2OCBA 4HEJA 1CRPA 1AS0A 1DE0A 2XJ9A 3FGNA 1P9RA 5CIQA 3R20A 4M9QA 4UNSA 1OFHA 4A8JA 4NCKA 1JEDA 1YU9A 4QFMA 3UANA 2O8BB 1AGPA 4TLAA 2YNMA 4LOAA 2QE7A 4DB2A 1AA3A 1JEEA 2H1LA 1UKVY 3B9PA 2WOOA 2Q9AA 1LFDB 4KBGA 3UATA 2CLCX 2Z43A 2YV5A 2Q0HA 4FCTA 4V0NA 1XPOA 3A58B 3QG5A 3U4QB 5JEEA 1AQYA 2KI5A 5FTMA 2H17A 1KO7A 1G21E 2IUUA 3ADDA 5C18A 3I72A 2A5DA 4TMVA 3P32A 1QDEA 1VCOA 3VKWA 3IILA 4Q1CA 1L2TA 3IBGA 1J7KA 4JLMA 3CX7A 2QTHA 1TU4A 3NEYA 4Q7JB 4CEJA 3I62A 2ZSFA 1CJVC 4L16A 4UJ5A 3OFNA 4R2IA 5CIWA 4I1VA 5FBVB 4F93B 2REXB 4BWYA 4NONA 4GL2A 2G0TA 2VL7A 3QIAA 3U2QA 4ARZB 3GFPA 1XRJA 3CZPA 5FBWB 3UMFA 2QTVB 3OAAA 1AN0A 5EUQB 1KSGA 2GJKA 1U99A 2BBOA 4RJLA 1G291 4TSFA 2HXYA 4JLAA 4XSGA 5KHOC 1XMJA 3QJYA 4HATA 4MYCA 1VYUA 3QPWA 3EXAA 4MITA 1P60A 3WHKA 5JWRA 2H5EA 5HR5A 1Z6TA 3E5HA 1S0UA 3THOA 3THWA 5FI1B 2HCJB 2ZSBA 3U6BA 1FUKA 1QVAA 4Y0AA 3I5XA 4DCVA 2OCAA 1DPFA 3VR4A 4AYXA 4G5QA 8OHMA 2A30A 4Q47A 4B48A 2XXAA 4Q1DA 4B33A 1TAGA 2Q3HA 3N2EA 1J99A 1CJKC 1GRQA 4QHSA 4P4SA 1GAJA 3GJ5A 5KDDA 1XD9A 4EDHA 2MSCB 1II8B 1JPJA 4PHGA 2OEPA 3KQHA 4D82A 4XVUA 2J3EA 2LKDA 4LV6A 821PA 3R9WA 3FTQA 1E2DA 4HLCA 3WMEA 2O8DA 2GJ9A 4V02A 721PA 4JVLA 1ZMXA 1DG1G 1YZGA 2DWOA 3LVQE 2IXFA 2J1LA 4FMCB 4K81B 2WTUA 2RKOA 1P73A 5GVRA 1ANKA 2QT0A 3HR7A 3DEFA 1KDTA 5BN4A 3Q8XB 3W6NA 2ZUCA 1QHHA 3X1XA 3LQQA 4Q00A 4IDNA 1IJEA 4FMDF 2IYYA 5BYKA 4JVNA 1N5IA 1N6HA 2B8WA 4AKHA 4IHQA 2W83A 1KI1A 3Q5EA 3GPLA 1AS3A 1UFQA 4ASUD 2R9VA 1Q20A 4O2RA 1N6KA 4KU4A 2XOKA 3PUWA 4CEIA 2WSMA 4KV9A 4H1VA 4U02A 4ZIRA 3AF0A 4M0LA 1TEVA 3CRQA 4UNRA 3SJZA 4XVRA 4GP7A 5CK4A 3ZZUA 4A0FA 1RYFA 5IRCD 5EE5B 1UBEA 4D4KA 1RW4A 4NH0A 2XTNA 3C5HA 4ZCLA 3QE0A 1ZUIA 4BPBA 4RD2A 2ZSDA 3THXA 1KO5A 1W4CA 2R62A 2ZJBA 3B1WA 1PZNA 2IUTA 3UPUA 1X1SA 4DKXA 3ND8A 2CMKA 2G1JA 1W48A 1OF1A 4QBFA 3VNVA 3LBIA 2FH5B 1FMLA 2ZRCA 1ZD1A 4MRVA 3TSOA 4IEEA 1UDXA 4Q4JB 2PZFA 4PZZA 5DIFA 3LW7A 3WRYC 5FBQB 3OHMA 1ZM4A 1E69A 2J87A 2ZUDA 1HQYE 1N0UA 1XXHA 2RGGA 3DM5A 5L3SA 2ZXUA 1KI2A 2A5YB 3LWNA 4JS0A 1GUAA 3CKLA 3RYTC 3UWOA 1ZNXA 4ZPXA 1D8TA 5FL7A 2OXCA 2OE2A 2W58A 5TV2A 1OIXA 1G1MA 3SNHA 1Z2CA 4V0MA 1I2DA 3GFTA 1NLYA 3G82C 2B21A 2ZREA 4MGZR 1QHIA 1TUIA 4UNPA 2O8EA 1NBME 3TKLA 1DEKA 2BKUA 1W49A 4BLTA 5CYOA 1W1WA 4KAXA 1VCNA 2CK3A 4PC2A 2V1XA 1XCMA 2EYQA 6Q21A 1VG9B 1XCGB 4LJ5A 5FTKA 2A5FA 2KBFA 3BB4A 4RD0A 1AKYA 3NVAA 2IYTA 2ZUBA 5H70A 4B2IA 2YC4C 2VHCA 4DT1B 2J0SA 4ACBA 3UMRA 1U0HC 2ERYA 3OEHD 1VPLA 1T8TA 2FFBA 3EIEA 3THYB 5FUXA 3MGCA 3B7GA 3CPJB 1C1YA 1NG1A 2ZU6A 2JATA 4AKIA 3IUYA 2C8VA 2ZTSA 2BMJA 4JLNA 1GP2A 2AKAB 4C0KA 1R0YA 1S9HA 3BIFA 4GOKA 1NG9A 5JS7A 1EG7A 1D9ZA 3EZFA 5SZIA 4WZ6A 4BLOA 4MKHA 3PJRA 3B78A 1V5WA 3T61A 3EPLA 2R65A 3DKVA 2OLJA 1MV5A 3CWQA 5KNBA 1XD8A 1Z0IA 1VG1A 1ZAKA 3QF4A 3UXMA 4BRUA 1WE2A 2QMUA 2F55A 421PA 2ZJYA 5FUWA 2WAXA 3DZ8A 1RKBA 4GNKA 4RCZA 3RRNA 3EC2A 1LS6A 2BHRA 2IK8A 2ZJAA 5P21A 4TYPA 3WMGA 1NF3A 5HPYB 1IN8A 1ETUA 1XTIA 1MO4A 3FHCB 4Q01A 4DHEA 2FEOA 3M0EA 4C0BA 5GADl 4IOMA 4Z51A 2AK3A 5JJLA 3WYGA 2QZ4A 3KB2A 3K0FA 1W4RA 1HE8B 3Q3JB 4LBZA 2YINC 1UDWA 2WJHA 2ZVPX 2WIBA 3GEIA 3IDQA 4QJ5A 1EFRA 1F2UB 3T1VA 1W5TA 1NY6A 4YDHB 5GVSA 4K46A 3S1AB 4XWOA 2HYIC 1KK1A 1RJ9B 4EUNA 1VMAA 1FTSA 3SFZA 4ON9A 3K0CA 4TQ9A 4HI0E 5FPKA 3DHWC 4IJMA 4GSYA 2DY1A 1R4AA 3IHWA 3DO6A 2ONKA 1U90A 2DPXA 4I81A 1EFTA 1OW3B 1R5NA 4GRAA 2QT1A 2QGNA 3KKOA 3CX6A 3RRZA 5AJWA 3RC3A 1P6XA 3U7FB 3P4YA 4IXNA 5AUOB 3I61A 2QP4A 1E2FA 4MYTA 3AVUA 1G3QA 4A0RA 1VDZA 2VO1A 4ZI3A 5EP2A 1U8YA 3K09A 3GJ0A
chains in the Genus database with same CATH superfamily
1BVRA 2B83A 2GA9A 3KFXA 3O74A 1ZD5A 2HIHA 4V03A 2C3PA 2B5VA 3OOHA 4BQQA 4CKBA 4U6QA 4RH0A 3E53A 4EUSA 5A62A 1Z4QA 2VDUE 3U4QA 3HJFA 4QXQA 3Q72A 3QEKA 2NPOA 3SSOA 1UC9A 2F2TA 3K8QA 4BVEA 4V24A 3QOWA 3VPHA 4FGUA 5BQ3A 1H3FA 1VHLA 1P7YA 4G5YA 3T3PB 1A77A 1YT5A 10MHA 1XZQA 1JPUA 2I80A 3EEIA 3LT1A 1VG0B 5I6DA 2XWPA 1UBGA 1PU2A 2VNJA 4RE6A 5IVIA 3IEXA 4JENA 2AOVA 4UNIA 4YBRA 1EP1B 3U48A 1BIFA 4AM8A 4JBGA 4K88A 1SXIA 4ZI7F 5I4BA 5DBFA 1P2GA 3H8WA 2M1ZA 5ICFA 2V74B 5BW8A 2B78A 1QYCA 3HP1A 1U0TA 5JCZA 1Y9JA 1QAOA 4GQAA 1YACA 4BUZA 2Y68A 5IBCA 1IBLB 3LX8A 4MS3A 3D4BA 3FOFC 2XXBA 3QNUA 2FMUA 3AQIA 1MB2A 1ES9A 1T2EA 2BR4A 1EFVB 3IRVA 3VMFA 1MU0A 1RMQA 4QOJA 1ZHHA 1E6EA 3RASA 4S24A 4AZ3A 4GM1A 1ZESA 4IQ4A 4WERA 2ZRIA 1WMEA 4UUOA 2BTOA 3B9RA 2O06A 3DTVD 3COJA 2GSWA 2Y76A 5CGZA 4F91B 3EXFB 2GBPA 3HJAA 3O94A 3FNHA 3TN7A 4YPVA 3RSSA 1X6VA 1GQYA 1CDOA 4WUTA 5M34A 1KP9A 1M7BA 3OWHA 3A70A 1RE0A 2PWBA 3PFFA 1NN3A 1YDHA 2AH5A 1MW9X 1R88A 2GETA 4RM2A 1OLOA 4R5MA 2IVFA 1BOFA 2VK1A 1G60A 2ON6A 1RJ9A 2HHJA 3BORA 1UPXA 2I3ZA 3T94A 2ODBA 1XT6A 1J8QA 1C29B 3VSDA 1RAGA 4MARA 1OPXA 1ETHA 1GNVA 3JW8A 1PTJA 3MWJA 4IH9A 4Q6WA 4QT0A 4GT1A 3UKOA 1XNHA 3N70A 3VVLA 3HO6A 1MO3A 1CR6A 1USKA 3ZWNA 3FDZB 4IDDA 3NGLA 4PYIA 2J7PD 1I94B 4WZBE 4ECEA 5IEBA 1R2QA 2P9YA 3VYTB 4J6EA 1CJUC 1E9DA 5AW1A 4OI2A 1P6UA 2ASEA 3MB5A 4LRQA 4OUKX 5KYUA 5IJ9B 3ONVA 1JKIA 3ENVA 3CUVA 2H3EA 2D0OB 2WFMA 4E5UA 2ZBQA 3KEFA 1WSBA 3IVAA 1M8FA 2FUKA 5C7IO 5D84A 2OHFA 3FNIA 2GRJA 3JXEA 4XKJA 1VP3A 4OLJA 3DO5A 3RUFA 2W8ZA 1CJMA 3IPXA 1X77A 2CXTA 4LNUA 621PA 3EK2A 2Q1TA 3I4FA 5IF9A 2POCA 3MOSA 1OX6A 2WWYA 3COVA 4ITUA 2FN4A 1SU7A 4AAYA 3ESRA 1L7MA 1QH8B 2II6A 1EFCA 2NZ8A 1NN1A 1U8EA 3C85A 4IDOA 1MO6A 5CD1A 4B4DA 3V2IA 4XWYA 3NJ8A 2PSFA 2Q3DA 3NWEA 1COWA 3N0VA 1A9XA 1FZQA 3KQLA 4BRZA 5BWOA 5IWCA 2LP4Y 3G7NA 3S2YA 4KPUA 2WD7A 1Y1LA 3QE3A 3ZR4B 2OBXA 4D8UA 1YS4A 2YN4A 4NAHA 3DB2A 1CULC 3DOUA 4ETMA 1BXKA 3O3CA 1ZUHA 2XMDA 1QK4A 2W8BA 2YCLA 4GOXA 4FJ2A 3M6VA 3C97A 4YFYA 5SYNA 3W2FA 5MF6A 4G0XA 4OGKA 3UW1A 4RZ2A 1QTQA 1II9A 1PLKA 1WXHA 3TLGB 4C0XA 3DEAA 4WNYA 2X58A 2VHTA 4K86A 1NUTA 4V0QA 1NQWA 1PT8A 3LQ1A 3ONNA 4I55B 4BP8A 1UFKA 3DMFA 1T5IA 2ECOA 4F5EA 5CCBA 4XE5A 2X3UA 4RANA 3J80A 3THSA 4RFSB 1ZM9A 4XGRA 1HDZA 3EF1A 2I8CA 2VHWA 3OMWA 3R9IA 1ESDA 3IQWA 1RU3A 2QN1A 1L3BA 5HJ7A 3I28A 1JPVA 1ULAA 3P2OA 1I7QB 1GRVA 2GK3A 4OOFA 5TVKA 2HMSA 4JBXA 1T6NA 2ZJ5A 4YCCA 1M34B 1CS0A 4MH0R 1CQWA 1Z3CA 3HU1A 3G17A 4FFOA 4B74A 4BHTA 3H7IA 4L8VA 5HG0A 1O0BA 1YI8A 1YXMA 5FR1A 2PU7A 2R8OA 3L0DA 4R1OA 2LD4A 1G5IA 1DC8A 4X1KB 2H1VA 1G4UR 4BO1A 3IVXA 2P5SA 5CT9A 1PGNA 4OYLA 5DBGA 5A1JA 1WBBA 3BL6A 3OEHA 2WUFA 2IIBA 5CFOA 3H5LA 1F7VA 4I4NA 1CR2A 2VBIA 3DCNA 1IBRA 1QFYA 3GRCA 4KQFA 3ENNA 1H23A 1XZFA 3GLIB 2KJQA 2W4IA 4CU5A 1KS9A 1SBHA 3OKAA 4LV8B 1NV9A 4LA4A 2CMHA 3G8AA 2W43A 3F8TA 1A27A 1D5CA 2R6AA 1GSIA 2IBMA 1U0RA 1CY1A 1DWPA 3DAOA 4BNNA 1H3EA 3VR6H 3ZQ4A 3ZV3A 3S1LA 3MQFA 1ZQ9A 4A1FA 4BVBA 3PNKA 1I5EA 3OFVA 4LI0A 4HL6A 1FP4B 3AEQA 1ACMA 3H99A 5E6UA 3SPXA 3FPGA 4KRXA 1JDPA 4OBEA 4OFZA 4I50A 2XXJA 1W85B 1LLCA 2B98A 2Q4RA 2YWEA 2BPOA 1RQRA 2ZYHA 3EUWA 1Z2NX 3HACA 3P71T 4Y1GA 3ROKA 1R9MA 3KELA 3O2QB 3RSHA 4DIUA 2VHYA 1YHNA 3H87A 4IICA 5LFAA 1E5VA 3FOEC 4D4MA 1IIBA 1I51A 5AVOA 3HTXA 4HP8A 2J0EA 1A9XB 1V37A 3E7WA 2BHLA 2FSFA 3V3KA 1GNLA 2EARA 4OKSA 2E5WA 2VNKA 1SVSA 3GJYA 4MW7A 4YRMA 4N0MA 3ZD8A 3WDKA 3SY8A 1C3OA 2HLDA 4X71A 4G5GA 2ATEA 2ZBUA 1B42A 5A9SB 2QD5A 3H5AA 1NZDA 5EP3A 1P8AA 4KXUA 1ZMTA 1T0UA 3MC1A 5IJAA 4YRRA 1ZIPA 2VJQA 4HH1A 3DUFA 4AULA 4AL4A 5B3LA 4GKKB 4PZPA 3BEOA 3N5KA 1ISSA 3C8HA 2I1WA 5K8IA 3ZCSA 2JGLA 2YQ4A 1JYEA 1NQOA 3DBVO 3E22A 4IYJA 4MVWA 3RM3A 2WPDD 3I5MA 3N05A 2AJ8A 2OXIA 2Q6VA 1KETA 4J2HA 1OFVA 2VF4X 1BO6A 4QO8A 3PC6A 5KTOA 2GVNA 2QR3A 1PJSA 3B8HA 1A5ZA 2F1IA 3QXSA 1BEEA 5ALKA 3BGDA 1B4DA 1U28C 2L42A 4HOYA 3WY9A 1GTRA 1PI3A 4MHTA 2EP8A 3I3OA 5DN9A 1L4BA 3IKLA 3FSGA 4P38A 4RSHA 4D9CA 1UK7A 1VKRA 2EC5A 2PKWA 4OATA 1V7ZA 4LJ8A 1HNWB 1I9GA 2O3SA 1KI8A 3W2IA 1MABB 1HFJA 4A92A 4MDYA 5G3ZA 1IBSA 2B0CA 2VP0A 1JHOA 4EW1A 4A8PA 5BT9A 1C30A 3CRZA 4RPHA 5JS8A 3HSKA 2HHAA 4RVGA 2H9AA 4AT1A 5CFNA 3MSXA 3GG9A 4HGQA 4CM9D 3Q41A 4I4TF 4R1QA 2M6LA 2QDKA 4RVSA 3W5DA 2BFFA 1H5UA 2V7QA 3PL5A 4BZQA 5EG5A 1V1MA 2C7VA 4BCCA 2IXEA 3Q9NA 3GH1A 1XF9A 2ILVA 3R9XB 4GS5A 3SZ3A 5HF9A 1EXNA 2XXAB 1HTBA 4QOSA 3NBKA 2O2JA 3MRXA 5IUNC 5CB4A 2OBNA 2BAGA 2HJSA 3Q8LA 5GJWC 4MO9A 1E9VA 3NWBA 3M1AA 4IF6A 2HEGA 3E8XA 2XKAA 5BR8B 5AR1A 5FOWA 5K01A 3OKFA 3GX1A 1KRWA 3HV0A 2W2NA 2X8WA 3ISJA 2ETXA 4DSAA 4FJ0A 2O8CB 2PKXA 2GWHA 3B3FA 4MLDA 4TRNA 4BMPB 2EJBA 3N76A 3QKUA 4NVRA 2PZJA 5LL6P 2Z8YA 3FWKA 4YO8A 1XMPA 3LBAA 1X7YA 1JHDA 4OJKA 4IIJA 2CDRA 5JCXA 3A3NA 4WLOA 2B8NA 1W46A 1UAYA 1XC7A 4BLUA 5F1YA 3WLRA 5ISMA 1R0ZA 3K1AA 1X15A 1C7ZA 1L7OA 4D25A 1PSWA 4S1TA 4E5VA 4EKDA 4KFCA 2G70A 2YBEA 4MA5A 4IEIA 5K05A 1XCOA 4MLZA 1MVLA 3F6SA 1EFVA 2YZMA 2B4TO 3MYYA 4QQFA 3MWKA 3NMUF 5TDHA 3LXXA 1A5SB 4TRJA 4WCFA 3EPKA 3PXEA 2VAWA 4INOA 4FDMA 2F1OA 1FMFA 2ALJA 2P2ZA 1PSDA 1QQBA 1FNMA 1TK2A 2QTRA 2QMEA 1N1GA 4EFMA 3WHLA 4JLOA 3UQZA 2H4XA 5CXSA 3C14C 1QRUA 4P3NA 1VRWA 1DELA 5DKFA 3SICE 3UFXA 4CQMA 1GQOA 4DQXA 1KWKA 2V0GA 1RM0A 3GAZA 2Z0MA 3DFKA 1LDEA 2H5LA 4FEAA 1L4EA 4YXWD 3RRYA 1B1CA 1UPCA 2B1IA 5EXXA 1ORIA 3IQFA 5TGDA 4DUGA 2ZE6A 3RC8A 1CRLA 4B43A 2IS2A 1PT7A 1LSOA 3C5EA 3AOGA 3G9TA 1GZDA 3BCSA 3GRKA 4G26A 3CX4A 4LHVA 5T4BA 5J63A 5D3MA 3RVMA 3UJBA 4QLBA 4E1BA 2C84A 3ZE2B 1X74A 1YZHA 1QF9A 1CLUA 1NUQA 2H51A 4OH7A 5BRJA 1SC4A 4LTNA 1DIOB 1LTQA 3TEFA 4F4FA 1LF0A 4IUBS 3CSSA 1GSHA 2EL7A 1BMFA 2BJHA 1NATA 2HDOA 1WG8A 1MH1A 2ZIXB 1ISPA 4EJ2A 1QZXA 1PJBA 2OHOA 3PRHA 4RJ2A 2OCLA 4HMOA 4WBSA 1DQPA 3QY0A 1F4LA 4L3VA 4LI3X 4P5PA 1GGVA 1UK9A 1Y0BA 3AF6A 2Y0EA 5LDHA 1XVVA 4DDMA 2C07A 2J9FA 4V2IA 3DZHA 3H4TA 4Y6GB 3WIVA 4C4AA 3UUFA 4PO9A 4IJUA 3TAUA 4A6DA 5IABA 4OKIA 3UYLA 5FRDA 3UUWA 3P0RA 4GR5A 3GI1A 3E81A 1TQ2A 4ESHA 3VNUA 1Z12A 1DRWA 4LJLA 3ZNOA 3NTUA 4RGYA 3RJ9A 1DLJA 3QXGA 5K3AA 5KYYB 2PAAA 3ENZA 2OL4A 2Q2NA 2WKSA 1I6MA 2J5XA 1HG1A 5JYCA 1POXA 1EWKA 2MINB 3CW8X 2M32A 3H19A 3LQ2A 3NHLA 3NTOA 4J29A 4M2LA 4PLZA 3TM5A 3WE7A 4NYJR 4TS1A 2RH8A 3IL2A 4R0NA 1VPWA 16PKA 5DTMA 1YZNA 2ZB8A 3F7OA 2B1RA 2EGHA 3HB9A 4PHTA 3FBWA 1T3TA 2C5LA 3MG9A 2CL7X 3D6MA 1C9EA 4IUYA 3TR5A 1OYOA 4DV4B 4M36A 2I3GA 3NOXA 2FWBA 2GEFA 2QQFA 1OUMA 3QBEA 4OA8A 1G66A 5E9AA 2OAGA 3RWOA 4BNGA 1U3DA 1EUYA 4EPYA 1RRFA 1FA9A 3GYBA 2AC2A 3LHDA 2PZMA 2PA0A 5EKDA 2QKYA 4TZTA 2R8XA 2ZUFA 1N78A 1EIWA 3HYCA 1XCLA 5KOIA 1NU8A 4DR6B 1SK9A 1NL3A 4H60A 2FPMA 2FW9A 1UEXC 3AUUA 1W73A 2FUNB 4KQ6A 2VP6A 3LE8A 4RACA 1MEEA 2Y92A 3SFTA 3TLGA 4UBJA 5GZ6A 3W6ZA 2AIRA 2ZBFA 4B47A 5KNLA 4F8JA 1LK0A 5EY5B 4QNNA 1A2BA 1MV8A 1PV4A 4AZ0B 1RT9A 3KU4A 3LQYA 5DK6A 3VOTA 5DN6D 3WJAA 2VJPA 1FMJA 3DMTA 1MNAA 3SLGA 1IUOA 1R0CA 5B1HA 1E3EA 2FXVA 4MCIA 3OCYA 3VZDA 2Y9MB 1MORA 4MRRA 1VE1A 3L8MA 3OECA 1JAIA 1I7DA 1RI3A 3VPAA 2ZRJA 3AM5A 4YJFB 3HP7A 4C89A 1V3TA 1DDOA 2BMEA 3T06B 3DCIA 3DT6A 3R3VA 3PXCX 2O4UX 2XNCA 1AO0A 4B3TB 3ODPA 1FRFS 4NECA 5A05A 3RWBA 4NZYA 5K0TA 3GD5A 4PLFA 4R1TA 1N9ZA 1RPNA 2FWRA 3EA0A 3FR8A 4G67A 1EFLA 4W6QA 4ZI5A 4CTJA 5A4FS 5BUCA 1AQ6A 1JEQB 3MM4A 4NKRA 4QBHA 3ZUPA 4F3NA 2EKQA 4O0MA 4U4AA 2HLPA 4KZPA 2X8JB 1A7UA 2WJVA 3C3PA 3LTEA 4BLWA 4FS3A 1X7GA 4RCVA 4YWHA 3RYIA 4MVJM 4TSFD 3FW1A 4Q3EA 2AUTA 5CM9C 4ZVLA 7REQA 1RQXA 2R2GA 2ECPA 2IXDA 3BAFA 4P2GA 3JZFA 2VJMA 4R1NA 1Z08A 3LY8A 1NLFA 1Q1BA 3O38A 4C05A 4QHTA 2VDQB 4DR2B 1KAQA 4IOLA 3A4IA 2ZI9A 3U3JA 5IC6A 1HT3A 3QVXA 4LDNA 1CQPA 4ML3A 4MVXA 3V80A 5G4KB 3CIFA 3IIMA 1CUJA 2DUWA 3PA6A 4GH5A 1I0IA 3CVWA 2VNHA 2WU8A 3RSZA 1KOFA 3AHGA 1C14A 3ENKA 5C8YA 4WL0A 3M3HA 3ZD7A 4ZANA 4DOMA 2OXEA 2J4CA 2FPLA 3E4DA 3GOHA 3IUPA 1X8LA 4H0CA 4MYRA 5DHAA 3K9BA 3OBIA 4JI7B 5AM4A 1V3QE 3T1NA 4OLBA 1B8NA 1FBTA 1Z8NA 1NUSA 1QCDA 2VLBA 2F6RA 3LRXA 1JFSA 1VLMA 3H11B 3URKA 4XUDA 3RVRA 1DWOA 5F2KA 1O2DA 1OMOA 2YFQA 4XI9A 3GEDA 4DZZA 4WXYB 2MR6A 2YXLA 1E3WB 2FR0A 2AD1A 4C0JA 3FMOB 1OFIA 3R5XA 5TS3A 3T52A 2EWVA 1E9EA 3ZUGA 2I3BA 3I0NA 4GBMA 4TQGA 4I55F 5H9VA 1ZSYA 5JAQA 1DAKA 4NOJA 5FLYA 3IERA 4HDSB 5KC8A 1IZ9A 4UBIA 1GSOA 4J76A 2G71A 2V55B 5AM3A 1L7PA 3ANLA 1Y8CA 5HM6A 1DSSG 2VOEA 4I2NA 4CF7A 3LAWA 3C6QA 5K7SA 4HHEA 4D02A 5TIIA 4MW0A 2AG6A 4MWBA 1MXFA 2L17A 1DQSA 4C6HA 4HK4A 4XDHA 1EFRD 3OWOA 2B92A 3NH6A 1THGA 3FAZA 1YCFA 3ER9A 1YZUA 2Z57A 1ZH2A 3TD2A 4DJTA 3MUNA 4D98A 2REQA 3BXZA 1LNZA 5KNDA 1YA6A 2VAMA 3UT5A 3T5PA 1VI6A 2A59A 1VFPA 2WTBA 3AEUA 4YMSA 2C20A 2Q62A 3ZVRA 1Y7PA 2PBRA 4I1YA 1XZHA 4WLUA 1CNEA 3ZWBA 1E7YA 3OJEA 4CN9A 3OFSA 1US8A 4RMJA 3ZHQA 1N2BA 5IHXA 3JQ6A 1M6NA 2C03A 3A3YA 3L0BA 3MGGA 1BROA 4TVOA 4Z9XA 3TSZA 4CMIA 4DABA 1C1DB 1R5BA 4GVXA 4RY0A 3FUVA 5C52B 5FBLB 4M0DA 3MF4A 3QKRA 3OUZA 1PL7A 1IXSB 2ZIZA 4AK9A 4DV2B 2WJIA 4P7FA 2JEYA 1AA6A 4L72A 4NXMB 4P2BA 1UBHS 3RTBA 4EHLA 1SBCA 1YZLA 4UFOA 2H1OA 3MTIA 4CEHA 3RQIA 4ESOA 4UHEA 4FWTA 2DM6A 3MJTA 2YZNA 2YKQA 1HURA 1QIDA 3R4CA 2I2AA 2VR1A 3JRXA 1JRLA 1QV9A 3GUVA 3ZZ0A 1WCIB 2OV6A 1SZPA 1F0PA 2E6KA 3UYKA 1QO7A 2IZ0A 5LMZA 2P9BA 2GCNA 3F4KA 2R2AA 3FTDA 4Q3AA 4Z9YA 3ESBA 2IITA 1U3VA 1A4IA 5EKSA 1ORVA 3UMVA 4BFYA 2KS6A 1SEVA 1RWBA 3EGXA 1HUQA 2L18A 3HWWA 3MCTA 3QIVA 4P35A 3MTBA 5KAMA 2PJRA 4LWOA 1YSCA 4K6OA 4N39A 5JG7A 4A0HA 1E6MA 1EUDB 3ZQJA 2Q5JA 4DJJA 1U1CA 2ID8A 3FMVA 3MIIA 1QPZA 2PUGA 3SI7A 4C3VA 4TL9A 4AJ2A 3B7WA 2X6RA 1LBTA 3A7DA 2EP5A 3OPYB 3VNRA 1Y80A 5HUJA 5JQGB 3R6LA 2IUYA 4M38A 4C6TB 2F1JA 4FDVA 3HC7A 5TMBA 3DAHA 4ZVTA 1AC5A 3A6ZA 3LIIA 1Z62A 5HUQA 3EDQA 1V8ZA 2A1TR 4Q7KA 1P81A 1G3RA 3CR3C 2LCQA 4EYQA 4DLUA 5DPMA 4ZXFA 1ISGA 4MI1A 4H7DA 4BQNA 2QN8A 1GKIA 1NE2A 1W52X 1F8FA 2JGMA 3OLWA 5JWHA 4JSYA 1ADBA 3ORYA 4MS1A 4Q3BA 1KBZA 1RXWA 4ZN6A 4BEJA 2I9PA 2WIFA 3OU2A 4GG1A 3WAJA 2XCSB 2WYVA 3BJEA 4J6FA 1V95A 3A36A 5F1KA 4AYTA 1E1DA 5CFZA 2WJ3A 4K1XA 4A0SA 4WESA 3C87A 4GOOD 5DNDA 4DUPA 1XTBA 1ZSNA 1OROA 3VH4A 3L4BC 1FCJA 2FQXA 3WJ2A 1TPYA 3H2JA 4KQCA 2OMEA 3WRXA 5JLAA 5JSKA 1GGJA 3CLUD 2Y0PA 3SQDA 3OJOA 2ZAYA 3ORRA 2CWDA 2JJ2A 5G1PA 4NIMA 3DNFA 4ARZA 3KV3O 1L5SA 2GX6A 2YWXA 3QWHA 1OAKA 4DBLE 4EMUA 4CM8B 1ZZEA 2BH2A 3WGJA 1VP9A 4JC0A 3HKBB 1SC1A 4GZLA 4XXHA 4Y18A 4ZEXA 2PGDA 2PBZA 3KQWA 4LGYA 3WP1B 3WOVA 3GEHA 3K5IA 5GMOA 3D2BA 3G2QA 4LXUA 4ETIA 2H1IA 1RYNA 1GL3A 1Y3DE 4OGFA 5EZ5A 4BO9A 1Q7BA 1MG5A 1L7AA 2FFRA 1IVYA 1IYZA 1H0HA 4WE3A 1K7EB 4NCJA 3UG7A 3WIOA 1JSLA 3GLGA 2XKJE 2EFEB 4XEHA 2P4QA 2W7TA 3TNLA 1KEUA 4LXQA 1E61A 2FJUA 1KZ6A 3FPEA 3GBSA 4JXJA 4JI5B 4WADA 1ODFA 1YASA 2VDRB 3V4PB 3H9QA 2DLDA 2QX9A 2XNSA 4D9IA 4ZQCB 1OLUA 1TZ2A 4BUCA 1NMYA 3HY4A 3LA6A 1G64A 4M1TA 4JJ7A 4QYIB 1UAAA 1FDIA 1P62B 2P0YA 3OEEA 4ES6A 2CWWA 3ORFA 1EDBA 1NVVR 3TVDA 2YRFA 2GPTA 3K2QA 2GB4A 1KEWA 1MB9A 1P0CA 1YRQA 1KDYA 4RGVA 1AKUA 3E2MA 3SIWA 4BV9A 2EU8A 1BXZA 3DDNA 4N18A 1T4CB 2HSGA 3CPSA 5FO0A 1HL7A 4QGGA 5AD1A 1CJTC 1ZI8A 2AQHA 1N1DA 4XCQA 4CI9A 1TEZA 1DCMA 1HMPA 3A4NA 4G5OA 3MRSA 3K7EA 3L82B 3E7FA 4MGIR 4TTJA 3I2IA 4PICA 2FSGA 4D5EA 2N42A 4CTKA 1Q14A 3AO0B 3JRWA 4OIFA 3TLBA 4DIBA 2FDCA 3C3XA 3ZWWA 2CXRA 5KBYA 1OXUA 2NYUA 2X41A 5HJ5A 4E22A 1RDFA 4YN3A 2I7DA 4DGQA 4QARA 4ALIA 4L0MA 4OU5A 2ZIEA 2PUCA 3ECAA 3IEPA 4US0R 5EHGA 1BC5A 3VX4A 1MC5A 2HGZA 1Y1PA 4QYSA 5E1OA 3REFA 1T5OA 1SCBA 5JYBA 4G65A 1ADFA 1KKMA 4OKNA 1IZ7A 5C46F 4FT4A 5LP6A 3O21A 1JG6A 1E3QA 1QVVA 4FZ3A 1MAUA 1WU8A 4M8NE 2WBLC 1SUSA 1ULBA 2ZB3A 4HNSA 2RGBA 5ALJA 2VPPA 4GUAA 3ZU4A 1X7ZB 1A9ZA 3DDWA 1SRQA 2FEKA 3D6VA 2ZJOA 3ABRB 2Y2VA 3LX5A 1JIJA 2ZKLA 1BN6A 3R77A 4FCWA 4KMSA 4YPFA 5JT1A 2BVNA 2AOUB 1NZFA 3DW1X 3HJTA 2PNJA 4NS1A 3WK7A 1C8KA 1IDOA 4DMLA 4D92A 2ZIAA 4YRIA 5B2EA 5C37A 4M0FA 3X2SA 3C5WP 3WDSA 3B1VA 3FX2A 3TPCA 4F5YA 4C0AC 3IBTA 1YKSA 9MHTA 1VHQA 3A9CA 1LNSA 3ACDA 3KKKA 1P75A 1FP6A 4XASA 3RBAA 4BB6A 1Q19A 4ENPA 5DXFA 3CSDA 1GPKA 1QYDA 2CLLB 3PC8A 5JDCA 4PSVA 2HV9A 3DDSA 2AN9A 3W5VA 2E9SA 3QKSB 3UTCA 1EX9A 2YW9A 3L8ZA 5FUBA 1L5HA 4ZK2A 4MHOA 4GE3A 1YE5A 1SCUB 1URPA 1NQUA 3PGVA 2VWQA 1P5RA 3IKMB 3P97A 2YFYA 4JWKA 3KJXA 4UNQA 4N0DA 2G9NA 4L57A 1CF4A 1IK4A 5CT4A 1VHDA 3A1TA 4Z4HA 1J23A 1NY5A 1PL6A 2JS7A 2W98A 1TADA 5BWMA 3W5SA 5KQMA 1X1BA 4YT5A 5F77A 3RAPR 2ZIFA 4KE9A 1E1QD 1Y37A 1CE8B 2R5NA 1VIAA 2YASA 5TQVA 1N0WA 3VTAA 4P33A 3CR8A 1PR9A 2EOAA 4CF4A 5FTNA 1Z2AA 2BRUC 5IMBA 5J2TB 3JD4A 4UVEA 3VYUB 1E96A 3EGCA 4EF6A 2IOFK 3FCYA 2EVWX 4QJIA 4QEZA 4YQZA 1MP0A 5FORA 1KPGA 4YAGA 1RMYA 2R3SA 4NBNA 3TTVA 4CZ2A 1F8GA 2ZR8A 3HP4A 4PSDA 1G5HA 4CTMA 1TC1A 2DJIA 1XRPA 3HY6A 4RJTA 5LU8A 4RK5A 3HZHA 1KKUA 4TYWA 1UODA 3HDJA 3IUNA 3VDXA 1J0DA 5AM2A 1GXSA 3L2OB 4X84A 2DLCX 2IS6A 1SOVA 3QVLA 5DNAA 3VJLA 4H0FA 3CNBA 4R41A 1PZXA 3RT7A 1KI3A 1ISRA 1N6NA 3H97A 4MULA 2FSVC 3AFGA 1RHRA 4CKWB 4OL0A 1IAQA 2RGRA 1SVOA 4YAKA 3HXKA 2WYHA 5F7ZA 2OZLB 1OFGA 5ECGC 1W36C 1GUFA 1YQUA 3HJGA 4BYMA 2WQ6A 4BE4A 5B64A 3AL0C 3IMGA 2DVMA 3TDMA 1JHYA 4QJ3A 2FUG6 1YS7A 3IOEA 2YZ7A 3AMVA 4FFWA 1WXXA 3AY0A 4QOHA 1A1VA 3INGA 3FPKA 4ITRC 3H1GA 4RY8A 2QR2A 4FOTA 2CXQA 5IT5A 4K7JA 1H22A 3NETA 4LOKA 2FFAA 5AP9A 3SYKA 2NMVA 4KBYA 5B37A 1RBZA 3D5TA 1SVNA 1QC5B 1M3SA 3O3NB 1K0UA 4NDZA 4TXMA 2P1ZA 4JAVC 5J9FA 2JHAA 3PJGA 3QVUA 1UXKA 1FX1A 3ABZA 3H2IA 2VP2A 4KE6A 5FKJA 4F2PA 4B82A 2IA5A 3ZZTA 3G2IA 1EIZA 2JVKA 2JBWA 1FLDA 3H5OA 1TE2A 2O3QA 2TMYA 3EXG1 2BF7A 2MYUA 4DBZA 5A5DA 4DR7B 2VFAA 3L8CA 1R8SA 2G9QA 4V38A 5FL3A 3L0CA 4HFMA 1I3MA 5EXEA 3RIGA 3HB5X 3LUPA 3ICPA 4UASA 4EAAA 1WM1A 5AJZA 5L8VA 4O8ZA 3S99A 4GOJA 1QWSA 3MMXA 1R6AA 4URVR 1BGXT 2FRVA 2H9YA 2QX7A 4M3NA 4A2PA 1NX9A 2PQ6A 1RPJA 3QF7A 4R1MA 3ER8A 2QY6A 2FOXA 3D54D 3PQ2A 1UPUA 2C2OA 2JLBA 3C6XA 2JAQA 4Q1EA 4LYHA 3BKWA 3T9CA 1P39A 4P36A 3DHNA 1P2VA 4RADA 3W8EA 5KKAA 1WY5A 1E0SA 5LSAA 2ZB2A 4Y2HA 3ZV7A 5KYYA 1E3LA 2PJDA 1T9KA 2XKKA 3JR7A 2BEWA 5ARBA 5EC8A 5LIPA 4XSHA 2P3OA 1QIHA 3OPYI 1NASA 3BE6A 3WBFA 2VZ0A 4ZQEA 2GJ8A 2A9VA 4DF3A 1I0LA 1KI7A 4ND4A 7ADHA 1C3EA 1ZVQA 1YBVA 5FBHA 4AIRA 3GJ4A 2J67A 1JX6A 1A7JA 5CYFA 1JWAB 4YIKA 3U1VA 4O4IF 4C87A 1NVEA 4EJMA 2Z9BA 3AC0A 3VV3A 2Q7OE 2HRDA 5D8DA 1WB5A 2O3TA 3UMJA 1DAOA 4YB8A 5BN5B 1J70A 3L0IB 4EHDA 2DEUA 2E4XA 5FOTA 3LKDA 2GBLA 5BSWA 3N7TA 4IJ5A 3DMRA 1SUPA 1THZA 1KWGA 3RIHA 5AW9A 3GNLA 3REQA 3C3JA 4JBLA 1DO0A 4MA0A 1F5SA 2JIZD 3FJOA 3EISA 2FQQA 3L4JA 1Y7LA 4GLJA 1Q7TA 1NMXA 1YJ8A 2Z83A 2ZPTX 2ZSAA 3A6JA 1RC0A 3E9RA 3OE7A 4IS2A 3IA2A 4QUBA 1S4QA 4B0OA 4Q4AA 2R44A 3G02A 1PIWA 2O2XA 2VDOB 5DT9A 3UPDA 1MA3A 2FLKA 1Z34A 2C9YA 3DYIA 1VSVA 2PEZA 1FUUA 1QGZA 1V9CA 2JLSA 3KAKA 4P0TA 4WXEA 4PZDA 5B4VA 5I9LA 3EC7A 1ECLA 5I9NA 1ZGAA 4MR9A 1O5IA 3K92A 4H3VA 1PJTA 4Q9NA 1VIDA 3CVOA 4J07A 3VPBA 3GGPA 1FF9A 3R24A 3OTHA 5G02A 1K3TA 2QL7A 2HFJA 3NRBA 4JB8A 5B6IA 3WGHA 4MQMA 1W0KD 1D6SA 1QB7A 2HF7A 3ETNA 4K9QA 3WZMA 3ZK9A 1NW4A 3FVQA 3NV9A 3H6HA 1L4HA 4TXNA 4ALMA 2W6ID 3VUEA 2ARKA 1G21A 3BFXA 2YXDA 2UZ1B 4MQ6A 1YKFA 1E77A 4JL5A 5KYGA 2OBFA 4RQBA 4HAVA 2ZRQA 1VLHA 5G3YA 4MINA 4GAEA 1RQGA 4KI7A 5K4HA 2ZI6A 2DFLA 3M9LA 4P32A 5LB4A 2J3HA 3ILYA 1SUCA 3IIKA 1USWA 4EPRA 5JNWA 4MQEA 1F7UA 2CD7A 2HXGA 2QTBA 1WZEA 2EW8A 4LECA 1DU4A 4YMUA 4OHMA 1GUBA 3S8EA 2NN3C 3J7AC 2P68A 1ZUWA 2ZTHA 4KYUA 4BQSA 2DTXA 3OLVA 1G6OA 2RONA 2VEDA 5DO9A 2Q5FA 5I7EA 1U1GA 2FR8A 3ZWDA 3MJRA 5IULC 1EAMA 4CM7A 4KJXA 2NSYA 3UH0A 1XE3A 1PT5A 4I0WB 4RS4A 3RVLA 2E1RA 5FQOA 3ZI4A 2XYRA 4NAVA 1OREA 2DETA 1NBMD 2ABWA 4MJLA 2HDWA 3DFUA 4UBNA 5HE9A 3SQOA 2UUPA 5H80A 5KTRA 2OZPA 2EYUA 3E58A 2NXJA 5KWSA 4TPKA 5GONB 4IX1A 1HNNA 2QI9F 3ZZNA 1YF3A 2AA3A 4KQ2A 3IE2A 1YHYA 4N8EA 2YOHA 1SUEA 1BCRB 5FULA 1HE4A 1J2JA 1L7DA 4NBKA 4EW3A 3OJFA 5AXCA 5BQPA 3TDNA 9GPBA 1DEAA 2Q2QA 1UZLA 3Q11A 4XARA 1B1AA 1HFKA 1L9KA 1U0JA 2C88A 5D2CA 5EWMA 1M5TA 3RYCB 3FWZA 1RJWA 1DJNA 2VF8A 4LHXA 3ONWA 4PPFA 2GEDA 2M9MA 3BH7A 3CBGA 5CDSA 2XAAA 2FN8A 2IVZA 4PAGA 4OMFG 4G0ZA 4JQYA 1B0AA 5EKTA 5LBUA 1CWUA 1QKJA 4M37A 5EGSA 3RJTA 2J5KA 1GAQA 2XE8A 4LF8B 1Z7GA 1N5LA 4DLTA 4FGZA 3ZKWA 4GSKA 1H2EA 5CJJA 1WDLA 2H7CA 3CG4A 3D5EA 1FYXA 3HRIA 2ZIUB 3E18A 3N8IA 4HTAA 2ZROA 4P3KA 3VVCA 3HUEA 4FBLA 1NYLA 1TF5A 2X9LA 4O4JB 3PQCA 4OEHA 1OILA 3A1NA 1G5FA 3EXHA 3OZGA 3UXEA 1TYDE 2EJWA 5E4YA 2HO4A 1QANA 4EQ6B 1STOA 4RZUA 4U7FA 3RROA 3TSWA 2FE4A 4DRXB 2JD0A 2O23A 3WRXC 4OXXA 4L7VA 1TX4B 2YRWA 3KTDA 4REOA 3S7TA 1QKKA 3IV7A 1W94A 2PS1A 3P20A 4LMAA 3S70A 4IO0A 2QROA 4U7GA 2PIAA 4RLQA 4A16A 3O8RA 1QU3A 4OHRA 3S2EA 1VYTA 3QVJA 3KSDO 1WCIA 4WPGA 4TYMA 3L07A 1RP7A 4D8VA 2YJGA 1B41A 2H16A 2JDIA 4XSVA 5BW6B 3MJEA 5JS6A 3R7WB 1E7SA 1SWVA 4YPOA 5LP6C 3S7ZA 1NR5A 3C15C 3D8BA 4ADSG 1ZRSA 3KTAA 1G3MA 1CBUA 2R8YA 3A6LA 4KQKA 2MYTA 2RAVA 4RHCA 2PMCA 1U8CB 1KQPA 1LBIA 1LPOA 1NBWB 1MEOA 1P0FA 1QOPB 3PI7A 2X0JA 3NQ41 4X20B 3V7YA 3HI4A 1WLYA 1SC3A 1E1YA 3WXBA 4DVJA 5LP6F 2IY7A 4O4HF 2JIDA 3UKDA 3EVNA 3HUFA 5GQSA 4GOMD 4KG7A 4D0RA 4YACA 1OI3A 4JT8A 2FZGA 1GEEA 2MHCA 3K1TA 1LLFA 3GJ3A 4YP7A 1C0PA 2V7TA 4J2TA 1YVDA 4YC7A 5JBNA 4F8EA 5C4IA 5GV7A 2W2OA 1VL2A 1Z8DA 3KKNA 3E3NA 4XCXA 3VU0A 3UWSA 3RI3A 2R4TA 3PD7A 4LN1A 2EV9A 4MJ7A 4LPSA 3A4LA 2PCLA 4JZYA 3C98A 2YVUA 1WEHA 1OTXA 4IIYA 3O9VA 3ZDXB 3ZXYA 3LLMA 2YHIB 2OC4A 1VL0A 5CG2A 3PHHA 4NCNA 4TL7A 1M8JA 3DWIA 2LPMA 2R96A 4UATA 3TLZA 3HKDB 3BFJA 1RI5A 1X9IA 4AWAA 4HVCA 1S5PA 1U65A 4TS3A 3MILA 4RIGA 4U2KA 4FYHA 2PUVA 2AB0A 2C5FA 3HDTA 2PJZA 4X6XA 4AY6A 1AB6A 4OD0A 1Q0ZA 3MTEA 3PDIA 4KH1A 5ICEA 3LCMA 4XQEA 1DARA 1U2ZA 3E1SA 5DT2A 2XV1A 3W1WA 5KPJA 1DAIA 6ABPA 1RRPA 3M9XA 2O19A 2ZRNA 1NW9B 3NUZA 4FS8A 3P45A 1DKRA 4YR9A 3OTOB 3N0XA 4AX8A 4HDOB 4QDTA 5JAZA 4OP2A 1Q77A 3SS8A 1ADYA 2DULA 1A98A 1L6RA 1EM8A 2G6BA 2ZE8A 2YV2A 3D4PA 3EXFA 3GGSA 4N7BA 4Z99A 4BZPA 4I9GA 1Z0AA 1QVZA 2VF2A 2YX1A 3K5HA 4PVCA 2X9VA 2HMAA