2ZRFA

Msreca q196n datp form iv
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
326
structure length
312
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRETTTGGKALKFYASVRLDVRRIETLDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 95
structure length 312
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrfA01
2OSBA 2OAQ1 4HATA 4I4LA 4G5RA 2J87A 3U4QA 1GIAA 4TWZA 1KI8A 3CRRA 2NPFA 3GJ5A 1IJFA 4C0QC 4MRNA 3RRMA 2H8KA 4L16A 4M9QA 4FCVA 1XPUA 1I2MA 3NIBA 3CH5A 4HLUA 2FE4A 1E2KA 2GBLA 1OIWA 3AVVA 2IYSA 1FQKA 1PJRA 1CP2A 1FX0A 2RGBA 4XVUA 1QZXA 1P61B 3B1VA 4G3XA 4G5QA 2IWRA 1OH5A 1BOFA 3MWJA 4JSTA 4OHWA 4BFTA 2XX3A 2GEVA 2IBMA 4FWIB 3UK6A 4QKQA 3U7EB 1G8PA 1HT2E 3L8ZA 1G7SA 4LJ5A 1M7GA 4PSAA 4OK3A 2OBNA 1P2SA 4ZDIA 4NZYA 2BMFA 3A4MA 2ZYVX 3C16C 5DGXA 1XP8A 2ZI3A 3SHFA 4PAMA 1DAEA 4NKRA 1UBCA 2ZRLA 1HUQA 1E9DA 3SHWA 3H4MA 4G01B 4Q4JB 2UZIR 4NDZA 2FSGA 2ZRDA 1MO6A 2MMGA 821PA 1GDDA 4DLWA 1UPTA 4L9WA 4TT3A 5J4HA 2V4ZA 3ZZ0A 2P6RA 4KO8A 1PLLA 3CRVA 4OJKA 4U5XA 5EE9A 4TYYA 2F9MA 3THYB 4IDPA 2ZRCA 1VCMA 5EP1A 2QRNA 1L2TA 3EG5A 2MSDB 4JSYA 1VIAA 1Q3TA 4AKGA 5CB8A 3NH6A 4DLRA 2NOAA 1W4AA 3SS8A 2RGAA 3KZ1E 4BECA 4F4JA 2XXAA 3UPUA 4B35A 2WAYA 5FBVB 3P4YA 3P4XA 4M53A 5L3QB 3U44B 2AXNA 4U00A 4DDVA 2ATXA 1DBSA 5EP3A 5L3VA 3B85A 4DC9A 1K5GA 1LVGA 1K8RA 3V9PA 1DVRA 5FOTA 5J4YA 3AVYA 2FGKA 2ZU0C 3IGFA 1NSFA 4ERNA 4LHWA 4PSKA 1ZW6A 3GJ7A 2OBLA 1JXOA 1N6LA 3IPXA 1AGPA 2IHBA 1W36D 3X1YA 2B7CA 3A36A 1GZSA 4YXWD 2JLXA 1AKYA 2EFGA 1N6IA 4TMZA 3GLHE 1N0VC 2G83A 2ASEA 1XEXB 3BK7A 2XB2A 1NP6A 2CE2X 3BS4A 4JJZA 4G5SA 4F38A 4V0KA 1VTKA 1E32A 5EE0A 3UWOA 1W4CA 4NONA 1KIMA 1LS6A 5G3YA 2NQ2C 3AF0A 3EC2A 4Z8YA 2W83A 4KFRA 1P9RA 4PAOA 5JECA 3MD0A 1E4VA 2AFIE 4OHZA 2IYQA 1G8FA 1IBRA 1KI1A 3KXIA 2J1LA 4A82A 1ZRHA 3CR7A 3MFYA 1HA3A 4US2R 2N42A 4MKIA 2GTPA 3L0SA 5AJWA 5L3SB 1E9CA 2FFQA 2NZ8A 3TBKA 4PHTA 4M8NE 3C7KA 2AX4A 4BFXA 4CEIB 2EYUA 2YOHA 3BFVA 5EZ5A 1ZM7A 4M9XA 1TQ6A 4OI4A 4MUBA 1Z5ZA 3CPEA 1G5PA 3MMPA 3NTUA 4Y0VA 3LFUA 3SN6A 4F7WA 1H65A 5BN5A 4H1UA 4HI0E 4XSGA 1OXSC 1KJYA 1IOZA 3NKVA 2CDNA 4V0NA 2ZJZA 1R5OA 2G1KA 5P21A 1EWQA 1OPXA 1G4AE 2CHQA 5LBIA 4KAXA 2A7QA 2AK3A 2WJHA 4YXWA 2NMVA 2ZREA 3OZXA 4MKFA 521PA 3B60A 3VKWA 1DG3A 1QHHB 1G3RA 4TLCA 2BEKA 2OCBA 3WMFA 5B57C 4FD2A 2GXSA 4JLVA 4DLZA 2O8DB 4PTLA 3AM1A 1XMSA 4PQRA 3HDTA 1E94E 2B7BA 3EAQA 1DEKA 1HQYE 3IQWA 3SFZA 3UMSA 4IDHA 3OFNA 4E22A 1XZPA 1KDRA 1PLJA 1RZ3A 5DHAA 3WHLA 3GLGE 2I4IA 2QNRA 4D26A 2O8DA 3KB2A 1H8HA 1G291 3TQCA 4EQ6B 4QXAA 2O8FB 3LBIA 2IYVA 2XGJA 2ZUDA 4ZKDA 2QQ0A 3AKYA 2W6JD 1E2FA 2FU5C 2R65A 2XZPA 3X1XA 1OHHD 4A8JB 3CZPA 4JZKA 3DOFA 5JJLA 2QTFA 5CIQA 1KMQA 5HE9A 1OW3B 2D74A 2FDCA 3M4YA 1GG2A 1KMHB 5JSZA 2V55B 4GOKA 3A6PC 1JXMA 2PEZA 2NGRA 1LB1B 5FBWB 4B48A 1KO1A 2E9SA 4M4SA 1BYIA 1QHNA 3GQBA 3VMFA 3KL4A 2OV2A 1JR3D 2NG1A 2ZTSA 1D9ZA 1NLFA 3CW2A 4OHVA 4RFSA 5DHFA 4E07A 2ZXUA 3U44A 1ZD9A 1E99A 2QMHA 1FQJA 1XWIA 3RVBA 1ZNXA 2REXB 1NKSA 4C9BA 3DPUA 4CEIA 1OFIA 4TSFD 2WKQA 4L5BA 2GF9A 3IO5A 4U02A 3GPLA 4Q66C 4ZI2A 4E03A 3DKVA 3PEYA 2ZSAA 3NDPA 3AF3A 3T34A 3B7GA 3TE6A 3DZDA 3SJAA 1IQPA 3EZ9A 1CR0A 2DWPA 3QY0A 3A8TA 2W0SA 4Q4AB 4PXAA 5F9FA 2XTMA 1XD2B 3IHLA 2CNWA 3KUDA 1Q3HA 1UKVY 4IW3B 2BCGY 4QHSA 2ZE8A 4GFDA 1VHLA 2PL3A 1F5NA 4P0TA 2E87A 1A2BA 2WJYA 3P1JA 1N5JA 2GHIA 5FBLB 5FPHA 5FOXA 3GJ4A 4Q1FA 4Q4HB 2RGGA 1N5LA 4NMMA 2Q9BA 3QKRA 1VG8A 1KYIA 2ANCA 2LCFA 1M2OB 3AEZA 4KV9A 4MKHA 2FEOA 4OL0A 4URXR 1TEXA 3EPKA 2GWHA 2P67A 2VP9A 4QHYA 5JI3E 4KXFB 3PV0A 4DSOA 4FMCF 4IVPA 3AUYA 5TARA 4BQSA 3AVTA 4GP6A 1PZNA 3I73A 1ETUA 1SGWA 3SBDA 4NL4H 3HJNA 4TZ6A 5DI3A 2GRJA 4R98A 2ERXA 3CPHA 1IN5A 3CPJB 4XWOA 5KNBA 3Q85A 1VECA 2JLWA 1ZU5A 1MH1A 5FUWA 5BYKA 5C4MA 1VG0B 3PEVA 1AZTA 2BMEA 3U7GA 2AK2A 1OT3A 4DLVA 4Q9HA 1T8TA 2IXEA 2DFTA 3QIAA 5EXXA 5UKDA 5ELXA 2IEYA 1Q21A 1R8SA 2HF8A 1E9EA 3WP1B 1P2UA 1YVDA 1CU1A 2DR3A 2QU8A 3IO3A 1F3OA 2PZFA 4JKYA 3K70D 1AQUA 3C41J 3VR2A 5TV2A 4YMTA 4TYNA 2X19A 1RRCA 1II0A 2GK6A 3KJIA 3SI7A 2BBTA 4DLXA 2R6CA 4URVR 1YJ5A 1G5RA 1VKJA 4NYJR 3VKHA 4JLMA 3FKSA 5HZHA 4CT4B 3RYTC 1YZNA 1TQ2A 2J0SA 3RSLA 1LF0A 1TU3A 3B9PA 4I1VA 4RD2A 4A9AA 4ZDKA 2JLSA 3B9QA 1OB5A 1NVVR 1GWNA 4O2LA 2Z5FA 3L43A 2PZEA 2D2EA 4A0FA 2WPDD 2Z4SA 3AP3A 4EPYA 1CJVC 4QNRA 2EFCB 2VLIA 2PLFA 3O47A 1JEEA 5F9HA 2QSZA 3M0EA 4OI2A 1FW6A 1HT1E 4LYJA 4GBMA 1HTWA 2ZS8A 2OLJA 4LV8B 2QRZA 5TY0A 1MRNA 1NBMA 1XBTA 2PCLA 2FZLA 1KI7A 4LJ4A 5BN4A 1MR3F 1T3SA 3P26A 4J0QA 2ZITA 3LVQE 5GJCA 3SC3A 1N25A 2ATVA 2WWXA 3L82B 3Q7PA 3TUZC 2CLDX 2ZRMA 2ECKA 5FPYA 1TNDA 1C9KA 3NC1C 3MUFA 1DADA 4DT1B 2GCOB 1R0ZA 4N0EA 3R7WB 4LJ6A 5CJ2A 3U3RA 1I4LD 1TUEA 4D0LB 3F3YA 3KFXA 1TAGA 3RDPA 2WM9B 2QE7A 3F0TA 4B2LA 1BKDR 2GNOA 4IRUB 4ESVA 4EFNA 6Q21A 4NCKA 4TTRA 4GRAA 2R6FA 1US8B 1FPMA 1N5KA 3F5FA 1WA5A 2BBWA 3B1WA 2QL6A 3KKPA 1IAQA 4GMDA 3K70B 4M1WA 4PPGA 2X8AA 3AGPA 3I92A 3BFKA 3I5XA 3B82A 3SYNA 3THOA 3LO5A 3K09C 2AHOA 3W5JA 2WVJA 5FI1B 1UKEA 2ZI7A 3GFPA 1IXRC 1AQYA 3L0PA 4BRUA 2GCPA 5SZJA 5K8LA 1U2RA 1ZP6A 4EPWA 1SVSA 2EWWA 3C5HA 3QPUA 1OB2A 3F8TA 2H16A 2VF8A 4EDHA 3K70C 1EX6A 2GK7A 3DDCA 3AUXA 1TU4A 4I1UA 1U8YA 3KKMA 5FTLA 4CIDA 2A5GA 4KFSA 1GKUB 4IOKA 2H17A 4JLJA 3NG1A 4C3ZA 5FI0B 4JBWA 4MGZR 1XZQA 2FMXA 1R8QA 2Z0MA 4NCJA 1XXHA 4WIAA 3CB4A 5EE3A 2WWGA 4ESHA 4IDQA 4UXJA 1PLKA 5E3HA 2GZHA 4B6EA 1AKEA 2C77A 4EJSC 1GITA 1ESMA 1YZKA 1F2TB 3TGPA 4JL6A 3EWAA 2BDTA 1X8KA 2ZYUX 4XD7D 3RS3A 3CR8A 2VSOA 3MG9A 1T3LA 2ZJYA 4PANA 4MRRA 4UNRA 3K9LA 1JAIA 1SXJD 2HUPA 4TZ0A 1D2MA 1YE8A 2HV8A 4Q1EA 4TN1A 3S1AB 3PJRA 3SU8A 4TQAA 1OH7A 1E2QA 4YONB 5L3SA 4G5GA 2VHJA 4JBYA 3SQWA 2AD5A 5KYKA 1EXMA 1VIYA 4LK2A 3GJ8A 3T5GA 2BM0A 4P32A 1XF9A 2YINC 4RCZA 1UDWA 2G0TA 3OIYA 2C96A 4CZ2A 4DRZA 2KWIA 1HV8A 1U0HC 4NBSA 5JCPA 1UDXA 2O8EB 2QMOA 5IT5A 1WE2A 4C4PA 1KHTA 4AI6A 2ZYWX 2XNSA 3JZAA 1UF9A 4KBGA 1X3SA 3LQQA 3O8RA 1U99A 2DY1A 3Q9LA 4X8OA 2BJVA 5J4LA 2Z43A 4TYQA 3RLFA 3HYRA 1YR9A 1DAMA 2A5DA 3K0FA 1KO8A 4MA4A 5HZKA 2RB4A 2VP6A 1R0XA 4BFZA 3M6AA 1SVWA 2RGNC 3E2IA 2BMDA 2IYXA 4UNQA 4JLOA 4KSCA 3IBYA 4ZCLA 2BBOA 4LC1A 2JJ2D 2IF0A 3RANA 2I1QA 2VHTA 5FTMA 1XTRA 1ZM9A 5ANRB 1XD2A 2JLRA 1XMIA 4OBEA 3B8HA 3LX8A 1W4RA 2NZJA 1W5TA 3GLGB 1RRPA 5FPTA 2FX3A 3V4RA 2QPTA 5AR1A 3U3KA 4EFMA 1EFRA 1Z6TA 4BLPA 3I1FA 5EZ6B 3TKLA 3EIEA 1XU4A 3CWQA 4HDQB 3ZLJA 1KI9A 1EWRA 1DE0A 1G9XA 2W6ID 2XNDD 4C0BA 5EJEA 3FHCB 1ANKA 2EQBA 2VP0A 1G41A 1M7BA 1DPFA 2XAUA 1ZIPA 2A78A 2A3RA 3D8BA 1YU9A 3WYFA 3UG7A 3T06B 4NCNA 5BXQC 1PV4A 2OCYC 4ILEA 3L0OA 1SXJB 2ZRAA 3EZ6A 4YDHB 2ZR0A 1YR6A 2QPAA 4BLSA 1UKYA 3U60B 2JGNA 2LKCA 2VPPA 2ORVA 3A1SA 4NHOA 1KMHA 5IK2D 1X86B 2XZOA 2V1UA 5CM8B 2CL7X 1NI3A 5DH9A 3WNBA 4D0GA 1XD8A 2OXRA 5KSPA 2Q21A 1G5TA 5JRJA 2XJ4A 3OEHD 2VRWA 1L8QA 2QAJA 4W7SA 5FBRB 3TJZA 4A8JA 1WDTA 1XEXA 1W36B 1NJFA 1QF9A 1W48A 4DSNA 3ICEA 1CR4A 1XJ0A 3NWJA 1TF5A 2AWNA 1XPOA 1KK2A 2EFDB 4DCUA 2O8FA 2PH1A 3SYLA 1V43A 2NO7A 3DEFA 3LAWA 1FNMA 3LY5A 1JQLB 4BFWA 3B2EA 3KQKA 3IEUA 4D4KA 1YZGA 1DAHA 4EUNA 1E1RD 3CF2A 1U8AA 5G40A 5HCIA 1X8LA 4KBFA 2AKYA 1IJEA 1Z2AA 4A1FA 2YC2C 2CXXA 3PCRB 3QSYA 4GI7A 1SKYE 4C7OA 1M8PA 3CX8A 3VKGA 1CEEA 3G82C 4DZZA 3I61A 3VAAA 3LLMA 1YR7A 3QG1A 3W6PA 2LWIA 4Q02A 5GVRA 5CLLA 4AWXA 4BLQA 1GNPA 5JHHB 4KI0A 1QHXA 3OE7A 1FUUA 1ZVQA 2J3EA 1XTJA 1OE0A 2DPXA 5C4GB 4LYAA 4Z51A 2OESA 1FP6A 1T91A 3W8RA 1Z28A 3K0EA 2V7QD 2UZ3A 4EAQA 3GFTA 3TSZA 3VR3A 4BEJA 2QT1A 2W6JA 1NG9A 4K8OA 2IS6A 1MKYA 4US1R 1KGDA 2GKSA 2OM2A 3KXKA 3OESA 4IJMA 4FINA 2GXUA 4ZKEA 3KKQA 3TQFA 1EFHA 3FHTA 2ZRJA 2ZJ8A 2BOVA 2EWVA 3UIEA 4LUCA 4XVQA 4DBLC 4JLNA 2WSSA 4ACAA 2RGEA 2ZJAA 3REFA 1XXHB 4RVCA 4M2LA 1Z6GA 3TUIC 4TLDA 2CVFA 1J2JA 1R0WA 3CBQA 2GESA 5FL3A 2BJWA 2Y8EA 2ZI5A 1SVMA 1Z08A 2EU8A 4UXHA 3Q5DA 1S3SA 1OYWA 5M04A 1NBME 3NVAA 4QJ4A 1GOTA 2QM8A 4HUQA 2B6HA 2ZSBA 3KFVA 2QGZA 3KQHA 1GM5A 3FTQA 1LS1A 4ZI3A 3T1VA 2RGNA 1JEDA 1G17A 5H70A 5JBQA 1UADA 3LH5A 4IFBA 2D4HA 1OH6A 1ZAKA 2A30A 1AK2A 4HAZA 5KU1A 5FUXA 3WNDA 2QG6A 1VCOA 4RD1A 1GP2A 2XSZA 4GSYA 2V9PA 4QGHA 2G3YA 2WIBA 3DHWC 4MGYR 1QG2A 4Q9IA 2ZANA 1BH2A 4PHGA 2CCKA 4O25A 2WJJA 1E3MA 2QA5A 2FSIA 4B3BA 3DVLA 3TW4A 4LJ8A 4QNMA 1E2LA 1W0KD 1E1QD 1HE8B 1YZQA 5B30A 1IONA 1CRPA 2J59A 4LY6A 1NLZA 4URYR 1R0YA 5DO9A 2YC4C 3KTAB 1JR3E 2IUSA 4KSBA 4WXPA 4A2PA 1C1YA 2VHCA 3QKSA 4KODA 1KK0A 5KUTA 1J70A 1G7RA 2ZS7A 3DM9B 5KO2A 1CJUC 3ADDA 4L9SA 2BHRA 3GFOA 4BWYA 4DT1A 1E96A 3TVDA 1IY0A 1KOFA 4P33A 1O87A 1KSHA 1T6NA 2W58A 3QQ5A 4LPSA 1O3YA 5DE3A 1P4SA 2OCPA 2FSFA 1KJWA 1S0UA 4ZPXA 3TRFA 3HR8A 1OSNA 1P73A 1JB1A 3EWSA 4HAXA 2G6BA 2JDID 3QBVA 3W3AA 3THXB 2QP9X 3W5IA 1GRQA 3LRPA 1QHGA 3H1TA 5SZKB 1GVNB 3NH9A 4JLKA 3AV0B 3LX5A 4TL6A 4EPTA 3PEUA 4BPBA 3GEEA 1NJGA 3OIVA 3ZGXA 1RVDA 2BVNA 2Q3MA 3TR5A 4JL5A 3H2YA 2FA9A 1EX7A 2IYRA 1BMFA 2MSEB 5AUQA 2WSSD 4BLRA 2PJRA 1M34E 3HWSA 5G53C 4X8HA 1KK1A 4G5OA 1CJTC 4TSFA 4LGMA 5J40A 2DFKB 2QI9C 3U2QA 2IS2A 5E7JA 3IPYA 4C0HA 1JECA 2XZLA 4HZIA 3QENA 3QKSB 4JIMA 4LI0A 2BMJA 4QG7A 3X1ZA 4DB2A 4TMXA 1AJEA 1XXHE 1OH8A 3A4LA 2QN6A 1ZCAA 3SQXA 3GJ0A 3O8DA 1LTQA 2HXYA 3B13B 4RJLA 1TF2A 1XTSA 2Q9CA 2FZ4A 3KX2A 2QE7D 2JEOA 5JZVA 4LYFA 3ECCA 1ZUNB 3FMOB 2I1VB 2BCJQ 4H1VA 2OBMA 4HYYA 5KDLA 4XH9B 2J45A 2O0HA 4PC1A 4RZXA 1WCV1 4HZUA 3EZ7A 3P32A 1DO2A 1UEIA 3GJXC 3VU9B 1X8JA 3AKEA 2IUUA 2C04A 1G19A 3CRW1 1JR3A 2QP3A 4TQ9A 3THWB 4M9SA 1BO6A 1N6HA 3QF4A 4IVRA 3ADBA 1OJLA 4Q00A 1E9SA 2VA8A 1CJKC 1KAGA 4BGDA 4HDCA 5FFMA 1IN6A 4E5UA 1COWD 5A4JA 4TLEA 1JNYA 1KO5A 1WQ1R 2WWHA 4RZUA 1T5IA 4WZ6A 1VCIA 2IYYA 3CNOA 4ACBA 4YMSA 2HT1A 4LYHA 1DAKA 1LFDB 4JT4A 4HAYA 2DHRA 4PZYA 4WA7A 3BOSA 1E79D 3C15C 4Q03A 1XCPA 5C2JB 3CM0A 4IFEA 1JALA 4V03A 4AD8A 2KI5A 2P6UA 2QAGC 4CDGA 4I99A 4RY2A 3A4NA 5FTNA 3ZS8A 3ZZTA 5KNCA 5HPYB 5D3QA 3ND8A 4R9UC 3KDSE 1PVOA 3OE7D 5GVSA 2HDNB 2FJUA 4GPTA 1N6OA 3AP1A 4RFVA 1P7CA 4C2TA 1K6MA 1Z6YA 4ZO4A 2O8BB 1TEVA 1KI6B 2XTZA 1Q20A 5J47A 3OAAD 5FH9A 1ZUIA 3E1SA 4W9MC 2IK8A 4KLNA 4C2UA 2BC9A 4OHXA 1JBKA 1LV7A 1IHUA 2GEDA 4A0HA 3I5YA 2P0EA 3TW8B 4DEXA 3FFBA 1IY1A 3QI2A 2C95A 2BM1A 1RW4A 3UXMA 2ZSEA 1G1MA 3KJHA 3X1DA 1DTSA 2WIAA 4AC9A 2GETA 5JI2E 4EKDA 2EW1A 3QUSA 3REGA 3T1QA 4MUAA 4GNKA 4ABYA 4MGKR 2VF7A 2F55A 1DAIA 2ZJ5A 2IW3A 2PT5A 4A36A 1XD9A 2REOA 2H1LA 2P5SA 2ZU6A 1XPRA 2QMEA 2J5XA 5DI3B 3EC1A 4B3CA 3M1IA 1ZD8A 1NY6A 2HXSA 3QXJA 1G8GA 1N2CE 2RH5A 2V8OA 2FWRA 4BRWA 4HB4A 2QTVB 4NYIR 2FOLA 4XD7A 2HF9A 1VDZA 1T8UA 3HU3A 1NVVQ 3TR0A 4KITB 2RHDA 1VG9B 4Q4HA 4OKSA 3VR1A 2QAGA 4Y0AA 1P72A 5CLQA 1CJMA 1UBFA 2XTNA 4FN5A 4Q1AA 4UNSA 4RD3A 5LD2B 2KBEA 4NPHA 2BBSA 2CLSA 4B6FA 4RD6A 4D4LA 4L15A 3W6NA 4B2IA 4DCVA 4BEBA 2HYIC 1M6NA 3PENA 3E70C 3PXGA 1KY2A 3WMEA 1ZJ6A 1W2HA 3TSWA 4Q4AA 3BERA 1SKYB 4NE2A 4UKDA 2WJVA 5FOWA 4JBXA 3EA5A 4B76A 4LHVA 4KYUA 1E0AA 1WF3A 3W9YA 3ZD7A 1RJ9B 4TYPA 3TNFA 4QGFA 2IA5A 2AL7A 1QDEA 3FPAA 5L8VA 3CLVA 5FTKA 5KTYA 1E2MA 4OQXA 2JA1A 1ELOA 3QKTA 4QJ5A 4NYMQ 4A6XA 2QUZA 2W2TA 1OF1A 3RS7A 3KKOA 1QG4A 3QXCA 3ONWA 1I4TD 1U0JA 1ZBDA 1CTQA 3V4FA 1R5NA 221PA 2ZIAA 2JJ1D 3MRSA 3PR1A 1TL7C 3U7FB 5B58C 2D3WA 3KQNA 2CEAA 3RRYA 1UBGA 1MABA 3BGWA 1FP7A 2A5JA 1S9HA 5JSZB 5FBQB 3PITA 1D8TA 2KE5A 3BD9A 3KUCA 1W44A 4TMWA 4ZIRB 5KSYA 2ZRHA 1XTIA 2XJ9A 4NCIA 2A2ZA 1HURA 3JZMA 4PQYA 1WXQA 3NHBA 4JJKA 5G41A 4OQLA 2CJWA 4PZZA 1DARA 2NIPA 3GLIA 3QOFA 2ZS9A 3K0FB 2Q9AA 4K46A 2DCUA 5AJXA 4BZPA 1Z0DA 1XJQA 2GJAA 4Z8XA 5IRCD 4Q7JB 4QM6A 2QTHA 4B34A 3HU1A 4F92B 4BZQA 1GKIA 2ZPTX 3PEWA 2YZ2A 3R8FA 2AWOA 4CEJB 3UKDA 3OF5A 1AN0A 3I3SR 4TTPA 4ZCIA 2C99A 2QY9A 3PG5A 3AGQA 3WYAA 4ASUA 1ZUHA 2QSYA 2VSXA 2C5LA 3VQTA 5H68A 1RE0A 2WJGA 2D62A 4X8LA 3ZJYA 5J4KA 2CJWB 4WAUA 2NPIA 5FOVA 4PPFA 3LLUA 2J7PA 1S3GA 1FL9A 2GEUA 1L4YA 1RKBA 1E98A 5EUMA 1KSJA 1MO3A 4JVMA 2A9KA 1SXJE 1W46A 4OK5A 4FW9A 3EPLA 621PA 1CR2A 4MRVA 1FMLA 1M74A 4CF7A 5EP4A 4XSHA 2QM7A 3RHFA 4BASA 1U0LA 1BIFA 1G7TA 2O8BA 1N6RA 5J5CA 4Q7LA 1S96A 1Q22A 3ASZA 4MYCA 4LHZA 1YQTA 4PPQA 2KBFA 2WOJA 3RAPR 5JWRA 3RABA 3CRQA 3Q5EA 4DKXA 1A82A 3EIQA 3CO5A 4DDTA 5HKKD 4I1OA 2Q0HA 1GRRA 4TMVA 4AG6A 1G18A 4X8MA 1Q0UA 3MJHA 3CKLA 1OXUA 2OILA 5JHGB 3FKQA 4KHZA 3CX7A 4C0KA 4PHHA 4O3MA 4GMXA 4EJSA 5E7MA 4JVLA 1A2KC 3U7HB 4QFMA 4CEJA 5SZHB 5JRZA 3K9HA 4U7DA 1SKQA 3FMIA 3W90A 1XCGB 2O5VA 2YYZA 4FMDF 4Q4JA 4TMTA 4XJXA 1EFRD 3QPVA 4M1TA 4Q9KA 2PBRA 3K0CC 2CBZA 4LHYA 4QHTA 1ZNYA 3EX7C 4CRWB 1N5IA 1DOAA 1U81A 1U90A 1MT0A 3GD7A 3WY9A 2FG5A 1CULC 2PEYA 3LQRA 3MLEA 1CRQA 5KPJA 1GL9B 1XRJA 4DUGA 2C98A 5GJBA 1E1QA 1B23P 3MJRA 2WPDA 2R9VA 2L0XA 2W6IA 3IILA 1NVWQ 1I2DA 1XX6A 1VPLA 3ZVLA 4EIWA 1Q44A 4PR0A 1E2EA 1Z8FA 2VYFA 2ZUBA 4AG5A 4DCTA 1RYFA 1OKKD 2CLCX 1F2TA 3BFXA 2IX3A 4GDFA 3K0AB 1E2HA 4Q48A 5DYIA 2QP4A 5TVKA 2RKOA 3QEJA 4EPVA 1YZLA 2R8RA 3ETLA 4QGGA 2B21A 3U3MA 2C78A 3AKCA 1L7VC 3FFAA 3SZRA 4DEYA 1G8YA 4GOXA 5FOUA 1WMSA 3IIKA 2WSMA 2PJZA 1YRAA 2JLUA 1SXJC 3EZ2A 5JMTA 1OIVA 3DZ8A 3VHXA 2PLRA 4HLUC 2GVZC 4XOIA 3KKNA 2ZRBA 1TX4B 3CZQA 3E5HA 3EPJA 1E9RA 1DAFA 2ZM5A 2IL1A 4QRHA 4TLAA 2ZJBA 4DWJA 4XVRA 2ZSDA 2X77A 2P5TB 3GEIA 4A0GA 4GP7A 3WP0A 2F7SA 1ZNZA 2QQEA 1KTVA 5DN6D 4N3NA 3H86A 5B2ZA 3C5CA 1R4AA 5EUQB 1CR1A 5HTKA 1E2DA 2RGXA 4K81B 5K8IA 2HJVA 2RHMA 2CVHA 1II8A 4TQUS 4DSUA 5KDOA 1TPZA 3NBZC 5JCZA 3T35A 1QVAA 1EG7A 2OUKA 2ZRKA 1OXVA 3DKPA 3OEEA 2AN9A 1E2NA 4O0MA 2GVDC 1XMVA 3UMFA 4B73A 4JMPA 3BJIC 4LJ7A 3I4LA 2HJGA 2WV9A 5CYPA 2WKPA 4DHEA 1ZMXA 2IHYA 1IY2A 3KQLA 4MQBA 2ORIA 1ZNWA 3AKDA 4IXNA 3QJYA 4C0SA 3FB4A 3PUZA 4OQNA 1IXSB 3ND9A 2RCNA 5FR2A 1A1VA 2J0VA 3QXSA 4URWR 5IDVA 2ZROA 2CHGA 5LB2A 2C9CA 1E0JA 5BYJA 2ANBA 5E4FA 4B44A 4OQFA 2GAOA 2GF0A 3IIJA 3Q8XB 2ZVPX 3LNCA 1OLOA 4KCGA 3VNUA 2V7QA 2CK3D 5HR5A 3R9WA 2XB4A 3K8YA 5CDFE 2ZJOA 3SJZA 1T0HB 4B75A 3ADKA 2FPKA 2J41A 2Q6TA 2CHVA 2Z6VA 3BH6A 3BORA 2GZAA 3BE4A 4PPNA 4PHFA 2F43B 3R8CA 3N70A 2UKDA 3C8UA 1E69A 2OO7A 2IS4A 2O8CA 4L4UA 2IYWA 4QBGB 3ZQJA 3AVPA 5HCNA 1G3QA 2P6NA 1HEIA 5FR1A 2R6AA 4OHYA 2KJQA 2ODBA 1XMJA 3JVVA 3RNLA 4CEHB 3MWKA 3PUXA 4TL8A 1AA9A 1KI4A 1LY1A 2X1VA 4Q19A 1W0KA 4JVSB 4PSVA 1MO4A 2ZE7A 1Z29A 2BIFA 1KY3A 3WNCA 1NY5A 2W0MA 3GLHB 2ZAMA 3I32A 4Z1MA 2A5YB 3H84A 2YVUA 2ZI6A 4IVQA 2FFHA 3BH0A 1E2GA 1OHHA 2WMOB 4YC7A 1T4GA 5EP2A 1R7RA 2YOGA 5FTJA 5BQ5A 3UATA 4HZUB 5IF9A 3BH7A 1Z0IA 3RWOA 1T3HA 4TL9A 1SZPA 2Z83A 2ZE6A 1G6HA 5DI9A 4PC2A 4YLGA 2QBYA 1CIPA 421PA 1P9NA 3CH4B 4LHXA 2VP2A 2FF7A 4RFSB 1UFQA 3ZVRA 3QNUA 3LD9A 5DSZA 1KK3A 4BZXA 4M22A 2OFXA 3RRZA 4NP6A 3N5CA 1AS3A 2OG2A 2H18A 2F9LA 4FXPA 4P4SB 4KYIB 2W2XA 2D06A 5D3MA 4ARZA 3RRNA 2JIZA 3GCGA 3IIMA 3FWYA 4HAUA 3SJBA 3FE2A 4XIGS 2XOKD 3T1OA 5IHPA 1XB2A 5AUNB 1AS2A 1F2UA 1ZM2A 3SEAA 3MWYW 4EFLA 3R9XA 1UEJA 3WMGA 5B64A 4PC6A 1Z0KA 5CDFA 3J81k 2QEQA 2YHSA 2DWQA 1HH4A 1RRFA 2PZGA 1Z83A 2HCJB 1X1RA 4HUQB 1ODFA 5LB4A 2F1JA 4IOMA 4LJAA 1YZUA 1PUJA 2V3CC 1KNXA 2NO6A 3A1UA 2J9RA 4Z54A 5KHOC 1FTNA 3TLXA 1Z0JA 4UQOA 1P62B 2IYUA 4NYIQ 3WHKA 1SVOA 4B47A 1JPJA 3NXSA 3LW7A 4KFUA 4HSEA 1R10A 1TMKA 2JDIA 1SXJA 2OCAA 1GSIA 1I4DD 3BWDD 3QXXA 1GAJA 1SVLA 3EXAA 1NVXQ 1NMYA 1WBDA 1OXTA 1D9XA 5AJYA 4PFSA 2JCSA 1FOEB 3MAAC 3ZH9B 5F98A 4FI3C 3K0AA 4JLDA 3BB3A 4Q1CA 1W4BA 2JJ1A 1XTQA 3QBTA 3EARA 1N0UA 1J90A 2GILA 2BKUA 4HLCA 2OZEA 1SHKA 4BLOA 4DSTA 2QROA 1D5CA 2JIZD 1K5DA 4D6PA 4B3FX 5CJPA 4A4DA 2OHFA 3VX4A 2V6IA 4ZDWA 4LC0A 4H9GA 3BB4A 2YWHA 3D31A 5KSOA 4B2PA 3WXMA 2G1JA 4FWTA 3FMFA 2RAPA 3P20A 2GJ9A 1YKSA 2HEIA 2CCJA 4ITRC 4CYMA 1DO0A 2DFLA 1UBEA 5G3ZA 3OIWA 4W5JA 1E9FA 4C7OB 4HB3A 3IQXA 2OFWA 1GL7A 2FNAA 3I72A 4IDOA 2YJTD 4DDUA 1W7AA 1OXXK 4AYTA 4Q7KA 3I62A 4YQFA 3ICQB 3HU2A 3CWZA 5JWHA 4EPRA 4V0ME 1VYTA 5CIWA 2ZRFA 4D2IA 4MGIR 4PO1A 5J4VA 4PO9A 2P2LA 3HR7A 3T15A 1UKZA 4NYMR 2K5UA 3CNNA 3OHMA 2ZJ2A 3ZIAD 2QT0A 4Q21A 2TMKA 1KO4A 2F3RA 2MSCB 4QC2A 4RKEA 2C9YA 4WXRA 4KVAA 2NO1A 4IOLA 4RZ3A 5AJZA 1P2TA 1W5SA 2ZR7A 4AKIA 2LKDA 4LBZA 1QBKC 1FMJA 4D0NA 3IDQA 5K8TA 4RD4A 3KJGA 2OAP1 5L3RA 4WZAE 4WW0A 3NHAA 4YMVA 3PVSA 2VIIA 2QBYB 1LF5A 1NN5A 1NN3A 3GLIE 4WVFA 3ZYCA 3LA6A 5L3QA 1P2VA 4N0DA 3RC8A 5IK2A 3AVWA 1D6JA 4D25A 3HPQA 1Z07A 2DYKA 2QZ4A 2ZUCA 2YWEA 1G6OA 2YNMA 4DLUA 4WBSA 3TVTA 3OEHA 1QVRA 3GEHA 1M1YE 4LCBA 2RGCA 2CK3A 2X2EA 5JLJA 3PFIA 1NVUQ 4B3DA 4IKEA 2JASA 3DOEA 4QBFA 2XNDA 3EW9A 2ZSFA 1CLUA 4BLTA 3CF0A 1EK0A 1G7CA 3B1XA 4R7ZA 4OI0A 1U8ZA 1E1RA 1E0SA 4RZ2A 4G0NA 5DISB 1TUIA 1ZD1A 3SOPA 3EZFA 2WWYA 3KQUA 3QKUA 3LXRA 4XTRA 2BKEA 1GFIA 1JR6A 5CB6A 1JAHA 1Q1QA 2JATA 1N6KA 4TTQA 5FL7A 2D7CA 1WP9A 2VEDA 1GRNA 3IBGA 2GAAA 2AD1A 4OI1A 1A7JA 121PA 4LBYA 2DB3A 2VHQA 2OT3B 4P4SA 5LDDC 1GILA 3ZQ6A 1W0JD 5FUVA 3A1VA 2ZAOA 2YWGA 3CNLA 1IXZA 2R6GA 4Q4LA 3LDAA 2CCGA 2V54A 4LBWA 3VU9A 2CL6X 1NNEA 1EFTA 1Q1EA 2Q3HA 1E2PA 3L0IB 1E2IA 1TADA 3CF6R 3KJEA 3EPHA 1NMZA 3FKSD 3EA0A 1S8FA 1KJZA 4NCHA 3R7WA 1UAAA 3WBKA 1NN1A 2NO9A 3FDIA 1XFAA 2W2VA 1E9AA 1BMFD 1GKYA 1RJ9A 3P27A 4M1MA 1G4UR 1UJ2A 3ZVMA 2R2AA 3SNHA 1II8B 1NMXA 4PC3A 3X2SA 4DVGA 4ZCMA 2BEJA 5GADl 2GJKA 5F2EA 3AF1A 3MCAA 4M1OA 5H8WA 3B1YA 1N3BA 3CIOA 4TYWA 4URUR 2VSFA 2ZE5A 5KDDA 2PX3A 3DO6A 3C4JA 3QXHA 5C46F 2C03A 3QG5A 4QL3A 3WRYC 4A0RA 1T5LA 4I81A 4B32A 3HPRA 2HYDA 2VQSA 4BFSA 1NN0A 1YRBA 4Q18A 3VTKA 4AYXA 3V00A 3A1TA 4HLDA 4DJTA 3T12A 3U6KA 1A4RA 4DCNA 2GBLC 4JLPA 1W2GA 5AJVB 1EFUA 1F60A 3NDBB 4YMWA 4IEEA 4PQFA 2ZEJA 3WRXC 1FUKA 2FEMA 3EASA 2Z4RA 3K9NA 1S4QA 2F1HA 2ODEA 1OYYA 2H7VA 3THWA 3PQCA 5CYOA 5FUYA 4BFUA 4TT3D 4W5WA 3JVUA 1JJ7A 4B43A 1F2UB 1J99A 2C2HA 1E9BA 5FOSA 5CK5A 1FX0B 3VR5A 3SBEA 1XNJA 1ZIOA 3AVOA 1BYUA 2P3SA 3IHWA 3A37A 1AZSC 2ONJA 4HAVA 2JLQA 2FFAA 1ONBA 4HAWA 3BBPA 1N6PA 3SR0A 1HY3A 2ZRIA 2NO0A 3ZD6A 5DNYB 3R9IA 2QENA 4CT5A 1H8ED 3ZDQA 5EXTA 4MDFA 2YWFA 3NC0C 4PZLA 5FL7D 1II9A 1US8A 2GZDA 3QVVA 2VP4A 2ZR9A 1MV5A 4KLZA 3SYKA 3TUJC 2OE2A 4QM7A 4C30A 2RGDA 2JLVA 2J7PD 2J0UA 4Q1BA 3DL0A 4A2QA 2KB0A 3AF2A 4LX0A 5EXPA 4V0MA 2J7KA 2QGNA 2ZYTX 1GL6A 3A58B 4AKEA 1E0KA 1R2QA 2PT7A 4LV5B 4NU0A 5DLQC 5TDHA 1Q1BA 3DMNA 4A92A 4XTCS 8OHMA 1XEWY 3B1ZA 3CONA 2NTYC 2QMUA 4D81A 4JYCA 3BC1A 4OK6A 5EXSA 4RKFA 4UXIA 2J46A 3G5UA 4R2HA 2ZQ5A 2GA8A 1EGAA 2PMKA 3GJ3A 3LXXA 3D7MA 4CEHA 5CM9C 2O0JA 5FPKA 4B3GA 1SHZA 2HT6A 5HKKA 1DG1G 4JLBA 2FV8A 2IYLD 4PX9A 3ZIAA 3K9GA 4EJSB 4TL7A 3PUYA 1Z47A 3QF4B 2GXAA 3AVUA 1XTKA 2SHKA 2GJSA 4S35A 2X2FA 3CX6A 4Q7MB 5K8UA 4RCYA 3PIRA 2F6RA 1N6NA 4UNPA 2REBA 1U9IC 1NIPA 2I3BA 4P4UA 3ADCA 1JQJC 2FFBA 4IXMA 2ZRPA 1S2MA 1Z63A 2BV3A 2IF2A 1IN4A 4Z1MD 4I1SA 2H57A 3GLFA 5AUOB 1KI3A 4BFYA 4AKHA 1LW7A 3BRWD 5AUPB 1RPZA 2WMNB 2F1IA 1IM2A 4CW7A 1L4UA 1Z22A 4DLTA 5JS8A 2IS1A 4JL8A 4QOSA 3LV8A 4RD0A 4LJYA 3FVQA 2R6DA 4ZDJA 1D2EA 3U3OA 2C8VA 1H8EA 2IC5A 3DM5A 1A5TA 3NEYA 3SE0A 1GNQA 4LOAA 2ODWA 3L8YA 3W34A 4NTZA 4E09A 1COWA 4R71A 4TMKA 5F3WB 3OFND 3I8SA 4MRSA 5GJVC 3TH5A 1MRSA 1CXZA 1AM4D 1E4YA 1NBMD 3LBNA 4MRPA 4OJQA 2FPLA 5DIFA 4YDSA 4LJ9A 2C9OA 3D3QA 2D7DA 1AIPA 1P5ZB 4JYBA 1TF7A 2VTKA 1QHYA 2R62A 4MYHA 3AQ4A 4EQ6A 1E79A 1Z06A 3FGNA 3KB1A 4JS0A 3RS5A 4NYJQ 1Z0FA 4BUJA 4C0LA 1KAOA 4D80A 1KDOA 1R6BX 2ZI9A 4A8JC 4KJZA 3THXA 4POAA 1XEFA 2EYQA 5E7IA 2ZETA 2DFNA 4G1UC 3AB3A 3B6EA 4TLBA 5DN6A 1ZC4A 4DDWA 1KDPA 2IYTA 1QHHA 3TMKA 1H8HD 5KNDA 1UM8A 2PCJA 3MWLA 4FMCB 1OFTA 4JKIA 3TK1A 3K09A 3QE0A 3BXZA 1X1SA 1YHNA 1Z6XA 4LPKA 4FIDA 3OEED 3KTAA 4C0JA 4A6PA 1C4OA 4NH0A 2CL0X 4MDEA 3UG6A 2GXQA 1VMAA 2ZRGA 3GMTA 3QEOA 1GTVA 4US0R 3T1TA 2ERYA 4HDOB 4Q9LA 4OQMA 1J7KA 5JWOA 3U6BA 2OLKA 2EFHB 4A2WA 1Q1ZA 3HP1A 1G3IA 5A5GA 4V0LA 3IKJA 3GJ6A 1S9DA 1SVKA 3CRMA 3UANA 1WB9A 1CF4A 4B33A 2AFHE 4LDJA 3AVQA 1IN7A 1Q12A 4P3YA 3X1WA 3U61B 2O52A 1CS4C 2XITA 2B8TA 2YKGA 1FTSA 1SQ5A 2N1BA 2WICA 5BN3A 1KKMA 3K1JA 4CGZA 2FH5B 2WAXA 3OIUA 4A15A 2RMKA 1U94A 1KI2A 2GJ8A 2OEPA 2GDJA 1QHSA 4F4CA 2ODNA 2WBLC 4HEJA 1VHTA 2YV5A 3VR6A 2WHXA 1P9WA 3PUWA 4YMUA 3LW8A 5A0FA 2G0NA 2A5FA 3VNVA 1AA3A 2F3TA 5EQTA 2R44A 1XCMA 2H5EA 1G3MA 4QJ3A 2VBCA 2VO1A 4DIDA 2IT1A 1QHIA 4XWKA 1NRJB 4M21A 5LPNA 4JVNA 1RFLA 2B8WA 1KDTA 2WWIA 2V1XA 1P6XA 3RS4A 1VCNA 5DYGA 4F93B 3DMDA 3O8CA 1SVIA 2WZQA 2O8EA 2IWHA 1TQ4A 2FGJA 4II7A 3N2IA 1OFUX 1OKKA 1FZQA 1Z0AA 2OXCA 4JLAA 2IXGA 1RIFA 4L8GA 2G88A 4B74A 3IEVA 2G77B 3K0SA 3Q7QA 1ZM4A 2Q3FA 1OIXA 3MGCA 4MYUA 5KOYA 3AF4A 1CBUA 4BFVA 3NBXX 3T61A 3FYHA 1NKTA 1PUIA 1ESNA 1Z3IX 3A1WA 1D2NA 1G3UA 2ZVQX 2VP5A 1FNNA 4QGAA 2EVWX 4GOJA 4P31A 4QBIA 4LBVA 4MKGA 3AP2A 1W36C 3WYGA 3UWKA 1HYQA 1AGRA 1KO7A 4URZR 4CVNA 1JPNA 3GLGA 4D4JA 4PO8A 4IOJA 1NF3A 4V02A 1J8MF 4DB4A 2YOFA 2IEZA 3T5DA 1G8HA 5BW8A 721PA 3THYA 2KSQA 4P4TA 4GT1A 2DBYA 2ZI4A 3B5JA 1S1CA 2HCBA 2JLZA 2CMKA 4GL2A 4C0AC 4KVGA 3Q3JB 1TQDA 3LBHA 4F91B 2PMDA 3H0KA 1GNRA 2J0QA 1OFHA 3R20A 3W3ZB 4FMDB 4LV6A 3PUVA 1KNQA 2HLDA 2XSZD 5CK4A 4AIIA 4AYWA 1RC8A 1KSFX 3QF7A 3ZVNA 2QPOA 4QBHA 4Q9JA 5EE5B 3GLFE 1TTTA 5JJIA 4IHQA 4AURA 4MH0R 2ZRNA 3U5ZB 4V0OA 4RSGA 4DLYA 1GUAA 1SULA 4Q01A 1ZU4A 1NLYA 5FPSA 1NG1A 1XEWX 5LD2C 2AXPA 3GLIB 2V6JA 1R5BA 2ONKA 3RSOA 4AK9A 1E2JA 2VL7A 3TIFA 3SJCA 4IDNA 2XEXA 3VHLB 4ZIRA 3FOZA 3LVRE 4AY2A 1T0JB 5SZIA 5D3MB 3UMRA 1MABB 4MYTA 1Z6AA 2H92A 1E6CA 1XJCA 3Q72A 2IYZA 5GJWC 4ASUD 3BAFA 1U9IA 1ZC3A 1FFHA 2FSHA 1BS1A 1KI6A 4LRWA 5JEEA 1HE1C 4M0LA 5C1BA 4EPXA 2F1RA 4MITA 5TXGA 3GP8A 3MSXA 1RYHA 4M1KA 5JJKA 1YZTA 1G64A 3K0CA 2PX0A 3D6TB 1EESA 1IN8A 5KSZA 3RS0A 2VHUA 4W5HA 1N0WA 1DAGA 3CUEF 4UJ5A 3FMPB 4N1AA 3VR4A 2D2FA 3TSOA 3L2OB 3W8NA 2QORA 4LZZA 2BWJA 4KU4A 1G21E 1JI0A 1P60A 3K53A 1VYUA 4JT2A 2AR7A 5BWMA 4ZV4A 1T9HA 2CE7A 1NSTA 3RWMB 5JFGA 3N2EA 3QPWA 4UNNA 1P3JA 3ZZUA 4DLSA 3U3JA 2WWFA 1DELA 2DWOA 2CNWD 1JJVA 1W47A 1J8YF 2W00A 2E1RA 1X6VA 4D82A 2O8CB 3FHOA 5C18A 1F48A 1ZM3A 2QAGB 3QVUA 4Q1DA 5TB5A 3AH8A 3W6OA 2JJ8A 3B78A 2P65A 1U98A 1ZCBA 4M9ZA 4ARZB 3WBJA 1WRBA 2IUTA 1DS6A 4S2EA 2UVQA 5JS7A 3NBFA 1Y63A 4B71A 2N46A 2ORWA 2B92A 4LSGA 1EFCA 3S1AA 2J0UB 3KXLA 1Q57A 2HLDD 4DXAA 3O8BA 1P75A 1ZINA 1NIJA 3BB1A 4GZLA 1Z2CA 4HLQB 3I8XA 5H1YA 5HE8A 3SFVA 4PC7A 1VYVA 4FCTA 1VG1A 3C14C 5EE1A 3NEJA 1XDBA 4LWZA 3GLFB 1B0UA 2OFOA 2FN4A 1F6BA 1QRAA 1G16A 2XXAB 3IUYA 3EIHA 4ON9A 2GCOA 4HB0A 3TAUA 4DUGD 2WWWA 4M1YA 1RRGA 1CKEA 1KZ7B 4FCWA 4PAQA 5KPDA 4B3XA 1NL3A 3U4QB 1AS0A 3HYTA 4F4IA 4Q5IA 3GLHA 4DCSA 2IXFA 4D4MA 2O0KA 4XWAA 1M7HA 3SDZA 3AVXA 4OYHA 2JAQA 2AKAB 4O2RA 4BE7B 1Y3AA 4HB2A 2VH5R 4DIEA 4GZMA 2JJ2A 2MMCA 3BIFA 1MO5A 2WOOA 2F43A 5CITA 1V5WA 3VFDA 2WJIA 4WZBE 1S1MA 1YR8A 2WKRA 3QKRB 1KKLA 2GCNA 1OV4A 1W49A 3RC3A 4M1SA 3TAHA 5TMPA 1MOZA 3VX3A 3OAAA 4FMBB 1W0JA 2JLYA 5E95A 1LNZA 2G9NA 2WTUA 1G20E 1W1WA 2EFEB 1WBBA 5JEDA 1HQCA 4KFTA 4Q47A 1KSGA 3RS2A 4IEIA 3NBYC 2FPMA 3ASYA 2XOKA 1ZYUA 3LWNA 3G0HA 3ZS9A 4R2IA 5AK0A 5AWFC 1KZGB 4HUTA 4UJ3A 4WOPA
chains in the Genus database with same CATH superfamily
3C4VA 3JU3A 3DZFA 1GA4A 3AHDA 3WWPA 3SSAA 4BNZA 4G5RA 2J87A 3U4QA 2ZB2A 2VNKA 4ZVTA 1KVQA 3PQ6A 1IJFA 2IKSA 3WRYA 1MAWA 1M0TA 3E7XA 4OD0A 4EI8A 2F67A 3T7RA 1DOZA 1W59A 1ABFA 2QL7A 4OL9A 4UUBA 4H7PA 3FTPA 4HLUA 4EYSA 1MPTA 2FE4A 2BSQA 2B5WA 4N41A 1OIWA 3OOSA 4K9KA 3OLWA 1ZITA 5FLEX 2PH7A 3WMWA 2IYSA 3FIUA 3HVIA 1E0DA 1DTWB 1HNNA 1QZXA 2OL4A 4G3XA 3B1VA 2Y93A 3IP3A 3HP7A 5LA6F 3KLPX 1KRHA 2W90A 3MWJA 5IMBA 3R3YA 4JSTA 2IWRA 3SSNA 1EWYA 3VISA 3UK6A 4FWIB 4PGMA 4D0RA 4OLFA 2YRXA 1HPLA 1VPVA 2DQZA 3D8TA 4MAFA 1XJWA 2DP4E 3U7EB 2AXEA 3II6X 5EWJA 4RO0A 5DBGA 1PW7A 2JCYA 3IERA 4ZDIA 5JDCA 4NZYA 2JGAA 1XP8A 1WXWA 1HX7A 1XLWA 2DUWA 2FETA 5DV9A 2JRCA 5AW0A 1DAEA 3FUCA 4ZP1A 3I9JA 2NXEA 2C2WA 5AQEA 1TUGA 5DASA 1VB3A 4ZVKA 3VXKA 1UOOA 2J30A 5JR3A 1NR5A 1SRRA 3BPSA 1WU7A 4NDZA 2WYUA 3LT5A 4RSRA 4X65B 2HREA 5F78A 1N1MA 2MMGA 1ISGA 1GDDA 3NAZA 4JXKA 5BWBA 1UPTA 3HLTA 4YN3A 3VO9A 2CVPA 1ZK3A 2Z57A 5K0LA 3KQOA 2C59A 4ZV7A 2O54A 1T0IA 1KMNA 1QZUA 4U5XA 2GGSA 2EG5A 2YBDA 4LOJA 3T3MB 3HBMA 1TKCA 4IDPA 4TXNA 5JDCC 1NVAA 2ZUEA 1A8SA 3OZWA 3AW8A 5A3QA 1Q3TA 2CZQA 1P7VA 3C3BA 4R9VA 2ZZMA 2I7VA 3OCCA 4OBBA 3GOQA 3WK8A 4IIJF 1PN3A 2C4MA 3SS8A 1ILEA 4BXOB 3PB3A 1DL5A 4WBXC 4Z9BA 1E7RA 3QRWA 5CXUA 2Q49A 2WF9A 3ACBA 3RSQA 2ARKA 5FBVB 1ULSA 2QR3A 1XJ5A 1IPHA 2ZTVA 4WASA 5AI8A 5L3QB 1ABEA 4OH7A 4PZDA 3U44B 4U00A 3MCVA 2ATXA 2Z8XA 1SIOA 2COUA 4LNUA 2UZAA 3N28A 4HH4A 1R8XA 3VYTB 3VR4D 4FHGA 5FKJA 1LVGA 2YBEA 1JFLA 2B94A 4LE0A 4EMSA 4AO7A 4YACA 3GJZA 1RXSA 3Q0IA 2CFOA 1NVDA 1ZW6A 5CB4B 2XECA 1JQEA 3GJ7A 2OBLA 2XA9A 1TM2A 2GN9A 1WQ4A 4JEHA 5KTMA 2WW8A 3WQRA 5H59A 2IHBA 4HQ0A 1CZHA 4N5MA 3T9EA 1W36D 1DQZA 3ROQA 4CF4A 3SP1A 3CNQS 3LWZA 4IDFA 2Z95A 2IOFA 3VNRA 2EFGA 4HNQA 3PGLA 4S3MA 4OYLA 1N0VC 3V4OA 1STOA 4URFA 1XEXB 1XYGA 5AW9A 4UDYX 3BK7A 4J9UE 3AEKA 2CE2X 3QE4A 1O95A 1WDWB 2I3AA 3L41A 2RFLA 4FDMA 4TV9F 4I36A 3THOA 4U2BA 2PKEA 5EZQA 3SXPA 3DGEC 1D07A 5EE0A 1NRXA 1X74A 2PWAA 3UWOA 1FDSA 4NONA 4K28A 1KIMA 3OHPA 5HIJA 1GR0A 3RM3A 3NO4A 4FB5A 3ODPA 3CTMA 1VBKA 2D2XA 1X19A 3ER8A 3AF0A 1VSQA 3I45A 3VR5H 2VEOA 4QODA 3D2CA 4KFRA 4PAOA 5JECA 5GWXA 2QTTA 3AU9A 3CXRA 1G8FA 3KK0A 1KI1A 1RXYA 5CA1F 4FD3A 2J1LA 3A31A 2HXGA 2C7RA 5EWMB 3MFYA 3OCYA 3E5NA 2JC3A 4WK0B 1ZGAA 3CW8X 2GTPA 3E4CA 3ELDA 3L0SA 1E9CA 3QUCA 3HS3A 3HY3A 4PHTA 1SZDA 2PZJA 1DBRA 3C7KA 4KAJA 2AX4A 1LQ2A 1OAOA 3NNNA 3UHOA 4CEIB 2EYUA 2YOHA 3ABIA 5J63A 3NYIA 3KPJA 4PFQA 1OYOA 5BN5B 3RAJA 1KEZA 2GN4A 1TQ6A 3MQFA 3NVMB 4OI4A 2GD2A 4V3BA 1R00A 1DKNA 3CPEA 3EJWA 3DEYX 3MMPA 4F7WA 2HMVA 3SN6A 3SVTA 2W8ZA 1GU1A 4HI0E 1IOZA 1Q7RA 2DZDA 3QTBA 1FP4A 2G1KA 4Q39A 4DTIA 4DDVA 2N75A 2OC9A 4FE3A 3AIOA 1OPXA 1EWQA 4NI5A 1UMDB 5TMDA 3PQEA 4EHNA 3NC4A 3VI3B 1F14A 5I4IA 3PNBA 2EL9A 1CT9A 2ZREA 1P1KA 2NVUA 3OZXA 3BXXA 3DAGA 4QELA 1V71A 2BGLA 3MHPA 3D81A 4IQ4A 4V3CA 2AN1A 3EHDA 4G81A 1Y48E 3OZCA 4AJPA 4P2GA 1IDOA 3B9BA 4JA0A 1ZSNA 1JLRA 2QRJA 1SA0B 2GXSA 3R0ZA 4QGBA 4V2IA 5FWDA 2Q99A 3RSZA 2O8DB 3MJVA 3BULA 3AM1A 3VSCA 2F3SA 3BKXA 1MGPA 2QW1A 3HDTA 3IQWA 4C4AA 1HQYE 4PIMA 3Q0TA 3SFZA 3UMSA 5IABA 4IDHA 4BATA 1IVYA 1RZ3A 4PTZA 1JG3A 5DHAA 1WDKA 3WHLA 2QNRA 3E8SA 4H08A 4BQNA 4D26A 2X0JA 4BNVA 2XKBA 4WLVA 3UW3A 1E2BA 1VE5A 3WB9A 1OVGA 2O8FB 1JDUA 4D9CA 4I6JA 2QQ0A 3HGTA 2P1DA 4YRKA 5IAOA 3HRIA 2D0DA 3PTLA 3T1YB 3KWFA 5DHTA 3CZPA 2X6RA 1SPXA 4JZKA 1C50A 3KT3A 4NCAA 1MHPA 1OW3B 2P5YA 1VLJA 3AZPA 3LQ1A 3PD0A 4KUGA 4DBZA 3PNVA 2OB1A 3MLBA 2D74A 3Q3CA 5I9BA 2FDCA 2FE1A 5G0UA 1M72A 3KOYA 4UU7A 5ER6A 4DQDA 3E2MA 1T4CB 3CZ5A 3DFZA 4XDGA 1AY0A 1OREA 4YYEA 1B26A 5A1TA 5ADWA 4B48A 1KO1A 2E9SA 2K87A 3OZGA 3SDBA 2BY4A 3EH2A 4XQ0A 1JDPA 1YB2A 4J0CA 4PG6A 3U9TA 4POOA 3ASVA 2NSYA 1DTWA 4FFRA 1YR3A 2BEWA 1XWWA 1D9ZA 2ZTSA 1OZ0A 1L7QA 1Z88A 3IB3A 5JSFA 4UM7A 2CYCA 2WJAA 2QMHA 1FQJA 1XWIA 4EUFA 5BORA 1Z15A 2REXB 4I55A 5A7FA 1J22A 3DPUA 2KHZA 2JVJA 1U0GA 2CXHA 4HX9A 4JBIA 4KXYA 4XX0A 4WUTA 2WKQA 4EENA 4L5BA 4G6ZA 3IO5A 4TWJA 4HOYA 5G4LA 1SUDA 4Q66C 3WMRA 3WGVA 1LH0A 2X7XA 2UXBB 3NDPA 3AF3A 1UJ4A 1MQ8B 5CPBA 2XMPA 1ZL0A 5T5QA 1P3DA 5EKUA 2CY0A 3A8TA 1J0XO 1UDBA 3MUNA 4W8OA 4BLWA 2IIQA 2F59A 1PNVA 4PXYA 3KYDA 3T52A 1SBCA 4Q3DA 3N2LA 3D6UA 1MFZA 4ZAZA 4Q4DA 5TMEA 4E07A 5JAPA 5IKXA 4MW7A 2HCTA 1OAAA 2ZYDA 5FPHA 1N5JA 1IBLB 1IVNA 1ECBA 2F48A 3VRHA 2MYUA 4Q4HB 2RGGA 1N5LA 3K1ZA 2D1RA 5CVDA 2WD8A 4BX8A 2ZIEA 4EI9A 2A9PA 2JAPA 1KYIA 2LCFA 1N2EA 4PSUA 3DOIA 4JMLA 4BQRA 3EPKA 3N86A 2PXCA 4QPNA 4KXFB 4L4SA 2PO5A 4Z4IA 3D3KA 2HO5A 3I73A 3WIUA 5JCXA 5DI3A 2JFWA 3TD6A 1PJSA 3BSFA 4NDAA 4R98A 1Z0UA 4P83A 1JLHA 2Y0BA 3TXAA 3WISA 1U1GA 4OYYA 3PXDA 3IA7A 4X93A 4E12A 3QU4A 1OZFA 3VJLA 4XWOA 3HO8A 3F2IA 4LXYA 1UXJA 4QEDA 5KOHA 2Q5JA 4MZXA 5TQVA 1RC0A 4ZOAA 4BNTA 5C4MA 3CXUA 4M76B 2WYIA 3PEVA 3G2HA 2VYNA 1WZEA 5LLSA 1SM4A 5HNKA 4YCMA 1T8TA 4JJFA 1JAXA 1Y7LA 3O92A 3NX4A 3DAPA 4L72A 2DFTA 1LBSA 1Y98A 2XLCA 3LXMA 2IEYA 3OFKA 4XM0A 4K2HA 4YJGB 5CUQA 5UKDA 4A27A 1PG2A 1CU1A 3RC1A 1I5RA 2QU8A 4HQOA 3L8MA 2YNMC 3RSHA 3KJXA 2OV8A 1SJ9A 4CFZA 3P0FA 1FJXA 3IDFA 3SM3A 1UC8A 3SI7A 1CQXA 5SYAA 4G41A 3Q41A 4I5DA 4WZZA 2MYTA 1YSCA 2DC1A 3LYUA 1OFGA 4RHCA 3F5SA 1G2PA 5EJ7A 2B1JA 3PX3A 4I4TF 1DJNA 4JLMA 7MDHA 1YZNA 3R5TA 1LF0A 1TU3A 4ZQHA 4N47A 5COAA 4O2LA 4A73A 3NM4A 3MJSA 4TS9A 5JNRA 3ZDBA 3BD8A 1MQAA 4XVHA 4B3SB 3E84A 3GDOA 1QQ6A 4EYKA 5ADHA 1I1HA 2AG0A 4EPYA 2EFCB 3F5MA 1AXEA 1OLXA 2PRSA 5I9IA 1JEEA 3DD1A 4DJFC 2YXNA 4CR8A 3GRUA 4CTMA 5F9HA 3DWFA 1J9ZA 4OI2A 1JAZA 2PLAA 2GUGA 4GBMA 1VOTA 1HTWA 4EDFA 5JRDS 4LV8B 5AVYA 2QRZA 2XYPA 1OI7A 2XVXA 1K6JA 2PCLA 3TTTA 1IZ9A 4LJ4A 3QEKA 5CBPA 3RTGA 4DARA 1WQ3A 3QX8A 2K6GA 3KJQA 4BC0A 2HGSA 3ZY6A 3QW4B 5GJCA 2NM0A 5HF6A 2Z8YA 4EHLA 4I4CA 1N25A 2ATVA 4AX8A 1YGYA 2FRDA 1L8OA 5FPYA 2G07A 3BWCA 1E5XA 1ODCA 1EE1A 2ICAA 4MUMA 4OB7A 5AJHA 1AQIA 1P3Y1 4D0LB 4KNWA 3KFXA 3PFWO 2CHUA 3UK2A 3C3EA 3UNXA 2WM9B 2QE7A 3A7DA 3L0BA 3EPHA 5IXSA 1W19A 2I6XA 4YPOA 3M81A 2QN8A 4X44A 3HL4A 1WSAA 1XZBA 1LBHA 2R6FA 4LW8A 5JAHA 2ES4A 3R3XA 2VKQA 1RHRA 2BBWA 3G17A 2QL6A 2PX6A 3QFFA 3V80A 4CKEB 1QQTA 2P62A 3G13A 3L0ZA 4PPGA 3PNOA 4EHHA 3CIFA 1DJPA 1ISFA 1DIGA 4XGKA 5CJJA 1X0VA 1TECE 4L74A 4MLZA 4YDRA 3D8NA 5LOVA 3OQOA 1FS5A 4IIJA 1IUNA 4R7GA 1V5IA 2JK0A 2X9NA 3GAZA 1ZJZA 3LXUX 2PTHA 3A6ZA 3O4JA 4Q9AA 3RUIA 2AHOA 1SCUB 3MWDB 1J09A 5A05A 3S27A 2Q6KA 4LZLA 2WVJA 1T35A 3CNHA 3GFPA 5FI1B 3ZOZA 1PGQA 4HEA6 4RH0A 1U2RA 4YJKA 1TIPA 1SVSA 2NTEA 3F47A 3H8VA 3HBFA 3IFSA 3Q9NA 4R9RA 4BV3A 5BNTA 3F4LA 3F8TA 3EF3A 4IWXA 1JFRA 2XR1A 4KXMA 5FQNA 6NULA 3ENQA 1ISRA 1U8YA 2QOEA 1QV6A 2FPOA 3C6MA 3JVEA 1S7CA 3GFVA 4ZZ3A 9ABPA 3H1GA 2ECFA 3DT8A 1U8CB 2A5GA 4KFSA 1UBOS 3TJRA 1U0FA 4KH1A 3PE6A 4B9EA 4XQEA 1RQGA 2C2ZA 1P8AA 4QRIA 1H0KA 4TROA 1MC4A 3DB1A 2ZJ1A 3PICA 3HXMA 1XZQA 5B3JA 5IH3A 5HMLA 4IGEA 4NCJA 3OU2A 4ZANA 4UUMA 2FPGB 1IM5A 4NS4A 5BNZA 2PPLA 4RKYA 4UXJA 1PJAA 1RSZA 3IQGX 3LPMA 2GZHA 2C77A 2JFVA 2Z2IA 3JWJA 5THKA 3T8YA 1ESMA 1YZKA 2FFJA 3WBFA 1BNCA 4MKXA 1QTIA 4PHCA 3OU6A 3D59A 4JITA 2RGWA 1XZIA 1NQVA 4AB1A 3GMIA 1T3LA 4W5NA 1Q2UA 2PSJA 1HQDA 3G9TA 3JQFA 5EVCA 2WD9A 5KSWB 3LPLA 4TZ0A 4CIXA 4NV0A 1YE8A 3NTRA 3YASA 1DEXA 4TTSA 3S1AB 3PJRA 3SU8A 2YFYA 1FLDA 3KQTA 4Y9RA 4G5GA 1W25A 2WIKA 4JBYA 1GFSA 3AR4A 3DGFC 2XCTB 3SQWA 1DCTA 1EXMA 1VIYA 2Z04A 3T5GA 2W4MA 1Z8DA 4DR4B 2XRFA 4FFSA 3WL4A 1QV7A 2QZPA 4KR0A 2GAIA 4P32A 1UDWA 4O2BB 2XYHA 3A2NA 3N3BC 3F6EX 2B4QA 2C96A 4DRZA 2R96A 1HV8A 1U0HC 4J43A 3ZNOA 4N3GA 1C7FA 1KHTA 1Q84A 2ZYWX 2P35A 3E05A 1CY1A 1I7NA 2FXIA 2OHXA 3W5BA 5JANA 4EARA 4FFBB 2IHVA 2WE7A 5EMLA 5KJCA 4GX2A 4YP1A 1Z9BA 1O4VA 2Z43A 1SA0A 3IJ5A 3KFLA 4NNJA 4RJ2A 4TYQA 5CXSA 5BW5A 5JXGA 1OX4A 2E21A 4O63O 1YZYA 1KO8A 1ZH4A 1JHUA 1CEQA 1EAMA 3LP5A 2JFOA 4MA4A 3LKVA 1HG0A 1NQAO 2VP6A 3ZV6A 2G04A 5EJGA 5K0FA 4CM9A 3OURA 4C08A 1ISSA 4JOQA 3D8RA 2MCFA 3IBYA 5TLSA 2Q7XA 3CVOA 5LDHA 4LSZA 3RANA 1S7GA 2I1QA 2SICE 2VHTA 1ZM9A 1L7BA 1Y8AA 2IY7A 3GLGB 3S2FA 2NZJA 2YH2A 2I2FA 4BLVA 4FUTA 1RRPA 1V11A 3FBTA 2B2NA 4GMFA 4EMBA 1YNOA 3EXIA 5AR1A 4EFMA 4WT7A 1WD7A 4BTVA 5EPEA 4INZA 4LXUA 3DS8A 3CWQA 4LTDA 3ZGZA 3A7EA 1EWRA 1DE0A 2XNDD 3FN4A 1TGVA 7REQA 3CJQA 1O96A 5EJEA 1DC6A 2ISQA 2Y6VA 1ANKA 3FHCB 4FHDA 1TEZA 2EQBA 3ESXA 4BCBA 3WICA 4EI2A 4XX0B 1W0CA 1LX6A 3E5RA 2A3RA 4RMHA 3T5BA 5BSGA 3T06B 4NCNA 1U5BB 4X90A 1PV4A 3EFHA 2EZ8A 1OC2A 3AG5A 4FYPA 2RE8A 4DIOA 2ZRAA 3AEYA 4CL2A 1ZONA 1VKOA 3UA4A 5FCDA 4BLSA 2CV0A 3PSAA 3FRIA 1XAGA 4P7JA 2GAJA 1UKYA 2GT1A 2WM2A 3L7YA 3L06A 1EM8A 2LKCA 2XUOA 1D2HA 1LXCA 2XMGA 4WX2B 4UHKA 3JD0A 5B3LA 4TS3A 1F7UA 1Z3CA 5IK2D 1X86B 4UTZA 4FIZA 3DUWA 2Q1UA 4JA2A 1YIAA 4Y9UA 1V6AA 1Y8RA 2DUNA 4IJUA 3FJ1A 5KSPA 3WJAA 2WJPA 3OICA 2HTEA 2Q21A 5JRJA 2XJ4A 1HSZA 4GP9A 1L8QA 1TXGA 5H3CA 2P90A 4FFVA 1WDTA 1E3EA 1QF9A 2YWBA 3ICEA 1XJ0A 4L73A 5K7SA 2AWNA 1KK2A 1KH1A 3D3NA 4HLNA 3SYLA 1V43A 2GX6A 3DEFA 3T5AA 1NF9A 3UBTA 3OJOA 2NV6A 1JQLB 3B2EA 3MXOA 3KQKA 4D4KA 2JAOA 3A9RA 1R18A 5G40A 5L51A 4KBFA 4UBMA 1GZVA 4MDHA 4LRYA 2Z1DA 2BUCA 2BMVA 3NJRA 1OU0A 1SKYE 4C7OA 2VHZA 3LUJA 4YRJA 4EL5A 1CEEA 3FOEC 1YAJA 4DZZA 3P0IA 4EW6A 5JQGA 1YR7A 4LKRA 4R2JA 2A1TR 1GFZA 2LWIA 2RKWA 1L1FA 1M2NA 5AMXA 2C4HA 1GNPA 4RIHA 5JHHB 1FUUA 1R4NA 4JOSA 5HSGA 1OE0A 4LYAA 4YFVA 3AB7A 3BIWA 4U7WA 3ID6C 4F9EA 3EOAI 1FP6A 3JQAA 3W5UA 1Z28A 1JDBC 2ODAA 2V7QD 3HDQA 3O3OB 3D5TA 3OH8A 5KQRA 4KACA 4L76A 3O1IC 4QOEA 3VR3A 2W2LD 5C8YB 2PU7A 3NCTA 1H2BA 4IEFB 1ZL2A 4GWLA 3VH3A 1CDEA 1P2FA 4BVEA 4NQRA 3N0RA 1UODA 3FTCA 1C3OA 1TTQB 4HNVA 4IS2A 1T2CA 2A94A 5EJ9A 1C7RA 3ORYA 5JQGF 4EKIA 4ZKEA 4RV4A 1EFHA 1TT5A 2ZRJA 1I4OA 2ZJ8A 4M7RA 4X61A 1QOZA 4YJ3F 5F2KA 3UIEA 3UMJA 3WDMA 2JGRA 5LKAA 1CRWG 5EQFA 1K3UB 2Q4TA 5AKHA 3WLMA 1EBFA 3JQBC 3OTGA 4CR7A 4ALIA 1XXHB 3KTOA 4I4TB 4RVCA 3Q8WA 4IR7A 4BKMA 2I7DA 4AUNA 1CUAA 3PCXA 1ADBA 3I5AA 3HFSA 4H17A 2VF4X 3CBQA 4OA8A 4PQEA 1H22A 5LMNB 2QZJA 2XXJA 4EVSA 4HDSB 1XG5A 1PT7A 4LF6B 3PUIA 2Y27A 3AJAA 1H1TA 4ND3A 4LMRA 1ZEMA 1NBME 2YHBA 1CCWA 4LC9A 5JSUA 4O2AF 3D1VA 3QWAA 4RHXA 1N77A 2IQ5A 2WMYA 1Q16A 3CUKA 1ID1A 3KFVA 4LJLA 3BA1A 4NATA 4BVAA 1XRSB 1LS1A 3KQHA 1ESZA 2QLFA 3LF1A 1Z74A 2X7HA 2YVAA 3FFXA 3RYIB 1JEDA 1LRLA 2JBAA 3AHHA 5AVVA 4Z1OA 1KIFA 2VATA 3C7AA 3OX1A 1T34A 4S1TA 2YHIA 5JATA 4X62B 2R47A 4RLSA 3NIWA 3DA8A 3T7EA 1AK2A 1OMOA 1VL1A 3JZDA 1OH6A 2CB9A 2QG6A 1GP2A 2XSZA 3OPVA 2D8MA 2EARA 2G63A 2RJOA 2J9ZB 4L4RA 3DHWC 4H3KB 1QG2A 5JNTA 1CUSA 1RYZA 1C1DB 1MEEA 2W37A 2ZANA 5HQJA 4PYKA 4AF8A 2CCKA 2JGJA 1PD0A 2VUSA 4O25A 1JYEA 5JDIA 4PG5A 2NSDA 1RYYA 4MYRA 3P2MA 4DR1B 1JX6A 2FSIA 1FRZA 1VXRA 1ULHA 4JJ6A 2YQ4A 4PZUA 3FH0A 1U8EA 3T95A 2HLPA 3TW4A 3IKTA 2R66A 1W0KD 3FPJA 4PYIA 1E1QD 4MMZB 4ETMA 5HZMA 4PGFA 1BDBA 4TUYF 1EMDA 2I1LA 2VYVD 2YMPA 3M3PA 2YC4C 3KTAB 1P74A 3QVGB 2ID4A 2BCEA 3QKSA 4HVTA 4FEYA 1DJOA 4GXQA 4ZAYA 1Z6ZA 1J70A 4RSMA 1XZLA 1S2OA 2O1WA 3FYUC 3UKJA 3ADDA 3V4SA 1P7ZA 2ZJ0A 3EXHA 4I2NA 3ZH2A 1SC4A 1FNCA 2P9CA 4GLLA 1T6NA 3L7KA 2W58A 2VYND 5HWSA 5CRIA 4H27A 4WESA 3AJDA 3QX7A 2FSFA 1S0UA 4FNMA 1M83A 3HR8A 1V3VA 1Y80A 4X3OA 1P73A 5BRAA 1OOEA 1X8XA 3ZWVA 2JDID 3P7MA 5B6IA 4RYDA 1UXGA 3M5WA 5EIWA 3LRPA 3KT6A 1GCOA 4YRFA 4BEWA 2IUYA 5BOVA 2QNBA 5ICSA 1QCYA 4JLKA 4YQEA 2ZYHA 4ZT4A 3C3DA 2AHRA 3S7TA 1NJGA 2Z58A 3OIVA 3LCMA 2HJSA 5AOAA 3TZ6A 3DT6A 4OMCA 1B76A 4AKSA 5A0TA 4FYKA 4QDZA 1J00A 1EX7A 2MSEB 1BMQA 1BMFA 3IYLW 5KQSA 2EATA 4FVTA 4FHFA 3WK4A 5TIIA 2YRWA 4I50A 4CM6A 1CJTC 4M0PA 3OPYA 2DT5A 2QI9C 3IPYA 2JPDA 4W9NA 1CY0A 3HG7A 2H0RA 2P6OA 3IQEA 3HI4A 2UYGA 3SKYA 4RPKA 2YXDA 1XQXA 3IVRA 1CUHA 4IICA 2PM8A 3A4LA 2QN6A 2NUAB 4ZFNA 2BFCB 1PQYA 1UWVA 5EAIA 3GJ0A 2OORC 3IEPA 3SCZA 3LFHA 3KDPA 1A5ZA 4YBRA 9LDTA 5JZ9A 5A9SA 4RTJA 1XTSA 1P81A 1UK7A 1AKNA 2Q9CA 4X94A 2ADFA 2QE7D 5JZVA 2WWTA 4ZVOA 4DC1A 3FLAA 4BO5A 3ECCA 2I1VB 1VI6A 2O0HA 4G1CA 4B80A 4LDPA 1V8DA 4RJTA 2Q07A 5ITVA 4K88A 3BJMA 3P32A 5FNZA 2P9GA 1OBVA 3JALB 5BR8B 3UTDA 4MWZA 2BEVB 2C04A 3B2QA 1N2XA 3AERB 3PGMA 2IYEA 1TJ5A 3OJEA 3RT1A 4TQ9A 1MF7A 5CH8A 5DOVA 1JJFA 4M9SA 1N6HA 1PZHA 4JBHA 5KYUB 2HNBA 3ADBA 2G8NA 1NXOA 1OJLA 1E9SA 3FPFA 3GDFA 1OT5A 3V1UA 5EUBA 1KAGA 4BGDA 3OLQA 1IEWA 2RHCA 5BN4B 4DA9A 1ZUWA 5KIAA 4E5UA 1D1SA 1AN9A 5E3IA 2Q7DA 3P71T 4AJKA 4AY3A 1J8FA 2AN5A 1U4SA 1PNOA 4YECA 1CRZA 5AVZA 4AZ3A 4WZ6A 2QN9A 3SLKA 3TLAA 3LTEA 2HT1A 4KXWA 1F17A 4F3KA 5A5DA 1R0BA 3C85A 4PNPA 3C3PA 1UBMS 2CFCA 1XCPA 2XF2A 2XODA 4KRXA 5GIOE 3DTTA 4MROA 1C8KA 2KI5A 2P6UA 4I99A 3ZZTA 2OPHA 4RJKA 3VVLA 1LNQA 2WUGA 3ELYA 2ZAIA 1Q11A 2PUTA 5HPYB 5IAEA 4YRIA 2FUEA 2FEAA 3R3WA 4GPTA 821PA 1U3UA 3AP1A 3FNGA 8GPBA 4NXMB 5GMOA 5CFPA 2WQ7A 5HGXA 3TLKA 2FLKA 1TA0A 3ELWA 4ZO4A 2O8BB 1JHQA 1OYVA 1V45E 1V16B 1Z5PA 2I5PO 4RWEA 1ZUIA 4KLNA 4YJGA 5CX1B 3VJRA 4OHXA 3B89A 1MO2A 1JBKA 1G9TA 4OP2A 2J48A 4R1SA 3I5YA 1AK9A 4RJJA 4D6XA 1WKVA 4ZMSA 2P0EA 2B36A 3NRJA 4DEXA 5ALVA 4WKBA 2QSJA 3CZCA 3QI2A 4M54A 1K2WA 3L77A 3HBAA 3T94A 1WW3A 1ZLYA 2EOAA 4BQFA 4DN6A 3FCOA 2ZIFA 2GETA 2PRJA 3PFGA 5JI2E 3DMTA 4XGRA 4ARCA 1W1UA 3O1HB 2JIBA 4JHLA 4YASA 1KAMA 2ZJ5A 3LZ6A 2YJNA 1RD4A 4AS1A 1XR3A 4PVDA 2H1LA 1OVMA 2HNKA 3LT4A 4UC0A 1AG9A 5DI3B 4C3UA 4F8EA 2FOXA 5AVUA 4JI4B 1Z36A 1NY6A 4NOJA 3HO6A 3VYUB 3QXJA 1JG2A 1N2CE 2BFWA 4GLBA 5AW1A 3ZJVA 4UCQA 3LRTA 2MU1A 2WU8A 4IGAA 1G21A 3ERCA 2HF9A 2J6CA 1T8UA 4OQZA 3KSRA 1P4GA 5L4SA 5DM70 4Q4HA 4OKSA 3BILA 3VR1A 2AUNA 3ZWDA 4NWIA 5C0OE 3I28A 4Q1AA 2OZVA 4RD3A 4IS3A 3V2UA 3JS5A 1T29A 2HJHA 3BDAA 1YI8A 4NPHA 5LD2B 1KQ3A 2L2QA 3CINA 4DV4B 1XQ1A 4RD6A 3W6NA 4DCVA 2CB0A 2QMQA 3H9CA 4YTEA 4CCAA 4RHFA 1HORA 1ZJ6A 1EAYA 4B5KA 1W2HA 4ZVSA 5HF5A 2CDRA 1AQLA 4NE2A 3U13A 1NC3A 4UKDA 5KTSA 3KL2A 5FOWA 3U1BA 1S01A 4QT0A 5FFNA 2XA2A 3EA5A 4HH0A 4KRGA 4KYUA 3K94A 4LHVA 3T3GA 5DTEA 3U17A 1FFBA 1UAYA 3DDWA 3ZD7A 3IDZA 4ZYZA 2R1UA 2JRLA 3PKJA 1TAHA 4F2HA 2VYQA 5AXBA 1VKNA 5D86A 2E4XA 1KJ8A 3D4PA 4P0QB 4DANA 5FTKA 1BE6A 4KQ6A 4HDNA 2JA1A 5JYDA 1ZESA 4QJ5A 3WE7A 1ARZA 3Q7EA 1RI3A 2COEA 2QUZA 5AVQA 2G70A 1WU8A 3CRZA 2OZPA 3RS7A 3U7JA 5IVHA 2O2IA 3B1KA 3QXCA 2OD2A 1U0JA 3V4FA 5EJ4A 1JWBB 1W8IA 2JJ1D 1TL7C 1E7WA 2NZUG 4AS3A 1EGVB 4E14A 4FPXA 3K0HA 5B58C 3U7FB 1UBGA 3IPCA 1T3GA 1FP7A 1T5TA 3WGTA 3OTOB 5LYJF 3I9LA 4FS8A 5FBQB 1D8TA 2F4VB 1YQEA 3HSSA 1K8XB 4QASA 1GGHA 1XTIA 2P6MA 3FYDA 3NT4A 3DHEA 1HURA 3PE3A 4NCIA 5CHEA 2QJTA 4BVLA 2ZULA 2C2KA 4QDOA 4NCBA 1GPAA 1RYNA 1WJGA 3IHTA 4ER6A 5MGNA 1T9ZA 4K46A 2DCUA 3Q7SA 4BZPA 5KYGA 1MA0A 1Z0DA 2GJAA 4Q7JB 2H07A 3UKOA 3HU1A 2DBRA 3TFOA 4RTKA 4IMPA 4ZT6A 1AF7A 4BZQA 2RBGA 2ZPTX 3PEWA 1IHYA 4B3IA 4GL4A 4NBNA 1K66A 2W48A 3GNTA 1UBRS 3HA7A 2X8JA 3I3SR 3R9KA 5JASA 4NNOA 1HDRA 3AGQA 3G1UA 3WYAA 1RBMA 4NAVA 3VQTA 2QZSA 1WZUA 3EZGA 5F1YA 5H68A 3AKZA 4LJSA 1Z45A 1Z82A 4DNFA 4CMBA 4LTNA 3DHVA 4NEGA 2AZTA 4RANA 4WAUA 4D1YA 3HYSA 5KX5B 1A7KA 4PPFA 1KQPA 1SURA 2J7PA 3EGXB 3LLUA 1AOXA 1S3GA 1NR7A 2P75A 3TQRA 3KD3A 1FLVA 3W79A 3H8WA 3UENA 1SQ6A 1RKBA 1E98A 5EUMA 1UMDA 1CVRA 4NBLA 5K8CA 3MWEB 4L0QA 1KSJA 2YIJA 1SXJE 2YRFA 1U1IA 4QBTA 5I5GA 2HU8A 1U9CA 2PFGA 2Y99A 5CX1A 2E4VA 4KKVA 2QM7A 4FYJA 4JR0A 1V39A 3O7WA 4LJRA 1VZ3A 4H7FA 3W06A 4X7MA 2O8BA 2A8YA 2R8BA 2V3VA 1GZ3A 1A98A 3QHAA 1S96A 1A95A 2BFFA 1YQTA 3USZA 1YULA 3DEHA 1PFVA 2I4RA 1Y33E 4C0WA 4O4HA 5JWRA 2C8KA 4UFNA 3WADA 3DFIA 3U4AA 2VHXA 2B0JA 4ZI5A 4YAEA 4BMXA 4BUCA 3UGJA 1Y81A 5H3HA 4DDTA 5HKKD 3OIGA 1ZXLA 3H97A 1GRRA 4HEQA 5EWMA 5LM3A 1G18A 3LKBA 1SK8A 1A4UA 4PYQA 4EY4A 4XASA 1XTZA 4HRYA 3CKLA 2JFGA 5ERXA 2GQ0A 3FKQA 1JMYA 2B7LA 3CX7A 3VDMA 2H11A 4OMUA 3OZ7A 4E2WA 1YQXA 4O3MA 4GMXA 2VRCD 5E7MA 3UV6A 5F35A 4RH3A 4B6JA 3A10A 4MVJA 2P4SA 2E7ZA 3M5DA 4N03A 4FT4A 1NFQA 1M67A 4OBXA 5SZHB 3GY0A 3S40A 5BV8A 3QVWA 2X5XA 4KDCA 1SKQA 3HACA 4BWGA 4K6HA 2XGGA 5IG2A 4U7DA 3JQFC 4ZXPA 1N4DA 3FZQA 3TNDA 2O5VA 2AEJA 1F20A 1AKRA 2VH2A 2P40A 3QBJA 1U6JA 3M9WA 4LKOA 4Q9KA 1URPA 1XVAA 2ZJ6A 2FPUA 1Q0HA 3K0CC 4I5GA 2Q4DA 3DBLB 4YROA 2AXQA 1NWHA 1N5IA 3E23A 4B6GA 5TQ2A 1H94A 2KPOA 2G4CA 3L7MA 1MT0A 1CULC 2PEYA 3MLEA 1TU0A 2H4XA 1XRJA 1JHMA 1XKXA 2C98A 1TO6A 5E6SA 3P9RA 2ACKA 3EK2A 1E1QA 4GSKA 4DQ0A 1C3LA 3OKCA 3E9YA 2L0XA 4TVOA 1KJQA 3IILA 1EU1A 3A3NA 1E4EA 5DGTA 5BO5A 5KMGA 1JT9A 1BQ4A 3ZV7A 4DABA 1Z8FA 4QVIA 2XEDA 2P91A 3PXXA 5K05A 2GKOA 2FUKA 1GSHA 1RYFA 1XZKA 3FDXA 4E5YA 3SDSA 1F2TA 4K6KA 3RADC 1E6EA 4K6OA 2QP4A 1Z0ZA 2RKOA 1QO0A 1KERA 2WF5A 3LOQA 3BHJA 4PW0A 2EF0A 3U3MA 2P11A 2VPQA 4FDLA 3IXMA 2CHEA 1UOQA 2QRVB 2GK3A 2VWHA 1P44A 1GNTA 1M1YB 2X0IA 4DEYA 1QX4A 1PEYA 4WECA 2I4MA 2OQVA 4LYGA 1ONNA 2WSMA 3PZBA 4HGYA 4YRCA 4Z7NB 2E85A 2VJKA 1A9RA 3AWIA 1K0FA 4GX1A 3S28A 1BKSB 1R0KA 3EZ2A 4HKTA 2R8OA 1VE9A 3GIDA 4HNSA 2PLRA 3GFFA 5F5XA 4JI2B 1KOJA 3KKNA 5K01A 4QXQA 2BZSA 4UHBA 4RTSA 3DZGA 3EPJA 4F72A 1N2HA 3IJPA 5DN9A 2YV3A 1Y3CE 3LVFO 2E5FA 2ZJBA 4BNDB 4TXHA 3O83A 3U31A 1DGQA 2PNJA 3WA7A 4M83A 4QSMA 2H7CA 5AHRA 1SCBA 1VJRA 3MS7A 1ETHA 2W2PA 1HZJA 2P5TB 1HI9A 4XJSA 4YI3A 1JEYB 2H4FA 1Z62A 3OLYA 3S1SA 1IYZA 1ZNZA 2F7SA 1FC0A 2QQEA 3ISTA 2IIBA 4RAQA 4R5HA 1W85A 1H9CA 3HFJA 4JD5A 4C4SA 1R4AA 1XVUA 1RWMA 1CR1A 2XT0A 4K6CA 5HTKA 1Y4AE 4HX5A 1ISHA 1C9YA 1NU8A 3GF4A 4K81B 2QD5A 2RHMA 4JEUA 4KTVE 3GZ4A 4OQ4A 3T9CA 3DDHA 5ITWA 3G0DA 3QYAA 2AOUB 3HKBA 1B1AA 4P80A 5A6VA 1NFFA 1E3SA 1QO7A 4AECA 1N9ZA 2GPTA 2PS1A 3IDAA 5DFAA 4AQ7A 1CY2A 1FYWA 5FEMA 1OXVA 1FVOA 1K68A 3I09A 4O0MA 3UQZA 4YCSA 1KZ1A 2FSSA 2H06A 3VR5D 3HEBA 4JMPA 1N33B 4QTTB 5I9NA 2WV9A 5CYPA 1X3LA 1VC2A 1Y82A 4W5OA 1RCFA 4DHEA 2CUTA 8ADHA 3KQLA 3AL3A 4LQ4A 3HCRA 1E5LA 2AN4A 4IXNA 3FB4A 1I7LA 3W5CA 4LDRA 4UTPA 3KSUA 3O1JC 1J2UA 2XB8A 5EIBD 3OCVA 4GRIA 3SBOA 3TLGB 3QHQA 1SQFA 2REQA 4KJXA 3ZUGA 3SZ3A 1QK4A 5DMXA 2GAOA 3IIJA 2J5QA 2JBAB 4L2IB 4L9AA 1OLOA 2BTEA 3VNUA 2V7QA 5LZ8A 2AG6A 3WLPA 3K8YA 3OUUA 3P2OA 2JBHA 3FOFC 2XUQA 2VK1A