2ZRGA

Msreca q196n datp form ii'
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
326
structure length
309
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRETGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 76
structure length 309
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrgA01
4PFSA 3GLHE 4TLAA 3EPKA 2EFDB 4HAXA 5JI2E 3CR8A 2R9VA 3GLGB 1VIAA 3D8BA 4B2IA 4GDFA 3CNOA 3ZS9A 2QRNA 1YRAA 3UG6A 1E1QD 3NEJA 3CPJB 4JJKA 2OFWA 5LBIA 5JWRA 3CNNA 4ZI2A 2JLWA 2ZE8A 3UMRA 2ZI6A 1WB9A 3C15C 4ASUA 1FQJA 3A1SA 2XZOA 1WBDA 1Z28A 1OFHA 3VNUA 3EC2A 5G53C 5J4KA 4AY2A 4GRAA 1TPZA 2GXUA 2JCSA 3DDCA 3SJCA 1PUJA 2JJ2A 4EJSB 2PMDA 2P5TB 1I4TD 5KOYA 3GLFB 3K70B 2IUUA 3QPVA 3PVSA 3U7FB 2QT0A 3KXKA 5A0FA 5TVKA 4PQFA 2R6AA 2IHBA 3PFIA 1TF5A 2KSQA 5L3SA 4NL4H 2OSBA 2FOLA 2IYYA 3A1VA 4RZ2A 4EPWA 4D80A 1VCMA 2VPPA 1LB1B 5HTKA 4BLTA 1TQ2A 4UNRA 3L0SA 2IXGA 3CX6A 3WYGA 5JSZB 4KFTA 5IK2D 2GA8A 4PXAA 4TTPA 1OFIA 5FPSA 1LY1A 3A8TA 3MJHA 4OHVA 3KQHA 5F3WB 5CB6A 4KLNA 1W49A 1M7HA 1T3HA 1G7CA 1UEJA 2VF8A 5FPKA 3KKPA 1TUEA 4H1UA 3VR4A 5HZHA 3CZQA 4LWZA 3KUCA 4BFWA 3B2EA 2YWFA 4DB4A 4WW0A 1Z47A 2QI9C 3K0AB 4ESHA 3I32A 1EFUA 4HB4A 4W7SA 1W7AA 4CW7A 3B6EA 1OXVA 1G64A 3SDZA 2ZUDA 3FHTA 3LW8A 3EASA 4IEIA 3A6PC 3DKPA 1Z2AA 1E9SA 2VP5A 4I4LA 4RD3A 3TVTA 1LTQA 2ORVA 1Z0AA 2MSCB 3THXB 4LHWA 3L2OB 5AJWA 1TADA 1T3SA 4NDZA 2YNMA 3VKWA 4QRHA 2ZRPA 3M4YA 5J4HA 3SFVA 2HF8A 3AKEA 3LY5A 4PAMA 1ZNWA 2YVUA 2ZJ5A 3NKVA 4LDJA 4AD8A 3EPJA 1KI6B 3WNBA 1IN7A 1YJ5A 3RABA 4L8GA 4QOSA 1JI0A 1RZ3A 2GZAA 3VTKA 3GLFE 3TUIC 3CONA 5TV2A 1VDZA 3UG7A 3EX7C 3LH5A 1JPNA 2GEUA 2YYZA 5J47A 2W6ID 3K0AA 1Q22A 5EZ5A 5G3ZA 3AP1A 3QXSA 4E07A 2ZE5A 1AS0A 3U3RA 3CM0A 2ZAOA 1NVWQ 1E4VA 3IGFA 4QXAA 4Q47A 2AKAB 3LBIA 3T5GA 4MDEA 4A2QA 3NEYA 4C3ZA 4URZR 2QPOA 1FOEB 2W00A 5GJBA 3TKLA 5HKKD 1OSNA 1EG7A 3BC1A 4MGKR 2DPXA 2V3CC 2EWWA 1FTNA 1W4CA 2ZROA 1W4BA 4NYJQ 4QHSA 4IDNA 3DOFA 1DAMA 3PUYA 3AVQA 4F4IA 1N6KA 4RY2A 4IDHA 3RS0A 2JJ1D 1X86B 3IILA 3MFYA 1PLJA 2IEYA 3U4QB 4HAVA 3U44A 1OXXK 2IYRA 4UJ5A 4HLUA 4HUQB 2ANCA 3IUYA 3N2IA 1N0VC 2RB4A 1GNRA 2A5GA 1EWQA 4Z51A 2NO9A 1XXHA 8OHMA 1SKYE 1D2NA 2OBLA 4RCYA 2BCJQ 3NDPA 4JKYA 5H1YA 1SKYB 4FIDA 4HZUA 4LRWA 1D9ZA 5FBVB 1E2EA 3AUYA 5CB8A 3L0PA 2X2FA 2Q9AA 1IN6A 5FFMA 4EDHA 1RIFA 2Z4SA 1CKEA 2FNAA 4BUJA 2OAP1 2JIZA 3ZVNA 1FMLA 3VR6A 1OIWA 2GAAA 1E2HA 2Z0MA 1R10A 1UBEA 1HE1C 2PT5A 2ZJ2A 3F0TA 2BC9A 3SS8A 2IA5A 3T06B 1N3BA 3ZH9B 4PC6A 5SZJA 4BFZA 2J45A 3N5CA 5L3QB 5EUQB 5JS7A 4WOPA 1X1RA 1DAHA 2FV8A 5E4FA 4M21A 1K5GA 2CVFA 1J99A 4NYMQ 4KFSA 1M7BA 4PSVA 4YONB 4PPNA 1A7JA 1T91A 2E1RA 2GXAA 1E2MA 3AQ4A 2QENA 1RRCA 1KSFX 4Q1AA 2JAQA 3N70A 2BMEA 2JDIA 4BZXA 1UDXA 4MITA 2DB3A 1U98A 1E0AA 3K0CA 4YMSA 2Q21A 3FMFA 3EA5A 3L43A 4HB2A 1LNZA 2C95A 5CIWA 5E3HA 4EQ6B 3RRYA 1MH1A 4LYJA 4CIDA 1SXJE 2WBLC 5FL7A 3CF0A 1CEEA 3A58B 1JAHA 1QF9A 1XD2B 2LKCA 3A4NA 3I73A 3KTAA 3TAHA 1XD9A 1YE8A 5EP1A 3CRMA 2MMGA 4F93B 4XWOA 4R2HA 5F98A 4JSTA 1PLKA 1P2SA 1AGRA 3TQFA 2AFIE 2B7BA 4FD2A 2DCUA 1LF5A 3CH4B 4UXIA 3WRYC 4FN5A 2HLDD 2RCNA 2C77A 3WP1B 3UANA 3W6PA 1CXZA 3F5FA 4UQOA 3DHWC 4DJTA 1N0WA 1E1QA 4G5SA 2ZR7A 4AKEA 1VYVA 1MO6A 2QL6A 2WOJA 4M1KA 2BMFA 1G3RA 1W0JD 1ZW6A 4B43A 2W2XA 4WAUA 4C30A 4E22A 2RHMA 1FX0A 1NJFA 1RYHA 2R6GA 3SU8A 1MV5A 5F9FA 1ZNYA 1FL9A 1KI1A 5HCIA 1T6NA 2FSGA 4PHHA 3WHLA 1YQTA 3CPHA 2XB2A 4K46A 4POAA 1R4AA 2IYUA 3U6KA 2ZI9A 2BEKA 4NU0A 2GRJA 3CPEA 3FFBA 4PHFA 4IFEA 1E2NA 1A4RA 2WMNB 2WSSA 2KBEA 4LHYA 5EUMA 3BK7A 3DMDA 2XTMA 3NG1A 3BGWA 2QU8A 1KAOA 5DI3B 4NONA 1KK3A 1EGAA 1NVVQ 2ZAMA 4RZUA 3CKLA 3RRNA 2NMVA 1P5ZB 1JQLB 2XB4A 4KU4A 4V0NA 4TZ6A 1NG9A 2YC2C 2ODWA 5LDDC 4LYFA 3CB4A 1E2DA 1V5WA 3NBYC 1ZVQA 3O8BA 1WQ1R 3SEAA 3EWAA 1VG8A 4URXR 5KNCA 1SZPA 1VCOA 4QG7A 3LVRE 2IS4A 4R71A 4A15A 4JZKA 4PC3A 4DDUA 2OFXA 2ZI4A 1WRBA 3TR0A 4KVGA 4DZZA 5JWHA 1OH5A 4O3MA 2DFNA 4D6PA 2W0SA 1E2GA 4O2RA 5C1BA 3FGNA 2IYLD 3J81k 2J87A 3SE0A 3SJZA 4DVGA 1G8GA 3C14C 4AKHA 2I4IA 2ZVPX 3CRW1 3RSLA 1IOZA 4MUAA 1KY2A 3BE4A 1S4QA 5EJEA 1OHHD 2AWOA 3P4XA 4XSHA 1CTQA 2ZRCA 3QG5A 4IVPA 5HPYB 5LD2B 3U44B 5FTJA 5FOTA 3MGCA 4EQ6A 5JCPA 5DNYB 1KJWA 2CJWA 4QKQA 2IYWA 4II7A 5E7JA 1NKTA 4S2EA 2QMEA 3B1XA 2BMDA 4C0BA 4F91B 4OK6A 4XWAA 2PH1A 3EARA 4N0DA 3QEOA 4R98A 2GZHA 2QMUA 1KK0A 2QTHA 4MKIA 2JJ1A 2QQEA 3HJNA 3X1XA 1W4RA 1QHGA 3P32A 4MYCA 3GLIB 5CJPA 1G3UA 2N46A 4TL8A 2ZETA 3UWOA 1E79A 1XF9A 2CDNA 3LBHA 1LS1A 1QHXA 3NC0C 3TQCA 3BIFA 2YZ2A 4ITRC 4J0QA 4IDOA 1X8JA 3AVTA 1COWA 5HZKA 2CEAA 4QBHA 4QBGB 1DAGA 4A0FA 2XNSA 5GADl 4ZKDA 4TL7A 3GFPA 1R0YA 2D4HA 2VTKA 1T8TA 1OXTA 1ZC4A 1VHTA 3RDPA 1XB2A 4OHYA 1G18A 4EPVA 4OQNA 2Z83A 1K6MA 4MGYR 1CP2A 2Z4RA 4MYTA 3E2IA 4BE7B 3AH8A 4E03A 1XP8A 4Y0AA 4CEJA 3QKRA 1FW6A 5AJYA 3OIYA 3CO5A 4IVQA 2FPMA 3T34A 5DIFA 1L2TA 2NOAA 1TTTA 1HE8B 1KI7A 1KO8A 1ZM7A 5H8WA 2PEZA 2PL3A 4M8NE 2I3BA 2FF7A 1KI3A 1NVXQ 1QHNA 2F9LA 1Q0UA 4EPRA 4Q00A 5DO9A 3SN6A 1DEKA 3QF7A 3M1IA 2HYDA 5KDDA 4HZIA 2O8BA 4M1MA 3LX5A 4NYIR 1P4SA 4KODA 1XD8A 3ADKA 2HCJB 1ZP6A 3CRRA 3S1AB 2W83A 4KBFA 5L3SB 2F1JA 3PIRA 1NIJA 4PPFA 4PTLA 2WJGA 2ZS7A 1F3OA 3GJXC 4Z1MD 1G6OA 3BXZA 1Q1EA 3I4LA 4DBLC 4HLQB 2BKUA 3KQLA 5H70A 2JGNA 3KX2A 4GOKA 3T1QA 4EJSA 4IJMA 2BKEA 3AV0B 1K8RA 5EE9A 1G8YA 2QEQA 2BBTA 2AWNA 4YC7A 4M1OA 4PPGA 3OESA 1GKYA 3LDAA 2XAUA 2ZRLA 1ELOA 4QBFA 3NBZC 2ZJ8A 4B3BA 1PV4A 4PZYA 1KSHA 1DELA 4AURA 1NBMD 3ASZA 4WIAA 3JZMA 3NBXX 1G41A 5FPTA 4AYTA 4UXHA 2YOFA 2EYUA 5FH9A 4RSGA 2F3TA 4LY6A 2Q9CA 2ZJZA 4D81A 1GTVA 721PA 1T0JB 1I2MA 4S35A 1CULC 1FPMA 1UJ2A 1XJ0A 2RKOA 3WNCA 1CR4A 4ASUD 3RWOA 2IX3A 1UF9A 5C18A 3RS4A 4ZDJA 2XOKA 3MWKA 4XD7A 1T0HB 1IXZA 2IF0A 4DLVA 1G6HA 1H8EA 4W5HA 3LNCA 5TY0A 1BMFA 4BASA 2ZI5A 4X8LA 3T12A 3EIEA 1Z83A 2YHSA 3AF2A 3ZJYA 4D0GA 4B2LA 2ANBA 2O0KA 2CXXA 2QT1A 1W46A 2RGCA 5L3VA 3AGPA 3VAAA 3H0KA 1G21E 4C0JA 4LJ9A 2A5JA 2NZJA 4ACBA 2P65A 4ARZA 2D7DA 4TT3D 3FPAA 4JLBA 1OE0A 1TAGA 5JZVA 4JJZA 2FG5A 2DWPA 4QFMA 1E0JA 1TQDA 2Z43A 2V4ZA 4LCBA 2WKPA 3PJRA 2G0NA 1WMSA 1QRAA 4D82A 1XCPA 3FKQA 4A0HA 3Q9LA 3QVUA 5CM9C 1NY6A 2NIPA 2PJZA 3GLGE 2P67A 1SXJD 3GQBA 2ZANA 4TMZA 1T5LA 2LWIA 1DTSA 4HLUC 2HEIA 3VR3A 1XZQA 3SYLA 3TIFA 1OH6A 2QP3A 1NJGA 2RGEA 2EYQA 3AUXA 1XEXA 3GEEA 1COWD 4PANA 5F2EA 4EJSC 4F4CA 2DFTA 2EFEB 3VMFA 2GJAA 1IQPA 1UKZA 2ZUBA 2CL6X 2YWHA 4HLCA 2WTUA 1Q3TA 3CR7A 3LX8A 4U5XA 4EPTA 2VHQA 5TDHA 2ZRMA 4LC0A 4LV6A 5FTMA 1OXUA 2RH5A 1TQ4A 1V43A 3H2YA 1JXMA 4DLWA 2FU5C 1KI4A 3OE7A 1G8HA 2XEXA 2YOGA 3IIMA 4HUTA 2QN6A 1S9HA 3K53A 2QAGA 1Z06A 3ND8A 4CEJB 1N5JA 3QNUA 4NP6A 5IHPA 1F2TB 1KJYA 2C03A 2PEYA 2OE2A 4LPSA 3CX8A 3W9YA 2XXAA 2ZU0C 1YVDA 1N6LA 4TMXA 5C4MA 1AN0A 1IN8A 5BWMA 2WAYA 2OCBA 1WA5A 5CYPA 2AHOA 4FWTA 3K9NA 4ZDIA 2AN9A 2X77A 3B13B 5KSYA 4RKFA 1QZXA 1UKYA 2C96A 3VU9A 4C0AC 1YZNA 4OL0A 3TR5A 2ZRFA 2QRZA 3RYTC 1SHZA 1J8YF 4C0KA 4O25A 4JLPA 4LJYA 1FNMA 1VG0B 5DI9A 5FBQB 2QM8A 3WYFA 1ETUA 3QJYA 1GZSA 2QPAA 1W36C 2FSHA 2JLSA 3BJIC 3SZRA 1AKEA 3FYHA 4OHWA 3UMFA 3PUZA 4LUCA 1KIMA 2GVZC 4CEHA 3BB4A 3W8RA 2B21A 3GLIA 4YXWD 4RFSB 2V8OA 1R8QA 2JLXA 4P3YA 2FFQA 4IKEA 1MT0A 2WJHA 1UADA 3IIKA 4EUNA 1AA9A 1FTSA 3UPUA 3W5JA 3B8HA 1KNQA 2PX3A 1J70A 1Z63A 3MJRA 3DZDA 3MG9A 5K8UA 2CHVA 2ZJBA 1C9KA 4H9GA 2FA9A 3DPUA 3FFAA 3L0IB 3QBTA 4L5BA 1ZJ6A 4Q1CA 4KAXA 5J5CA 3I62A 5P21A 3A4LA 1Y63A 4FXPA 3MCAA 2H16A 3CWZA 3KJHA 2GBLA 2FPKA 4Q4JA 1W36B 2G77B 2WPDD 4PSKA 5EZ6B 3OIWA 3PR1A 4NCJA 1Y3AA 4DSUA 4LYAA 5FTLA 2H5EA 5DHFA 4Q48A 3UIEA 5HKKA 1QG4A 4NZYA 1BKDR 5FOXA 2BCGY 4JLDA 3TW8B 1D8TA 1TUIA 4U00A 4Z8YA 5KNBA 3BB3A 3FMOB 1KMHB 1TF2A 4A0RA 2OLJA 2JEOA 1ZUIA 2BBSA 3EZ2A 4LPKA 4PO1A 3WMGA 2VP9A 3CNLA 2PZGA 3QKSA 4OHXA 2J46A 1KMQA 4MQBA 2B8WA 2JLVA 3WHKA 2XZLA 5EXSA 2DBYA 1JXOA 2XZPA 4Q1FA 2JJ8A 2QZ4A 4JSYA 4BLRA 4ON9A 2RHDA 3P26A 5J4LA 1DAFA 4XVUA 1ZM9A 2EVWX 1IN4A 4I81A 4L9SA 4LBZA 2IYVA 3QUSA 2XSZD 1ZINA 2F7SA 4LHVA 4PC7A 1AIPA 1JEDA 2WOOA 1GL6A 4YXWA 2Y8EA 1NN3A 2QA5A 3MWJA 2H18A 3FKSA 3HU2A 2ZTSA 3KJGA 2H8KA 3GJ5A 5FUYA 2CK3A 2FEMA 3RVBA 3AVUA 1GL9B 2AFHE 4BFXA 2QSZA 3RANA 4RCZA 3NH9A 2V1UA 1FMJA 4X8MA 4FMDF 3SHWA 2CJWB 2TMKA 4LJ6A 2YINC 2G88A 4HDOB 2IS1A 1X3SA 2JLQA 4Z8XA 2WJVA 3IEUA 3QXCA 3B1ZA 3SFZA 1ZCBA 1TQ6A 5JRJA 2FE4A 3T15A 4L16A 3LW7A 4GNKA 5J40A 3WY9A 2N42A 3SI7A 4BRWA 1EWRA 3DM5A 3W90A 2IYXA 4KITB 3O8DA 5L3RA 2OLKA 3HP1A 4BFVA 5BN4A 3KKQA 1X8KA 2IXFA 3PUXA 4GMDA 4LI0A 3WBKA 3D7MA 5E7IA 3F3YA 4F7WA 2JDID 3OE7D 1N2CE 1XNJA 3ZVMA 4KFUA 1E2KA 1RW4A 4A8JC 4IRUB 1IJFA 1L4UA 5GJCA 4P4SB 4Q01A 1KKLA 4I1UA 4LHZA 2DHRA 3FMPB 2V6JA 4JT2A 4D4MA 1Z2CA 1GOTA 1XEXB 4DT1A 1W47A 3W34A 5K8IA 1Q3HA 2CHGA 4G01B 2IWHA 4UNSA 1Z0KA 1DE0A 4KCGA 3CIOA 1CLUA 1XRJA 4Q9LA 1Z6YA 1P60A 3LRPA 4HI0E 2O8EB 1GG2A 2IF2A 3KJEA 4TT3A 2QGZA 4H1VA 4GFDA 4LOAA 5DISB 3C8UA 2VHUA 1W44A 1EESA 1N5IA 3I8XA 4WZBE 1E94E 1Z08A 5M04A 1A2BA 3LLUA 3QOFA 3PUVA 3IPXA 3RC3A 4PO8A 4NCKA 2IWRA 3B78A 3TE6A 4RKEA 4ZDWA 3AB3A 4ZI3A 5JRZA 4TMWA 2XOKD 4XD7D 5KYKA 4M1YA 2VSXA 1G3MA 4PO9A 2J59A 3PEWA 1ZAKA 2H57A 1E6CA 4JLJA 1NLFA 1P9WA 3T35A 1KO1A 3UMSA 3BH7A 5FBRB 1N6HA 2W6JD 3D6TB 2O8CA 1U90A 1NL3A 4M22A 2AK2A 1F2TA 2IYSA 3MWYW 2B6HA 2XXAB 1S1MA 3R8CA 3GCGA 2VP6A 1RRFA 4IFBA 1HY3A 1W2GA 5DE3A 5JFGA 4AKIA 1WF3A 2JASA 5EP4A 4QBIA 4ZIRB 3K70D 4B3GA 4TTRA 1E9DA 2GCNA 3ZZ0A 2J0SA 1YR6A 3HR8A 3TUZC 1QHYA 2ORWA 3EIQA 3ZZTA 3NHAA 2CCGA 5C46F 5JEEA 1W36D 2HXSA 3W3ZB 2F6RA 4P33A 4YLGA 3QEJA 5JJLA 2PCJA 1N6NA 2F43B 2AX4A 2D2FA 4YDHB 3V4RA 3TAUA 3OEHA 2BBOA 1OPXA 1G4UR 2GAOA 4ZCMA 1ZCAA 5A5GA 4CZ2A 1E69A 1EX7A 2CMKA 4NCHA 1FP7A 1AK2A 2QGNA 1NN0A 2QSYA 3C41J 4XWKA 1XPOA 4PR0A 3RRZA 1F2UB 2HXYA 2P5SA 2CLSA 3PCRB 4DCNA 3OIUA 3UWKA 5D3MA 4D0LB 4DLYA 1H8HD 2OUKA 4R9UC 2OFOA 4LJ8A 4DEXA 1UKVY 4M9XA 5GVSA 1U8AA 3UK6A 3FB4A 3G5UA 1J7KA 3AP3A 1TX4B 3VQTA 821PA 2O8DB 4PSAA 3O8RA 1KDPA 1KAGA 2OZEA 2G1KA 2GTPA 3L8ZA 2NG1A 5K8LA 4B48A 1AQUA 1XTJA 3BD9A 3KB1A 1N0UA 4C4PA 1U9IC 1OLOA 1R5BA 2EFHB 4CVNA 2EWVA 4KSBA 2IS6A 2IL1A 1P7CA 3Q7PA 1J2JA 2OV2A 2FSIA 2DWQA 5FPYA 5TB5A 4QNRA 1IHUA 3QXXA 1GRQA 4L4UA 4TMKA 4RJLA 2P3SA 2B92A 3D31A 2WWYA 4LK2A 1MR3F 5AUQA 2QMOA 2ZREA 5EE1A 3HYRA 2BVNA 4UNQA 2QAGC 2VIIA 1BOFA 4HZUB 1D2EA 2PZEA 4BLSA 1X1SA 3VKHA 4JVNA 2HCBA 1HH4A 1E2JA 4DDVA 2YOHA 3R7WA 1F60A 2WICA 4KYUA 1ESNA 2BWJA 4ILEA 4EPYA 1JAIA 3X1YA 5DLQC 4ZCIA 3VKGA 1EFHA 4OYHA 3ICQB 1TU4A 2WZQA 4KI0A 2KBFA 4RVCA 4LJAA 1XFAA 3PEYA 2BDTA 2AXNA 5EE0A 4QM6A 3QF4B 1Z0JA 2VA8A 5CK5A 4LGMA 4QGHA 4NCNA 2V54A 4IDQA 2OBMA 1ZM3A 2DFLA 2KE5A 2D7CA 4MYHA 1W0JA 2F43A 1SVKA 5FUVA 2D2EA 5LPNA 2XTZA 3SR0A 1EFRD 4KV9A 2OCAA 4TL6A 1KSGA 4TMVA 4OQXA 1GRNA 3RAPR 2BIFA 4N0EA 4MRNA 1BMFD 3SQXA 1DBSA 1J8MF 2PBRA 4G5RA 4PHTA 1EK0A 3GLHB 4RFVA 1SVWA 1Z6TA 2ZSAA 4ACAA 3HU3A 3B85A 1MO5A 4WXRA 4Q4HB 1E2QA 2J1LA 1XDBA 2D06A 3AF0A 2V7QD 5KHOC 3QBVA 1TF7A 2GXQA 2Q9BA 5EXXA 2GJ9A 3UKDA 1SXJC 5AJXA 2ERYA 4LHXA 4XTRA 2OHFA 3DL0A 4KSCA 1XJQA 3AP2A 3I8SA 4DSTA 3VNVA 2C99A 2X19A 2FSFA 1IXRC 1M7GA 2GEVA 2P6UA 2SHKA 3LVQE 2WKQA 1Q1BA 1Z8FA 2I1QA 1Z22A 3K9GA 5DHAA 4D4JA 4Q7LA 4RD4A 1BH2A 1E1RA 2RGNA 4AG5A 3MLEA 2ATXA 3A1UA 1G4AE 3WBJA 5IK2A 2C04A 3GLGA 2QNRA 1UBFA 2VBCA 2A78A 1E9BA 1NY5A 2XNDD 3QVVA 4B6EA 1YU9A 1LF0A 5EXTA 1XZPA 1Z6GA 3UATA 1R0XA 1CJTC 1E2PA 3TLXA 3CLVA 5KO2A 1KHTA 3K0FA 5EP2A 4Q7MB 4B44A 1KI2A 3BWDD 5AJZA 521PA 1KNXA 2O8BB 4Q7KA 1XMJA 2ZYVX 1WE2A 1G9XA 5D3MB 1FUKA 4AYXA 1R8SA 3C16C 4PAQA 4GSYA 2IUSA 1N5LA 1NLYA 4Q9IA 2MSDB 2FMXA 1GITA 4PC2A 3A36A 2EW1A 3WYAA 3LQQA 4A2PA 1S9DA 2ZRNA 4GI7A 4KFRA 3X1ZA 3B1WA 1AKYA 4Q1DA 4C0LA 4B2PA 2AK3A 2CK3D 1L7VC 1Q1QA 2UVQA 1S1CA 4P4SA 3IDQA 3B5JA 4HDQB 3ZVLA 5EP3A 4YMTA 5ELXA 2G83A 5DSZA 4URYR 2ZYWX 2KI5A 1IY1A 4A6PA 1G5TA 4AYWA 4EFNA 4ZPXA 1IY2A 2GK6A 4D26A 1VYUA 4TLBA 5CIQA 4US2R 5H68A 1P3JA 1R0ZA 1EFTA 4OHZA 3ZZUA 3AF4A 4BECA 4DB2A 5FR2A 4ESVA 4GP6A 4P31A 4UJ3A 5FPHA 4B76A 5JBQA 4CGZA 4OJQA 5IF9A 2OG2A 1SHKA 1HV8A 1E9RA 2CE2X 2WJIA 4JYBA 4DIDA 1U8ZA 4MDFA 1BYUA 4K81B 2VO1A 2R6FA 1JR6A 2VSOA 2IHYA 4KJZA 1AGPA 2PLFA 2GHIA 3T61A 2W0MA 4DUGD 1E3MA 4M1SA 2O8FB 1DADA 5FBLB 1E0KA 2G3YA 2R44A 2NTYC 3GP8A 3CRQA 2JLYA 1UAAA 2WJJA 3RHFA 1W5SA 3AKYA 3BBPA 3FTQA 3PQCA 4NYMR 3K8YA 2BOVA 1GVNB 3ONWA 3VHLB 1VTKA 2RGBA 2RMKA 1GKIA 3ECCA 3HWSA 4FWIB 4LJ7A 2J9RA 4M0LA 4PAOA 5HE8A 2JATA 5G40A 3AVWA 2X2EA 4MRSA 3TNFA 1E9CA 1WXQA 1JJVA 4TYNA 2CVHA 1KTVA 1P2TA 3CF6R 3NH6A 3K1JA 1GRRA 3VR1A 2ZRJA 2ZSDA 1IM2A 1EFCA 1VECA 2JA1A 3GJ8A 3SC3A 3VR2A 4RD2A 4B3FX 1US8B 1XMIA 1NMYA 1OHHA 4RZ3A 1KMHA 1T4GA 2P0EA 1WBBA 3VR5A 1JEEA 1G20E 2A2ZA 4P0TA 4GT1A 3QSYA 3PITA 4L15A 1C4OA 4Q19A 3RC8A 3REFA 4PZLA 2A9KA 4NH0A 2QAGB 4YMUA 5KTYA 3FKSD 1KZGB 3LLMA 6Q21A 1PVOA 1QHSA 2IW3A 5DYIA 2ZRHA 4G5GA 1D5CA 4HLDA 4R2IA 1PUIA 2DFKB 2OXRA 4Q4AB 2P6RA 3REGA 2FDCA 1IY0A 1FFHA 2PLRA 1VCIA 4JL5A 1XXHB 2VHJA 4TQ9A 3DM9B 2NO7A 1AA3A 1R5NA 2ZIAA 2ZS9A 4M1TA 4BFYA 4C0SA 1CBUA 1SVLA 5B57C 4DC9A 3NDBB 3K9LA 1KDTA 4HUQA 4X8OA 4NYJR 3KQUA 1W48A 3TVDA 5HR5A 4KXFB 2ZSBA 1OH7A 1XD2A 4JIMA 3U4QA 3EPHA 4IXMA 4QJ5A 4U7DA 1CRQA 4V0OA 4BZPA 4NKRA 5FBWB 1QBKC 3SQWA 3T1VA 1L8QA 4BFTA 3LBNA 1OF1A 2A5YB 4Q5IA 2G9NA 2QP9X 4XVRA 2GEDA 4KLZA 4TLCA 3TW4A 1AS3A 3R8FA 1RRGA 1TEXA 2WWWA 1W0KA 5HCNA 3C5CA 4JBXA 4JVSB 2HF9A 2ZXUA 2GZDA 2EU8A 3B9PA 5EE3A 1GUAA 4HB0A 3HPRA 3A37A 2GCPA 4MGZR 3PEUA 4G5QA 4N3NA 4B71A 4QJ3A 5JI3E 2FEOA 3E1SA 1HTWA 1HEIA 3ZIAD 4NBSA 1UKEA 2GJ8A 2NO0A 1HURA 2DR3A 3GJ3A 1P2UA 4IDPA 3THWB 1YZQA 2QTFA 1U94A 2CHQA 4OI4A 4F38A 2GNOA 4EKDA 1U0HC 5CDFA 4HAYA 2ZQ5A 3RS3A 1NRJB 1R6BX 3IQWA 1XMVA 1U99A 3AM1A 4DLRA 4LJ4A 1QG2A 1ZU4A 1PLLA 3RS2A 4BFUA 3AVOA 2A7QA 1ESMA 1P75A 2DYKA 3B60A 3WRXC 4BEBA 1UFQA 4TQAA 2QPTA 1DPFA 3W6NA 4BZQA 4GMXA 3QXHA 5C4GB 4BPBA 1DARA 1CR0A 4OQFA 1WP9A 1B23P 4CEIA 2XJ9A 1KDOA 5A4JA 3KTAB 3CUEF 3W5IA 2GCOA 3LA6A 3KUDA 3LXRA 5GJWC 4I1VA 2HT1A 1Q21A 3BAFA 3I92A 3Q8XB 3U3JA 4YMVA 1P9NA 4JLVA 3GEIA 3WMEA 4NMMA 1P73A 1DOAA 2BBWA 3V9PA 4ZKEA 2RGGA 3P27A 4HYYA 1KK1A 1TU3A 2ZRAA 4Q1BA 5TMPA 3QPUA 4V0ME 3RLFA 4NHOA 1Z5ZA 1NIPA 3T5DA 4AC9A 1OV4A 3MMPA 3RSOA 1GNPA 4V0LA 1HQCA 1R2QA 3CW2A 3HDTA 4OKSA 1ZUNB 4V02A 1Z0FA 1UBGA 4RFSA 1YZTA 3IKJA 2ZVQX 2IC5A 5BYKA 1TMKA 4Z1MA 1E1RD 5FOWA 1E32A 2WJYA 3X1WA 3FVQA 1YR8A 2VHCA 3TRFA 2HDNB 1RKBA 4GPTA 4DUGA 4G3XA 3IEVA 2R62A 1G291 2YKGA 2NO6A 1XU4A 5E7MA 4D0NA 1KI9A 2QBYA 2WIBA 4GOXA 5L8VA 1CJKC 2CLDX 1KI6A 4V03A 5FOVA 2ZE6A 3VU9B 4B6FA 1DG1G 4A2WA 1E9EA 3IIJA 1E2FA 4M9ZA 2V7QA 4IOMA 5FUWA 1R0WA 2IUTA 3O47A 3LD9A 1GDDA 5GVRA 4AK9A 2IYTA 3DKVA 3K9HA 3W8NA 3ADCA 3PUWA 3TMKA 3GFOA 1ZRHA 1AS2A 1T9HA 3QE0A 1W1WA 5FR1A 4C7OB 1E2LA 1XBTA 2X8AA 4N1AA 4QNMA 2ZE7A 4KBGA 3THXA 5CJ2A 5DN6D 4UXJA 2OESA 2G6BA 2VP4A 5K8TA 4G1UC 1IBRA 5DN6A 2FGJA 4Q4HA 1MRNA 5GJVC 3EG5A 4Q03A 1Z0IA 4M9SA 5TARA 4GP7A 2WKRA 4A36A 4TZ0A 5JEDA 5KSPA 3FDIA 1CF4A 2GJKA 2VF7A 2K5UA 5JCZA 4D2IA 1RJ9A 3GLHA 3NVAA 4TTQA 3EZ6A 2L0XA 3EXAA 3KZ1E 4WZAE 2WWXA 4JMPA 3AKDA 4BRUA 1HT1E 3ADBA 4DLZA 1NN1A 3MUFA 1KO5A 1H65A 4QGAA 3T1OA 3BS4A 4B47A 1QVRA 3IHWA 2ZPTX 2MMCA 1OH8A 1VG1A 1F2UA 4DWJA 1S96A 3AVVA 3EZ9A 1E79D 1RJ9B 1SVSA 3QXJA 1U8YA 1ZD1A 1ZBDA 3KQNA 2WWGA 3U6BA 2GCOB 2WHXA 4GBMA 4C0QC 1YZKA 1G7RA 3TJZA 3ZVRA 4NE2A 4OJKA 2J7PA 5UKDA 3KQKA 2ODBA 1KI8A 221PA 2ATVA 5CDFE 3OF5A 1A2KC 4LV5B 1JR3D 1LVGA 3D3QA 3A4MA 3P4YA 4OK3A 1VKJA 1OFUX 3U3KA 1Z07A 1NP6A 3SOPA 5BN3A 4AG6A 1G3IA 1ANKA 3ZQJA 2NQ2C 4IHQA 4BEJA 1A1VA 1XPRA 2QUZA 2BHRA 3B1VA 2ZUCA 4DSOA 2HV8A 2JIZD 1BS1A 2ZI7A 1CR2A 1XTQA 3KFXA 4DHEA 4GOJA 1JBKA 4CT4B 3GJ6A 1N6RA 2AXPA 2Q3MA 1XWIA 1PZNA 4AKGA 3X2SA 2ZRKA 1W5TA 2ZR0A 1U0LA 1YR7A 2V55B 3RS5A 4W9MC 2J7KA 1II9A 1G3QA 1T5IA 1KGDA 1ZD9A 2BV3A 2F3RA 3H86A 1LS6A 3OEHD 4TSFA 5LB2A 1P6XA 2BJVA 2FFBA 4P4TA 5FTNA 4Z54A 1SGWA 3BH0A 4UNNA 1OB5A 3IQXA 2C9OA 4MGIR 2ONKA 4PPQA 3L0OA 1Z3IX 5B2ZA 5FUXA 4JBYA 2A3RA 4XOIA 3U60B 2XGJA 2F1IA 3EWSA 1ZIOA 1OKKA 4DLTA 4TLDA 2HUPA 3NHBA 4CEIB 3A1WA 1ZM2A 4IEEA 1F6BA 2RGDA 4BQSA 4DT1B 4TN1A 5D3QA 1W4AA 2V6IA 2ASEA 1WDTA 1NSFA 3LV8A 3R20A 2C5LA 2ORIA 2A5DA 4TL9A 4PZZA 4U02A 2W6JA 4UNPA 2D62A 4QC2A 3OFND 3Q72A 4HAUA 3WMFA 4EFMA 2QMHA 4Q4AA 1OYYA 3V4FA 4ZIRA 1P62B 4F4JA 3ZD6A 3QPWA 4OI0A 3ND9A 1VPLA 4OI1A 3DMNA 2IEZA 2UZIR 4LBVA 1OIVA 3QKRB 1HUQA 4US1R 5CM8B 1OT3A 3H84A 1RFLA 2IYZA 4JVLA 4A82A 2KJQA 2C2HA 1L4YA 2G1JA 1ONBA 4WVFA 4Q1EA 3VFDA 4DEYA 5KUTA 2FFHA 3OZXA 4BWYA 1NN5A 1SVIA 3OAAA 4XVQA 3SHFA 1AZTA 3C5HA 3E70C 5DH9A 3MAAC 1U9IA 2EFCB 4MKGA 3U2QA 2VH5R 4XIGS 5JHHB 2VYFA 1GILA 2VHTA 3NWJA 2R6CA 3AVPA 1UDWA 4DCTA 1XXHE 1ZNZA 4IVRA 1RVDA 1VHLA 2NGRA 1RE0A 2YC4C 4JLMA 2CNWD 3QY0A 5DGXA 4DDTA 1JQJC 3KKNA 1NG1A 3BOSA 4IXNA 3SBEA 1IN5A 1SVMA 3FHOA 3IBYA 1JPJA 1G16A 3I72A 1OJLA 3P1JA 1ZNXA 5FOUA 1JJ7A 4ZCLA 1GWNA 3ZYCA 5AUPB 3LWNA 3AEZA 4Q9KA 5AK0A 4LX0A 2Z5FA 5BQ5A 3ZS8A 1TEVA 3U7GA 3THOA 1K5DA 3KXLA 2ECKA 2P2LA 3PEVA 1DAEA 1QVAA 2X1VA 2O8FA 1GP2A 3GFTA 1E4YA 2XNDA 1S8FA 3EZFA 5IT5A 2UKDA 1E2IA 3H4MA 4D4LA 1OW3B 1ZUHA 1XPUA 2D3WA 4TWZA 1M34E 1NVUQ 2Q3FA 3FHCB 2Q6TA 3CWQA 3TK1A 2ZI3A 1LW7A 4AIIA 1M6NA 2ZJYA 2OCPA 2W2VA 2C78A 2O5VA 1BIFA 2WSSD 4D4KA 2F9MA 4JS0A 5J4YA 1VIYA 4QGFA 4WZ6A 4D25A 4FW9A 3PG5A 2C9CA 1YZGA 1SXJA 3E5HA 1G5RA 3SJBA 1S3SA 4B3CA 2QORA 3EAQA 3WXMA 2AL7A 5JHGB 1S0UA 4F92B 4YMWA 2GESA 4QJ4A 3DO6A 2IT1A 3R9WA 1YZUA 3PXGA 1UM8A 1OXSC 2PT7A 3KL4A 1DAKA 4WBSA 3U7EB 4KVAA 2CL0X 1E9AA 4EAQA 2A5FA 3U3OA 4HB3A 4Q9HA 1XCGB 2NPIA 1OYWA 1XTIA 3IO3A 3THYA 4EIWA 2Q3HA 5DI3A 2YWGA 2Q0HA 2GETA 3I3SR 2WWHA 2R2AA 1XTRA 4FMCF 1CRPA 5L3QA 1HA3A 2W2TA 1MKYA 3EA0A 3K0FB 3K09A 1NMZA 2CCKA 1IONA 3DVLA 4M9QA 1BYIA 1AM4D 4A6XA 3KJIA 1QDEA 2IS2A 1FZQA 3Q5DA 4GZLA 4TQUS 2IK8A 421PA 4WA7A 1M1YE 5KSOA 3AF3A 4A4DA 1FX0B 2WPDA 5FI0B 1DVRA 2FWRA 2GF9A 1JR3E 5BYJA 4UKDA 1Q12A 3BFVA 2EQBA 5CYOA 2OILA 4BGDA 5ANRB 3Q3JB 4OK5A 4B32A 1RC8A 5AWFC 3RS7A 4BLQA 2GWHA 1FUUA 5BXQC 1E0SA 4WXPA 3MSXA 3HU1A 3TBKA 4TYPA 4Q4JB 1GFIA 1SVOA 1G17A 3C4JA 5SZHB 2H92A 2HYIC 5B30A 3NIBA 2GKSA 2GK7A 4DKXA 4PC1A 1ZU5A 1KKMA 2V1XA 5KNDA 3VHXA 4OQLA 2FH5B 3ZLJA 1UBCA 2V9PA 2ZSEA 2O0JA 3EPLA 2F1HA 1DAIA 2R8RA 4E5UA 5AJVB 5JSZA 4KO8A 1ZC3A 4KYIB 4P4UA 5C2JB 1ZMXA 1FP6A 1NSTA 1O87A 1JECA 4NTZA 3R9XA 1KY3A 3K0CC 3SJAA 3OAAD 4QHTA 3NXSA 4CDGA 4YQFA 3RWMB 2D74A 3PV0A 3QF4A 3L8YA 4LBWA 4XH9B 4B3XA 1HYQA 3GMTA 4MH0R 1G19A 4MRVA 4FI3C 4QGGA 3W6OA 2BJWA 1JNYA 2QE7D 3AGQA 3BRWD 3IHLA 5SZIA 4JLKA 4A1FA 1II8A 5B58C 1LV7A 2J0QA 2VLIA 3U7HB 2FN4A 1CJUC 2FZ4A 3AVXA 1CIPA 2VRWA 4JVMA 4Q02A 2AKYA 3R7WB 3IBGA 1QHHB 5BW8A 121PA 5JMTA 3OFNA 3ASYA 1XEWY 1ODFA 2FGKA 5FTKA 2ZM5A 3EC1A 2GJSA 2ODNA 2ZYUX 4JL8A 4V0KA 3TSWA 3U61B 2J0VA 3GJ4A 4R7ZA 1N6OA 1VMAA 2H17A 5KPDA 5AR1A 4ZO4A 1OKKD 3RNLA 1NBME 5BN5A 3GPLA 3K0SA 2BM0A 3HPQA 4DLXA 3I5YA 2Z6VA 4FMBB 2C9YA 1YHNA 4JYCA 4URVR 3GD7A 3NTUA 4GZMA 3CBQA 3ADDA 2HJGA 4JLNA 3SBDA 1KK2A 2DWOA 4HEJA 1T8UA 1SULA 4MKFA 1Q20A 1CU1A 2AD1A 2BM1A 2WMOB 4TSFD 4IOJA 4C0HA 2O8DA 4LBYA 1GAJA 3LFUA 2NZ8A 5IDVA 4QM7A 1PJRA 2FFAA 4FINA 1T3LA 5DYGA 1X6VA 4C9BA 1N25A 1F48A 3SYKA 3Q7QA 1D2MA 1A82A 4FCTA 3AKCA 4I1OA 4Q7JB 4TLEA 5KDOA 4ARZB 1KDRA 1KO4A 4B75A 3SYNA 4RZXA 4JLOA 4EFLA 1VCNA 3GLFA 3M6AA 5G41A 2NO1A 1I2DA 1B0UA 5FOSA 2E87A 3B7GA 3EZ7A 1BO6A 1MRSA 2R6DA 3MD0A 4I1SA 3ZGXA 2ONJA 2LKDA 2OBNA 4CRWB 2VP2A 4DRZA 4IOKA 1HT2E 1JR3A 3N2EA 4URUR 3G0HA 1SKQA 4Q66C 4TYQA 1SQ5A 4IOLA 2WM9B 2WWIA 5SZKB 621PA 3FOZA 4FCWA 4K8OA 3FE2A 3WNDA 2KB0A 4IW3B 2P6NA 3G82C 3QKTA 2REXB 3H1TA 5B64A 3CF2A 1XCMA 1MO4A 4HATA 3BH6A 1ZIPA 4XSGA 5JJIA 4P32A 2ZRIA 1QHHA 5IRCD 1KOFA 4B34A 1CJMA 1G5PA 1ZM4A 4AI6A 3BORA 3DEFA 1GKUB 1II8B 4JBWA 2BEJA 2PX0A 2JJ2D 1M74A 4A8JA 4DIEA 2W58A 5EE5B 2G0TA 2J41A 1R5OA 2VL7A 3CX7A 2RGNC 4A9AA 1AZSC 2LCFA 4XJXA 2OCYC 3LO5A 1Z29A 3X1DA 1NNEA 2OXCA 1MABB 4RD6A 1EX6A 1I4LD 3JVUA 1DG3A 1G1MA 4BLPA 2CE7A 2OM2A 3VX3A 3LXXA 5J4VA 1RPZA 2AD5A 4HDCA 3S1AA 5CK4A 4PHGA 1Z6XA 4XTCS 2ZITA 2O8EA 4TMTA 5JECA 2QP4A 2J3EA 1EFRA 3JZAA 2VQSA 3QIAA 1N6PA 3C7KA 4B3DA 4MA4A 1GL7A 1KSJA 4A0GA 4DCUA 4FMDB 4RD0A 1IAQA 2H7VA 2IXEA 2J5XA 2A30A 2RGXA 3CRVA 5FI1B 4LJ5A 2R65A 3ZIAA 1I4DD 5F9HA 2YJTD 3VX4A 2REBA 1DO0A 4URWR 4ZDKA 1E98A 2QY9A 2FZLA 1D9XA 3V00A 3UXMA 2HLDA 4MKHA 3AF1A 1NBMA 2ODEA 3MWLA 4B33A 5CLQA 1CS4C 3T1TA 4C7OA 5TXGA 2ZRBA 2QG6A 3B1YA 3NBFA 2QAJA 3QI2A 1RYFA 4GL2A 2GILA 5AUNB 3BB1A 3NC1C 3AVYA 3BERA 3W3AA 1E9FA 1U81A 2GBLC 3KKOA 1WCV1 3PENA 2VP0A 1MOZA 3ETLA 2N1BA 1NF3A 3TH5A 1II0A 2OEPA 4MUBA 2W6IA 3IO5A 2QBYB 2QROA 4LV8B 3TUJC 1CR1A 4LSGA 2J0UA 3Q5EA 2QE7A 5G3YA 1OFTA 3U3MA 4TYWA 2C98A 2AR7A 2HT6A 1KZ7B 3WP0A 1UPTA 2QM7A 3KKMA 4JLAA 1EXMA 3KFVA 3A1TA 3KXIA 3Q85A 1X8LA 3DZ8A 4O2LA 4V0MA 3QG1A 1NMXA 2ZRDA 4DDWA 4QHYA 3I5XA 3LAWA 4MRRA 4W5WA 5CLLA 1OB2A 1GNQA 3CH5A 4Y0VA 2WVJA 4LZZA 1TNDA 1U0JA 1DS6A 1W2HA 2XJ4A 1P2VA 4DSNA 3OEED 3OEEA 1OIXA 2UZ3A 5HE9A 1Z6AA 2J0UB 1O3YA 4M53A 2CLCX 1H8HA 2VSFA 1ZD8A 3OHMA 1XMSA 2WIAA 1J90A 3KB2A 2KWIA 3BFKA 1VG9B 3SNHA 2WSMA 4FCVA 2ZS8A 1D6JA 3QQ5A 2O0HA 2XSZA 1YKSA 4B73A 5CITA 5KPJA 1Q57A 4OI2A 3O8CA 3QKSB 1IJEA 1Q44A 2J7PD 1N6IA 2C8VA 2PMKA 4M4SA 2JLZA 3OIVA 3L82B 3LQRA 4CF7A 2ZU6A 4X8HA 3U5ZB 3ZD7A 1P72A 1G8PA 2CL7X 3K0EA 2OAQ1 1S3GA 1HQYE 3RRMA 4AWXA 1XTKA 4DLUA 3F8TA 2GVDC 1ZYUA 1W0KD 2CCJA 2FPLA 4ABYA 3CZPA 4LC1A 5JWOA 4G5OA 4LYHA 5LD2C 2WV9A 3THWA 1AJEA 5AUOB 4I99A 4TYYA 3BFXA 4A92A 4PQYA 4G0NA 1LFDB 1YZLA 1R7RA 1US8A 5FL3A 4YDSA 4Q4LA 2VEDA 4DLSA 1XEFA 4CYMA 4B74A 1S2MA 1QHIA 3B9QA 3B82A 2OT3B 3K09C 3QENA 3DOEA 1G7SA 3ZQ6A 4DCVA 4Q21A 4KHZA 3THYB 2RGAA 3R9IA 3MRSA 3ZDQA 2CBZA 1M8PA 3ICEA 2F1RA 1E96A 3EW9A 4EPXA 4JL6A 4PQRA 2B7CA 2GXSA 2I1VB 3EIHA 2B8TA 5LB4A 1A5TA 5KSZA 1MABA 3HR7A 1NVVR 2OO7A 1G7TA 1NKSA 2GDJA 2WAXA 4US0R 1RRPA 1IXSB 3QKUA 2ZRGA 2RAPA 4E09A 2ZEJA 2PJRA 2GF0A 1AQYA 4ERNA 1XEWX 2O8CB 4B35A 1H8ED 4C2TA 2ZJAA 3K70C 2XX3A 3FWYA 3JVVA 5JLJA 4DCSA 4JKIA 1VYTA 2IBMA 1DO2A 1N5KA 1SXJB 2YV5A 4L9WA 1FNNA 2ZR9A 1NLZA 2EFGA 2PZFA 2DY1A 4MYUA 2PCLA 1JALA 2NPFA 1YR9A 2REOA 2O52A 4NYIQ 4QL3A 3I1FA 3GJ0A 4W5JA 3TGPA 4O0MA 3TSOA 1FQKA 5KDLA 1G8FA 2JLRA 4RD1A 4M1WA 2XITA 4ZV4A 5FL7D 4NPHA 1KYIA 3IPYA 2MSEB 2HJVA 1CJVC 2F55A 2YWEA 3TSZA 1F5NA 2E9SA 2JLUA 2H1LA 3I61A 1XTSA 1GIAA 2IYQA 5E95A 4FMCB 4HAZA 2QQ0A 2ERXA 5KU1A 3FMIA 4OBEA 4OQMA 3P20A 1GSIA 4BLOA 1NI3A 1E99A 3GJ7A 2XTNA 1Q1ZA 2ZJOA 5EXPA 1JB1A 1KJZA 1MO3A 2BMJA 4HAWA 4CEHB 1M2OB 4PX9A 3KDSE 3GLIE 2FJUA 4NCIA 4MRPA 1C1YA 1GM5A 1KO7A 2QTVB 5JJKA 2CNWA 2WWFA 4Q18A 1P9RA 1TL7C 1U2RA 4A8JB 1UEIA 5EQTA 2ZYTX 5JS8A 1XX6A 3HYTA 1Z0DA 1P61B 3GEHA 2FX3A 1XJCA 4DXAA 2ZSFA 3M0EA 4BFSA 4JT4A 4CT5A 4HSEA 4Q9JA 4M2LA 4C2UA 1YRBA
chains in the Genus database with same CATH superfamily
1VE5A 1Y9JA 1Z36A 2COKA 4TLAA 4DRXB 3SQOA 3FZEA 1AF4A 2FWJA 3GN1A 3GLGB 4GDFA 4NH4A 1N32B 2EGHA 1BXRA 3CNOA 3ZWNA 3K0HA 4EVRA 3IUQA 3UG6A 2YRFA 3QEMB 1CV2A 4P82A 3RTGA 4F3YA 4NZMA 2IPMA 5LBIA 3OI7A 4ZI2A 1B00A 2QRJA 2JLWA 2XCTB 3VPDA 1EM8B 1YBHA 4EHLA 4ASUA 4PQGA 3B1FA 3KO8A 1XHEA 3OFKA 2XZOA 2DQ4A 4GRAA 4JLWA 5ALLA 2GXUA 2J85A 3DDCA 3IOBA 1JILA 3FIJA 2GM4A 3GLFB 1X80B 4YVFA 2NN3C 2RG7A 5JG7A 4Y2VA 3I4CA 3A1NA 1E4EB 2JLCA 5EHIA 4C14A 1VC2A 3OTGA 5A0FA 5KTPA 2W4IA 4PQFA 3CFYA 1Y6ZA 4A5OA 3GRYA 3KPWA 4L74A 5F7XA 4U9IS 3THSA 1TF5A 1ZXXA 5L3SA 1TW3A 4RZ2A 2IYYA 4EPWA 3A1VA 3BXFA 1U2PA 1S3FA 4UNRA 1J2RA 3CX6A 3WYGA 2ZSKA 1O9HA 2J9FA 2LDBA 4I5IA 4TTPA 1OFIA 1T2CA 1DJPA 4O4LF 3KQHA 4OHVA 2PHZA 3WKAA 1PKEA 5CB6A 3R3VA 5K2MA 3SNKA 1W49A 1UEJA 5LP6B 1G7CA 1YDFA 4BEWA 5BV7A 2AG6A 5FPKA 3UGJA 1CE8A 5LIPA 3AR8A 3KLMX 1OREA 4A7PA 3B2EA 2YWFA 4L72A 5ADWA 1XK6A 2QI9C 3M9WA 1J1ZA 3I32A 2BW0A 1EFUA 3E1KA 4C88A 4HB4A 4W7SA 5SY6A 3SZOA 3OSZA 4CW7A 3ANMA 4BCDA 4MW0A 3SDZA 2CV2A 3BWCA 4WUVA 2XWJI 3ZDCA 4IEIA 3HCWA 3HDVA 3A6PC 1AQIA 2FWBA 1Z2AA 3EIUA 1YVPA 2LXNA 3TVTA 1CWUA 3W05A 1XRPA 2X9LA 5F7ZA 1QVVA 3CLRD 4OVKA 4WLUA 1ECFA 1KU0A 4LHWA 1LV8A 1PN3A 2DH6A 2MSWA 3L2OB 3PNLA 3W7VA 3O83A 3BGVA 5EIFA 4QRHA 2ZRPA 5TNXA 1NT2A 4PICA 4G63A 4RV9A 4PY2A 3AKEA 5JT1A 4E21A 5IKXA 2P0YA 2NVBA 2YVUA 3PX3A 3NKVA 4AD8A 5C81A 4V3BA 1JW9B 1BE0A 1IN7A 1EEHA 1KI6B 3D4PA 2WB4A 3GL9A 4QOSA 3VTKA 5FV7A 5HFNA 4YRJA 4C4SA 4ESOA 2IP2A 2O7QA 5ALEA 3TUIC 3WFZA 3G5MA 4U6NA 3ORYA 2WIDA 4QU5A 2YYZA 4ZA2A 2AFIB 2W6ID 1Q22A 5G3ZA 4UATA 3NAMA 3R40A 3GLKA 1MAHA 4O2BF 2YHAA 4QXAA 4ENPA 1WETA 3QLJA 2PGDA 4MDEA 1UDAA 3M7IA 4F0JA 3ZHVA 2GLXA 1A8UA 5GJBA 3WZMA 3TKLA 3AEKB 3ZDZB 4MAMA 1CUXA 2AG0A 2NPOA 1EG7A 3GPIA 4HN2A 2H63A 2VZ9A 4HQRA 1T26A 4N9WA 5IF3A 1LNSA 4QHSA 5F76A 3OTIA 1QK5A 3NIFB 4JJAA 1VLLA 2GDZA 1VL1A 2E5WA 3CUWA 2VPWA 1S2LA 4F4IA 9GPBA 5DM0A 4BP3A 1S2OA 5L3ZA 1AKQA 2BEVA 1PLJA 2IEYA 3I0MA 4HAVA 1S89A 3ZCXA 2ZG6A 4LGVA 2IYRA 7GPBA 3RAEC 1XDUA 1MO2A 1NLUA 1L6IA 4DCCA 1OVMA 3PX7A 2E4AA 2WM2A 3N2IA 4KQ9A 4ZAXA 1MDBA 3K2BA 4JJ7A 5FFFA 1V5IA 4JLUA 5KYYA 3S7TA 1AKUA 1GNRA 5KTOA 3WC4A 2RAUA 1WMBA 5CT4A 1ZY2A 2IIVA 2I2DA 4FHFA 4BNHA 2H06A 8OHMA 1RBMA 3SYMA 2BCJQ 1CZLA 4XARA 2UYCA 4JKYA 1EK1A 3X3HA 3ZU2A 1DJMA 1ISMA 2DRIA 2QIOA 2YICA 4LRWA 1JG7A 4MWGA 1Z33A 1RD4A 1VJCA 3FGZA 2WFMA 1L7OA 2Q9AA 3K6SA 1OAAA 1IN6A 5FFMA 4FEYA 4HNSA 4YNBA 2NTNA 1CKEA 2QX9A 3B6JA 5FA6A 4BUJA 4I6GA 4EMBA 4C7KA 4IMIB 2IH5A 2JIZA 3ACBA 3RYCB 5HF8A 4O4LA 1RXEA 1CG6A 3VR6A 1PR1A 1UBEA 1COZA 1HE1C 3TOZA 2PNFA 4FFMA 2IA5A 5LJLA 2O4UX 4YRNA 1T9GS 3DFMA 4PBSA 2VQ3A 1YMUA 2LR0A 3CN7A 3KZMA 3OCUA 4MCAA 3ZH9B 4BFZA 4MVJH 5EIOA 2XADA 2FV8A 4LW8A 5C3MA 2YXPX 1Z8DA 1TQ8A 1Z4PX 2EJTA 3C3DA 3FZNA 4KFSA 3DZKA 4PHCA 4OMDA 3VNRA 4YONB 4QTXA 4PPNA 3D4OA 4Y8VA 2QENA 3VNBA 1KSFX 1OAOC 1ST2A 4Q1AA 4X64B 4V1CI 2JDIA 1Z12A 2HA2A 3HXOA 4BZXA 1QU3A 4MITA 3NUQA 4C2AA 3HJRA 3OPQA 3FMFA 4D1YA 2R85A 4EFDA 1DMRA 3K8QA 3L43A 4M0FA 1I3MA 2CWDA 1E1MA 4RIHA 1NBIA 1USGA 4JELA 3RRYA 2FKAA 3V1TC 4CIDA 1EGQA 2G1AA 3HGTA 3CF0A 4LRSB 4K7JA 2I4OA 4IJKA 4AP9A 1XD2B 3WL5A 5JFOA 2D7JA 3I73A 1XD9A 1YE8A 1O9BA 1ZKMA 4XWOA 4R2HA 4I6EA 4D41A 1K66A 3R5JA 4G0VA 1O97D 4IVNA 2AFIE 2ENUA 3O1HB 2DCUA 4JB0A 4F2WA 3D8SA 3PNQA 4MUJA 1YC2A 2I80A 4TGLA 5BO5A 4HV4A 4D46A 1T8PA 1KIAA 1RYYA 1PJLA 1MX1A 5BT9A 3DHWC 1NZDA 4K2HA 4DJTA 5CXUA 3QYPA 3QYJA 2RBKA 3BSSA 2MIIA 4YRGA 4AKEA 4BRZA 2P1RA 1T5HX 2XTJA 1JKFA 2D5LA 4RJTA 1ONOA 4M1KA 3A3PA 5KX5B 2BMFA 2C2MA 4FYWA 1U11A 3JCZA 5AOAA 1I5OA 4LDPA 3NALA 4TXLA 3V2HA 1UBOS 2H4FA 3LKVA 1MF7A 4M8KA 2P69A 1KH3A 3OOYA 4J4BA 5A3VA 3VZPA 4ZHQF 1FFYA 4WAUA 1AHNA 1JU9A 1EINA 1ZGJA 2Q1YA 5FP0A 4E22A 2IOHA 2O2SA 1V4NA 2Q5OA 1P9LA 3FVTA 3HCOA 2R6GA 4XFJA 4E5DA 5F9FA 1ZNYA 1FL9A 3CH6A 4O4IF 5LDHA 3BWVA 3NHYA 5JAHA 5KYVA 1BQEA 4PHHA 3WHLA 3COYA 2RE8A 5AVTA 5EJ9A 4K46A 2M32A 3HUEA 1QIHA 1R4AA 3ROKA 3F67A 5AHOA 3D7LA 4OHKA 2ZI9A 5EMMA 1ZVJA 2YUTA 4N8DA 4J90A 4L95C 4PHFA 4ADSG 5ED0A 5LKRA 1TZBA 4KE9A 1A4RA 3JQ6A 4RK4A 1IWOA 1DX4A 2HV9A 2WMNB 2WSSA 3CT6A 1W76A 3K9CA 1R6UA 4LHYA 3BK7A 5EUMA 2XTMA 1ZKDA 3MCWA 3NG1A 4I1IA 5ALYA 5ETJA 3ASVA 2LDYA 3B9BA 5F12A 1QOPB 2QU8A 4RZUA 1KK3A 3UENA 2BR3A 2HFKA 2QN8A 1EDDA 1ZL0A 1JQLB 4O4JB 2WT8A 2XB4A 4YROA 4D6XA 5FOQA 3C2QA 1T5DX 3SZMA 1UMKA 3QUAA 4GVXA 3I37X 4G09A 1Q1AA 5BN1A 2HY7A 1ZVQA 2RBEA 1WXXA 3SEAA 2BZGA 4UW9A 1VG8A 3AERA 3DCYA 5FLKA 4C01A 4URXR 2RK4A 1I0ZA 4PAWA 1VCOA 1TB4A 4QG7A 4MVCA 3LJKA 4HHEA 1FUYB 4BQEA 1Q7RA 2P2NA 5EL0A 4DDUA 2XNKA 4XDGA 5GAJA 3IUSA 2HZBA 4X1KA 5FNVB 1E64A 3GRVA 2ZI4A 2VSYA 3RSSA 4E0BA 3TR0A 2WAAA 4G67A 5JWHA 4RUKA 5KAMA 3T9CA 1OH5A 1DT3A 3NHKA 1IB0A 4PGMA 1ENPA 2DFNA 4G25A 1J24A 3ZI0A 4NU6A 2WU3A 4DUZB 4DR2B 3J81k 3FGNA 2IYLD 2J87A 3SE0A 4DVGA 3LT0A 3O26A 3C14C 5CURA 4CUZA 2G76A 2ZVPX 2PD4A 4FNAA 2QE6A 2WY2D 4HEA1 5KYYB 3D3NA 3TM4A 1E5LA 1RLMA 2EZ9A 4R51A 5JSUA 3ENNA 3EULA 3BDIA 4FU0A 1K97A 4WUTA 4DDKA 1T1GA 2AT1A 3PQDA 4FFRA 1T15A 1YBFA 1CTQA 1RLIA 2VZLA 2WSLA 2BEVB 5A5VA 2C00A 3WQHA 4JJ6A 4RIFA 3L0DA 5LD2B 2G8NA 3PQ3A 1CJBA 1DQYA 3I09A 2X0FA 1NF2A 4DC1A 5JCPA 3VR0A 4DM7A 5MF6A 1KJWA 3QUBA 2CJWA 3A28A 3S44A 3R4CA 5IBRA 4CF3A 2FHPA 4EGJA 1Q7EA 1NKTA 2NACA 2HAEA 3LQKA 1JKMA 1S2NA 2I54A 2QMEA 3B1XA 2BMDA 3O7WA 3R9KA 2PH1A 4NHEA 1I3OA 4RE5A 2GZHA 1IPEA 1KK0A 2QTHA 1D2CA 1BE6A 2QF7A 3FUXA 3SLRA 1HT0A 2JJ1A 1Y7PA 3HJNA 3KAPA 5KMGA 4D3YA 1W85B 1Z7EA 5CJPA 5HTOA 1Y3HA 1PSZA 3MJFA 4H0NA 4TL8A 3UWOA 1JDJA 3AJDA 1I13A 3UMVA 3VOTA 2CLMB 5DTRA 2JPDA 3N6XA 1UPFA 1M33A 3NC0C 1JG2A 2K7ZA 3LUCA 4B3MB 1DTWA 1TCBA 5DLYA 1COWA 3DLHA 4RZQA 1L1RA 4QBGB 3G88A 4J03A 4QAJA 3UB3A 1DAGA 3E9QA 2VJPA 3EDCA 2ODPA 1IG3A 5GADl 4KK3A 1GLGA 2YN0A 3GFPA 1R0YA 2D4HA 2PX5A 4MWDA 3O94A 5IFLA 4PYLA 1QFSA 1T8TA 2JFYA 3OLXA 5FADA 5FORA 5FUBA 2ZVDA 3NHSA 2GOYA 4OLJA 1BEZA 2A4KA 2B99A 1N2CB 2JIMA 1OWOA 1CP2A 4MYTA 4D98A 3IP6A 2RHCA 3WGJA 4K05A 4KQ2A 4E03A 3S2IA 4DNFA 4Y0AA 3QKRA 4Y6RA 1NU8A 1SCUB 3CO5A 5LLDA 2QD5A 3MTDA 5AK4A 2BUCA 2R84A 3TW0A 4ZMSA 4IHJA 4K03A 4HDRA 2AZMA 3FHLA 4TMFA 1V5FA 4WNAA 4KAFA 2IZOA 4W8GA 1C3OA 1HE8B 4HXYA 5HUQA 1ZM7A 4K86A 4PLVA 2PEZA 4ALNA 1NBOA 2C2XA 2ICAA 1XYVA 1LSUA 3DBIA 3MUEA 2AUMA 2C54A 2FF7A 3HCRA 3KPUA 2F9LA 4JCCA 2IDJA 2ZULA 3EGDA 3WV4A 2QX4A 3CEAA 1GUYA 2IIQA 4Q00A 4ZRDA 4RABA 4O1HA 5MDHA 1DEKA 5K0SA 2R11A 2Z8XA 3ZX4A 3DEIA 5CLFA 2I1WA 2YJGA 3WJ1A 2O8BA 4M1MA 3QU9A 4NYIR 1Z2DA 3ED1A 3LMKA 4UAUA 3VR6H 5T8KC 3M3HA 3NOVA 4U6QA 1R00A 1XD8A 1KS9A 3CRRA 4G9EA 2W83A 3TDMA 3K1AA 4WK0B 3H83A 4MNTA 5D7NA 5DFAA 3FLEA 2AJBA 2HPVA 2EFYA 1QO9A 3OY7A 4MDYA 4PTLA 2PL5A 5AI9A 3T3IA 1N1GA 3PJDA 2QV0A 3V4PB 4HADA 4F9GA 2CNBA 1Q0TA 4LYDA 4CLRA 1MB2A 2WFZA 2XRFA 4HLQB 4DBLC 4EGCB 5EJ6A 3DZHA 2WYVA 3I04M 3I9MA 5SY4A 5IG2A 1X0VA 1CVRA 1PT8A 4YUZA 3EF3A 1HE2A 1IC6A 2QNBA 1RAEA 2EOAA 5IBQA 4FT2A 5LFAA 2J3QA 5FLEX 5H81A 5B12A 1M1NB 1XCLA 3DE5X 4MYSA 4PNHA 5EZYA 4D8XA 1UC4B 3EYAA 1G8YA 1FFGA 2X76A 4P6VF 2BBTA 2RD2A 4PPGA 3HDGA 4U8HA 1SB9A 3VNAA 5BXQC 1EBUA 3ABSB 1UWKA 2ZRLA 1ELOA 1M1UA 2F8MA 1KVTA 2VAWA 1CY2A 4HDKB 5D85A 5D7BA 5ALMA 3K15A 4COKA 5B36A 2W2KA 1OTXA 3DMHA 5T7BA 1X1EA 4CTKA 2Z6UA 3UXHA 4PS0A 5ESRA 3NI2A 4N8SA 3VNVA 3B6MA 1YS2X 3TX6A 3LP5A 1QDLB 3L1KA 3DO5A 5EJ8A 4UXHA 3A4VA 4RPHA 3J7AC 4WKNA 3ZWDA 1LRKA 4LY6A 4M9RA 4RM2A 2ZJZA 1DFHA 2HGZA 4QZVA 3BGSA 3WNCA 1TK9A 1T8RA 1U7TA 1UF9A 2F8TA 1RM5A 2ZBQA 1F8XA 2DHCA 3F71A 2JFZA 2P7HA 2PR7A 3CT4A 3DMTC 3MWKA 4OKNA 2IF0A 4LQLA 2JGDB 3FCOA 4GKJB 4WTOA 1BMFA 3WLIA 2ZI5A 1RXUA 3GXOA 3ZJYA 1Z83A 2LD4A 3U7JA 4B2LA 2ANBA 2O0KA 2CXXA 2VF4X 3ORQA 3MTAA 4JXJA 5TT1A 1XA4A 3EVCA 2FRDA 3C97A 2A84A 4LJ9A 4YUYA 5DPMA 3VNSA 5IN5A 3HN7A 4XB2A 1TAGA 1P1BA 2FG5A 4QXOA 1E6UA 2YZGA 3OUTA 5LQNA 1ZLYA 1QUFA 2J3MA 5K4AA 3PJRA 2N1MA 1WMSA 1QRAA 3M8KA 1XCPA 1QYCA 4G97A 4EUKA 2EJBA 4HEA6 4D56A 2Q8PA 1MW9X 3H2JA 3PXCX 3GQBA 5F78A 1Y1KE 2HEIA 4C2BA 3FWHA 1HDRA 4XIFA 3TIFA 2WFLA 4H7IA 1U5BA 2RGEA 2EYQA 4F4CA 1HKHA 2VOEA 2V0NA 1OLXA 5H80A 1QQ5A 1NDUA 4E5NA 1Q3TA 1BS2A 1TA9A 2J48A 4PYNA 2ZRMA 5HQ3A 4X6XA 4MSUA 4WRRA 2RH5A 3CN9A 4ZVKA 3WLAA 1YL7A 2O2HA 4MJ3A 1KI4A 1W25A 3GDHA 2JJMA 3OE7A 1U3WA 4GICA 3UKOA 1B76A 1WZNA 1AKNA 3ROZA 3DBLB 3S27A 5E4YA 1N5JA 3ZCQA 1EMDA 3MPUA 8ATCA 3KWJA 3TSAA 2C03A 2OE2A 3IXMA 2YXBA 3W9YA 4MX8A 3GXBA 4H17A 3JARB 4ND1A 4EVQA 5HIIA 4WXHA 3WL6A 3TNDA 2ENWA 2JFWA 3A4IA 4E2XA 3K9NA 2KLHA 1DIAA 2XIJA 3EDMA 3FYUC 4OB8A 4BP9A 4CU5A 1L5QA 1W29A 3LUBA 3LGAA 4W4TA 5E1OA 5IUJC 5DSTA 2P35A 8AT1A 1VZ2A 3VU9A 1QRRA 4C0AC 1YZNA 2OV8A 1PGNA 2ETXA 2C7GA 2Q8QA 4O25A 4NIMA 4B4KA 5A4FS 5FBQB 2QM8A 3Q3IA 1W36C 1TKCA 2O23A 4P22A 3SZRA 1B41A 3SHTA 3FYHA 3UMFA 4YREA 4GX1A 5TGZA 4BMYA 4BVKA 4LUCA 1EQUA 2VC2B 1KIMA 4CEHA 1PSWA 3AV3A 3W8RA 4Z7OB 1NJSA 3TLEA 3GLIA 4H15A 4AF6A 2UXDB 2A35A 2FP4B 4K26A 3LS2A 1ZJ5A 3FNBA 4IKEA 1Q3KA 3VU3A 1AA9A 4BMXA 3UPUA 1QQ7A 1TTHA 2I99A 3DEJA 1FYDA 4MXDA 1DC6A 1V11B 1RZRA 1VA4A 1Z63A 3AJAA 1TLFA 5JRDS 2J07A 2JK1A 3VJRA 5LU9A 1ZI8A 5CFMA 1C9KA 4H9GA 3DPUA 3ITDA 4HSGA 1P0PA 3L0IB 3BZBA 3LWDA 3DULA 4L75A 3A4LA 2C0QA 5E4JA 4X6UA 3SYRA 1HETA 3MCAA 2H16A 1SN7A 3F74A 5L95A 3QX7A 3ES9A 2H29A 2DEUA 2WPDD 3I58A 4MYDA 3RNOA 3OIWA 3VI4B 4NCJA 5IT9A 5KB3A 1Y3AA 2CC2A 3OM0A 4LYAA 3CBGA 2H5EA 4NK5A 3GZTB 3MW8A 4DY6A 5HKKA 2R1VB 1BKDR 1UMCA 2E89A 4YP5A 1PZFA 4U00A 3KKEA 1JZTA 4NU8X 1PJ8A 3BB3A 1KMHB 4UUOA 1JVNA 1XRMA 3L07A 2BBSA 4XW2A 4UPDA 4UHKA 4M83A 3TB4A 3WMGA 2R8BA 3FJYA 5KOJB 5FWNA 2PZGA 3ZXUB 2IZ6A 4MQBA 3AI1A 1KDYA 3R7LA 1L8LA 1LLDA 1Q6YA 3I2FA 1ISFA 4DUPA 3VOBA 2PUGA 1JXOA 3R77A 2CHFA 3KBOA 5B53A 4WOJA 3C3WA 5BMVB 4N12A 3PPWA 4OL9A 5B3KA 5E38A 3TG2A 2XBLA 3P26A 1UP4A 1RR6A 4CMJA 3Q10A 2HW8A 2GPNA 2EVWX 1IN4A 4LBZA 2XSZD 1J25A 4KIGA 4RH3A 2F7SA 5DF1A 1U0FA 1W8DA 3F2VA 5HZGA 4GMFA 1RWOA 3GNQA 4LYGA 1GL6A 1K9VF 3V80A 5LQCA 3KD3A 2VDJA 1MIHA 2D5AA 2RJNA 2VNHA 3FKSA 3HKBB 3HU2A 3NDIA 1VP3A 4R2LA 2YY6A 5AW1A 3PDIB 4ZK2A 1R6AA 5FUYA 1NPTO 2XGOA 4ZARA 1GL9B 2BY4A 2C07A 3IJEB 1GSAA 4ZVPA 5K0CA 1DKMA 1PG2A 1FMJA 3UCEA 1RM3A 1WKBA 3H16A 3N2GA 5BVGA 2RHBA 2QRLA 3JQAD 1G21B 3ANSA 2TMKA 4PZUA 4UMEA 2YINC 3OPNA 5F4ZA 5E7QA 4RS4A 1X3SA 4OQQA 1Q1GA 4ZI7F 4MUIA 3IEUA 4NE7A 2EQ5A 2YDYA 3B1ZA 3QXCA 1ZCBA 2ZBVA 4C04A 1TQ6A 3CEPB 3NZEA 1ORVA 3LW7A 4KOAA 1USUA 3U19A 4GNKA 1I7SB 1V26A 4N49A 2N42A 4CI0B 1JPUA 3DM5A 1AHIA 3X43A 2DTEA 2OLKA 3BD6A 4M49A 3KKQA 1FZTA 2K2QB 2IXFA 1RAFA 1T34A 4BUZA 4GMDA 2PS9A 4U9UA 1UXIA 5TIIA 1X7XB 1V8DA 2BKXA 1AUPA 4W8HA 2RG1A 3HEMA 4O63O 1LU9A 4F7WA 3NWEA 1ENOA 1IY9A 1TDJA 1U8EA 3E9EA 3ZVMA 2WWTA 3DD5A 2QIPA 4RKQA 4E2WA 1Y6GA 4KFUA 1QNFA 4CG2A 5H4GA 1BA2A 2H0AA 2BGMA 3RASA 1WCIA 1PTKA 2NO4A 4IRUB 4A8JC 1NOJA 1N36B 3DTYA 2J3HA 4P4SB 2V5VA 3RSQA 3C70A 4FD3A 5HUJA 1I1NA 3UHJA 1XNHA 3ISVA 4INJA 3UT5A 4MHTA 2VJKA 3TLBA 4XZ3A 4URFA 1PFWA 5JH7A 4K28A 4N03A 3H2IA 4N39A 1Z2CA 4N3BA 4K1LA 3L7NA 1T9AA 1W47A 2PRIA 3JQAA 4Y1FA 3U0VA 4ANFA 1Q3HA 3IURA 3ME5A 3MN1A 5HOQA 2EBFX 4O8ZA 1AXGA 2A1TS 4RHTA 1FJ2A 4LHSA 2AN1A 3CIOA 1CLUA 4LJKA 3WI7A 3WLRA 4EJ0A 1Z6YA 2DQSA 4KN6A 5DTJA 2Q5LA 3INTA 3S55A 1R6VA 4EAAA 4HI0E 4DADA 3W5CA 4DMCA 5JS6A 2ATCA 1IM8A 4Q93A 1SIOA 2WNHA 3KEGA 1EESA 3VKFA 1WNFA 2Y92A 3E7FA 5EJGA 3TECE 3MAJA 1U8FO 1A2BA 4YAIA 1UPAA 3IPXA 5IWAB 2ZSIA 1RQLA 1V4VA 5TQ0A 3OICA 4D9NA 5BWOA 3G2QA 3B78A 4P4GA 4QLOA 4M76B 3R41A 3TE6A 3TZCA 1T0BA 4F06A 4ZI3A 2X41A 3STWA 5JRZA 2VNKA 2IKQA 1KAEA 4KVFA 5AHWA 4CLXA 1R8JA 3D2BA 3WR5A 3PPYA 2J59A 3CCCA 4PRLA 3ZDBA 1JE0A 1C2YA 1EVQA 3AUAA 3DEKA 3W2IA 2C1ZA 1DCTA 3T35A 1OU4A 3H11A 3O1LA 5F5XA 3RK0A 3TZ6A 5FBRB 3WGYA 3EGWA 5K9ZA 2W6JD 3P97A 3U17A 4M22A 1F2TA 4UE2A 1KZYC 2IYSA 1PR0A 2XXAB 1S1MA 3R8CA 1GNSA 2VP6A 4IFBA 4AKIA 4RGYA 3A10A 5JFGA 1JH8A 4RADA 4QU0A 1P0CA 4Y9SA 3ZJVA 3VPHA 4MQUA 1J0DA 2ZYHA 4P08A 4H27A 4QPPA 4B3GA 1X7GA 2A0XA 2O59A 1LWNA 2X0KA 4HPWA 3AY7A 2J0SA 2AJDA 3B6IA 3B6ZA 4P5PA 3TUZC 2ORWA 3EIQA 1ES9A 4M60A 2CCGA 2HHLA 1L5VA 2IEDA 3DL2A 3II6X 3PNKA 3I9V6 2F6RA 4P33A 3V1LA 2PRJA 1W36D 1ZD3A 5FYQA 2PMBA 2R8XA 4BKRA 2BCEA 2BI7A 1X15A 1W1UA 2PCJA 1N6NA 1V6AA 4Y6GB 4EI9A 4I5DA 1F5SA 4ZI7A 3O38A 5F7OA 2AIRA 3ANLA 3QHQA 1OPXA 5LXTA 3PHBE 3PL5A 3T3NA 4ZCMA 1SCBA 1DC5A 5T4HA 3FDZB 4KXMA 2XZDA 1NXSA 4CZ2A 4CLRB 2XQKA 4X7RA 3FSRA 3E58A 1UH5A 3IAHA 3KWLA 4P5DA 2XA2A 5PNTA 4EYGA 4ZYWA 4XWKA 1QS0B 3L6CA 1HFKA 4C7MA 4DSZA 2HXYA 2KMLA 2OCDA 2P5SA 1UJ4A 3AXTA 5PGMA 1YS9A 2FR8C 5BR7A 4H6PA 5D3MA 4DLYA 1Y6RA 3HVUA 2C88A 3ZW9A 1JI3A 2R7NA 5T6MA 2B4KA 1YNOA 4M9XA 1I1QB 1VSQA 2I4TA 1TMYA 3FB4A 1B43A 1J7KA 3LPMA 3AP3A 3PNSA 2XGMA 4LISA 4PWZA 1YUNA 3QA9A 4R01A 4R5HA 5FBHA 2M6LA 1KAGA 2GTPA 3ZE8A 3O8RA 2NG1A 2IP1A 4IGKA 5K8LA 1AQUA 3B3QA 3BD9A 4FN4A 1RJDA 3NRCA 3ESXA 4TX1A 2G9VA 5TPZA 3RG2A 3TNYA 3L1IA 1E1CA 5HKLA 4C4PA 3CTPA 3TBFA 2IS6A 2BGNA 5DM70 1NUSA 4MVJE 1Q16A 1Q7TA 4L9AA 2C5AA 4WEOA 2OV2A 4YRBA 1BX3A 4OHUA 1EFVA 2ZK7A 3ILYA 3MRXA 2BRUA 2B1IA 4G0YA 3SZUA 3O7MA 3PHJA 5I8WA 4TMKA 4RJLA 5EIBC 2B92A 5MN5A 4ESEA 4LK2A 1PFVA 1B6SA 4NQRA 2FQ1A 4NFYA 5C1IA 3CXUA 3HYRA 2BVNA 1M8JA 1BOFA 4HZUB 3PC3A 1ZW1A 4I19A 4YBRA 1A3CA 3Q2OA 3V6MA 2PR2A 1Q7BA 4JA2A 2IRWA 2HCBA 4UMDA 5FBZA 1C8KA 1DBWA 4BB6A 1K6JA 4RK7A 3UK0A 4M0EA 1PNQA 1G20B 5HG0A 3ET4A 1UFOA 4JN6B 5IC5A 1CHNA 3X1YA 1HOTA 3G0GA 1EFHA 5I7SA 3TQSA 3ICQB 4MS4B 3F7TA 1TU4A 2AA3A 3VYVA 2PVPA 2J5RA 3NQ41 5CYGA 1J56A 5HOEA 5IVHA 3VA7A 4QM6A 3CGWA 3G1TA 1NNUA 4DJEC 1ZEMA 2QUKA 3QE4A 5U4XA 3ZDEA 4PRKA 1X1AA 1GZ3A 1K7YA 1LKZA 2Y76A 5TE9A 5DTIA 5MGBA 2V54A 4IDQA 1B8OA 4IS2A 2OBMA 5JAIA 2QQ5A 4PSDA 1ZMOA 2VDKB 2KE5A 1H5NA 2YVQA 2D7CA 1NUHA 2JGKA 2AJTA 4R0NA 2F4VB 3V7FA 5LLSA 3GZNB 2F43A 3L0BA 3LHKA 1SVKA 4U2BA 3TJRA 4JI4B 2BDUA 4YRFA 4B7AA 4TL6A 1KOLA 3UWMA 5L53A 4A8TA 1C9NA 2BIFA 2GK3A 1OJ7A 4MEAA 1J8MF 3LUHA 3DHYA 4G5RA 1NX6A 3GLHB 4P5EA 4G86A 4Z7JA 4RFVA 2ORED 3O4FA 4YK7A 5LP6F 4TVKA 5CX1A 1RP7A 5DM60 1IZ7A 3CJQA 3EVAA 1XDBA 2D06A 1WY5A 3AF0A 4CODB 3OOJA 4H6WA 3QBVA 1TF7A 4KMMA 1C4WA 1CR6A 2GXQA 3Q3CA 5KTNA 1I7DA 1KEKA 2XA1A 1AZWA 2GJ9A 3L4JA 1LBSA 3T7DA 1U8TA 1QCDA 4IDBA 4E1AA 1DC7A 1U0EA 2XQVA 4HDKA 2YQ5A 1UFVA 1VL8A 3CW8X 3DL0A 3AP2A 3F96A 2WSBA 2XVXA 3H1EA 2C99A 5ECYA 2ZDQA 2FSFA 1M7GA 5BN4B 2GEVA 2JAXA 4UCFA 5M3BA 4QKQA 1O95C 2I1QA 1LDGA 1H2YA 3HCBA 3ZHCA 5I7RA 1OY1A 3EAFA 1C0KA 1PZGA 1M9NA 1TUBB 2I87A 2JD2A 1ECGA 3FH0A 3BTVA 4PGHA 5CW1A 2ATXA 3A1UA 3KDPA 3WBJA 3GLGA 2C04A 2QNRA 4MV4A 2GAFA 1UBFA 2VBCA 5C5IA 2D2IA 4BQIA 3BF8A 1E9BA 2OVBA 1R15A 4YY3B 1G42A 2VDWA 3BJRA 5EXTA 1G1AA 1Z6GA 1LDYA 3UATA 1JG3A 3UEOA 2FPGB 3UPDA 1ZESA 1FVXA 3G2IA 4KXNA 3CLVA 5KO2A 2Z09A 1KHTA 1X7YA 2FZWA 1I3LA 2HD4A 3K0FA 2WIJA 3EBLA 1KI2A 4J0GA 5HQJA 5AJZA 4HFRA 5B7QA 3HR4A 3IJPA 2J32A 4AJLA 1QG6A 4AYXA 1YRYE 3C16C 4EKIA 4PAQA 2AFVA 2UZ4A 1N5LA 1JIUA 2MSDB 1GITA 1YDGA 2VTVA 4HNAB 1S9DA 3FCUB 5FWYB 1W35A 1H4SA 1O5IA 1FLAA 1AKYA 3FUVA 4M7PA 3CINA 2IPXA 5F9MA 3VU8A 3ICOA 4Q3OA 1E5DA 3PDCA 3CNEA 3NGXA 5FKJA 3DQPA 2WE8A 4NBRA 5DSZA 1SOUA 1IY1A 3B1JA 3P2KA 1SD5A 4ARUA 5AVWA 1GTG1 3KT0A 4BO7A 1IY2A 3BCSA 2Y71A 3HFJA 3BMOA 3DE4X 3U3XA 1WPRA 1G63A 2XMPA 5FJIA 3H5RA 4YX9A 1UZUA 3HSKA 4IUYA 1P4HA 1SWWA 1Z4NA 3F5MA 1RWQA 3N0XA 3RVPA 2HR1A 5A9RA 3UMJA 2BLLA 1QGUA 5G4LA 4IG9A 2H1CA 3IAEA 4U3JB 1FLNA 4UJ3A 1JQAA 3NHFA 4KO1S 4ESVA 4Y2XA 2Q0XA 4OY3A 2B0JA 4FGJA 1IOVA 4S1NA 3RRBA 1E9RA 5A6SA 1KMCA 3HADA 3TBHA 2C7RA 1BYUA 3NAQA 5AKEA 2R6FA 2XEDA 4YXFA 2VSOA 4LXIA 2IHYA 1AGPA 2PLFA 3DTTA 3IV7A 2EJWA 1V95A 2TMDA 2W0MA 2CZGA 1D0IA 1Z88A 3MTEA 2CJYA 4WQMA 2EJUA 4OKIA 2XT0A 2YZMA 1DADA 3CVVA 1ICEA 2ZTHA 4MVYA 4PYRA 4LF7B 4XIIA 3TOSA 4I50A 5DP1A 1UOOA 4JODA 2XGSA 5D6NA 3GP8A 4XGIA 3A2LA 3P2IA 1FCJA 2OC9A 3AKYA 4GPD1 1ZUWA 4QDJA 4LX8A 2WVAA 3WYBA 4QD3A 4BNDB 3H5TA 3K5IA 3DFIA 3LNTA 4KQFA 1T1SA 4IQGA 4NYMR 4F7DA 1GZUA 1KMIY 4YV1A 3ONWA 4Q9DA 1O2DA 2E4XA 3SPXA 1GKIA 1NQOA 3JR3A 4LJ7A 5GMOA 5HE8A 1NE7A 2XDQA 3CUUA 5G40A 2NSHA 3DPSA 5L40A 3RUHA 3CEJA 3T7JA 3U62A 2CVHA 4TYNA 3CF6R 1YZ3A 5JV5A 1JDBC 1ONNA 1VP9A 2F8SA 2FOIA 1TC2A 1C9EA 1EFCA 1VECA 2JA1A 1VLZA 3FNQA 3HCPA 4G5HA 4AMUA 4UEKA 4EELA 4X41A 1Y1RA 1D07A 2DU8A 3GGGA 3QPBA 3QSGA 1EFLA 1OHHA 2G67A 3FCXA 1W52X 1KMHA 2G25A 1EFPA 3IBSA 5F1PA 5GONA 4G5XA 1BXKA 1G20E 4X93A 3VR5A 2XKKA 5GIOE 3JWPA 1ECBA 1HDGO 2Z8ZA 4OQZA 2ZGVA 4WA8A 3QSYA 5I8ZA 3REFA 5TPWB 4BXOA 2CXTA 4PZLA 3JSXA 4YMUA 5KTYA 3VR2D 2P3LA 3I6YA 1KP2A 3LLMA 4N65A 4KSYA 4OA5A 5DWVA 5BVHA 2XB6A 3CZCA 1CJSA 4FE7A 4DA6A 4DMHA 1L5LA 1U3VA 2IW3A 4WT7A 4RVGA 4BJ6A 4ARIA 2DFKB 2PSEA 1Z56C 1OC4A 4FNOA 4Q4AB 2CLKB 4BNFA 1Z0ZA 4AZWA 2P6RA 5A0VA 1J2EA 4ZN6A 1HLGA 4UZSA 4TQ9A 2W43A 3BWYA 2NO7A 1JZQA 3BD7A 2ZS9A 5IZCC 1Z35A 4M1TA 1FTWA 2ZBPA 2HMVA 3MA0A 1KRHA 4PCVA 4ZCSA 4CNQA 2VDUE 4EUEA 2RKWA 5K0BA 3H2GA 4OXKA 3OHSX 1AX9A 4HQKA 5JIBA 5KQLA 1KDTA 4FGUA 4X8OA 5A7GA 1C3VA 1ZICA 5HR5A 3O8LA 1KQFA 1OH7A 3G85A 4EG0A 1XZKA 5HIJA 1C8BA 2YIJA 4QJ5A 4J16C 3U4MA 1CRQA 2WSIA 4V0OA 3T5BA 1N7GA 1HEUA 4H4DA 5FBWB 3SQWA 4AM8A 3IUPA 2E85A 2A5YB 1SVNA 4IF4A 3VR5H 1ZRSA 2GEDA 3AHIA 1EA5A 1R6TA 1F1JA 2QD2A 2B1JA 3INYA 4TLCA 2H48A 5HCNA 2OYCA 1W0KA 3EOZA 3C5CA 5AQEA 4JVSB 4ND5A 3IERA 1MTZA 1GUAA 3UA4A 3MB5A 4NXNB 2O7SA 1O8CA 2RIPA 3HPRA 3TS1A 2VWGA 3WLTA 1RWXA 4G5QA 4B71A 3JD1A 2AG1A 5AJUA 2A9RA 3E05A 3ZIAD 1WXEA 4WLOA 4JYAB 4GRIA 3UF0A 2AFIA 2AMYA 1TM7E 1GG5A 4NBVA 4UM5A 3VC2A 2H0RA 1ZO8A 2QD1A 4Z2YA 1U94A 3DCJA 4OI4A 1GU0A 2AC7A 1V8OA 3GAAA 3NJ4A 4OA8A 2W6ZA 5CDFA 4CTNA 4P0PB 1RZRD 1YQXA 2J67A 3X2EA 3BHIA 4UHFA 3AM1A 1TT5A 1PLLA 4RIIA 3X2FA 1N7HA 4E3ZA 2L18A 2ZJFA 1AK1A 4UBOA 3ML1A 3W6NA 4UPEA 4GMXA 1O6BA 2C29D 1XMQB 4BPBA 3D6JA 1DQZA 4OQFA 1P6QA 1USVA 4NRDA 4IAOA 5KSWB 1Z15A 3B12A 2QZ9A 3SEZA 3FOAA 3TZLA 2J3KA 3U7QA 5BT8A 5A4JA