2ZRFA

Msreca q196n datp form iv
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
326
structure length
312
Chain Sequence
APDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRETTTGGKALKFYASVRLDVRRIETLDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 95
structure length 312
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrfA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrfA01
1L4UA 4JBYA 1QHSA 1X8KA 2FOLA 1HA3A 1RFLA 2TMKA 3QXXA 4DVGA 4KFUA 5LB4A 3NDBB 3LV8A 2ZYWX 4US1R 1CR1A 1X1RA 4D0GA 1LNZA 3E5HA 2GJKA 1CJKC 1LV7A 3CX7A 3P26A 3SOPA 4Q19A 1Z6TA 3SHFA 2ZPTX 5SZJA 4Q01A 3IPYA 2B7CA 1N5IA 4G0NA 3I1FA 3U5ZB 5G3ZA 4B71A 2PEYA 3X1YA 3U44A 1S96A 4NKRA 3SZRA 4DCNA 4PC3A 3L0IB 3X1XA 3KQHA 4RSGA 1G19A 5SZHB 5JHHB 4NCKA 3Q5EA 1AZTA 3ZZUA 4LV8B 1A1VA 1N3BA 2A5DA 3LLUA 4HB4A 1AGPA 1ZD9A 4YXWD 3PIRA 1K8RA 3RS4A 3OIVA 1T3SA 5LB2A 3DPUA 4HLUC 1ZJ6A 2ODNA 3MWYW 2DHRA 1DAGA 1M7GA 3A4NA 1W36C 1E0SA 4Q48A 3BGWA 2C96A 1YE8A 5GVRA 1XMVA 3U61B 3QUSA 4PXAA 5DHFA 1Y63A 4B3GA 1E2KA 2JCSA 2C77A 1G8HA 2P0EA 5L3SB 1NRJB 1BH2A 1Y3AA 3NWJA 3CBQA 3WNCA 4JLMA 1KK1A 4OI0A 4HAZA 4WBSA 3P4XA 3QKSB 4DDWA 4NYMR 3C4JA 3HPQA 2N42A 4LJ7A 1KO4A 3GJ8A 3QOFA 4C0AC 5HPYB 2YC2C 5EE3A 3VKWA 1GP2A 2OXCA 2IYVA 2B6HA 2CHGA 2WJJA 3OFND 5DI3A 5DIFA 1Q44A 1SVLA 3BB3A 4A6XA 4DB4A 3EASA 4Z54A 3U7FB 2FX3A 3OE7A 5EXTA 2WSSD 3LBIA 1NY6A 2ZRPA 3M6AA 1A5TA 5IF9A 2CNWA 1U0HC 1JQLB 2J9RA 2A2ZA 5FPHA 1ZIPA 3NH9A 2QZ4A 4Z8YA 1M8PA 3N5CA 2VP0A 2NPIA 4U7DA 1HV8A 2ONKA 1XP8A 2J7KA 1E1QA 3CRQA 4WVFA 1B0UA 2FMXA 3BH7A 4JIMA 5CJ2A 4LZZA 4PSKA 2I4IA 3CO5A 1UDWA 3PEYA 4PAQA 3U3KA 1AKEA 2WJHA 3UMRA 4OQNA 3AVWA 2Q9BA 4PANA 2HLDD 4CDGA 3KL4A 3TK1A 3IKJA 1E1RD 4ZDIA 2JLXA 1Q20A 3OEHD 3P27A 4QXAA 4Q9IA 3I61A 4TLCA 1YKSA 1KY3A 4Q1CA 3TW4A 2J0SA 1HE8B 2VLIA 4NCJA 4MUBA 721PA 1YJ5A 4YLGA 4JZKA 2GCOB 1O87A 2NTYC 1GNPA 1GSIA 4AG6A 5CB6A 2UZIR 2WMNB 1OJLA 3GQBA 4LY6A 1DS6A 2QG6A 1WXQA 3B1YA 3U3JA 2FN4A 3DO6A 2A7QA 4ABYA 2GWHA 1Z83A 2DFNA 2IC5A 4Q4JB 1Z3IX 2B92A 1E2QA 3GEIA 2O8CB 3AF3A 2NG1A 4GT1A 3K1JA 4TL8A 1QHXA 2YWHA 4OHZA 5TARA 3AM1A 4OI4A 4PC6A 2J41A 2E87A 4FXPA 1AS3A 3B1VA 3KTAB 2YNMA 2GNOA 2CK3D 2ZRFA 2B8WA 2QM8A 4DSNA 2BIFA 2W6IA 4AKGA 4TQ9A 4M1YA 1SKYE 3RSOA 1T8UA 1PLJA 4B3FX 2H7VA 2CHQA 3AGPA 2BJVA 5C2JB 1K6MA 1T4GA 1U81A 2IWHA 5GVSA 3Q7PA 3BD9A 2VP2A 1PVOA 4IOLA 1XXHA 1NLFA 1VIYA 1YR7A 2QBYB 3K0FB 4C2UA 3BOSA 3KQKA 2EWWA 1DVRA 2JDID 4Q66C 4YMTA 3EX7C 3CLVA 3KUCA 3TE6A 2BMDA 3OIUA 4P4SA 3DOEA 2ZETA 2E9SA 3EXAA 2QN6A 2OCYC 1A7JA 2FDCA 1CF4A 1E9SA 1GG2A 3KJHA 1V43A 3RDPA 2J59A 1X86B 3QF7A 1OB5A 1HUQA 1COWA 1QG4A 3TNFA 1NVVR 3HR7A 4AYXA 1GM5A 3QXJA 4BFZA 2VL7A 3LAWA 1JR3A 5E3HA 3W9YA 4ACAA 1KMHA 4Q1BA 4ACBA 2IHYA 2DPXA 4TMTA 2GJSA 4Q4AB 3UG7A 3SJBA 3UPUA 2NO6A 2PZGA 4DLSA 1G3QA 1KKLA 2JA1A 5JI3E 3CZQA 1XTSA 2QMOA 1SVSA 2O0HA 2ZRLA 4IDQA 5LD2C 3X1DA 2A78A 3W8RA 3K0SA 2ORWA 2FZ4A 3H0KA 2IWRA 1W48A 1F2TB 4ITRC 4LBYA 3IPXA 4KV9A 1AGRA 221PA 2AWNA 3BIFA 1EFHA 2D3WA 2Z6VA 4LYJA 4QJ4A 4DCSA 4TLBA 3OAAA 4BFWA 3CNLA 1JR6A 1NIJA 2D7DA 2P65A 2FA9A 5DE3A 3TLXA 4Q18A 5IT5A 3VX3A 2WWXA 4WXRA 2DFLA 4RD1A 1D2NA 3H86A 1II0A 3W3ZB 4EPWA 4V0LA 4PSVA 1ZM9A 3KFVA 5HTKA 2KJQA 1RRGA 4KVAA 4WW0A 4BZQA 1YVDA 1OIXA 2FSGA 2VF7A 4U02A 4B34A 2BBTA 2QENA 2CL7X 3FHCB 3GEHA 5BQ5A 4K81B 4XVRA 4DXAA 3EIEA 4OQXA 3CZPA 2ZJ2A 2QSZA 4LDJA 1E79A 2ODBA 2KB0A 3FPAA 2QP4A 3BC1A 4KBFA 5FTNA 2ANBA 2WOOA 4RJLA 4Z1MD 4E09A 3CRW1 1Z0FA 2ZVPX 4I1SA 4MRNA 3W6NA 1JALA 2GTPA 1OYWA 4LYFA 4OJQA 4TYQA 2VTKA 2OHFA 1N0WA 2OEPA 4UXHA 1SXJB 2WMOB 1WCV1 2QRNA 3A8TA 3R7WB 2G0TA 3R8CA 2AXPA 4KITB 4IDHA 2JJ8A 3CKLA 4YMSA 1U94A 1Z2AA 3EAQA 4JT4A 3QE0A 2GCPA 1UKVY 2YC4C 3FMFA 5AJYA 1BYUA 1RJ9B 4RFSA 2Q3FA 1E9EA 1G7SA 1E4YA 1KJWA 4TTRA 1KKMA 2RMKA 3QBTA 4EJSA 3TBKA 5TMPA 1UF9A 5EZ6B 2O52A 1GNQA 3CIOA 1G8YA 4AURA 4R71A 4EPTA 1GRQA 5C18A 2GXQA 3DDCA 1VDZA 1XXHE 1AA9A 2GEDA 2A9KA 4DLTA 2QORA 3IEUA 4AC9A 2HDNB 3VR2A 2EVWX 2HF8A 1KI7A 2NO0A 1UDXA 2C5LA 2QL6A 2NQ2C 4FCTA 4IFBA 4OKSA 4CRWB 1W0JD 1N6NA 1KJZA 1FOEB 1EX7A 4YC7A 1Q22A 4NCIA 2OZEA 1LY1A 1OFIA 1U8ZA 3MSXA 1KO7A 1OHHD 2EYQA 5J4LA 1G7CA 5FR1A 3KQUA 3OIYA 4MKFA 1ZM4A 3GLIB 5KDOA 3SS8A 5JFGA 3VHLB 4ESHA 1UBCA 1JB1A 1G7RA 1XDBA 3ZS8A 1I4TD 3W8NA 5L3VA 2OAP1 1MO3A 3ZIAA 1NBMA 3O47A 2XTMA 3BH0A 2OV2A 1KI6A 4M2LA 1FMJA 2WWGA 3VFDA 3H84A 3V9PA 4PR0A 2XSZD 2PT7A 4NL4H 5J5CA 2ATVA 3LLMA 3LVRE 4P3YA 2WWYA 3LO5A 1KI2A 2X2FA 2YWGA 1HT1E 4UXJA 4BPBA 1I2MA 2BC9A 1KTVA 1R0WA 1E9BA 1QBKC 4MYCA 4G01B 4ZCMA 1QHYA 2V4ZA 4NMMA 4DDUA 1XRJA 3KXIA 4URZR 1XEXA 4JYBA 1LW7A 1OH7A 3AV0B 2GK6A 4PC1A 4TTQA 4LYHA 3ADCA 3QEJA 1HY3A 3GMTA 4A0HA 1ESMA 5KDDA 1E2LA 2H16A 1PUIA 2VP5A 3QY0A 4M22A 1TU3A 1FX0A 3GJ3A 3D7MA 5P21A 4FCVA 2IYZA 4RCZA 4LYAA 2BVNA 2PL3A 4M9QA 5UKDA 1QZXA 2D4HA 1TUEA 2AHOA 2CJWB 3D3QA 3RAPR 1JAIA 4M0LA 4JLNA 4XWAA 1U0LA 3AH8A 2VPPA 4TSFA 3B9QA 2QAGB 4FCWA 1PJRA 1MO4A 2G3YA 2W0MA 1TQ2A 4OQFA 5FPKA 2GF0A 4BGDA 3M4YA 2HT1A 4YMVA 2DWPA 4Q02A 4ZIRA 1UKZA 4OHWA 2IYSA 4TMZA 3QXCA 5IDVA 4HSEA 3GLGE 4BFTA 2VQSA 2XOKD 1BYIA 3GLHE 1CRQA 2OXRA 2EFDB 1EXMA 2PLRA 3KFXA 3U2QA 4ASUA 2HV8A 2I1QA 3AF0A 4EDHA 2ECKA 4I1VA 2Z83A 1Z22A 1IOZA 2VEDA 2C78A 2IUTA 3FE2A 3O8DA 5IK2A 2X77A 1TUIA 4QBHA 5EP2A 2WAYA 3RRYA 1G291 2R6AA 4TYYA 2WZQA 3W34A 4CEIA 1B23P 4JSTA 3BE4A 2ZS7A 4Q4HA 5D3QA 5JWRA 1DG1G 3IQXA 3MAAC 4OJKA 3C8UA 1D5CA 2BMJA 3M1IA 5HCIA 4I4LA 4HZIA 2A5FA 2JLRA 4M21A 4GOJA 1V5WA 1F60A 5FUVA 1FNMA 2Q0HA 2V7QD 4LHVA 2WKQA 1E0KA 1AS0A 2CMKA 2AX4A 4KYIB 3NTUA 3OE7D 1Z0IA 2G1JA 3PEVA 1VYUA 2R62A 3MWJA 4A8JA 3NG1A 4URYR 2CNWD 1G17A 2NGRA 2CEAA 3AF1A 2O0JA 1W7AA 1VG1A 1KOFA 3NXSA 1RC8A 3IGFA 3VR4A 4DIDA 2QAJA 4PSAA 2H17A 1E1QD 1NBME 2ZRNA 2RB4A 3QKRB 4LX0A 4C2TA 4KO8A 2QMEA 4B44A 1DO2A 1P6XA 2WHXA 4KU4A 2XZPA 2ZR9A 2CXXA 1QVRA 2V55B 1W4BA 3RLFA 2ZYTX 4LJAA 2GEUA 3SYLA 2ZI9A 2Q6TA 3EC2A 3AVVA 3TVTA 4AYTA 4V0ME 4QM7A 2EYUA 4PQFA 4EKDA 5G3YA 3K0EA 4M53A 2VSFA 3T35A 1ZUIA 4M1OA 2W6JA 5DH9A 1P9RA 3AUYA 4M1WA 2MSCB 4LI0A 1Q21A 2QTFA 1S4QA 3CWZA 4WZBE 1GILA 1FFHA 1T8TA 2GA8A 4M8NE 3AVYA 3AVPA 3EPKA 2RGXA 1NN5A 3BAFA 5FUWA 3ASYA 3B1WA 5F2EA 4BZPA 3GLFB 2ZAOA 3NHBA 1R0XA 5H68A 1BMFA 3K9GA 4WIAA 1P2TA 1M2OB 1SKQA 2IYTA 2Q3MA 2QMUA 3EPJA 4D0NA 1GL7A 4O2RA 5HCNA 2AL7A 3U7HB 2WIAA 1E99A 1M74A 3GJ0A 3MD0A 4PO9A 2ERXA 4II7A 2ZJ5A 5JEEA 2B21A 2LKCA 4HAXA 3CPHA 3V4FA 4NYIR 3ZVRA 1M6NA 2WJYA 2WTUA 2PT5A 1ZMXA 1S3GA 1YZNA 3BXZA 3HU3A 3L8YA 1DG3A 3T1OA 5IHPA 2OFWA 1E98A 5AJZA 1A82A 3U7GA 5L8VA 1R10A 1U9IA 4LV5B 2JLZA 4NDZA 3BORA 3ZLJA 1XEWY 1E0JA 5E7MA 4Q47A 3WRXC 3KJIA 3U4QA 2HYIC 4PO8A 1EFRD 4KODA 4IDOA 3A37A 1DE0A 3KDSE 1N6RA 3AP2A 3ZS9A 4B3CA 2WIBA 1YZGA 5L3QB 4C0SA 2O8BA 2HXYA 3QXSA 1COWD 1KSFX 4D4JA 1RRFA 1VMAA 1PUJA 4B43A 4A0FA 1QRAA 2Q21A 3W5JA 1N2CE 4GP6A 1E96A 1EFUA 1JR3D 3BWDD 1ZYUA 2CL0X 1OSNA 2XEXA 3IO5A 3OHMA 3K53A 3PG5A 4GP7A 5HE9A 3UANA 2V9PA 4MGYR 1IXSB 5E7IA 4ZI2A 3TGPA 3DZ8A 2ZTSA 1N0UA 2RGNA 3OEEA 4A8JC 5EE0A 1BKDR 1SVOA 1ANKA 1LVGA 2FZLA 4UNSA 3IBYA 4Q9KA 2X2EA 1NN0A 3I5XA 1UBEA 2FV8A 4LGMA 1QG2A 4OI1A 3T1VA 4Q1AA 1OH6A 2XXAB 4POAA 1KMQA 2FJUA 4LC1A 4Q9LA 4A15A 4GMDA 1FUUA 4XVQA 5KO2A 4CYMA 5EZ5A 2J7PD 3OAAD 3G82C 2BM0A 4P32A 1XD2A 1ZBDA 2F43B 3QNUA 2OESA 3DEFA 4DEXA 4X8OA 2QRZA 1NG9A 5EP1A 1G6OA 1TF7A 4F4IA 4DLZA 1ZP6A 2FSHA 3Q7QA 5JS7A 4BFYA 4PO1A 4ZKDA 4Q7JB 4XIGS 3S1AA 2QPOA 1DELA 3GD7A 5FOWA 4A2PA 4CEJB 1Z0JA 1SVWA 3K0AB 1XEFA 2IW3A 2VHUA 4RD2A 4QC2A 4GDFA 1RRPA 4MRSA 5EXSA 1KYIA 3DM5A 2GJ8A 2MSEB 4URVR 4BECA 4M9ZA 1J99A 3A6PC 1IN5A 2PX0A 3ND9A 1UKYA 5KDLA 3RS0A 1IN7A 2VHQA 2ONJA 1PZNA 1NN1A 1R0ZA 2PBRA 3GEEA 1KI9A 2A5JA 3BH6A 2IYUA 1NMYA 1LF0A 4IVPA 4KFSA 3QPVA 4MITA 2QP9X 3EPHA 4NYMQ 1L7VC 1NVWQ 5AK0A 3VX4A 5SZIA 2R2AA 4E03A 2DWQA 4PFSA 3BS4A 3THXB 1EGAA 2C98A 5FI1B 4MYHA 4PHFA 4RZ3A 5HKKA 3VKHA 3AKDA 2Q9AA 4HI0E 5FBQB 4B35A 1TU4A 3DHWC 1WE2A 2EW1A 1WBBA 4JL8A 1DAFA 1U9IC 2J0VA 2VP9A 1XJCA 3NC0C 4HUTA 1MRNA 2HT6A 1DAHA 2ZU6A 3CH5A 1VKJA 4JLBA 3RS3A 1SVKA 4ZV4A 1PV4A 2OBNA 2OLJA 3TRFA 5JHGB 1E94E 1VCIA 1VYVA 2PZEA 4FMDF 3J81k 1CBUA 2ZI3A 2UVQA 4FMCF 4QHYA 1P2VA 2P6UA 2WJIA 4A0RA 3LQQA 3RRMA 5KU1A 2REBA 2QY9A 1Q1EA 2XJ9A 3WY9A 2W2VA 1IAQA 3C15C 4MDFA 2IS2A 1SQ5A 3FFAA 4D82A 5J4HA 2XTZA 2F1IA 3RABA 3ZIAD 1AJEA 1VIAA 1H8EA 3EZ9A 1CJTC 4PHHA 1E9RA 4BLPA 2G88A 1KSHA 3NBZC 4BRWA 5HE8A 4RY2A 2FSIA 1II9A 1WP9A 1YU9A 2GVZC 4DBLC 3ZD7A 3A36A 5DI9A 2RGNC 4IXMA 4CEHA 4MKIA 2IYXA 4X8MA 1N6HA 1VPLA 4P33A 2ZE5A 3R8FA 1AN0A 2OUKA 5JJKA 2JLWA 4MKHA 4V03A 2XJ4A 3PV0A 4DSOA 1TF5A 3U44B 3SR0A 4Q21A 4BE7B 1OXUA 3CR7A 1OYYA 1GL6A 1Q3TA 2ZE8A 1NY5A 4LHWA 4ERNA 1CRPA 3DKPA 4Q7LA 2ZR7A 2XNDD 2G9NA 2WPDA 2ZVQX 1ZNZA 2ZJ8A 3LVQE 3SNHA 3TUZC 4ZO4A 3ETLA 2AK2A 3K9HA 1RYHA 4JLDA 3NVAA 4DT1B 4C0HA 2D62A 4G5SA 1JQJC 4TSFD 4ARZA 1UJ2A 4TN1A 3ECCA 1A4RA 2IL1A 4TQUS 5F9HA 1P2UA 2QGNA 3GFTA 1WMSA 4GBMA 3RC8A 1C1YA 4V0OA 1GTVA 3QKSA 2Y8EA 2BEJA 3AQ4A 3RVBA 5J4KA 3LDAA 3IHLA 2WWFA 5BYJA 5K8IA 2ZREA 1NP6A 1OXTA 4C7OA 4TT3D 3ZGXA 5DI3B 2GZAA 1U2RA 4NE2A 4UNRA 1G6HA 5ANRB 4EPVA 1G18A 1YRAA 3QG1A 4ZPXA 2HUPA 2XB4A 2ODEA 2W00A 4F4CA 3KXKA 3RRNA 5IK2D 2BDTA 1U0JA 2QA5A 1Z0KA 3THWA 1J2JA 5LD2B 4W9MC 4D2IA 3BB4A 421PA 2F1JA 3KJEA 2JJ2A 3WHLA 2QTHA 2VA8A 3C41J 2QU8A 2IHBA 4DIEA 2JAQA 4TLEA 1AQUA 1US8B 4DUGD 4DKXA 5A0FA 4JBWA 2D7CA 1NKTA 4B33A 1XMSA 1Q57A 2C95A 2J0UA 2BV3A 1Z08A 2F7SA 2MSDB 4NYJR 2C03A 1SGWA 5BYKA 1R8QA 1YHNA 4WA7A 3GLFE 2KBFA 3LD9A 4O25A 4DDVA 1VTKA 3EZ2A 2DCUA 3AGQA 4KBGA 1XD8A 3FB4A 1VCMA 2BBSA 1W47A 4QGAA 4KYUA 3EIHA 2ZJYA 5F98A 2G77B 3ICQB 3HJNA 3CNNA 1E2IA 3WMFA 5EE1A 3DZDA 2ZE6A 4MH0R 1W5SA 3DL0A 4QM6A 2VSXA 3QSYA 4NU0A 2WJGA 4CT5A 1R5NA 1G4UR 5B64A 2Z4SA 3DMDA 1YZUA 2W6JD 1TTTA 4X8LA 4XD7A 4IEIA 4BLRA 3F3YA 2OG2A 4OBEA 2ZRAA 1Q12A 3NEJA 5D3MA 3RWMB 3MFYA 1OKKD 3TSOA 3QG5A 4X8HA 2CHVA 1OLOA 3N2IA 2REXB 4LJ6A 8OHMA 1ZNXA 4R98A 4Q4LA 5FUXA 4B47A 3ZVLA 2QSYA 3IUYA 4F93B 1IM2A 1P73A 1BMFD 1NMXA 3BRWD 4EAQA 2QNRA 1TL7C 5FOXA 4HZUB 3SE0A 3KKMA 3GJ7A 2O8EA 1P9NA 3WMEA 3GFOA 3SDZA 3FHTA 2YKGA 5EE9A 4GZLA 1PLKA 4HLCA 1CJMA 4M1KA 2VRWA 4C3ZA 5KSOA 4W5WA 4LJ8A 4PTLA 1W4AA 3T1TA 1P62B 5E7JA 4I99A 1ZC4A 1SULA 3SEAA 1W2GA 2HYDA 3QF4A 1KMHB 4IVRA 4A9AA 1KDTA 4IHQA 4Q4AA 5C1BA 3GFPA 2J87A 2PJRA 3REGA 5LBIA 1KSJA 1QHIA 1JNYA 1K5DA 5JSZA 2BMFA 1RKBA 2PMDA 1R5BA 2ZQ5A 1E9DA 2J45A 1VECA 3LNCA 2B8TA 3H4MA 4RD6A 3P32A 1UPTA 4HDCA 1MRSA 3TAUA 1Z28A 1F2TA 4V0KA 4QKQA 1DOAA 1G3MA 1KNXA 2OT3B 4EFNA 1HYQA 1OIWA 3U60B 4A36A 4PHGA 2HEIA 3FKQA 4TMWA 4I1OA 2QT1A 4AD8A 3PR1A 4IXNA 2J1LA 4G1UC 2I1VB 2BBOA 5K8UA 3SQWA 1NN3A 4DB2A 4C0JA 3PJRA 4OK6A 2JLUA 1EESA 4MDEA 1BOFA 1YR9A 2VP4A 621PA 5GJVC 4MYUA 3R9WA 1P60A 4LK2A 1NI3A 3OEED 1WDTA 3I92A 1G3UA 1N6KA 2Z5FA 1XF9A 3I3SR 1E6CA 3OIWA 4E22A 3NC1C 4L9SA 5DN6D 2XTNA 3LW8A 1S1MA 2KBEA 2WWIA 3AP1A 4QNMA 1I4DD 2JJ1A 3ZH9B 4DC9A 3GLGA 1W36D 3AUXA 3GLHA 4M1TA 4LSGA 3GCGA 5GADl 2F55A 4KSBA 1Z2CA 4B3XA 3SC3A 2EU8A 1XTQA 4LHZA 2ZR0A 1ZINA 3IIMA 5KYKA 3LFUA 4OL0A 1YZTA 5EE5B 1NMZA 1SXJA 1T3HA 4Q1EA 1JXOA 5HR5A 2VO1A 2ZJZA 1XTIA 4LWZA 2ZSAA 2FG5A 2ZRGA 1E4VA 3A4LA 5JJIA 4JT2A 2ZRKA 2FFHA 2X8AA 2YWEA 3QPWA 3SJZA 1OXSC 2AK3A 3IBGA 5CK4A 4BLTA 4KCGA 5CDFA 3V00A 1RRCA 3TAHA 4GFDA 4LBZA 4B3DA 5JLJA 3CWQA 1LS1A 1ZD8A 1JBKA 2GBLA 4RFSB 4RZUA 3WP1B 2RKOA 521PA 1GZSA 4IDPA 1KO8A 3X1WA 3A1WA 3A1TA 4HUQB 1P4SA 2R9VA 2CE2X 3THYA 5BWMA 3MCAA 2AKYA 1MV5A 3EWSA 4JYCA 1RPZA 2PX3A 4AKIA 3BBPA 2P3SA 4TTPA 4P4UA 4B2LA 2XZLA 2IYQA 2YZ2A 2KE5A 2O0KA 3TKLA 4B74A 1N5KA 2J5XA 3NKVA 3GLIA 4Q7MB 1XNJA 2GAAA 2GXUA 2RGDA 3LA6A 5TY0A 2JASA 3CX6A 1H8HD 2IYRA 1E9AA 2OLKA 4ZI3A 3ICEA 4MGZR 1KJYA 3ZQ6A 3MMPA 4V0MA 2YHSA 4IKEA 2REOA 3GJ6A 2ANCA 2GEVA 1KI6B 3ADKA 3MGCA 1KK3A 3CPEA 3L0PA 4J0QA 4XWOA 4OHXA 2XNSA 3NHAA 4L16A 4UJ5A 2OCBA 1NJFA 3U6BA 3JVVA 1M7HA 4NBSA 1GL9B 2WSMA 4HAYA 5A4JA 1G3IA 4N3NA 3EZFA 4FW9A 3R9XA 3K70C 1IJEA 3WP0A 1NG1A 1XZQA 1IQPA 1DAMA 2B7BA 4BWYA 3I32A 3RANA 4DJTA 1H8ED 5DLQC 4QJ3A 3WRYC 1FX0B 5F3WB 4B3BA 1AS2A 1KIMA 2ZXUA 3QVUA 3EIQA 3K8YA 5CIQA 5CYPA 5FOUA 2FSFA 1WF3A 1YRBA 4HAUA 4JVLA 4PZLA 2IF0A 1QF9A 4IJMA 5LPNA 4JVMA 3GJ5A 2QQEA 1XZPA 4OQMA 4N1AA 4TYWA 1II8B 1S1CA 3WBKA 4P31A 4QGFA 3I62A 3LBNA 2Z43A 3CF2A 1E3MA 1E0AA 2ZSFA 4FWTA 5KHOC 1HTWA 4F38A 3ONWA 4XSHA 4ZIRB 3RS5A 3MLEA 4YDSA 4ILEA 2WPDD 3L0OA 1ZCBA 3AB3A 4IDNA 4V02A 1Q1ZA 2FFAA 2FPKA 2IYLD 3OFNA 1CS4C 1SXJE 2DYKA 3ZVNA 4BLSA 4Q7KA 1SXJC 3AF4A 4W5JA 5DHAA 4GSYA 3RC3A 2WSSA 5A5GA 1XCMA 1JPJA 4EJSC 4QRHA 2WOJA 3BFVA 2NPFA 4QBIA 2IEZA 3OESA 3HYRA 4Y0VA 5CDFE 3NBYC 3KKQA 1BIFA 2P6RA 4NYIQ 4L8GA 2WJVA 2IS1A 1QVAA 1XCPA 4CEIB 2O8FA 3K9LA 3C16C 1W4CA 2GBLC 1D9XA 4Q4HB 4NP6A 1I4LD 1CR2A 1IXRC 3EPLA 1BS1A 1KZGB 3C5CA 2ZEJA 3HWSA 4RZXA 3NDPA 5FPSA 3UXMA 1OT3A 2HLDA 4PZYA 2AN9A 3EA5A 1S9DA 3L43A 1E1RA 3UG6A 1JPNA 3N70A 1S3SA 4XOIA 3WXMA 1EG7A 1RVDA 2C9OA 4Q9JA 1ZNYA 1XBTA 2H92A 4A8JB 2BCJQ 1W5TA 1CIPA 4S2EA 1DEKA 3UWOA 3GLIE 1U8AA 4ON9A 4MRPA 2XGJA 2GRJA 2NMVA 1W49A 2WWWA 4MGKR 2JJ2D 3U3OA 1JEDA 4B73A 1IY1A 2GK7A 2GXSA 3LW7A 1HT2E 4NHOA 1NIPA 3B1ZA 4IW3B 4BLOA 1D8TA 3BFKA 5KNCA 3ADDA 2Q9CA 1NSFA 4FMDB 5KOYA 3KQNA 1Q1BA 2FFQA 4FMCB 1G64A 4C0KA 4I1UA 4I81A 4PC7A 1D9ZA 1VG9B 4RFVA 4N0EA 3I4LA 2Q3HA 1T0JB 1IN6A 4QBFA 4QGGA 1XMJA 1TX4B 3T61A 4ESVA 2IUUA 5CLLA 1KK2A 4R7ZA 4URWR 2RGAA 3BB1A 1NVXQ 2R6DA 4FIDA 4WXPA 1YQTA 4QFMA 3K9NA 5HZKA 2FEOA 3TUJC 3EA0A 4HATA 2F3TA 2F9MA 5KTYA 1QHHA 2HCBA 3QVVA 4LCBA 1G3RA 3CB4A 3CX8A 1JECA 2W6ID 2ZRHA 1DPFA 2VP6A 2QQ0A 5EXXA 2JDIA 4LC0A 1XEWX 4IFEA 4YMUA 5AJXA 1NL3A 3NIBA 1MH1A 1OXVA 1DO0A 5FI0B 1L2TA 2V1XA 3LH5A 4EUNA 5J4VA 1FUKA 1C9KA 1HEIA 4L9WA 4PAOA 1NLYA 5CB8A 2RCNA 3VR6A 1AKYA 3KQLA 3KZ1E 5JJLA 5FTLA 1VHLA 4ZKEA 3TW8B 4EIWA 2KI5A 1L8QA 5FOSA 3V4RA 3C7KA 1G5PA 1W1WA 2ZM5A 1MABA 4Q5IA 4QG7A 1F48A 1XJ0A 2AWOA 3K09A 3ADBA 3QI2A 1M1YE 5FH9A 1GITA 4F7WA 1ZIOA 5DNYB 1W4RA 1FQJA 4OK5A 4DRZA 3U4QB 1T0HB 4YQFA 1PLLA 1N6IA 2BHRA 4E07A 4D4LA 4L5BA 1D2EA 4DLVA 4RCYA 1NSTA 3TSZA 1R0YA 2C8VA 2O8BB 2J3EA 1F2UB 3LX8A 1UFQA 3A1UA 3AVTA 2QPTA 2A30A 2FPMA 2JIZA 1NVUQ 2NO9A 2ORIA 2FU5C 821PA 5KSYA 5KPJA 1E2EA 3ZDQA 4D4MA 4LRWA 1KY2A 1XTJA 3PUYA 1RE0A 1Z47A 1IN4A 3B9PA 2YOFA 3VU9A 3QBVA 3MRSA 1NF3A 1P7CA 3MJHA 5EUMA 3B60A 3UKDA 4B2PA 1XPRA 5FTKA 2O8DA 2GDJA 3GPLA 2DB3A 4PPGA 4KHZA 5DISB 3TUIC 2VBCA 4V0NA 4GL2A 3K0CA 1GFIA 2FPLA 1EWRA 3K70D 4EPRA 3A4MA 2W0SA 1ZU5A 2YOGA 2DFTA 1W36B 1CEEA 2NO1A 2VYFA 4LBWA 3RNLA 1CU1A 3LWNA 4Z1MA 4DLXA 1A2BA 2D2FA 2F43A 4UJ3A 1XD2B 1G8PA 4C4PA 2IS6A 1Q1QA 1DAKA 5DGXA 3SI7A 1TPZA 2OCPA 4EQ6B 4D26A 1W0KA 1CR4A 1U98A 2NOAA 3CRVA 5AUQA 3F5FA 1D6JA 2ASEA 1E79D 1S2MA 3FHOA 1N6LA 2PEZA 4Z8XA 5H70A 3S1AB 4FINA 4D25A 3BERA 4CEJA 3THOA 4QJ5A 3K0AA 4Q1DA 4M1MA 4RKEA 4A1FA 4RD0A 2AD5A 2R6GA 2NZJA 1CP2A 1XWIA 5FBRB 4AYWA 4DHEA 4K8OA 4KI0A 2NO7A 1S9HA 3QPUA 4FMBB 4KSCA 2OFXA 2VHTA 1UEJA 2RH5A 1WBDA 3U3RA 2I3BA 2XAUA 2X19A 2W2XA 3W6PA 1YR8A 2GHIA 2GVDC 5JS8A 1XPUA 1W0JA 1FPMA 4PC2A 2YYZA 1FNNA 4YMWA 1T6NA 1NLZA 1OHHA 1G16A 2FE4A 1E9CA 2WBLC 1FZQA 3KB1A 1OFTA 4LJYA 1VG8A 2YWFA 4R2HA 5CJPA 3FWYA 2HJGA 4RVCA 4XH9B 2ZSEA 1N6PA 4NTZA 3KKNA 3PEWA 3BK7A 1DADA 5JRZA 3BFXA 5BN5A 1AZSC 2DFKB 4TLAA 3ZJYA 4RKFA 1ZU4A 2FF7A 3RRZA 2NZ8A 2FH5B 1W2HA 1Z6YA 2QUZA 3K09C 4KAXA 3GLFA 2XSZA 2D74A 5JZVA 5JWHA 4UQOA 3RYTC 5J4YA 1FTNA 2QT0A 5GJBA 3JZAA 1KGDA 5K8LA 3AVUA 4JLOA 4LJ4A 1NBMD 3UIEA 3VR5A 3LXXA 3PVSA 1CR0A 2IA5A 1Z0DA 1E2FA 1KI1A 2IXFA 3CR8A 4LHXA 2RGGA 4GNKA 2BJWA 4HAVA 3RS2A 4HLQB 1UBGA 2AXNA 1Z63A 1ZM2A 4LV6A 1DAIA 1KNQA 2VHCA 3G0HA 4A82A 2CLSA 2RGCA 4A0GA 5IRCD 2OO7A 4NYJQ 2HJVA 5CK5A 5FPTA 3TR5A 2QEQA 4WZ6A 3ZQJA 4C0LA 3WNBA 1N0VC 4OHVA 1OV4A 2YJTD 2ZYUX 2OSBA 2ZJAA 4CEHB 4Q9HA 1XTRA 1SKYB 1S8FA 3VHXA 2PJZA 1NKSA 1G21E 5JMTA 1N5JA 3K0CC 2GF9A 2WM9B 4RD3A 4PPNA 2BKUA 2DWOA 4TZ0A 3NBFA 4H1VA 1JJ7A 1G8FA 4A92A 4CT4B 3EARA 4LBVA 4WAUA 3T5DA 2F1HA 3B5JA 1OF1A 5EUQB 4MGIR 2ZI7A 1KSGA 1E2DA 1XX6A 3AEZA 3N2EA 2J0QA 2F1RA 4Y0AA 5L3SA 3W90A 4O2LA 2XOKA 4KXFB 4XTCS 2ATXA 3MWKA 4JKIA 3U6KA 2VIIA 4DT1A 1Z6XA 2BWJA 5AUNB 3VQTA 1R2QA 2YV5A 1MO5A 5JBQA 2AKAB 3PFIA 4PZZA 3CW2A 4ARZB 1EK0A 4C30A 1E32A 4EFLA 3RSLA 1X8JA 4US2R 4DLYA 1U8YA 1ELOA 1KDPA 4RZ2A 1ZUHA 1EFCA 1T91A 5AUOB 5GJWC 1LF5A 5G41A 4MRRA 5EJEA 3PCRB 1HQYE 4ASUD 1J70A 5JCPA 2EFHB 1W44A 4C9BA 4ZCLA 2WVJA 5H8WA 4EFMA 3QKTA 2NIPA 2N46A 2V8OA 2W2TA 3D8BA 2O5VA 3T1QA 1KI3A 4C7OB 1TQ6A 2V7QA 1Z07A 1G4AE 1T5IA 4AIIA 3KKOA 1VHTA 3Q9LA 1IXZA 2GJ9A 2DR3A 4AWXA 1NVVQ 3ZYCA 4GMXA 3GJ4A 3REFA 3O8BA 5G53C 4G5OA 4D80A 2R6CA 3Q8XB 3RWOA 1JI0A 4L4UA 5FTMA 2QROA 3I72A 3THWB 1FW6A 4B2IA 5CITA 1UADA 5L3RA 5JWOA 1E69A 1UKEA 4LPKA 4KJZA 4LOAA 4ZDKA 2AD1A 2R44A 4EPYA 4CW7A 2LCFA 2KSQA 4G5QA 1IJFA 1UBFA 3NH6A 4JSYA 1US8A 1YZQA 1P5ZB 4TMVA 4UNNA 2EFGA 2GCOA 2GZHA 5KNBA 3HPRA 2VH5R 1HURA 3KJGA 4JVNA 2ZRCA 5JI2E 1JXMA 2IX3A 2J0UB 1G9XA 4AK9A 1MOZA 1Z5ZA 1FTSA 1KZ7B 3SJCA 3B13B 3KX2A 4OQLA 3QQ5A 5TB5A 3EG5A 2CE7A 3FVQA 1NJGA 1M34E 2CCKA 4H1UA 3QKUA 4Q4JA 2JLYA 2O8CA 2ZROA 1KO5A 5HZHA 1X1SA 2G6BA 3CONA 3H1TA 1N5LA 4OK3A 4CGZA 3KTAA 4KFTA 1H65A 1DAEA 1KK0A 4HB0A 1OPXA 4FI3C 3AKCA 1O3YA 4R2IA 6Q21A 5FR2A 5FTJA 3KUDA 1TEXA 2CDNA 1Z29A 1YZLA 5KSPA 2E1RA 4URXR 1ETUA 3T5GA 1OFUX 5FUYA 4XJXA 2GESA 2IXEA 4JBXA 2H18A 1VG0B 4UKDA 3RS7A 2Z4RA 2BKEA 3B1XA 3X2SA 4HAWA 1RIFA 4A4DA 2P6NA 3SBDA 2JATA 1XXHB 2QBYA 3CUEF 5FL7A 3K0FA 4QGHA 3IHWA 5D3MB 1MR3F 1XPOA 1E2PA 4F92B 1IBRA 1K5GA 3O8CA 1G5TA 4P4SB 1T9HA 2PLFA 4W7SA 3OZXA 4KVGA 1E2JA 1G41A 2G1KA 2VSOA 5DYIA 2WAXA 3FKSA 1Z6GA 3T06B 4BFVA 4JLPA 1QHNA 1EX6A 3SFZA 3TQCA 4JKYA 3TIFA 3WYFA 4DDTA 1EFRA 3H2YA 1TNDA 1P2SA 2CVFA 5FBVB 1DTSA 1XU4A 4HZUA 3EWAA 1HQCA 3QENA 2QE7A 2EWVA 2O8EB 1ZRHA 4NCHA 3E1SA 3AVOA 2OBLA 4DEYA 5EQTA 4M4SA 1S0UA 3WNDA 3ZD6A 3DM9B 3B82A 2Z0MA 4ZDJA 5TXGA 3ZZTA 2LKDA 2GCNA 4JS0A 1R7RA 4YONB 4TLDA 4G5RA 3DVLA 2H1LA 3U3MA 3RHFA 3QF4B 2PCJA 3BJIC 4K46A 3VTKA 3X1ZA 2FGJA 1JAHA 1AQYA 3HU1A 5SZKB 2ZI6A 2WWHA 3W6OA 2MMCA 4GRAA 5JSZB 4B48A 1VCOA 2ZRMA 1GRRA 3KKPA 4FN5A 4AI6A 1GKUB 3ND8A 1UM8A 4NONA 2CLDX 4JJZA 1VYTA 3IQWA 4BZXA 5EXPA 1L4YA 4BEJA 2C9CA 5K8TA 3K70B 4R9UC 4A2QA 4XSGA 2V6IA 4L15A 1OB2A 1KDOA 2ZJOA 3PITA 4HDQB 2J7PA 2AR7A 2JLSA 4C0BA 4NCNA 2JIZD 2V3CC 2ZE7A 4LPSA 2VHJA 1XMIA 2RAPA 1RW4A 3IILA 4B76A 3B6EA 4B6FA 5BN3A 1GKIA 1EFTA 3FDIA 4NPHA 3MG9A 5J47A 5AUPB 3O8RA 2EFEB 2FGKA 5FPYA 1T5LA 3UK6A 2CCGA 3VR3A 1OW3B 1Z0AA 4P0TA 1GUAA 1KAGA 2BBWA 4LJ5A 2GXAA 1G7TA 1MT0A 4TL7A 2OFOA 1MO6A 2XZOA 4TYPA 3KB2A 3GLGB 3F0TA 3GLHB 2BOVA 3A1VA 2N1BA 3R7WA 3VNVA 2P2LA 1CLUA 3HR8A 1GVNB 3R9IA 1FP6A 1ODFA 1OXXK 2UZ3A 4XTRA 2RHMA 2C99A 4B6EA 1W0KD 1Z06A 2RHDA 1OH8A 1RJ9A 4MA4A 5FBWB 1R8SA 2J46A 3QEOA 1J8MF 1ONBA 2V6JA 2V54A 3QXHA 4JLJA 4EJSB 5B30A 3DOFA 3I8XA 1ZCAA 2OILA 4CVNA 2P5SA 2F3RA 4BEBA 1I2DA 5KPDA 1Z6AA 3EZ7A 4LHYA 4TQAA 3WYAA 3UWKA 2ZIAA 5JECA 2R8RA 2CCJA 1IN8A 4ZDWA 2A5GA 1KDRA 2ZITA 1TF2A 5AWFC 2ZRBA 3SHWA 3TJZA 2A5YB 4HUQA 2ZI5A 4IRUB 3D6TB 3THYB 1YR6A 4KLZA 2FNAA 1GKYA 3PUZA 4U00A 5E95A 2GILA 3PUXA 3KXLA 2W58A 4G3XA 2D06A 5CLQA 1AIPA 2BM1A 2LWIA 3TR0A 1OH5A 4AY2A 3P4YA 1OIVA 1CXZA 2WICA 5CM8B 5G40A 5HKKD 5KNDA 1N25A 1FMLA 4PPFA 5LDDC 3P1JA 2ZUBA 1LS6A 1XFAA 1E2GA 2F6RA 4Q03A 4DLUA 1Q0UA 2GJAA 1D2MA 3HYTA 1JR3E 4D6PA 5AJWA 4RD4A 3B7GA 4WZAE 4BFSA 1P9WA 1XD9A 1TQDA 3TSWA 4PAMA 2PZFA 1ZC3A 1XTKA 2WV9A 1SZPA 1G5RA 1WRBA 4KFRA 2IYYA 4M9XA 1XEXB 2AFIE 4AKEA 2ZRDA 2DBYA 4NZYA 1YZKA 2EQBA 4DWJA 1E2MA 4YXWA 3E2IA 1ESNA 2IBMA 2HXSA 2A3RA 3L2OB 3CH4B 1OE0A 1XCGB 3OF5A 4S35A 4MRVA 3TMKA 2CJWA 1X6VA 4XVUA 1ZM7A 1GDDA 4OYHA 1TAGA 4UNQA 3LBHA 4DLRA 2ZRIA 4BFXA 4NH0A 2XNDA 3UMSA 3JZMA 2QAGA 4JMPA 2QMHA 3U7EB 4QNRA 4IOMA 4AKHA 5AJVB 3CRMA 2ZANA 2ZRJA 3E70C 5C46F 1GWNA 2KWIA 4AG5A 4TYNA 1UAAA 1FQKA 1II8A 1UEIA 3FOZA 4BLQA 2OBMA 2ZS8A 1X3SA 1G20E 2BMEA 1KI8A 2X1VA 2C9YA 1T3LA 4CZ2A 4HEJA 4ZCIA 2ZS9A 4URUR 1NNEA 1F3OA 1DBSA 5TVKA 3NEYA 3HDTA 3Q5DA 2PH1A 4HLDA 3TQFA 3GP8A 1R4AA 4BRUA 2JLVA 4BUJA 5EP4A 1ZUNB 4QBGB 3T15A 5JCZA 3FMPB 1KAOA 2ORVA 4EPXA 2D2EA 4TT3A 1IONA 1WQ1R 1HH4A 5CIWA 1BO6A 2ZU0C 3EC1A 4Z51A 4LJ9A 4B32A 4B75A 4DZZA 2K5UA 3R20A 3WBJA 4A2WA 3TH5A 4D0LB 4OHYA 3W3AA 1XB2A 1CTQA 1AA3A 1MKYA 5GJCA 4JL6A 2JGNA 1R5OA 5B58C 1KHTA 4C0QC 3VMFA 2O8FB 3OEHA 4D81A 5EP3A 2QTVB 1AM4D 2OCAA 1N6OA 1GNRA 1ZD1A 3C14C 3CNOA 1RYFA 3F8TA 5B57C 2IS4A 4DUGA 3M0EA 5KUTA 2ZUDA 5E4FA 4FWIB 2SHKA 4LUCA 5AR1A 2P67A 4PX9A 5BN4A 1E2NA 3B8HA 3GJXC 3B85A 2XX3A 2H57A 1E9FA 3SBEA 1W46A 3QKRA 4TL9A 4QHSA 3SN6A 2QM7A 4DCTA 3L0SA 2C2HA 4IOJA 4O0MA 4QOSA 1XJQA 4TL6A 4Q1FA 3FMIA 3FFBA 4JLAA 2H8KA 1QHGA 1E2HA 2OE2A 3UATA 3G5UA 3WMGA 2FWRA 4GOKA 2G0NA 4JLVA 4Q00A 1U90A 2CK3A 3Q72A 3WHKA 3L82B 1FP7A 2CL6X 2WKPA 5C4MA 2G83A 3ASZA 4A6PA 2RGBA 1Q3HA 4M9SA 1QDEA 3IIKA 4F91B 3SQXA 2R65A 1DARA 3PENA 3CRRA 4IVQA 2IF2A 2VF8A 1R6BX 3D31A 4MYTA 1RZ3A 2GKSA 4JLKA 1HE1C 4XWKA 1A2KC 5DSZA 3IEVA 3B2EA 2CLCX 3LQRA 2MMGA 1OKKA 1ZAKA 5TDHA 2FEMA 4QL3A 2P5TB 2W83A 1GRNA 5BW8A 1CJVC 3DKVA 2QAGC 1QHHB 3AKEA 5B2ZA 1J90A 4N0DA 5FL3A 4TMKA 3L8ZA 3LY5A 4XD7D 4HB2A 5FBLB 5FOTA 1ZVQA 3EW9A 4YDHB 3PUWA 3MWLA 2L0XA 3SFVA 2BCGY 4MKGA 2IXGA 1CJUC 2F9LA 1CKEA 2FFBA 2XB2A 2UKDA 2QP3A 3PUVA 3AVXA 3JVUA 5DO9A 2GETA 2ZJBA 5FL7D 1M7BA 1LTQA 1IY0A 4W5HA 4PPQA 3MJRA 4DLWA 4G5GA 1LB1B 4FD2A 4PQYA 2YOHA 3FTQA 1J7KA 3PXGA 1ZW6A 3W5IA 3C5HA 1MABB 4QHTA 2IUSA 3FKSD 4UXIA 5L3QA 2ZI4A 1LFDB 3I8SA 4HB3A 3ZVMA 1TQ4A 4US0R 2QE7D 4U5XA 1KO1A 3A1SA 3DMNA 1GOTA 2ZYVX 1F2UA 4HYYA 4M1SA 1JJVA 1KI4A 3IIJA 4BASA 2V1UA 3SJAA 2IYWA 4P4TA 3AF2A 1JEEA 2PMKA 3LXRA 2CBZA 3CF6R 2BEKA 4CIDA 3P20A 2QGZA 3IO3A 3NBXX 2XXAA 2ZSDA 3VU9B 1CULC 5ELXA 2IK8A 1SVIA 2ZAMA 2RGEA 4F4JA 2O8DB 5DYGA 3FMOB 3I5YA 3Q85A 3B78A 5CYOA 4DSTA 4E5UA 4HLUA 4KLNA 1OFHA 2IEYA 5DN6A 1TEVA 4GZMA 3A58B 2HCJB 2DY1A 4JJKA 5C4GB 1G1MA 4MQBA 5JRJA 2QPAA 2YVUA 1U99A 4UNPA 2WKRA 3LRPA 3I73A 5H1YA 5FFMA 1GIAA 1C4OA 1TMKA 4WOPA 3UMFA 3FYHA 1F6BA 4EQ6A 1WA5A 3HP1A 4GPTA 3FGNA 2H5EA 4HDOB 4DCVA 4OI2A 2JJ1D 1F5NA 2GZDA 1ZNWA 3VAAA 4DSUA 1WB9A 1EWQA 3CPJB 3PEUA 2ODWA 5KSZA 2YINC 3HU2A 4GI7A 4GOXA 3SYNA 3T34A 2IT1A 1IY2A 3AP3A 3CF0A 1IHUA 3IDQA 5CM9C 5J40A 2PCLA 3AVQA 1P75A 3SU8A 4D4KA 4TZ6A 1VCNA 1FL9A 1SXJD 4IEEA 3EZ6A 3VNUA 3VKGA 4TMXA 121PA 5BXQC 4IOKA 1SHKA 3Q3JB 2OM2A 3T12A 2QI9C 4JL5A 4H9GA 3PQCA 4DCUA 1G8GA 3MUFA 4BQSA 2R6FA 3QJYA 2AFHE 1GAJA 1SHZA 4TWZA 4MUAA 3THXA 2XITA 4JVSB 5F9FA 2ZSBA 1SVMA 2CVHA 1TADA 3TVDA 1AK2A 1X8LA 1P61B 4O3MA 3AKYA 5FOVA 3SYKA 5M04A 4PHTA 3CM0A 5JEDA 3ZZ0A 2JLQA 2ERYA 1J8YF 1H8HA 1ZM3A 1P3JA 2ZUCA 5TV2A 3VR1A 3LX5A 2GAOA 1Z8FA 3QIAA 3WYGA 4CF7A 1P72A 2C04A 2EFCB 4BFUA 2HF9A 2OAQ1 2JEOA 4PQRA
chains in the Genus database with same CATH superfamily
1ULSA 1VKRA 2GN2A 3PQEA 5JAZA 3L7OA 2DQSA 4GGOA 4YJGB 4XLZA 3RIXA 3Q9NA 4G8JA 4DVGA 3OA2A 4QOHA 1LA2A 1JIJA 3LV8A 4F6RA 3EGVA 3GUCA 4RLSA 3FJOA 4DV7B 2GJKA 1CJKC 5BQXA 5EIXA 4Q19A 3OCJA 5JTTA 1I1QB 1Z6TA 4FDUA 4FWBA 1YDMA 1P17A 2ZPTX 5SZJA 1RLUA 4M46A 2W2MA 2II6A 4MLPA 4X1YB 1JWAB 3CNEA 1T5OA 1MDFA 1NQUA 5G3ZA 3NWOA 4YLEA 3ZWOA 4YJ3F 4B71A 4DBLE 4DCNA 4PC3A 2UV8A 1E89A 4I4TA 2QVCA 3IHTA 5EJMA 1VL1A 2DQKA 2L2QA 1XA0A 3GMDA 1I3NA 2ZYDA 3CRNA 5SZHB 4NCKA 4JI4B 1AV7A 3LLUA 1JYEA 3OURA 4FVTA 4YXWD 2MSLA 2ZIUB 1M2GA 2J9ZB 3WVNA 4JUFA 1JG3A 4C7KA 1ZJ6A 3R1IA 4I6JA 2VDWA 3H11A 4FT4A 4MPDA 4OM8A 4CL2A 4LECA 1KFCB 2G28A 2O7RA 3AHEA 1R3UA 2EEZA 4QPJC 5LZ2A 5HILA 3ORSA 1YE8A 2NTNA 2W2LA 1XMVA 2Y76A 3H9GA 5GVRA 3DKKA 4X7BA 4B0PA 4DMGA 3AY3A 4PXAA 4RKYA 1KS2A 2X3YA 5FWYA 1L5RA 2EOAA 1E2KA 3FDZB 3ZG6A 4UDYX 5IUJC 1CQWA 4MYRA 1IH8A 4QOEA 3CBQA 1JDJA 4GOLD 2OXFA 3E3OA 4JLMA 3WNCA 1GZ3A 3PX3A 4FQ5A 3OP1A 3WIBA 3QKSB 4DDWA 1FFEA 2H5JA 4NYMR 5ALVA 2N42A 4G23A 4LJ7A 3G68A 2FR8C 1DIOB 2A35A 4C0AC 1CY4A 3LU1A 2HU7A 2YC2C 3L04A 1K4YA 3ET4A 3IMKA 2BZGA 3ROMA 3VKWA 5ITVA 2H00A 3HVKA 2HL6A 1OQAA 3HCNA 1Q44A 3BB3A 3GPIA 3OMLA 4FKBA 2C2KA 5ALPA 3TZBA 4A73A 4FDMA 5CMLA 3NEAA 3DMTC 1DBIA 1F8GA 4FFOA 4EVRA 2WSSD 4MVJM 2C5GA 3LBIA 1NY6A 4WBNB 1KYVA 1K7EB 4JH0A 2NU7A 1U0HC 1ZMOA 2JJMA 1JQLB 4OLHA 2J9RA 3V8VA 3L9WA 3OLCX 1MNAA 1ODCA 2QZ4A 4Z8YA 1B6GA 3HWX1 1CNFA 3N5CA 1BMTA 2VP0A 2Y6VA 3PT9A 4GM4A 4EW1A 4Z0PA 3GFSA 1MFPA 3RC7A 2ACVA 1ZN7A 2ONKA 1WUKS 2FPGB 1VMDA 3H7IA 4U3JA 1MAWA 2FMXA 4JIMA 2OUIA 5EWMB 5DZSA 4LZZA 2ZB8A 3R7NA 5KINB 4HTFB 3PEYA 2WJHA 3UMRA 5JZSA 4OQNA 2A59A 1U5CA 2H5LA 4WLEA 5DMXA 2IPMA 4EI9A 3AVWA 2GM3A 3KL4A 3IKJA 1E1RD 3UFXA 2JLXA 4QT0A 1JP7A 2BHSA 2YS7A 4NMHA 2G76A 1Z5PA 4Q9IA 4YAIA 1KDZA 2HA6A 2VLIA 1FRQA 4DARA 1P29A 1B00A 3SOOA 1L7NA 1L7PA 4MUBA 4R81A 5A9TA 1DC6A 3FLAA 4JZKA 4TWIA 1O87A 3GR6A 4NWIA 4BO0A 5L6LB 3M4NA 2O05A 2OV1A 1OGJA 1AQNA 5PNTA 1OJLA 4G8BA 3G8BA 4LY6A 2A1UA 2C2MA 3OI7A 4N0PA 1AHNA 2XMDA 1HE3A 1WXQA 4ZHSA 4V24A 1CK4A 1WDWB 3VV3A 3EVNA 2GWHA 5EMNA 1Z83A 1R64A 2DFNA 2IC5A 2WZBA 2W6ZA 1E2QA 3JWPA 4IIVA 4UOQA 3M5CA 3UAXA 4F5YA 3HKBA 3DE1X 2NP6A 4QA9A 4YJDA 4BB0A 3AM1A 1EHYA 4OI4A 2GM5A 2NZUG 4PC6A 1SUBA 2D1YA 2E87A 2OAGA 2VI5A 3IT1A 1POWA 3B1VA 3KTAB 5CH8A 1QC5A 2YFHA 3EC7A 2P9TA 2OZPA 1ZUD1 3A2LA 2IELA 2YNMA 4QDTA 4UEJA 2CK3D 4PO3X 2B8WA 3VC3A 1NVMB 2BIFA 2OVBA 1EK6A 2MR5A 4PU0A 1MB2A 4TQ9A 4LFAB 4ZC1A 3RSOA 4GF5A 1T8UA 2PAFA 3DMYA 3RAFC 3R7SA 4DXHA 3ZZNA 3RUCA 4ARIA 4HPJB 3QBEA 1HRDA 3MSCA 4J0GA 2JBAA 2CHQA 3ZCPA 4B3FX 3BXXA 3L6BA 5LLTA 2EJWA 2VJOA 3QU7A 3W5SA 5KOHA 1GQOA 1PZEA 1U9JA 1VC2A 2ZJ1A 3BD9A 1PVOA 4DCPA 5JXWA 2A4MA 3CR3C 4DV3B 1EP2B 1DKPA 2EWWA 2JDID 1X7XB 3MMNA 3T0FA 3T95A 3OIUA 3DEIA 3IRUA 5KCMA 3DOEA 1T8PA 2E9SA 3QTLA 1OLSA 2QN6A 1WIWA 1QGDA 4JJIA 1WF6A 2VNKA 3UW1A 3W5HA 4A0SA 2FDCA 5ADVA 5AM4A 4O4JB 3O82A 4BO5A 4ECEA 3KR2A 5L9AA 5DX0A 3WB2A 1UCFA 1HUQA 1QG4A 2OYCA 3TNFA 3VHQA 3CISA 3HR7A 3IOCA 1P4GA 4MUMA 3GV0A 1GM5A 1T2AA 4MR8B 4C3UA 3C6YA 2VL7A 4XLLA 3LAWA 1U8FO 1JR3A 3TZ6A 3PA8A 1VL6A 5E3HA 5B4UA 1KMHA 2VPZA 4Q1BA 3WOVA 4ACBA 4DM4A 4HPXB 1JRLA 3AL3A 3WJAA 1K3TA 3GJRA 5BO5A 4CQMD 2WD8A 3CNQS 3SJBA 4BEVA 4CMBA 5JAPA 3DZGA 1KKLA 1P5HA 1PGJA 4R0VA 3TZQA 3WLHA 1GYRA 1DTWA 2A3NA 3BMNB 2OHOA 3CZQA 2QX9A 5FHQA 1R15A 3IUMA 3FGPA 3IUBA 5FJIA 2J67A 2VUUA 4IDDA 5HDQA 2AEFA 4TXMA 3X1DA 1I1NA 2A78A 2GI4A 2ZSIA 3I30X 3LQ4A 5EIWA 2FZ4A 3H0KA 1GHTA 4MI1A 4R4JA 3QP9A 5T3UA 3ADBA 1T6XA 3T38A 3ITNA 3QFTA 1U7HA 4KV9A 221PA 3L8EA 5C1PA 1O97D 3ZWBA 1EFHA 1T0BA 4BFWA 1LW6E 3CNLA 1V2HE 4XRRA 4PWZA 5KTTA 3RYIA 1PK8A 1NIJA 2IIPA 4I9GA 3T1HB 4U2CA 5IT5A 1CY8A 2F3QA 4WN9B 3VX3A 2JD1A 2XQJA 4PE5B 4YV7A 1ZJ5A 4F3RA 4CN8A 3O4GA 1CQJB 4PSVA 1ZM9A 3KFVA 1A88A 1OXBB 1X15A 2DHQA 2KJQA 3H4VA 3LUAA 2PKXA 2F3SA 2VF7A 4IRXA 1KRWA 1Y5IA 2BTQA 4B34A 4C04A 3INYA 1J5EB 2SECE 3DE2X 2HLNA 3EMDA 1B8NA 3WZ2A 4DXAA 3ENNA 3IVMA 3FYTA 2HKIA 3RUDA 3KSZO 3KSDO 2ZJ2A 1KEUA 2OK8A 3PXCX 1E79A 1P33A 2KB0A 4HMQA 1QSGA 4B7AA 4DJDC 3UPDA 1F12A 2P9YA 4KBFA 5FTNA 3L8FA 1O4WA 1P3Y1 2ANBA 4R31A 4B6OA 4OQYA 3LDHA 3C0KA 2W8ZA 5DKFA 3ZDEA 1Z0FA 3UXHA 2ZVPX 4WD3A 1Z2OX 4TZKA 3VYUB 2XMGA 4QXOA 1GZ4A 2C5BA 1KQGA 3Q8WA 4OJQA 5AVJA 2OEPA 1WTCA 2WJPA 2VKQA 3RH0A 3OPYA 1YK1A 4XGQA 1DXOA 3KB8A 3R7WB 3R8CA 5F78A 5B4TA 3FBGA 3ACDA 2YNMC 1PV2A 2HMYB 4HBGA 5ER6A 1Y8CA 4XFKA 4LQCA 3S2EA 1FDVA 2IODA 1Z2AA 4J76A 4NNPA 4RGQA 1Z7YA 2CZQA 1EXNA 1F14A 2R5WA 3P9CA 4O2AB 2Q3LA 3NORA 4TSKA 2AC2A 5C35A 2JANA 4WJZA 4YP6A 1A8PA 3M5WA 4QQ8A 2FSVA 2Q3FA 1T4CB 1VJ0A 2XT6A 3EVBA 4TTRA 2FMTA 3QBTA 5AKHA 3TBKA 4EJSA 1AHHA 1MOQA 3CIOA 4RHEA 5EJ7A 2XVMA 3A27A 1GUBA 1XTPA 1Q7BA 4BFUA 3IEUA 4AC9A 1L5WA 1HLDA 2EVWX 1SC3A 1Z74A 4TZTA 1OREA 3U4DA 1N6NA 3OIFA 4F5EA 5JBIA 4YC7A 1EX7A 4DR5B 3FWZA 2DFDA 4GMHA 4WOCA 1GTRA 3QYPA 4C7JA 3KYCB 3U39A 1SCBA 2EYQA 5JAOA 5T67A 5AW1A 3SQWA 2POQX 3WYDA 1VL2A 3OIYA 1ZM4A 1T3GA 5KDOA 1DIRA 3FVWA 5JFGA 4FUQA 2QRVA 3C2QA 4I2VA 1DDOA 3V8EA 1WY5A 2OGZA 4LWOA 3W8NA 4KO2S 2CWDA 1PU2A 4C5BA 4QQFA 3HKCB 4ODIA 3W04A 3OP4A 3T7AA 3GX1A 2UUAB 1SUAA 1FMJA 3GH1A 3T4UA 1EBBA 2QG4A 4JOSA 1O8BA 3DDOA 3DFFA 5JW6A 2XSZD 5JMPA 3MT9A 1W73A 3G2OA 3OLQA 4MA0A 1ECFA 3LLMA 3LVRE 3VC1A 1Z8DA 4AKTA 1SCKA 3M33A 4MHOA 1V6SA 4Q6WA 5CLGA 1E1MA 1YL7A 1I2MA 3AY6A 4PINA 1DC8A 2PX2A 4YEDA 1FTGA 1R0WA 1E9BA 4MYCA 2P4UA 5LQMA 4ZCMA 3QVGA 4DDUA 1XRJA 3N75A 1L4HA 3ZXXA 2DKNA 3ESBA 3KXIA 3MGAA 3PIIA 5TQ2B 2A9FA 3SIXA 2OCDA 2HSWA 4M89A 2P9QA 3HQ4O 3ODGA 4IIUA 4TTQA 4QICA 1K5HA 3RO7A 1HL7A 1HY3A 2DY0A 2PU7A 3E15A 2DCMA 3ND5A 4MR7B 5GV7A 3EBLA 3SEQA 1E2LA 1O6FA 1PUIA 1L7BA 1SC9A 4NY1A 5EYPA 2VAPA 2Y1KA 3OZEA 3SQDA 1MAVA 3TLGA 1C9YA 1S7GA 2B5VA 2IVFA 1T9KA 3KE9A 1JHZA 1B76A 5LA6F 4HT3B 5UKDA 2D4HA 1NVEA 2O57A 3D3QA 2HBQA 5CA1B 1HNXB 3DKIA 1Y42X 2QRPA 1U0LA 3AH8A 4TSFA 3C8ZA 2C59A 2CXQA 2QAGB 1YDHA 4IDAA 1BKYA 1X1DA 4MW4A 4S0XA 5ARCA 5IU6A 2W0MA 3LM8A 5G0WA 4P7BA 2F8MA 1Y3IA 2OQ2A 4M0EA 5KYXA 4AJ4A 1X80B 3TJRA 4BGDA 3F6BX 4Z9YA 1CS0B 5HS4A 5FCDA 3ROZA 3PF9A 2R8YA 4ILKA 3DO5A 1UKZA 4ND8B 1GZ5A 3ZBTA 2HLHA 5FRDA 4HSEA 4TN5A 1LJ8A 2XOKD 3U2QA 3GLHE 2ZWIA 1CRQA 4F8JA 3CUUA 1V8ZA 4ASUA 2HV8A 1NASA 4MV6A 1WXDA 4I1VA 1Z22A 3RSSA 5HS6A 3DQZA 2WFLA 5DHTA 3A70A 4X1KA 1PE0A 2IUTA 3D5TA 2EP8A 3OEYA 4PLGA 3O8DA 4PXSA 5IK2A 5T5QA 3QUQA 1DX4A 1YDWA 1G291 3DVSX 2R6AA 2WZQA 3EGXA 1M2NA 1NVDA 2OZLA 1XALA 2FSVC 4R2LA 1UKAA 3ZLBA 3HCDA 3IQXA 3MAAC 5IMSA 5B2FA 1Z7EA 3QLTA 5CT6A 3JARA 5KI6A 4MW7A 4BJ1A 1ECCA 3M1IA 4HZIA 1VE1A 1QFZA 3I09A 1XZMA 2JLRA 4OOEA 3DE6X 1WPQA 4IRMA 1V5WA 4IJQA 1KZ9A 3H1EA 2VK4A 4IIXA 4CKBB 2V7QD 4OMCA 3RS8A 1KBQA 1MXHA 3WZMA 1P7VA 1NF2A 1AS0A 3KXPA 2O50A 4MS3B 4RE5A 1H4SA 2AOUB 1B14A 3I4FA 3IUNA 3OE7D 4Z4GA 2ZBEA 3E61A 3A6ZA 1N2ZA 4KACA 3MB5A 4A8JA 2VRNA 3NG1A 2Q1XA 3NNSA 1SOAA 2V6GA 1LTHR 3DDUA 4I5GA 2NGRA 4TKVB 3SX4A 4DA8A 1ISPA 3ZZ1A 2CEAA 3AF1A 1QLHA 1U0RA 2QX7A 3OLYA 1ZRSA 4HY3A 2O0JA 3B5EA 3KJZA 1TCUA 2CBXA 1S5PA 3F5QA 1CUXA 3U3ZA 1KOFA 1E7WA 3NXSA 1GPWB 1J0XO 1VHDA 5TX7A 4DIDA 4DIBA 4IO1A 4MQFB 2NVUB 3RKUA 1U6JA 4B44A 2HRBA 5IBRA 1P6XA 2J09A 4F0JA 4BUCA 2N47A 3SKYA 3AZPA 1QVRA 3RLFA 5LVAA 3G2QA 1C3OA 4BL5A 1QH8A 5JC8A 5KNBD 2ZI9A 4WESB 1U4OA 2XKKA 5J9FA 5BWNA 4QXRA 2G08A 3D7LA 4NJEA 4MINA 3JWEA 2HCTA 2EYUA 1F8XA 1X2EA 1XLTC 1BRTA 4EKDA 3HNPA 3ZV7A 3U5TA 5AK5A 5DK4A 3H5OA 1PYGA 2W6JA 2B2CA 6PFKA 4FZJA 5DH9A 4YIHA 5HSGA 1P9RA 5A0VA 3H19A 1V4BA 4ZV9A 1Q21A 4M49A 3O21A 5JZOA 4RM3A 3CWZA 1C3JA 3E4DA 4EHLA 4G1BA 4ZGGA 4JJEA 5EERA 4PNPA 2F4VB 1RLOA 1GNTA 2XNCA 3FFWA 5C53B 1UIRA 4ZEOA 2KHZA 1N8NA 4JGIA 3BAFA 3DNFA 3B1WA 5F2EA 3DQPA 4MP6A 2ZCUA 4R54A 4RTJA 3O2NA 1NBEA 2PS1A 3H9BA 1ACJA 4B8ZA 2WHEA 4H77A 4EECA 3FHLA 4OXNA 3IESA 1P2TA 3AFOA 1FYXA 2XVXA 3KU4A 4X85A 2IYTA 2PTHA 5K4GA 5M29A 3A6FA 1B26A 2CJPA 4O2RA 3OKPA 2ZZNA 5BQOA 1E99A 1Z56C 2JVJA 1Y8RB 3MD0A 2OO5A 3WE7A 3E0QA 4II7A 2ZJ5A 4IJUA 4BKRA 4DMKA 1FYDA 3WAGA 3D8UA 1JGTA 2ZIXA 5DLYA 2WHPB 3MXOA 1M6NA 2WJYA 4E2XA 3T5PA 1ZMXA 2X4DA 1BMQA 3Q7SA 1AO3A 1DG3A 3KTDA 4K8RB 1DRJA 4Z9XA 4XGKA 2QY6A 1E98A 4Y2SA 3U7GA 1FS4A 1EVJA 1R10A 1U9IA 4A6DA 1MC4A 4PIPA 2E6UX 1PWHA 1JQAA 4YAOA 1ZCJA 4B4DA 5E7MA 1SUIA 3TXAA 3ZWQA 4R8RA 4AZ3A 1EFRD 5CLJA 5IF3A 1GGNA 2DKFA 4KQGA 1DE0A 3AIMA 2HQSA 1N6RA 2HMAA 1XHFA 4B3CA 1FSFA 1E3EA 4D46A 2VN8A 1DC3A 5L3QB 4H16A 2ONYA 3X1KA 3H9EO 4MCIA 3QXSA 5EAIA 1D5WA 1RRFA 3A31A 3I45A 4IICA 3O26A 2BGKA 3R3UA 3T3NA 2YHUA 4B43A 3OJWA 3UK0A 1UL1X 3NOOA 4XIIA 1VMKA 5CX4A 1N2CE 3TIGA 3W5JA 4YV2A 4YHHB 5LQNA 1CUYA 1ZYUA 1OSNA 4JEMA 1JJBA 4X84A 3PG5A 5HE9A 3UANA 1E8MA 2H63A 2V9PA 3M81A 1ZICA 5E7IA 3KG2A 3TGPA 3DZ8A 5IM4F 3CS3A 2X0KA 1Z7WA 4NK4A 1N0UA 3CZ5A 1CRLA 4N18A 2AW5A 4FSXA 3PQ4A 4OL9A 1BKDR 5TQVA 4A8JC 4ZYXA 1YO6A 4OJNA 1K88A 1C8KA 3AERA 2UUBB 4UNSA 2QD5A 1XDWA 2XMQA 3T1VA 1L7RA 5SY9A 1ADBA 4POAA 1KMQA 4YJFB 2CV2A 3RADC 3HB0A 1BXGB 3F6EX 2FPSA 4XVQA 1W9MA 1F8YA 5KO2A 1EVQA 1NJ2A 2G9UA 3KDAA 3PUHA 3KALA 3OAAD 3G13A 3G82C 4X97A 2OB1A 3TI7A 3UH0A 4EVQA 1U1CA 4N3CA 4P32A 1FDIA 2OESA 1NDUA 3DEFA 4DEXA 5DNDA 4EO7A 1Z45A 1Y98A 1HLPA 2PXCA 2QSJA 3OFVA 4X8OA 1NG9A 5DOZA 2G8LA 1XYYA 4GRIA 3E3NA 3EE6A 3SGLA 1HYHA 1OAKA 2REQB 5B1IA 1K7SN 2MOKA 3GXOA 1IXYA 1N5DA 2IDJA 1JEOA 4CR6A 1I4EB 5DT2A 1DQYA 2JZOA 5IS2A 1LDEA 4CM4A 1QYCA 1Z0JA 4GDMA 8ATCA 1WXIA 2LD4A 3N39C 2IW3A 2VHUA 3SYTA 1KDYA 3VU0A 5IKXA 3PDHA 1BEUB 1LWNA 1YI8A 3MTDA 4QQRA 3N8DA 5EXSA 2Q0QA 3EXFA 4KIWA 2M6LA 2GJ8A 2UU9B 4M9ZA 1PAUA 3I39X 4JT8A 1C8VB 2Q5OA 3D3KA 1K08A 5DXFA 1IN7A 5EEGA 3RGGA 5H4HA 4U0JA 1AKTA 3JYLA 1M8FA 1NN1A 5DCUA 1R0ZA 5GPBA 2OQVA 1ZOPA 4L74A 4HGNA 1KI9A 4DVJA 3DJYA 3VPBA 4FBMA 3W6UA 2IYUA 3BA6A 4B09A 2VDUE 1NMYA 3I8OA 1HLFA 4UM5A 1PZMA 4KIJA 3WV4A 2YY5A 3SQMA 2JB9A 3L0CA 2OO5C 2C0QA 5KYUA 4R6WA 2P77A 4E03A 4B6GA 1UC9A 3V48A 2C98A 1W1IA 3PQ8A 4IFIA 5DX1A 5HKKA 3VKHA 3EG9A 4W5QA 1ADGA 1B4DA 4MVJD 5COQA 4JL8A 4TUYA 2J0VA 1U9IC 4QSMA 4C08A 4HUTA 5KVQA 2VDJA 3CSSA 4G26A 4JI1B 4FOPA 2LDXA 1JEQA 1I3KA 1ST3A 4BRZA 5JS1A 1L8LA 3JTEA 2OKCA 2XDQB 3Q7IA 5THQA 3R4VA 1SVKA 4R5HA 5BQPA 1ZD3A 2OBNA 3VXKA 4C05A 1E94E 4DQUA 5IUNC 5LIPA 1G2QA 5BMVB 2JC3A 1U8CB 3J81k 4QHYA 2QN3A 1JHDA 3EXEA 3FDXA 5HOQA 3FFTA 2PE5A 1Y9EA 2XJ9A 2E21A 3R3VA 5EVCA 3C15C 1JH8A 3CH6A 1KWKA 5L95A 3FFAA 1ONPA 4IXTA 5GGXA 1L7QA 5EJ9A 1JN0A 1XZDA 3VZPA 4PHHA 1JEAA 1CJTC 2BR3A 3SS9X 3SR3A 4BNFA 1L5QA 4F6RB 5DNAA 1LQTA 4KNVA 2AS0A 2NVBA 3NBZC 1YS7A 1PZGA 2FSIA 1H3EA 1WP9A 3AUJB 1YU9A 1T24A 2G1UA 2VNJA 3QX9A 1YBVA 4IXMA 3TEFA 2I2DA 1ZH2A 1VPLA 3L8CA 1AN0A 5JJKA 3PLNA 4LVNA 1P5JA 4MKHA 3DBHA 1TCAA 4V03A 5A1TA 1TF5A 2PQ0A 2NN3C 4Q21A 1AKVA 1D2HA 2QB5A 3FYCA 1NY5A 2V9CA 4I4TB 5DWDA 4ERNA 4RMGA 4L72A 1O4VA 1YQ9A 4PBRA 1FNSA 3JQRA 4CLOA 2JLAA 4EKGA 1Z7BA 4AWBA 3K92A 2DLNA 2ZVQX 4RTPA 3ZQKA 2VDWB 3H11B 3QLUC 3RVMA 4LXUA 4P35A 3VOSA 4BCDA 4XQEA 1S2LA 3K9HA 4X7PA 3EHDA 3O4VA 5EHIA 4DT1B 1KP9A 3HZRA 3BUSA 3I5AA 4G5SA 3JTMA 5DVZA 2H7YA 3OFJA 4YRQA 5FWYB 3U4CA 3V6MA 3Q7TA 5CFLA 2C9DA 4FX2A 4XARA 3IA7A 4IG4A 5AI5A 4TQUS 1L1RA 3D8RA 4MW9A 4KXNA 2C8KA 1WMSA 3RIHA 3RC8A 1RKVA 4K6OA 4A27A 4D97A 2E4WA 5EA2A 3PPVA 5EQDA 3TQOA 3UJ3X 1UXGA 4UM8B 3RVBA 4P5DA 4ZVQA 5KTKA 4FJ2A 3HWRA 1LDGA 2IZOA 2BKXA 2Y3IA 2QJRA 5CNJA 1UP6A 4Y9SA 2VP3A 5BYJA 2GDZA 4DHWA 4L0DA 1Y7LA 5K8IA 1IOLA 2G70A 1NP6A 1TD9A 3OOHA 3DS8A 4Q12A 4CM1A 3BDAA 1RWWA 5EEHA 1TGYA 4MV4A 4EELA 1NYTA 1V25A 3FSRA 4JBGA 1LPOA 1YRAA 2PS9A 4AMZA 3M3HA 1U5BB 2AVNA 4W9NA 3PL5A 4XJTA 4ZPXA 2FPIA 5LQRA 3BHMA 2ODEA 2NU7B 2XEDA 2JGMA 3H9QA 3DCJA 2BDTA 2BI4A 4X71A 1G0NA 2ACWA 4JB0A 3O7WA 1J2JA 5ILGA 3ZU3A 4L7VA 3D6HA 2WT9A 3KJEA 1CETA 3BMXA 1YGYA 4U7FA 1Y1QA 2GPSA 1J2RA 1A27A 1EBFA 1JZTA 2AX3A 1E59A 4GPBA 3ZDZB 1U9YA 4U3JB 2QU8A 1O6CA 4AF6A 2PY6A 2D1FA 3A6HA 3QV2A 3ZE2B 4HGZA 1JA0A 3IDSA 5E3JA 2HGZA 3O93A 1ZJZA 3K1ZA 4FNMA 4ANFA 1SEPA 1IQ0A 5LJIA 3NASA 2LE0A 3UFXB 1XMSA 2JFXA 3HY6A 5IZ4A 1PR2A 2BV3A 1Z08A 1CVRA 4IWXA 4REQA 5F2NA 3CLRD 5T57A 3LQYA 2AN3A 3OHPA 5BYKA 2FKAA 1R8QA 2PPLA 3M4ZA 2VCHA 3SDSA 1NDQA 1CUEA 2ESRA 4HDNA 4QUBA 2KBFA 4OQPA 4WERA 3W05A 1R0BA 4DDVA 4MW6A 4HADA 3D0OA 3WJ1A 3EZ2A 3KKZA 1ZSYA 1TIPA 3D02A 3WHPA 4KBGA 2A1UB 5AI9A 3FB4A 2HHHB 3BT7A 1WABA 1VCMA 3M6VA 1PT5A 4YXFA 4N12A 3UJNA 1KAQA 1VSVA 4RU1A 2ZJYA 5F98A 5K0NA 1ISFA 5ALUA 2EDCA 1MQSA 2R7AA 4LMPA 4YAGA 4AM8A 3WMFA 5EE1A 1DEXA 1B8PA 4BO3A 4GIBA 1W5SA 2PL9A 4C6RA 1Y6FA 3CCBA 1Z35A 2D1RA 2H2FA 2FWIA 5C8YF 3GDHA 4FPXA 3SZUA 4WLFA 5TMDA 2O2EA 4XJVA 4AY5A 1QC5B 1UP7A 5KYVA 4CLRB 4J0KA 4RS3A 5JSQA 1YZUA 2XHZA 1W9HA 4LTDA 3IQHX 2V9ZA 3TLMA 5LZ4A 4J6FA 4XD7A 5DM70 4M0CA 2OG2A 1USWA 5K3SA 3B48A 1V8FA 2AJTA 2JBAB 3MFYA 3RWMB 1TC1A 4Q37A 2NU9A 3JRWA 1OLOA 1U3UA 1GT6A 2OCLA 5L7WA 1USVA 3ZE1B 2CXPA 4P82A 2FLKA 3ZU2A 4R98A 1R5JA 4OQDA 5MGNA 4JB3A 1HT3A 1NSYA 3D6VA 3DV0A 3KCQA 1G2PA 3KQVA 2R97A 3ZVLA 4BVGA 5C5CA 2P9EA 4X7RA 1TYAE 1P73A 4RVFA 3GLUA 4ZCSA 3BRWD 3RG8A 4MV1A 4EAQA 1SURA 4XA8A 3SE0A 1OLSB 4IF4A 3OT4A 3GJ7A 1NF9A 3SDZA 1SELA 1M83A 1PLKA 3AUUA 5DTQA 3C3JA 1DKNA 3G79A 4IVNA 5H82A 4OXIA 2IE0A 1WX1A 5HIMA 5TNXA 3TSAA 4M60A 4Z0TA 4C3ZA 4OXQA 3EPPA 3PC7A 2IDMA 2B1GA 3G2JA 3DDHA 2PHZA 3KVRA 5BWOA 2PUEA 4PTLA 1U0OC 4KB5A 4Q34A 1IRXA 3FOBA 4AJLA 3HXKA 4JROA 1ZC4A 3B3JA 1L5MA 3Q88A 4R16A 2FDXA 1RWXA 1M75A 1W2GA 1UWVA 1KMHB 1TKBA 2HYDA 4FOLA 1KDTA 4IVRA 4O0LA 5JPDA 5E0KB 3R0QA 2J87A 4F2DA 4W9NC 5LBIA 4JEIA 1T1JA 2COUA 4DPMA 4UREA 1GA4A 2AFIB 1K5DA 1XROA 1DTWB 4GUAA 2BMFA 3QWIA 3P9NA 3U1VA 2PMDA 4ZAXA 4BQRA 5LP6F 1Y6GA 1E9DA 1VECA 5LR6A 1W52X 3P32A 1XQYA 3STHA 5DFAA 4RAQA 1GCUA 1C80A 1G3MA 2OT3B 1RLMA 1TU0A 1YQEA 3NNDA 4PGHA 3FCCA 1LQUA 3ZGOA 4A36A 4PHGA 1IDN1 1PEYA 5I7EA 1F2DA 1T5BA 5D5PA 4OHBA 4I46A 3RYIB 2UYQA 3PXXA 2H2IA 2HC9A 4E31A 5K8UA 3QIVA 3W2EA 4QJBA 4OLJA 3N0VA 2GO1A 4OK6A 2HO5A 3I9OA 4NBVA 5LQJA 5G02A 2JLUA 1EE1A 3DLCA 4I1RA 2QTNA 3LT1A 1IDOA 2XI4A 1ZGZA 4CMJA 1Z62A 2HA2A 1WO8A 3C74A 3R9WA 3LQ1A 1NI3A 3OEED 1WDTA 3I92A 4LDAA 1S8OA 4HDKA 4JJ6A 3ZE8A 4C88A 4J9VA 2PRYA 2H07A 2CHEA 2BTQB 1E6CA 3I3SR 2BR4A 3EFBA 4YCLA 1WNTA 3KHSA 4HQ6A 1YQDA 2VWPA 4JQSA 2W8BA 1KJNA 2XTNA 1G20B 4F11A 1RQNA 4F3CA 4MR9B 2OZVA 4CE6A 2JJ1A 3FUTA 2BZSA 3ZH9B 4JZYA 4FR5A 4G4IA 2ZKIA 1AK1A 2J6HA 2MJLA 4X3CA 4B3XA 1SXPA 1XTQA 2E4UA 5B6PA 4LGCA 1JG7A 4XPZA 3IA2A 5KNCD 4QYXA 1W6RA 4MJ7A 2ZR0A 4Y2QA 3DBVO 3W79A 2H85A 3G5MA 4AJ2A 4CIVA 1ORVA 3E3LA 2WE8A 4YWJA 1T3HA 5F2OA 3P9SA 2VO1A 3OPYB 4P38A 1AGYA 2ZSAA 2FG5A 2NTVA 3C3WA 1ZMBA 4JT2A 1DKRA 2DHEA 2I4LA 3P71T 3TAXA 4IGIA 1Z17A 1OXSC 2AK3A 3OT1A 2XKAA 3VDMA 3FPLA 5CDFA 4P81A 3PXEA 1DWUA 1H6CA 3CVJA 2QTCA 1NUAA 3H8JA 4B3DA 4ZHQB 4RABA 1P2GA 2GBLA 5IM5A 3LDUA 521PA 1GZSA 4FEGA 1TGVA 2CHFA 3IV9A 4N5LA 4HNAA 3X1WA 4C5AA 2PTGA 1PGPA 1QDUA 2VZ0A 4WECA 3THYA 1JQBA 4ZAVA 3HA3A 4U7WA 2VXCA 1YB7A 5BWMA 1PFKA 2CXSA 1PS0A 1HKUA 4G9BA 4WZZA 1C3EA 3BBPA 2P3SA 5JDCA 2XGOA 3OZFA 4P4UA 3ESCA 5HIJA 2F1KA 3TZHA 1SRQA 3TKLA 3SQOA 4B74A 3HFGA 5KJ6A 3H7AA 1KYTA 4DAEA 2PBLA 2VTDA 1H2AS 2QRVB 2RGDA 3LA6A 4OMUA 4RHCA 5TY0A 3CX6A 2PBFA 2Y99A 3AEQA 3MD9A 3QFFA 3ZGNA 4W82A 1I3OA 1WKVA 1J06A 2GYWA 4XJSA 4GW3A 3ICEA 2EKBA 4RKRA 3S70A 3MMPA 2O3TA 1J2TA 4V0MA 5F5NA 1M8GA 2YHSA 1JQ3A 4FZ3A 4GEKA 4PNHA 1ZAYA 4O5AA 1Y5NA 3ADKA 5E6RB 1JI3A 4FYIA 1OX5A 4EHJA 4K6FA 2YR0A 4EHBA 1YT5A 4OHXA 2C3YA 2XYGA 4LZLA 1H2RS 1P7PA 2VJNA 2WSMA 1GGKA 4BC1A 4MCJA 4QUHA 4FFVA 4WZBA 5A4JA 3TG8A 1G42A 3ONVA 3QVGB 1YKFA 2W6CX 3W2TA 1ZEJA 3R9XA 3FFXA 4H59A 1BN6A 4L4YA 3K0HA 1L1QA 3E53A 2EJVA 2BZ1A 1DAMA 1A9TA 2B7BA 4EGAA 4ERXA 1KEKA 4XR4A 2FX5A 1FW8A 3E6AA 1N9KA 3HBFA 5DLQC 4NZMA 3F3SA 3COYA 5EYPB 2B2NA 4IV8A 4EA7A 1AS2A 3QVUA 3EIQA 3EDYA 5DU2A 3TLGB 2QF7A 3O8OA 4MYSA 4JVLA 4PZLA 2DHCA 2IF0A 1ISSA 1QF9A 4IJMA 2RHTA 3GCXA 3MJCA 4JVMA 3RFXA 4CF7A 3AO0B 1AMOA 1XZPA 2VPTA 4QU9A 5AHRA 3K2EA 2R48A 3GMSA 2QNIA 5DW0A 3WLNA 4PG4A 2FMKA 2IW1A 5AW5A 1E3MA 2Z43A 2CLOB 2H65A 1TFRA 1XKQA 4FWTA 1Z0ZA 2JFFA 3GLSA 4J1TA 1EM6A 1MJHA 1C3LA 1HTWA 3PQ3A 1G5FA 4J29A 4F38A 2FG7C 3MPUA 1ZUNA 2CN1A 5LYJB 5BR8B 3B2QA 2FZCA 2W2LD 3RUHA 2ES4A 1FJGB 1YQQA 1EFVA 5CH5A 2WUFA 2F67A 3LHFA 4G0OA 4R9RA 4RETA 3SXUA 5KQLA 4EYOA 1ZCBA 3AB3A 1Q1ZA 1J09A 2QD2A 3OFNA 4L27A 1CS4C 3RIMA 3ZVNA 1HE5A 1N1MA 2RIPA 3AB8A 2HU8A 3AF4A 4W5JA 4GXNA 3RC3A 2PFSA 4LY0A 5DM2A 1XCMA 4HVAA 4DANA 2QMZA 4LXXA 4X1KB 1G9SA 4JV5B 5B12A 1YTLA 3BFVA 3DHNA 3GYGA 4UUAA 5B7GA 5CDFE 2WRZA 2FZVA 4IHJF 2V7VA 2ZSHA 4L8GA 3EGXB 5E6UA 1QVAA 4E5DA 2YVKA 4ZVRA 1CJBA 1MHPA 3UTCA 1W4CA 2C29D 2GBLC 4QTTB 2Z6UA 4OHOA 2R751 1IXRC 1R0SA 1RADA 4RBNA 3OQMA 2XIQA 4NBRA 1RAIA 3C5CA 3HWSA 3KSUA 1SCQA 5A4DA 2IUYA 1OT3A 4EW3A 5LU9A 2PR7A 1S9DA 3L43A 4TXNA 4U6NA 3UG6A 2FEXA 4C7BA 4MHTA 2FZWA 3OCCA 1HZZA 3H5VA 1QNFA 1RVDA 1W5EA 2ZSJA 5JDCC 4A8JB 2BCJQ 1W5TA 1CIPA 1EK5A 2ZLBA 3KB6A 3ORRA 1U8AA 5AKLA 1QJCA 1C7FA 3JQDA 4LDQA 2PSFA 3KTOA 1W49A 2XWSA 1KEEA 3N76A 3IMEA 2P1ZA 2H11A 3OECA 4HDSA 3U3OA 1OFVA 1OUMA 1T1SA 2D5BA 1PWEA 2GXSA 1HT2E 2PKRA 2WTNA 3G5AA 4GE0A 4NHOA 1H2FA 5JH7A 3OH8A 3I1JA 4BLOA 2ECFA 4FGSA 5C4IA 2P9HA 3DT6A 3N7AA 2Q9CA 3NHWA 1GQ2A 1QX4A 2X1MA 3KQNA 1C3OB 1EDBA 1Q1BA 1QH8B 2Q0SA 1ECLA 2QJTA 2XMPA 4I9FA 2J3JA 3JXEA 1DQPA 2BHTA 3CEHA 2RI1A 3FDFA 3RHSA 3I4LA 3FNHA 4WNAA 1T0JB 4UCWA 2F3PA 1RD4A 3T6KA 1I1OA 3AHGA 3ZZMA 4RTNA 5FWDA 2VDOB 3EZNA 3PQDA 3ZTTA 4L6CA 2RGAA 1QIFA 3LKVA 3BB1A 3K8QA 3VR6H 4BV9A 1NTRA 1P45A 1UC8A 4PSUA 2ZT5A 1NR7A 4NXNB 3ABSB 1YQTA 4QFMA 3K9NA 4A26A 2WG2A 4W5TA 3LWBA 2FEOA 3G2MA 4KAFA 5CFRA 4RMIA 2C5EA 3M9LA 4IIJF 1D09A 2QTMA 2R68A 2YNMD 2YIVX 3B51X 1YQWA 4B7ZA 3DWIA 3G8DA 4FGJA 4HWGA 1JECA 4XAQA 1DPFA 1ESDA 1RP7A 1IVSA 1GN9A 2BFPA 2EBHX 1MX9A 3E8MA 3RC9A 3TXXA 3A6LA 1XYGA 2GPNA 1L2TA 3FLBA 2AFHB 1LBTA 3LH5A