2ZRGA

Msreca q196n datp form ii'
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
326
structure length
309
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRETGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein recA
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
total genus 76
structure length 309
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrgA01
3NXSA 1V43A 3B8HA 4D82A 2GILA 4LV6A 2J7PD 1ANKA 1NVVQ 3H0KA 1R0ZA 2FSFA 2XAUA 4PHHA 1U94A 3D7MA 4YMUA 1TEXA 3CBQA 1R0XA 1TQ6A 4A6PA 1H8HA 1Q3HA 3JZAA 1CTQA 1G16A 3NHAA 5KDOA 3L0OA 1RRCA 2QQEA 4GMXA 2O0JA 3ZLJA 4RD0A 4IDPA 1XDBA 2FMXA 2CHVA 3EARA 4PC7A 1GL6A 1P9NA 1G8HA 3P27A 4H9GA 2QI9C 3I4LA 2Z4SA 1DG1G 2F3RA 4HAWA 2ZEJA 2DBYA 1JECA 1OFUX 1KJYA 3IKJA 1R5OA 2ZXUA 4Q47A 4B75A 1NJFA 3U3JA 4BWYA 4MKGA 4Q7JB 4EPXA 4AKIA 4B71A 2ZUBA 1KI7A 1JR3E 4DLZA 2ZRDA 2G1JA 1TPZA 2FG5A 4Q7LA 3PR1A 2CL7X 4XJXA 5EUMA 4C0HA 2GETA 3KUCA 3FDIA 1S1CA 5GVSA 2V3CC 1SVKA 3WY9A 2QBYB 5FBLB 2O0KA 4A92A 4B34A 3B13B 3GCGA 1ZBDA 3EPJA 1M8PA 2ZI3A 1Q1QA 3AF1A 1GRNA 1ETUA 1OH5A 1UADA 1RIFA 3HU3A 4HAYA 1N2CE 3SE0A 5CYPA 4PX9A 4DUGA 2GXAA 5K8LA 3VR3A 2ONJA 4TZ0A 3Q7QA 2FEMA 3MCAA 1Q1BA 2GTPA 2RGGA 1R0YA 4B47A 4CF7A 3U7GA 1WBBA 1BIFA 1BMFA 2ZJBA 5KTYA 4X8OA 1NSTA 2J45A 2I1QA 2EW1A 2PT5A 1MKYA 1ZNXA 5HR5A 2PT7A 4BQSA 2V6IA 1CULC 4D4MA 1Z2AA 3ONWA 4B3BA 1NRJB 4EPTA 3I5XA 2V55B 3T1QA 2ZVPX 3TKLA 4QOSA 4MQBA 1R8QA 3CNNA 4DCTA 3OIVA 1PLJA 5EP1A 3QG1A 1XNJA 3TK1A 2PH1A 4UXHA 1AQYA 1XEXB 4V0KA 4KBFA 4G1UC 4OQXA 2ZR0A 1NN1A 3SI7A 2R6GA 3K0CC 1G17A 1YZKA 2P3SA 3ZS9A 2A5JA 2IYYA 5EXXA 4EFLA 3EWAA 4MRNA 5FUYA 1RJ9A 2GCNA 3AVPA 1KO4A 3RS3A 2VSXA 4D6PA 1U99A 4I1UA 3IBGA 1JEEA 3U3RA 3NEYA 2YHSA 4F91B 2JGNA 2ZR7A 4URZR 2EFCB 2ZETA 1D2NA 2ZQ5A 2DFTA 1FNMA 1UPTA 1W36D 1EFRD 3TVTA 1E0AA 2ZYUX 1QRAA 2H5EA 2Q9BA 4B3FX 1CU1A 3A1VA 1CJKC 1HURA 3FHOA 2XTZA 2XSZD 3E5HA 3KQUA 4R7ZA 3B1WA 4N3NA 4KITB 1CRQA 3QSYA 2C03A 3KJIA 4C30A 2OSBA 2BBOA 1S0UA 2OFXA 1AJEA 3M4YA 3N5CA 2KB0A 4EQ6B 3OAAA 1HT1E 5KU1A 5CIQA 4C0BA 1G7SA 1CIPA 1W36C 3VHXA 4P4UA 3LW8A 2A5YB 3IPXA 2NTYC 3AQ4A 2O0HA 3LVRE 4RD2A 2NZ8A 3P4XA 2XTNA 3ZQJA 5FL7D 1OFIA 1OJLA 5FUVA 4RZ2A 4EAQA 1U9IC 1E1QD 4V03A 5DN6A 4TMWA 5E7MA 4B2LA 4M9ZA 1ZM7A 2GCPA 4KBGA 4IRUB 2H17A 3T1TA 1GRRA 2G0NA 3UG6A 1IN8A 3NBFA 1LS6A 4FIDA 3VR2A 3QKSA 2E1RA 3RYTC 2ORVA 3QXHA 1M34E 2BV3A 4TT3A 2A5FA 3W5JA 4BFTA 1DS6A 1MO6A 2IS4A 4EJSC 5H1YA 5JJKA 2GK6A 1M7HA 2XZLA 1NG9A 1C1YA 1DG3A 1E32A 2AXNA 3LO5A 4GT1A 5FI0B 1K5GA 3P26A 2XGJA 3HPRA 1QVRA 1EX6A 3E1SA 4G01B 4UNRA 3K70B 1LTQA 4X8LA 2GBLA 5EE5B 1E1RD 3DOEA 1EFCA 2QY9A 3GJXC 1EK0A 2UZ3A 2ZS7A 3VU9B 3VNVA 3WP1B 4I81A 4YMTA 3S1AA 2VTKA 4FMDF 4KFTA 1Z08A 3THYB 3FHTA 4U02A 1R10A 5H68A 4BLPA 4FINA 1VYUA 2NMVA 2OEPA 1VIYA 2MSEB 3E70C 3RABA 4CEHA 1U98A 4QNRA 3RAPR 3FKSA 2ZPTX 3A36A 4ZCLA 3AH8A 2GJKA 4YDHB 3CZPA 4BFXA 2QG6A 2WSMA 1GKYA 4XVUA 3UMRA 3WMGA 1W48A 2B92A 4QG7A 3VQTA 2ZREA 4OKSA 1D9XA 3WBKA 3WNCA 2PX3A 1RPZA 1M7BA 1ZC4A 1P61B 4HAVA 4PTLA 4DSOA 1E99A 2KE5A 2FA9A 3I92A 1W49A 2F7SA 2QPAA 3EZ9A 2HUPA 3GJ7A 4JBWA 4D0NA 4LBWA 5TY0A 2IUTA 1LVGA 4BFYA 2OBLA 4EPRA 4RD4A 2QMOA 3UWOA 3GLFB 1GZSA 4IDQA 1Z6XA 4QBFA 5D3QA 3GLIA 4HYYA 3PUXA 3BC1A 4BFUA 2VQSA 3F8TA 4I4LA 1E2HA 3VKGA 1N5IA 3X1WA 4FXPA 4XD7D 3I5YA 1ZMXA 5TDHA 4BZQA 3KQNA 5JZVA 1KAOA 5AUOB 2GK7A 1BKDR 4M9QA 1D5CA 1NIPA 3BOSA 3QKRB 5BQ5A 4G5OA 1SULA 3DEFA 4RSGA 1W0JA 4MA4A 5DYGA 1ZNWA 1N0UA 4OK6A 1ZNZA 4M2LA 3GFPA 4PQFA 4OYHA 2QZ4A 1T8TA 4UXJA 4JLNA 3A1TA 3ZVNA 2BBWA 2Y8EA 2RKOA 4YONB 2I4IA 2ZJ8A 4IFBA 3SJAA 4PPGA 1IJFA 3B1XA 4WBSA 5TMPA 2GXQA 4PAQA 5FR2A 4RZ3A 3CZQA 3BB4A 4OJQA 2MSDB 2Z4RA 3R8FA 5KYKA 1IAQA 2NIPA 3SYLA 4LJAA 1W4RA 1L4UA 4GMDA 4TLEA 4OHXA 2RGDA 3PEYA 4KFUA 4GI7A 4Q4AA 1XZPA 2JLWA 1XJQA 5A5GA 2VHCA 4F38A 5BXQC 2ZRLA 5G3ZA 1UKVY 4PO9A 3AP2A 3M6AA 4MGZR 4DVGA 4UNNA 1CP2A 1G19A 2PX0A 3K9LA 2WWHA 1JPJA 1RYHA 2A3RA 2C04A 3MWJA 2VP2A 5HZHA 2WKQA 3B6EA 4C0KA 3HR7A 4AKHA 3WXMA 3TE6A 5J4KA 1AK2A 2QBYA 3CRMA 5CDFA 1XCMA 2BMFA 1F3OA 4B2PA 3SJZA 4C0AC 4RKEA 4D2IA 4Z1MA 3D8BA 5P21A 3QY0A 4YC7A 4OQLA 2IYVA 1O87A 4Q4JB 1II8A 2BEJA 2XNDD 1G1MA 1SXJB 3BBPA 4AD8A 3WYAA 3KTAA 3U60B 2Q3HA 1Z0KA 3GLGE 4RCZA 1Q20A 3KX2A 3DZ8A 2H57A 1P2VA 3OE7A 4ABYA 3QG5A 3LWNA 4TMVA 1NNEA 1W1WA 2XXAA 4M8NE 2Z83A 4ZV4A 1YZQA 3L8ZA 3GLHA 1U90A 3PJRA 3LA6A 3VTKA 3CLVA 5L8VA 5DO9A 1N25A 1AS3A 4P31A 4MKFA 1MV5A 3KKOA 1MR3F 1HTWA 3BAFA 3W34A 3IQWA 1GKIA 5GJBA 4A1FA 1KGDA 1HE8B 4M1SA 1E94E 3THOA 1VCOA 4HB4A 4RZUA 4QGGA 5FOWA 4GBMA 2JLUA 1DARA 1Z6GA 3T15A 3GD7A 2PEYA 2VP4A 1XJCA 4GZLA 1T6NA 3D3QA 4HLUC 2XX3A 3BB1A 2WPDD 4DRZA 5ANRB 2VSFA 4POAA 2OAP1 2ZI7A 4X8MA 5K8UA 2OLJA 1G9XA 1OB5A 1OXUA 2CJWB 4DZZA 4Q4LA 3KB1A 2GESA 3EIHA 1XMIA 2AR7A 2ZS9A 4Q18A 4IOLA 3ZH9B 5DGXA 2QAGA 3FMOB 3SZRA 5B57C 3FFBA 1R6BX 3ND9A 1J2JA 3NC1C 1COWA 1GNQA 4XTRA 4KO8A 3ND8A 4AYWA 2OFOA 3FKSD 3CRVA 1XP8A 2DWPA 3F3YA 1PLKA 2GXUA 4OI2A 3TGPA 3IILA 2ZANA 1SXJE 4RD1A 2ORIA 4QGAA 4TL9A 2IK8A 2ZSBA 1Y63A 4ITRC 4XSGA 1MOZA 1F2TB 2QAJA 1ODFA 1KSJA 3H2YA 5EP2A 2CLSA 2XNSA 4TTRA 3TJZA 4DLVA 3FOZA 4L9SA 2IYUA 2F9LA 4PPFA 1P3JA 1KY3A 2GZAA 3NHBA 1XFAA 5L3SA 4TN1A 1CS4C 1XMJA 3VX3A 2AX4A 2X77A 1KI4A 2AD5A 1NMXA 3T5DA 1CF4A 4B74A 2FJUA 1N0VC 3WHKA 2ZSEA 1D2MA 5JECA 4Q1CA 3EZFA 4N1AA 4OHWA 2JLRA 2QTVB 2WOJA 4K81B 3RWOA 4F4IA 4OL0A 1A2BA 2CCJA 2YJTD 521PA 3SBDA 4R71A 2W6IA 2YOHA 1VYVA 3VU9A 1G6OA 1GWNA 2G3YA 3UKDA 4YXWA 1W0JD 3AUXA 1KI8A 2AD1A 5JWHA 1CJTC 1DO2A 4QJ4A 4CIDA 2ZROA 2FWRA 4Q7KA 4XTCS 1NSFA 1ZUIA 4L9WA 5FFMA 1H8ED 2X8AA 4KVAA 2WJJA 1U0LA 5EXPA 1FOEB 4TMZA 4XOIA 5KDLA 3CM0A 4QHTA 4CZ2A 1G7CA 4A2WA 4KYUA 1E79D 3FYHA 4FN5A 1NMYA 4II7A 4UNQA 2B6HA 2RHMA 2W00A 1MO3A 2GF0A 1J8YF 3X1ZA 1FP7A 4D25A 1EFUA 2DFKB 2J5XA 2PZGA 1FNNA 1R5BA 3BD9A 2ZRBA 2C8VA 1Z28A 3W5IA 1XCGB 3GJ5A 2ZU0C 1JPNA 3GLFA 1TQ4A 6Q21A 4QNMA 1VHTA 1ZD9A 2CXXA 2JLQA 4HLQB 2WMNB 3DKPA 3MGCA 3B9PA 3GFOA 1U2RA 3FGNA 1LW7A 2EFHB 2W0MA 1E2GA 2Z0MA 2WWIA 3EC1A 1P75A 1NLYA 1XXHE 3M0EA 2KI5A 3IDQA 4BFZA 3RHFA 5K8TA 3WYGA 2JLYA 2RGNA 3OEED 4L8GA 5JWOA 2DFNA 2PCJA 1GDDA 1TTTA 1QZXA 2QN6A 1W7AA 2C5LA 1N5LA 1T3SA 4RD3A 4B3XA 3AEZA 3NBZC 2O8DA 2NPIA 5F2EA 2IL1A 5DYIA 3PCRB 1UAAA 2WOOA 1Z63A 1HQYE 3OZXA 1G41A 3BIFA 5F3WB 2P2LA 5JS7A 1JB1A 1XTSA 3Q8XB 1WRBA 1VYTA 3W8NA 5B2ZA 1E2QA 2JAQA 4BFSA 5G40A 2HLDD 4IEEA 5A4JA 3CONA 3KKQA 4XVQA 3QKSB 5HCNA 2F1HA 4LI0A 1P6XA 4ERNA 2CL0X 4TLCA 2FNAA 5JS8A 5F9FA 4MGIR 2IHBA 1FTSA 2RB4A 2ZJZA 3TSOA 4DDTA 2ZJ5A 4FMCF 1N5JA 2VIIA 3ZJYA 4CGZA 3PVSA 4TZ6A 1E2KA 1VDZA 2EWWA 2IS1A 1Q57A 5GJCA 1SKYE 2HF9A 3VR5A 4W5JA 4W9MC 2RGEA 3QXCA 4C7OA 2QEQA 5LB2A 1DAFA 2A5GA 2C99A 5EE1A 5JEEA 2OILA 2CEAA 2GCOB 5DIFA 3RS4A 2ZSFA 1N6OA 1N6KA 4LJ7A 3S1AB 3QOFA 4OI4A 3LX8A 4PC6A 4IFEA 4TL7A 3Q5EA 1AM4D 2F1IA 5AJXA 4CDGA 3KQLA 2DR3A 4CRWB 4JYBA 3LW7A 1BOFA 4CEHB 1DE0A 2WV9A 4NCHA 1T3LA 2QA5A 5SZHB 4ARZA 3T61A 2QMEA 3C5CA 1AA9A 2CDNA 4JSYA 3TBKA 2FSGA 1P2SA 1XWIA 2NG1A 4PAOA 1IXSB 2VHJA 1XRJA 4JLPA 1NLFA 2EYUA 4MGKR 5EP4A 2WWGA 4Q9LA 1DOAA 4A36A 2CK3A 4A0RA 1WXQA 2JIZA 3P1JA 2P6RA 4JLDA 4BZPA 4D26A 4HDQB 421PA 3TNFA 2LWIA 3A4MA 4N0DA 4NU0A 3D31A 3R8CA 3PUZA 3RC3A 2JLVA 2IC5A 1GOTA 3L8YA 3O8BA 2ZM5A 4NONA 3AVUA 3R9XA 4DLTA 2RGCA 4TYQA 3GLIB 2N1BA 4V0LA 1AZSC 1GUAA 1P73A 1FL9A 4TMTA 3A8TA 4K46A 1I2MA 1GM5A 1SVIA 3C5HA 3RSOA 1X8LA 4JJZA 3WBJA 3U61B 3ZIAD 3MFYA 1KNXA 3L0PA 4WIAA 3P20A 4EIWA 1S4QA 2BBTA 5J5CA 2IWHA 2IW3A 4HI0E 1AS2A 3FMFA 1B0UA 2REOA 3CF2A 3TIFA 2LKCA 3K70D 5FR1A 3IUYA 4I99A 3AV0B 4IEIA 4U00A 4DKXA 1Z29A 1G3IA 3B82A 3AVYA 1YQTA 5BN4A 3A4LA 4YXWD 2CJWA 4MYTA 1OH8A 1VTKA 4EKDA 1HY3A 5CM9C 4TMXA 1G21E 2F43A 1E2JA 4M9XA 2WSSA 3DZDA 4AWXA 3C8UA 1FFHA 1N6PA 1H65A 1G291 4KSBA 1E2LA 1ZM4A 1CLUA 2ZRJA 1XD2A 3K70C 1E2DA 3U5ZB 3AF4A 1ZC3A 2EFDB 3G82C 1RYFA 5KSPA 2AKYA 3TSZA 2IYZA 4DLRA 1WB9A 1A7JA 3PUYA 3L2OB 2AFIE 4M1KA 4Q4AB 1CR2A 3QEJA 5JSZA 1F2TA 1OYYA 4KCGA 1NN3A 4UNSA 2BM1A 3WNBA 3SJCA 3T12A 1SVSA 3KKMA 3AVXA 1NN5A 1ZINA 1NLZA 4JLAA 3ADKA 3H86A 3R7WA 2YWEA 3EZ2A 5FTJA 4AURA 2JLZA 4O2RA 2G9NA 5A0FA 4E5UA 4GFDA 1AGPA 2YINC 2ZAMA 2AWOA 2GJSA 4NH0A 1G8GA 1U8ZA 2BKUA 1XPOA 1FW6A 1P9RA 4JLJA 5EE9A 2BIFA 1F5NA 1WDTA 2FFAA 3U3KA 4MUAA 5LD2B 5JWRA 4QM6A 2K5UA 3QXXA 1U0JA 4GP7A 4BZXA 1RC8A 1UEJA 1V5WA 2BMEA 1D6JA 2FH5B 4OQNA 4OHVA 1X86B 2YC2C 2QUZA 3KJEA 3K09A 4P4SA 2FU5C 3X1XA 1II8B 4YMWA 2CBZA 1CKEA 3AVQA 821PA 2MSCB 3KTAB 4D0LB 1ZYUA 2C9OA 3L43A 4TSFA 4JLKA 2ZYVX 3JVUA 4P32A 1FQKA 5TXGA 2BMDA 3RLFA 3E2IA 3IIKA 2XOKA 5AUNB 3CKLA 4NE2A 1XTRA 5FPSA 1TAGA 4G5GA 2CNWA 1UKYA 1OH7A 4PC2A 2C9CA 4C0JA 2XXAB 2XB4A 3GJ0A 4NCJA 3GLHB 4GL2A 1GKUB 4E07A 3DO6A 1ESMA 2ZU6A 4KODA 4Q1DA 4E09A 3OFNA 4MRVA 5FBVB 1XTKA 4JS0A 4C0LA 2NGRA 4I1OA 2FZLA 1E4YA 2IXFA 5FUXA 2IEYA 2VP0A 3SC3A 4LOAA 3V9PA 1OXXK 1VHLA 4F4CA 4V02A 2DHRA 4WXRA 1IY2A 1C9KA 3PG5A 1YR9A 1IOZA 5IF9A 2W0SA 4DCVA 2ZI6A 3MRSA 2XITA 2RGBA 3D6TB 3LV8A 2VHUA 4IKEA 1US8A 1YRBA 3OIWA 5B64A 5BN5A 4YMSA 2F3TA 4M1OA 1XMSA 1OIXA 3GPLA 3WRXC 1SKQA 1TADA 4CEIA 2ZYTX 2ZVQX 5E4FA 1LNZA 3MJRA 4LJ5A 2J87A 2OHFA 4WVFA 3GJ3A 3B78A 5IDVA 2E9SA 4HATA 2CL6X 3O8CA 2BDTA 4AYTA 1NVUQ 2QAGB 1R2QA 1Z3IX 2EQBA 3GEHA 3QPUA 4KFRA 2ODEA 3EWSA 3LAWA 1DBSA 2GVZC 2OXCA 2PJRA 1L4YA 1P7CA 1OFHA 1SVWA 4M22A 4Q1BA 1NBMD 5KO2A 2HCBA 5CLQA 4V0MA 4JT2A 4Y0AA 1XTIA 2G1KA 2JJ1A 1UF9A 1SXJD 1D8TA 1OW3B 1T3HA 3PQCA 2WIAA 3Q9LA 2PZEA 4E22A 2PCLA 3NVAA 3PIRA 2BOVA 1CJMA 4FMDB 3ZZTA 1E9AA 1Q44A 1KDTA 3CPJB 2HJGA 4IOMA 5TV2A 4ZIRA 3H4MA 4KFSA 1ZNYA 2R62A 2ZRNA 2IXEA 5TB5A 4DHEA 4LUCA 3WHLA 3M1IA 2AFHE 2ZRGA 4RFSA 3RANA 3JVVA 1ELOA 1FP6A 1Z0IA 4HAZA 1Z6AA 4DLYA 5JRZA 5L3SB 1ZM3A 2VBCA 1SXJC 4E03A 2QP9X 1YR7A 1XJ0A 1TNDA 2WWXA 2ODNA 4PSKA 3SOPA 1E2FA 1F2UA 2P0EA 2GKSA 3Q85A 4A15A 5GJWC 1XPUA 5EE0A 3H1TA 3MLEA 3LLMA 2QTHA 2V6JA 4PSAA 1RE0A 2VSOA 4TQUS 2EU8A 1WP9A 1EGAA 2GCOA 2ZRMA 4RY2A 4PSVA 4D4LA 2WJGA 3HJNA 5J4YA 2F55A 1KAGA 1X3SA 3DHWC 4LJ8A 5AJVB 1KSFX 1ZW6A 3AP1A 5HKKD 4NYJR 4B43A 4HDOB 4HZIA 2A7QA 1MRSA 2CE2X 4URUR 2IS6A 3CUEF 4I1VA 4EDHA 1OSNA 3QXJA 2ZI9A 4HAXA 5CJ2A 4XVRA 4EUNA 1XTJA 1MABA 4JVSB 2QQ0A 2P5TB 5E95A 4TYPA 4ASUA 5SZJA 4JKYA 1JQJC 1Z83A 4OHZA 4DC9A 4ZKDA 5KUTA 4HAUA 1IONA 4BLQA 4DWJA 1H8HD 3CR7A 2W2TA 2F1RA 3W6PA 4JT4A 4PPQA 1S1MA 5FOSA 3IHLA 4GNKA 5FPHA 3EPHA 4LWZA 2B21A 2R9VA 1Z07A 4Q1FA 4ZKEA 1DO0A 3GEIA 3U2QA 4URVR 1NJGA 2H18A 5L3QA 3BGWA 3EX7C 3ZVMA 1ZCBA 4IVRA 1A1VA 4G3XA 4Q48A 5D3MA 3UANA 2RMKA 3B9QA 2AHOA 4F93B 1DPFA 1PUJA 1TX4B 1TF7A 1W2HA 4DXAA 4KAXA 5EE3A 5LPNA 3FHCB 4RCYA 2R6DA 5FBRB 1WCV1 2QMUA 2CHQA 2PLRA 3AVOA 1Q0UA 3B2EA 1FUKA 3NKVA 4KLNA 5JCPA 5KSOA 2FPKA 2OE2A 4C9BA 1QHXA 1TL7C 1OLOA 1AKYA 3IHWA 1GVNB 4L4UA 4MRPA 3DPUA 3DL0A 3C7KA 1JR3A 5FPKA 1WF3A 1X1RA 3FB4A 3PEVA 3PENA 4P0TA 3VX4A 4EPVA 5GADl 4OI1A 4DUGD 1DAGA 2RAPA 1ZUHA 1PUIA 2BCGY 2FFBA 2O8DB 4LHVA 2ZE7A 1G4UR 3O8DA 5EZ5A 3EA5A 2DY1A 4GRAA 1KO7A 1BMFD 1G5TA 3QVUA 4BRUA 2V1UA 4MRRA 1W5SA 1Z0FA 3WNDA 3ADCA 2CNWD 1VKJA 3R9IA 5AR1A 4HUQB 1GAJA 2V7QA 3TW8B 4AI6A 5EP3A 4LHZA 1N6NA 3SFZA 1QDEA 2BC9A 5J40A 5FH9A 4LPSA 4QFMA 2UVQA 5CJPA 1CXZA 1OIWA 3U3OA 5FI1B 4FWIB 3CX7A 2H7VA 2CLCX 2VP9A 3LLUA 3OFND 1SVMA 1W2GA 1AZTA 5B30A 1FUUA 2ZJOA 1F48A 3QUSA 2ZS8A 4LSGA 1P4SA 3FWYA 3Q3JB 4PZYA 5HZKA 4DB4A 2O5VA 3BH0A 4A4DA 3WRYC 2WWFA 4DCNA 5FTKA 5DI3A 1X8KA 4M1TA 4C7OB 5HCIA 3CW2A 1K8RA 4Q4HA 3TQFA 3SN6A 4YLGA 1CJVC 2C95A 3KL4A 3GLFE 4H1UA 1L8QA 2Q9CA 2V8OA 3I73A 1TMKA 4Q19A 4R9UC 5KHOC 1S9HA 4Q9IA 1Z0DA 3VR4A 4O3MA 2JDIA 5KSZA 2J46A 4LZZA 1E2PA 4MH0R 2X2EA 5FOXA 1JR6A 4TL6A 5DHFA 221PA 4ARZB 2YKGA 3BFKA 3LFUA 1QG4A 3VAAA 4S35A 3OAAD 1SZPA 4MRSA 4FWTA 3QXSA 4ACBA 4NCIA 3NH6A 1WA5A 2ERYA 3PXGA 1Z2CA 2VPPA 3X1DA 4YMVA 2REBA 2JJ1D 2KBFA 4QGFA 1KI9A 2VL7A 1NG1A 3CF0A 1SHZA 4AY2A 1CR4A 1T5IA 4HEJA 2ZRPA 1U8AA 2BKEA 2BEKA 3KKPA 4CW7A 5JBQA 5EUQB 4B44A 5DN6D 4JSTA 1GL7A 2KBEA 4Y0VA 5FL3A 2AN9A 3NDPA 1Q3TA 5GJVC 2HJVA 2ZRAA 2Q0HA 1OF1A 2OBMA 1ZU4A 3O8RA 1E3MA 4DLXA 1G6HA 1R7RA 4TT3D 1F60A 2IYTA 2J0SA 2EFGA 2BMJA 1NVVR 5FTLA 2WKPA 4AG6A 1DAKA 2J0QA 2J41A 4NCNA 1CRPA 3EC2A 4DLUA 1VCMA 3K53A 4JMPA 4B32A 2FOLA 3KXKA 4ZDWA 2V1XA 2ZE5A 3TSWA 3RRMA 1AGRA 1GILA 4PQRA 1JNYA 4RZXA 5TARA 1L7VC 4A0FA 2R65A 3P4YA 3IPYA 3AGPA 1GP2A 2ATVA 2J9RA 4AG5A 3U7FB 2PLFA 5EXSA 5HE8A 3W6OA 1UBCA 2F43B 4LK2A 1S8FA 3U6BA 5GVRA 4PHFA 1KO1A 3AF2A 3T1VA 1HV8A 1Z22A 1S3SA 1G8PA 1XD2B 2ZSDA 4CYMA 1NBME 5C1BA 1GNRA 2GBLC 1VECA 3QBTA 3AUYA 3AKEA 1PVOA 5J4VA 1KI3A 1EFHA 4LPKA 3TQCA 121PA 4G5QA 5G41A 3L82B 5JSZB 3TVDA 3HDTA 3K9GA 2LKDA 3FFAA 5JI2E 4CVNA 3CH4B 1RVDA 3R7WB 1S2MA 2KSQA 3OEHA 2WMOB 1QHHA 2CVFA 3BORA 3RNLA 3SBEA 2GZDA 5TVKA 2CLDX 3Q5DA 3KKNA 3VMFA 1YVDA 3SS8A 4XIGS 2BBSA 3AB3A 1OV4A 4RD6A 1Z06A 2VA8A 4GDFA 2HT1A 2QNRA 3ZDQA 4B6EA 4P4SB 2OO7A 4IVPA 4BLRA 1UBEA 1P60A 2SHKA 5JJLA 4BLTA 3MD0A 3AF3A 2IS2A 2OCBA 2F6RA 2OXRA 3RWMB 3UG7A 4CT4B 5ELXA 3EW9A 4QJ5A 3IO3A 3IO5A 1AS0A 4TYYA 3WMFA 1OKKA 4V0NA 1BS1A 3OIUA 4Q9HA 3QF4A 1FZQA 1KYIA 2REXB 3ASYA 3EZ6A 1QHYA 2ZSAA 3BRWD 1SHKA 2ATXA 4BLOA 1E9BA 3SFVA 3I8SA 5FOVA 3DMNA 2OV2A 4DCSA 4KV9A 1OXSC 2FSIA 1YZGA 4C0SA 1YRAA 2IF2A 4PAMA 1BO6A 1UDXA 2P5SA 3QQ5A 3CWQA 3PEWA 1OPXA 5F98A 1EWQA 1FPMA 3B1ZA 1WBDA 3HPQA 5J4HA 2QL6A 4XH9B 1M74A 5JMTA 3KQHA 2PBRA 1EX7A 2N42A 4LCBA 4Q1EA 1G8YA 2WIBA 4LYJA 3ASZA 2WM9B 2IWRA 2QTFA 5AUPB 4QBGB 2GDJA 4LC0A 4JL6A 4IW3B 1UDWA 1US8B 1UKZA 2ZIAA 1R8SA 3CPEA 1N3BA 4ESHA 4QGHA 2CMKA 4HSEA 4CEIB 4Q1AA 3TUJC 4LYAA 2D2EA 4LBZA 4BE7B 3KQKA 2HYDA 4DSUA 3CNOA 4B35A 1AIPA 5E7JA 2J3EA 1JJ7A 2ZE6A 1N0WA 1PV4A 3IGFA 3NH9A 4WZAE 4KVGA 4PXAA 1II9A 4MKIA 3DMDA 1W0KA 4FMCB 5AWFC 4Z54A 1E9EA 2GEUA 1YZNA 2ZJYA 1O3YA 4Z1MD 2FDCA 3KXIA 3T35A 3THXA 1S96A 3LXXA 3UMSA 3U4QA 1FTNA 4BECA 3HR8A 3QF7A 4TTQA 2OESA 4DLWA 1HYQA 1CEEA 2EWVA 3SEAA 3ZYCA 4PC1A 1KOFA 3I61A 2IUUA 3L0IB 3R9WA 2IT1A 2WAYA 3SDZA 4GOXA 4ZIRB 1UKEA 1W4BA 1VMAA 2P6UA 5KNCA 5LD2C 1ONBA 1KDRA 2P6NA 3OE7D 3B5JA 4IDNA 1GL9B 3NC0C 4HUQA 2Q3MA 3K9NA 4RFSB 2FGKA 4HB3A 1KMHA 2AKAB 2YZ2A 4GP6A 3CH5A 4QBHA 3GLGA 4W5WA 3A58B 1T9HA 3ICQB 1ZVQA 2A9KA 2C9YA 1BYUA 2NO7A 2XJ4A 2UKDA 1JQLB 2ANCA 3R20A 5EZ6B 2W83A 4DIDA 2WWYA 2FGJA 1PLLA 3MUFA 1F2UB 2C77A 1XTQA 2CHGA 2V54A 3EA0A 3HP1A 2O8EA 1CR0A 3UWKA 1DAMA 3GJ6A 4JBYA 3LY5A 2AL7A 1G3RA 3TH5A 3SU8A 2R6AA 2WAXA 1TF5A 2W2XA 3UATA 1N6HA 3CF6R 3RS0A 4EFMA 4W7SA 1KK0A 1X6VA 2JATA 3LD9A 3F0TA 5LBIA 3V4RA 1UJ2A 4QRHA 3VR6A 4AYXA 5EJEA 1E2IA 5KSYA 4WZBE 1OH6A 2PZFA 2CCKA 2DPXA 3C4JA 1TQDA 1XX6A 4KYIB 3UIEA 2I1VB 4PC3A 1D9ZA 3V4FA 2GJ8A 2WBLC 4QXAA 3EZ7A 1MABB 3IEUA 3C41J 4JLBA 3VKHA 1EFRA 2WZQA 1MH1A 1HEIA 1N6RA 4LJYA 4IOJA 4FW9A 1WE2A 3O47A 1J70A 2WKRA 2NZJA 4JIMA 1COWD 2HDNB 2XSZA 1KHTA 2GWHA 3UMFA 4IOKA 1GTVA 2FN4A 2O8CA 4EPWA 3CX6A 3REFA 1U9IA 4UJ3A 4V0OA 1ZP6A 4H1VA 1S9DA 5CITA 3PUWA 1VPLA 4P3YA 5L3QB 4DSNA 5IRCD 621PA 2QU8A 2VP5A 3BS4A 2QAGC 5D3MB 2YWGA 5JEDA 2DYKA 2OM2A 2AWNA 5DLQC 1M7GA 1G5PA 2QPOA 2ZI5A 4WXPA 2NO9A 3TAUA 5FL7A 3BH7A 3ZZUA 4N0EA 4EJSA 4URWR 3N2IA 4WA7A 3U3MA 2ZRFA 3MMPA 1E1QA 3IIMA 2IYLD 3NEJA 1N5KA 2WHXA 1ZJ6A 1ZD1A 4J0QA 2NPFA 5DI9A 3RRYA 2YV5A 1JEDA 1SQ5A 4YDSA 4OQFA 4NKRA 4TLBA 4F7WA 1ZU5A 2QPTA 3MSXA 4FCVA 4HDCA 1OT3A 2VLIA 5KPDA 1N6LA 3RRNA 2W6ID 3QVVA 2ZR9A 2D7CA 2VYFA 2IUSA 3GJ8A 3U7EB 3WP0A 5JFGA 3K9HA 3V00A 1R4AA 5BWMA 1RZ3A 3HU2A 4B3DA 2XEXA 3THWA 3NDBB 1YKSA 2QM7A 1HE1C 2G77B 1S3GA 2ASEA 1LF0A 3TUIC 1OKKD 1OYWA 1E1RA 5FOUA 5J4LA 2VF8A 2BHRA 2F9MA 1LFDB 3ZZ0A 2JLXA 4M53A 2HCJB 3NTUA 3L0SA 4G0NA 3VHLB 3K0SA 4LHXA 2JCSA 1KO5A 1P2UA 4NYIQ 4L15A 2ODWA 3AVWA 1FMJA 4M1WA 4DT1A 1W4AA 5K8IA 2JA1A 1G3MA 1UM8A 2EFEB 4LBYA 1KK2A 4BRWA 1R0WA 2C78A 1QBKC 4MYUA 4P4TA 1FQJA 1T8UA 4NZYA 4O25A 5DI3B 5JI3E 4XWOA 2W6JA 1G3QA 4Q4HB 1J99A 1KJWA 1II0A 1TU3A 1ZM2A 2GJ9A 2JEOA 3SYKA 2NO6A 3VKWA 2ZE8A 4BGDA 1KZGB 3PFIA 3GLIE 2RGAA 4U7DA 1P72A 1K5DA 4PANA 3A1UA 4NMMA 2ZI4A 2G83A 1J90A 3PV0A 3X1YA 1IXZA 1E69A 1KIMA 1IXRC 1KK1A 1FX0A 3TW4A 3LX5A 4F4JA 1KTVA 4DSTA 1RRGA 2WJYA 1LF5A 2YOFA 3KB2A 4QBIA 1ZIPA 2Q6TA 3AM1A 1W0KD 2MMCA 1Z47A 2AK2A 5JJIA 3K0AA 2D2FA 1ZM9A 4QM7A 1DAIA 3FPAA 1W5TA 2ECKA 2GVDC 2X2FA 1XXHA 4R98A 4XD7A 3MWLA 2R8RA 1T4GA 4BLSA 2CCGA 4JJKA 3UPUA 2C2HA 1X1SA 4US1R 3LQRA 4LY6A 2IF0A 1KY2A 2X1VA 4JBXA 3WYFA 3MG9A 4Q9JA 1JXOA 2RGNC 4M0LA 4ZPXA 2FFHA 1JALA 1R5NA 1MO4A 4Q03A 1J8MF 4IDOA 3NG1A 4Q21A 4B33A 4L5BA 4G5SA 4B6FA 4ESVA 2YWHA 2G6BA 2NO0A 3PITA 1IM2A 5FBQB 3K0FA 2AXPA 2PEZA 2QM8A 3A1WA 1T0JB 1E2EA 5HTKA 4YQFA 1OE0A 3FTQA 2OG2A 1BH2A 1P62B 4JLVA 4PO8A 1HA3A 2OLKA 2ZITA 3NBYC 3AF0A 4GOJA 4URXR 1E0JA 5L3VA 4D4KA 1XPRA 2VF7A 2J0UB 4XWAA 1OB2A 2IHYA 3N2EA 3ZVLA 2FSHA 2WWWA 2F1JA 3CO5A 1CJUC 3LXRA 4TQAA 3K1JA 2IA5A 3LQQA 1KSGA 1NY5A 3TRFA 1Q22A 3QIAA 4MDFA 1VG8A 1E0SA 2IXGA 4IXNA 2RGXA 3NWJA 5E7IA 5CDFE 1QHGA 1YU9A 3IEVA 4MDEA 1QF9A 1IBRA 1KO8A 3LBNA 1E4VA 1YZUA 5BYKA 3ZQ6A 2Z43A 2O8BA 5JHHB 2CVHA 1UBGA 2GNOA 3VFDA 5DSZA 2IX3A 3QNUA 4US2R 2QENA 3LRPA 4NTZA 2BCJQ 3AKYA 2YOGA 4DCUA 1RW4A 3BH6A 1ZRHA 3CRQA 4RKFA 3LDAA 1NMZA 2CK3D 1KSHA 3MWKA 2JIZD 2ORWA 4B3GA 2XNDA 2E87A 4DDWA 3GLHE 3W6NA 1QVAA 2V9PA 4OQMA 3EG5A 4PZLA 2G0TA 1QHHB 3HYRA 1OFTA 4A8JB 3TMKA 2D3WA 4B3CA 1CBUA 2LCFA 1W46A 3I32A 4B2IA 5SZIA 1XEWX 4PQYA 2XTMA 3B85A 4NYMQ 3GMTA 2HT6A 2VRWA 4C3ZA 1XB2A 4HLUA 3A4NA 1T0HB 2IYSA 2KWIA 4MYHA 2GHIA 2PMKA 1E2MA 3A1SA 4LBVA 4GZMA 2P67A 4OI0A 2HF8A 3U6KA 3W3AA 5HE9A 3BB3A 2G88A 3ZS8A 4HUTA 3U44A 1LY1A 4NBSA 2OUKA 3QF4B 5SZKB 2J59A 1UBFA 3P32A 1TU4A 2FEOA 2B7BA 2RH5A 4LYHA 3WMEA 2WICA 5C46F 1YZLA 4A6XA 2WPDA 1AKEA 2WSSD 3EASA 4GSYA 5AJZA 3BFXA 4GPTA 5AUQA 1GIAA 4TTPA 1I4DD 1RFLA 1E9RA 1SVLA 2BJVA 3I8XA 3EPKA 3QI2A 5JHGB 1NF3A 2ODBA 4CT5A 1XCPA 1QG2A 3DOFA 3OHMA 4OJKA 1UEIA 2VHQA 2KJQA 5EQTA 4DLSA 2O8FA 1PZNA 3W3ZB 5AJYA 4C4PA 4XWKA 4TMKA 4CEJA 3LVQE 4DIEA 4M1MA 4A0GA 2ZUCA 4K8OA 2B7CA 2QGZA 1GFIA 4TLAA 2QORA 2W6JD 1U81A 2MMGA 4JVMA 5G3YA 4D80A 2OFWA 2UZIR 3T5GA 4BFWA 4KSCA 4TYWA 5KNBA 2D7DA 4UXIA 2QT1A 5E3HA 4JL5A 1CR1A 3EAQA 2HYIC 2XJ9A 4PR0A 1RKBA 1XF9A 4AK9A 2RHDA 3CNLA 4Q9KA 1ZCAA 4MKHA 5HPYB 4TWZA 2OCPA 3SR0A 3IIJA 2ZYWX 3THXB 1IHUA 1G20E 1LS1A 2JJ2A 3U4QB 1MT0A 4IHQA 1TUIA 4LC1A 2ZUDA 1HUQA 1NL3A 2Q3FA 1AN0A 1JJVA 1GNPA 2FPMA 1LV7A 4X8HA 1P5ZB 5DE3A 2TMKA 1A5TA 4TSFD 2WTUA 2OCAA 4FI3C 2XOKD 2ZRCA 4BEJA 1IY0A 1YHNA 2O52A 4Q66C 3U7HB 3QBVA 5DISB 2B8TA 2FE4A 4HZUA 1M6NA 5UKDA 1KMHB 3VR1A 3RSLA 3K09C 3AKDA 4O2LA 3GLGB 2Z5FA 2JASA 4LHWA 3C15C 721PA 1X8JA 2R6FA 1Z8FA 2DWQA 3KFXA 4ZCIA 4HLDA 1TQ2A 2X19A 1AA3A 2WJVA 1H8EA 3QKUA 3TLXA 2O8EB 3LNCA 4WOPA 4TYNA 2HV8A 5FTNA 3IBYA 1NKTA 1E79A 3QE0A 4US0R 3C14C 2P65A 1QHNA 5F9HA 4KI0A 4ZDIA 1TUEA 1KI6B 4PFSA 2R44A 2QROA 4PZZA 3MJHA 3GJ4A 3A37A 4KLZA 4LGMA 4TQ9A 1XD8A 5JLJA 2QSYA 5CIWA 1G64A 1E96A 2GJAA 2ONKA 3I72A 2VP6A 1HH4A 1DTSA 3A6PC 2BM0A 2CE7A 4IXMA 2V4ZA 1W36B 4HLCA 4EPYA 3OIYA 5DNYB 2OBNA 3KZ1E 4S2EA 2QMHA 1G7RA 3EIEA 5C18A 1EWRA 3FMIA 2O8CB 1KKMA 3DKVA 2FV8A 1IN4A 1MO5A 1U8YA 4QC2A 4Q02A 1G18A 1MRNA 3OEEA 4QHYA 2ZRKA 4QHSA 3QPWA 1A4RA 4BASA 3K0EA 2QRNA 3BJIC 3BFVA 2W2VA 2WJHA 2N46A 2IYWA 5KOYA 4TL8A 3NIBA 3Q7PA 3RVBA 3FKQA 1GRQA 1I4TD 2QE7A 1ZAKA 2IYRA 4IJMA 4JL8A 4R2HA 2D06A 1NP6A 4EJSB 4ON9A 1JAIA 4D81A 1YR8A 1NVXQ 3EIQA 1E6CA 4JZKA 3ETLA 3ADBA 3T06B 3G5UA 4KHZA 3GQBA 3I62A 1XD9A 3KDSE 2D4HA 4C0QC 1DADA 5CB6A 2NO1A 4JLOA 5IK2A 5L3RA 3SHWA 2HLDA 1WMSA 3IQXA 4B76A 2J0UA 2ZJAA 4MGYR 4C2TA 2WVJA 4R2IA 2FF7A 4NYIR 1RRPA 2W58A 5LDDC 4NL4H 5EXTA 3H84A 4AKGA 3ZGXA 1XEXA 3KUDA 3B1YA 5BYJA 1E9DA 5DH9A 3GP8A 3THWB 3ADDA 1JXMA 3UK6A 4MUBA 2FZ4A 2ZRHA 1L2TA 1U0HC 2H16A 4NDZA 3SHFA 4OBEA 5C4MA 3KXLA 1OHHA 4I1SA 3SYNA 3BERA 3GEEA 4PPNA 1VCNA 1SVOA 1XBTA 3ICEA 4ASUD 5CYOA 1ESNA 3C16C 4ILEA 4DT1B 3GFTA 1E98A 1ZIOA 2A30A 5IHPA 4LJ6A 3KJHA 1KK3A 3KJGA 1IN5A 2BJWA 5H70A 5AK0A 1A2KC 2D62A 2DCUA 4PHGA 4QKQA 2YYZA 3HYTA 1EESA 2GAOA 3W8RA 5FTMA 4UQOA 3OESA 4LHYA 3BWDD 5CLLA 3QEOA 2VEDA 4EQ6A 2C96A 1KMQA 3CR8A 2A5DA 2QT0A 4DEXA 3X2SA 1N6IA 2J0VA 4LV8B 4Q01A 2ZRIA 1OXVA 3AGQA 4LYFA 3J81k 4ACAA 2OAQ1 1DELA 2A78A 4A8JA 1NIJA 1YJ5A 2PL3A 3CIOA 1W44A 2IBMA 2JJ8A 1AQUA 4JKIA 5BW8A 2GRJA 1UFQA 5KNDA 4MITA 4WW0A 4Z8XA 1W47A 5FPTA 4Q00A 1FX0B 4BFVA 4C2UA 5AJWA 1NY6A 2EYQA 2Q21A 1E9FA 3I1FA 4NCKA 3RS7A 3K0AB 1JR3D 1HT2E 3T34A 1E0KA 4ZO4A 2FX3A 1YR6A 4AKEA 1B23P 3ECCA 1XXHB 3CPHA 4WAUA 2JJ2D 1OIVA 4ZI3A 3QJYA 1Z5ZA 3AP3A 3EXAA 2GXSA 4XSHA 3ZIAA 3B1VA 5LB4A 1KDPA 1M1YE 1K6MA 1M2OB 1KI1A 2R2AA 3PUVA 2C98A 4M1YA 1KKLA 2YVUA 2ZAOA 3TAHA 2BVNA 1TEVA 3I3SR 3RS2A 2V7QD 1IJEA 3BXZA 5C2JB 2GAAA 2GEDA 4HB2A 4U5XA 3DDCA 3THYA 3B7GA 2QRZA 3K0FB 3SQWA 1ZD8A 1EXMA 2GF9A 2J7PA 3NBXX 3W90A 4ZDKA 4JYCA 1WQ1R 4B73A 4ZDJA 1J7KA 1RRFA 4BEBA 1JBKA 4TLDA 1KDOA 1Q1ZA 1VG1A 3CRW1 4PHTA 4DDUA 5JRJA 1IQPA 4LJ9A 4F92B 1OXTA 3AVTA 3T1OA 5IT5A 4LDJA 4A82A 4BUJA 3FMPB 4A0HA 2YWFA 1P2TA 5CK5A 4HB0A 3CWZA 4DJTA 3EPLA 4KXFB 2OT3B 4LX0A 2J7KA 1BYIA 4NYJQ 2BWJA 3RC8A 3FVQA 1SKYB 1G7TA 1XZQA 2DWOA 1RJ9B 2JDID 3AKCA 3CB4A 1YE8A 4Z8YA 1IN6A 2GZHA 1XEFA 1I2DA 4DB2A 1VIAA 2H92A 1NN0A 3N70A 5CK4A 2O8BB 4AIIA 2NOAA 4NPHA 2Q9AA 1HQCA 4NHOA 1DVRA 2DFLA 1IY1A 4Q5IA 4WZ6A 3SQXA 4LV5B 4RVCA 2IYXA 4Z51A 2NQ2C 4NYMR 1YZTA 2AK3A 1VG9B 2J1LA 1D2EA 4ZCMA 3DM5A 3QKRA 2YC4C 2HEIA 4FCTA 3QPVA 2H8KA 1Z6YA 4P33A 4DDVA 4NP6A 4L16A 5G53C 2GEVA 4M9SA 1G8FA 2QE7D 2QP4A 4OK3A 4OK5A 3CRRA 5CM8B 1NKSA 1TF2A 2HXYA 3K0CA 4FMBB 4UJ5A 1NI3A 2XB2A 4O0MA 5C4GB 3MWYW 3QENA 5JCZA 1VCIA 5J47A 2QGNA 4KJZA 1KNQA 1Z0JA 2XZPA 4QL3A 4DBLC 1ZUNB 5IK2D 1EG7A 4DEYA 1G4AE 3OF5A 1XMVA 4JLMA 1I4LD 3TR5A 2HXSA 4D0GA 4M21A 1KI6A 1XU4A 1Z6TA 3Q72A 3MAAC 5KPJA 1IN7A 2B8WA 4W5HA 4URYR 3U44B 1F6BA 3DVLA 2XZOA 1VG0B 3SJBA 4IVQA 4FD2A 4FCWA 4Q7MB 1Q12A 4A2PA 1GITA 4RJLA 2H1LA 2OZEA 2VO1A 4ZI2A 1W4CA 2D74A 2FPLA 2I3BA 2R6CA 4MYCA 3G0HA 4M4SA 3FE2A 2RCNA 4GOKA 1KI2A 1OHHD 3LBHA 2GA8A 1G5RA 2YNMA 3BK7A 3K8YA 3CX8A 1KJZA 2L0XA 1GG2A 4LJ4A 1JAHA 4V0ME 5KDDA 1EFTA 3BE4A 1T91A 2ZJ2A 1LB1B 3ZD6A 2FFQA 2DB3A 1SGWA 1QHSA 5FUWA 2ERXA 2O8FB 2IEZA 1QHIA 3RDPA 1DAEA 1Z0AA 3SNHA 4RFVA 4CEJB 2JLSA 3RS5A 3DM9B 5H8WA 1A82A 4UKDA 1NVWQ 1E2NA 4AC9A 2VHTA 3KFVA 1NBMA 1DEKA 3RRZA 1G3UA 3HU1A 1PJRA 4G5RA 4IDHA 3B60A 4JVLA 1E9SA 4Q4JA 3LBIA 3HWSA 1SXJA 5FBWB 2A2ZA 3OEHD 3UXMA 2VH5R 1T5LA 3F5FA 2OCYC 3LH5A 5FOTA 4A9AA 5M04A 5DHAA 1C4OA 4EFNA 2ANBA 5B58C 1JI0A 1P9WA 3JZMA 4D4JA 3TR0A 2PMDA 4A2QA 1Q21A 4PO1A 3TUZC 1E9CA 2PJZA 2QP3A 5BN3A 3AVVA 2ZTSA 3ZD7A 3QKTA 4UNPA 1DAHA 4B48A 4A8JC 8OHMA 4QJ3A 3ZVRA 3W9YA 5CB8A 3REGA 4JVNA 2Z6VA 1GSIA 1FMLA 2WJIA 4LRWA 1Y3AA 2QSZA 3PEUA 1Q1EA 4HZUB 4OHYA 3VNUA 5FPYA 4KU4A 2EVWX 2IYQA 1XEWY 5HKKA 4BPBA 1KZ7B
chains in the Genus database with same CATH superfamily
2I1LA 4MZDA 1CUAA 1POWA 2XA2A 3S5JA 5JYBA 3GT7A 4D82A 2GILA 1A50B 2BKAA 4UQPA 4I9NA 1ANKA 3UHPA 1VLJA 2H1WA 2PS9A 1Y1QA 4PHHA 5ER6A 1TEXA 5FNVF 4LGYA 1XU7A 1ISJA 3LC2O 4O4JF 1SXGA 1G8JA 1Q3HA 3FWKA 3S40A 2I91A 4UBLA 1EGMB 3V46A 3R09A 1K5HA 1PJSA 4GMXA 3NIWA 5CEJA 5JNSA 1DNPA 2V0NA 3PE6A 4RD0A 5AI5A 2ZIFA 5IAAA 1XDBA 1E1DA 4Q9NA 3EARA 5LA6F 1GYQA 1GL6A 2BFFA 5HOEA 5K09A 1P9NA 1G8HA 1XZEA 2Q5JA 3P27A 2G4LA 2Z4SA 1MEEA 1NUPA 2F3RA 3A3OA 3ZGVA 4BBPA 2GN1A 4CKYA 1MRZA 4WNAA 1JECA 5DJ5A 4GGMX 3UF0A 4BNIA 4MB2A 2X5KO 5C7LO 5LDGA 1EVLA 3W8EA 4LJLA 2ZXUA 1ZGJA 2Y4OA 3NAMA 1M2GA 1NJFA 2C2KA 4BWYA 5C52B 1YFKA 2ZUBA 3BFJA 3G2NA 1V45E 2HDWA 4H16A 5HZGA 2R6JA 1ESZA 1SXPA 1IBSA 2NUAB 2VR1A 4XJXA 5EUMA 4KNYA 3VZBA 2WP8J 3PR1A 3JQ9C 4C0HA 1BGXT 4D0GA 4PG7A 2GETA 1ICEA 2VSYA 2YTZA 3FDIA 1S1CA 3IPRA 4GQBA 4NFLA 5LP6C 1PEYA 5GOTA 3HKDB 1KDVA 1AQJA 2AQ8A 3DS8A 5FBLB 1A95A 3B13B 1M2OA 3BWXA 3H9UA 3HVHA 3CZMA 3GWZA 1RYYA 3AF1A 1GRNA 3HE3A 4A23A 3OU2A 4KOAA 4IV5A 1RIFA 5DBIA 2WIDA 3SE0A 3H87A 5CYPA 2P0YA 5DYNA 1YB5A 3C8HA 1L4NA 1UXKA 1V16B 5HEKA 1KGSA 3LF2A 3DZBA 3INRA 4H3KB 2FEXA 3SKXA 4X64B 1Q1BA 4FLMA 2RGGA 1R0YA 4B47A 4CF7A 1WBBA 3SC2A 1BMFA 1NSTA 5J2UF 2EW1A 2WF6A 2JK1A 5ETJA 1MKYA 1YOBA 3T38A 3IP1A 3VOAA 2PT7A 1O1YA 4BQSA 3H5OA 4CG1A 2AFHB 1RAFA 3BXXA 1S8NA 4H4DA 4K87A 1RXWA 1MXFA 4IQFA 5K0NA 3I5XA 1D0SA 2ZVPX 3EXIA 1EPUA 3OWHA 4MQBA 1R8QA 4GGPA 4QOSA 4WXHA 4UPEA 4FHEA 3CE6A 3DBHB 1W85A 3TXAA 5FCDA 1YQDA 3QG1A 2WMDA 3GFGA 4JC0A 2PD6A 1MB3A 3TK1A 3URMA 3CLSC 4BNDB 1AQYA 1UPUA 1XEXB 2IXDA 4W1RA 3X2FA 1N2XA 1PHRA 3TE7A 1TVMA 2ZDHA 3HSKA 4LNAA 1IH8A 4OQXA 1NN1A 2E3JA 1UODA 2W4QA 5CURA 3VR6D 1NVDA 2XCRB 4WZBA 3E5RA 1MV8A 3IV9A 2PKEA 2FMUA 2BDEA 2OXTA 2J85A 2B82A 1BE8A 4BNZA 5EKDA 3AVPA 2GCNA 3JU3A 1U99A 2BTQA 1JEEA 4F91B 1NQOA 1Y37A 2V7PA 4CR7A 2ZJ7A 1CQPA 2FR8C 3EDRA 4HF7A 4AKTA 1W36D 4EKYA 1EFRD 5E9QA 2JBWA 3L0YA 3TVTA 4XGNA 5DPMA 4DNPA 2ZYUX 5HUHA 1M2KA 2H5EA 2Q9BA 2BFEA 1XQ6A 1CU1A 1NBWB 2HIGA 2ZJ6A 3COZA 2G8LA 3H8VA 3KQOA 3NTQA 1YQQA 2XSZD 3E5HA 4K6HA 4NZPA 2GLXA 4BMNA 3B1WA 1NLMA 1FNBA 4N3NA 4KITB 1CRQA 1PYGA 2JNWA 3SY8A 3QSYA 2C03A 3BDVA 3K30A 1MJGM 4P9NA 3M4YA 3N5CA 1QE3A 2DBQA 1CV2A 1V41E 5F33A 2EP5A 3CUVA 5FWYB 4PU0A 2DVMA 4DV5B 4Q16A 4K9PA 3UUFA 1D1PA 1G7SA 3LWDA 3G0OA 1LJ8A 4LQDA 4BQOA 4L8FA 2PQ0A 5H82A 3KQHA 1QK5A 1K27A 2R8XA 1LC0A 4PGFA 1RKVA 4GR4A 2WINI 3LVRE 1M75A 2GSWA 2QMQA 4G0OA 3M70A 5I8PA 2O57A 4G67A 2PZ8A 1NRIA 1LEHA 2NXEA 4PFKA 1VB5A 3R6LA 2GD6A 1E1QD 3EH2A 2UDPA 3GHYA 3NWEA 3ORHA 1UUFA 5F5XA 3UFXA 2IY7A 5E7MA 4B2LA 2AQHA 1OXBB 3JR3A 1L5GB 3T0FA 3T1TA 4X65B 5BUZA 3UG6A 3M3DA 4FIDA 3DXFA 4Q7QA 2XE8A 2E1RA 1WCXA 1BS2A 1ZGBA 1M34E 2BV3A 2JL1A 2I8AA 2QXTA 3IAFA 4TT3A 4BFTA 2XUKA 1KYWA 2PQ6A 3QI7A 3WLLA 3D5TA 5JJKA 3H2HA 1YBFA 2KX7A 3AJAA 3OA0A 1ZXXA 3PNOA 4KRYA 1DG3A 4I66A 4ZQIA 3ZWXA 5C8DA 2INGX 4M8LA 2OD7A 3NLLA 4OPMA 2FWIA 3LP5A 3AESB 2SBTA 3V4LA 3P26A 3HPRA 3V7YA 5CFMA 5TNXA 3UK1A 1LTQA 5EHXA 4MDHA 2GBLA 4HRAA 5HZMA 1N3LA 1QZZA 1TM3E 3I12A 1EK0A 4O33A 2IZOA 3VU9B 2AC7A 3MZ0A 3OZSA 4I81A 1VHJA 1OR8A 1JLLA 3S1AA 4YMTA 4Y8VA 1V8PA 1M2VA 1XZ8A 2WD9A 3OM9A 3EN0A 5H81A 2VAMA 4HEHA 1M2FA 4WOCA 4TYMA 4U02A 1R10A 2YN2A 4OXNA 5DTIA 1Y9DA 2ECOA 2FR1A 5DX8A 3ULKA 2MSLA 1YRWA 4AJPA 4JMLA 4CLXA 1AK9A 2PRSA 5IHXA 5TF0A 1NXTA 2MSEB 4XRRA 5KYXA 1U98A 4QNRA 3FKSA 1N3IA 2ZPTX 3MHPA 4G56A 2GJKA 1C9EA 2I6UA 4YDHB 1C9MA 3CZPA 1KRXA 2Q1XA 2QG6A 5NLLA 3EW7A 7ADHA 1W48A 4MW7A 4CKCB 3WBKA 4C6HA 1QQTA 2E4WA 3I6MA 3FLEA 2J30A 4RL4A 2PXHA 1ZC4A 3JQGA 3VI3B 2O1EA 4BMPB 3A6EA 4RXTA 4DSOA 2KE5A 2QG9A 4H7KA 5C8VA 3T3NA 3A9UA 4QA9A 4P83A 5EFZA 1HYEA 2EZUA 2E1PA 3EZ9A 4E2WA 3GJ7A 1YFLA 3N7TA 2NXJA 3GNTA 3IV7A 3IVGA 4YUXA 1JLSA 2HK6A 4F5DA 3PLAE 2IUTA 1R16A 3IA2A 1T43A 4UUNA 3ZZ1A 4BFYA 3UWOA 3VPDA 1KS9A 1PDWA 5FBHA 4EITA 4EJ0A 1GZSA 1E66A 3C39A 1OI7A 4IDQA 5DEIA 3GLIA 3D9QX 1ODJA 1SOMA 5FNVA 2C9BA 4BFUA 4IDBA 5KQPA 4O4JA 3CW9A 1Y8RA 2PQMA 2B99A 4YALA 4YBRA 1H3EA 3VKGA 1L8XA 1N5IA 4DJFC 5LQUA 1ZBQA 1CUXA 2VZLA 1ZMXA 2IZZA 1A9TA 4R2WA 1M8JA 4BZQA 1XRSB 3I5YA 1TEHA 3RIHA 1KAOA 5AUOB 5JZVA 3KQNA 4X1YA 1JPVA 1FS4A 5LA6A 3TLGB 2QM0A 4J7AA 5D3KA 1S8AA 4G5OA 5DGCA 5MF6A 1VJTA 1DUSA 4TTAA 5DYGA 2IUYA 3FDFA 1TIKA 5KYVA 3ROQA 5JADA 3PX7A 3SXUB 1J4AA 1YSCA 1ZNZA 3G8CA 1FYEA 1WCIB 2AYZA 2FLKA 2Y99A 3I9V1 4HN2A 1WLYA 5BR4A 4X6XA 1YJQA 3QE4A 4IQ8A 5A1TA 5LKRA 1TM4E 1T8TA 4YI5A 5C5CA 2HGZA 4U3JB 4NX2A 3MGGA 5INTA 1RAAA 2JBHA 2BBWA 3DAGA 1EQ2A 4YONB 1E63A 3R6GA 4ME6A 3SJAA 1IJFA 2WUEA 2AOWA 2EX1A 5DHTA 3OKFA 4ZAFA 5TMPA 3PLRA 4PQEA 3TTXA 3FOEC 1V7PC 1ILEA 2WC1A 3BB4A 3NTVA 2Z8ZA 4Y2UA 3UK7A 3MWGA 2ZUWA 1IAQA 1F0KA 1L4UA 1QAQA 1XLTC 2HU8A 4GMDA 5FPPA 5ILQA 4XUDA 1EESA 3HADA 3TF5A 2RGDA 2X3UA 1GUZA 1XZPA 2I7CA 2JLWA 1XJQA 3AI2A 5A5GA 3KD2A 4P3KA 3R44A 1RHUA 4QXMA 3ZNPA 4C7KA 1L8OA 3C3CA 2DCMA 4WWHA 2GBFA 2HMYB 4DVGA 4PO9A 3M6AA 5FORA 3VJMA 8ATCA 1Y6FA 3CLTC 2I34A 3VSBA 4WVLA 3LK7A 1JPJA 3MWJA 5FLEX 5ICFA 3RB8A 2JCVA 3PNKA 2OPBA 3BWBA 5CA0B 3VHQA 1ITZA 3T1YB 5HZHA 5CIYA 2PR2A 2WKQA 5F9MA 1GYRA 2P68A 4TKZA 3MXTA 4EG4A 1LFAA 5J4KA 1AK2A 3DB1A 5IT0A 3EG9B 4U6SA 4N7JA 5H59A 3OTQA 5CDFA 4GNRA 5DLYA 2LP4Y 5G4KB 4DA9A 1VQ1A 3PT9A 4C0AC 4D2IA 4Z1MA 4HNAB 5P21A 5JARA 1KH3A 1TC1A 3IKMB 1R27A 3SS7X 1LI5A 2NTVA 2RHRA 4N3AA 4YC7A 1BCRA 2WTXA 2WFLB 2GYUA 4JJEA 4Q4JB 4MGHA 2BT4A 3SOOA 3DE7X 3KSDO 4UPVA 2J07A 5H7XA 4HYQA 3U60B 2AZDA 3DZFA 4GVLA 4S3MA 1IZ8A 1CY8A 3KX2A 4D3FA 1K0FA 1QC5B 2J5BA 2P30A 1P2VA 2AN5A 1FP4A 2DHEA 2XXAA 1ZA1A 2C84A 1P5FA 1YZQA 2HD4A 5JFOA 3L8ZA 1D2GA 1U90A 3TL6A 3VMMA 4DA0A 2JJMA 4Q6BA 4MSUA 4YGXB 1Z12A 2PANA 2Z9BA 3CLUC 1IUOA 3DA8A 1KR5A 5IUJC 1U3UA 3HUFA 4LXGA 3W6ZA 1RM5A 3GLSA 4HMOA 1JA1A 4NOLA 3W34A 5A4AA 1IBKB 2HH9A 1EDOA 3DGFC 4A1FA 1KGDA 1Y33E 3ZDDA 3GLQA 2RD2A 1ODTC 2IBTA 3VJRA 5G4LA 3T3EA 1B41A 2WU1A 4LZAA 4UPDA 5DOZA 5I7RA 5LKAA 4HT3B 2JLUA 3MLAA 1DARA 1Z6QA 3OQMA 1YFJA 1RTTA 3T15A 1DCFA 4XFJA 1YJ8A 1TRKA 2CW5A 1XJCA 3CR3C 1T6NA 2PJUA 1CQJA 2HJHA 2QW8A 3K1AA 4DRZA 2AUMA 4K6KA 4BB9A 4YCSA 3PTAA 2JVIA 4PYMA 3JVIA 4POAA 1LDBA 2OAP1 2ZCJA 3BT7A 1EFPB 4LTDA 1UKAA 5K8UA 3AETA 1SD1A 2OLJA 1XTBA 5MFPA 5BN4B 3WGQA 1YOVA 3QX8A 4P54A 5IC5A 2IY8A 3TSAA 2IEDA 2CJWB 4AJHA 3S1LA 2PS3A 2WI8A 3EIHA 3QJGA 3MUOA 2AR7A 3D4BA 4X6LA 1Y4SA 3L7JA 4L02A 5ULLA 2X2PA 5B57C 1R6BX 4KRFA 1BNCA 5AK4A 3PRYA 2VUTA 3K9FC 3DVQX 1B4DA 4FHGA 4MV5A 1Y8QB 5TSDA 3TNJA 1E6EA 2IKQA 3A4TA 3TGPA 1K92A 3V1TC 3IILA 2ZANA 2W6ZA 3SXPA 2C94A 3HN2A 4C01A 4QGAA 1SC3A 2I76A 2IK8A 2WM3A 1P3DA 3A0RB 2WQZA 3EGIA 3O03A 2H0AA 2QKYA 1N1GA 2XCUA 2JI9A 2QAJA 3V48A 3QVKA 5EP2A 1X7XB 1ZMTA 1XLVA 2XNSA 4XASA 3R3UA 3A2LA 4DLVA 4H77A 3EMKA 1BE1A 1VJ1A 2F9LA 4PIVA 1KY3A 1BHJA 2QX9A 2X8WA 3HUTA 3UTCA 9ABPA 5L3SA 2P5YA 3RI3A 2C2BA 3H6HA 1B6RA 1W76A 3VX3A 4WI1A 2FKAA 1KJ9A 2GI4A 1AV6A 2VYNA 2AD5A 1NMXA 1GR0A 3ANTA 4YJ3B 3T5DA 3P94A 1WOMA 5EMJA 2C7OA 1CF4A 2FJUA 2X4GA 4G36A 3WHKA 4O08A 1V3TA 2TYSB 4GX2A 4OHWA 4WRRA 2QTVB 1I6LA 4TOIA 3R7FA 1C7FA 4JR1A 1UWCA 1ISIA 2CCJA 2G36A 5K3EA 4EX6A 1MQ8B 4RVUA 5J2TB 1BWRA 1NHWA 2XE6A 3NHYA 1G6OA 1RYBA 3P19A 1G5QA 3Q9SA 4X5OA 2GYWA 4M60A 4YXWA 3AUXA 1TGYA 5JSQA 1P5RA 1KI8A 2AD1A 1GAEO 3PDWA 4W5NA 1I5EA 5FPQA 1DIAA 1FFSA 1U7PA 1YQWA 1F8UA 2FWRA 3KWMA 3Q88A 2XVZA 5KKNB 4Q7KA 4XTCS 3W1EA 4JQSA 4BKUA 1CW2B 3K96A 1H8ED 4N65A 3B48A 1ZN2A 5EXPA 2J08A 4TMZA 3C48A 2HRBA 4I4NA 1REQA 4QHTA 3BGOS 3T54A 4A2WA 2Q41A 1F0YA 5K3BA 3DWIA 4EHKA 5HILA 3IDSA 4GMKA 4NU8X 4UNQA 2B6HA 2OBXA 2RHMA 3H3FA 4FI3F 4UNIA 1QCDA 1AY0A 2EWMA 1KAEA 1UKBA 4J49A 4PSDA 2H2FA 4QELA 4KR6A 5IDWA 2G5PA 1EFUA 2WJWA 3V4SA 4UU8A 4KQ1A 4AICA 3ZTWA 4L73A 4KXXA 2PX8A 1R5BA 3MF4A 4JYPA 4YYZA 3ETCA 3JAWA 2PUDA 1K6JA 2FK7A 4LSZA 1JQDA 1A8IA 2BI4A 2QYHA 5HFNA 3K35A 2X9NA 2DGDA 1AD2A 1X80A 1H05A 4Z9YA 3LPDA 3DKPA 4HLQB 4EO4A 3B9PA 1S2IA 2HLHA 4OGFA 3TI7A 3GFOA 2QRKA 5FBZA 4B7ZA 2W42A 3FGNA 2VNSA 1PYOA 3IP8A 4PCLA 5E6UA 4H7FA 3MRTA 2W0MA 3EIWA 3O0DA 3EC1A 3EGXA 3M0EA 1P75A 1YK0A 3R0QA 1KJJA 4YCDA 2HEGA 3AHGA 2KI5A 3E3LA 2Y1EA 5K3CA 4BC1A 3EVBA 4RWEA 3OEED 3X44A 1O9GA 1VLMA 2EEPA 5DVZA 2H1IA 3OTGA 4L8GA 4OLFA 4RMHA 4AXBA 4KE9A 4LXYA 4YV0A 2HWYA 1UJ6A 1GDDA 4J3JA 4AJNA 5CD1A 1SXIA 1R0SA 3RBXA 1N2ZA 1N5LA 1UWLA 5BUSA 1Z15A 3TLYA 4WQMA 3NBZC 4YRPA 2O8DA 5FFFA 4XGRA 4QD3A 5DYIA 1NW4A 1VL5A 2WOOA 4ZK2A 4C43A 3OZXA 1Q3KA 3BIFA 3A3YA 4WINA 1XZAA 3RBZA 3UOGA 5F3WB 4FOLA 1XTSA 2F3UA 4BO5A 2ZBQA 4BB0A 3AJRA 3MRXA 4QUKA 4YP0A 1VYTA 5DNAA 4NV0A 4TS4A 3MTAA 3EXHA 1KMCA 5TPWA 1IDOA 1HZJA 1X7WB 3ZW8A 2W2KA 1KQPA 1JIVA 2HLDD 4IEEA 3CONA 1I01A 1Z34A 4RKQA 3SZMA 3QKSB 3EJ6A 5HCNA 4B09A 2F1HA 2R68A 4MR8A 4TLCA 5JOQA 3MW8A 3KNZA 4MGIR 1EBBA 2A9OA 2RB4A 4B9AA 4MPTA 2R1TB 4DDTA 1TAHA 4YS6A 3TSYA 3IJPA 1GQQA 3ZJYA 4EO9A 5AJHA 4EENA 1MVNA 1EFVA 3PUIA 4V1CA 4TZ6A 3DKKA 3VR5A 5A3JA 2G80A 4W5JA 3QXCA 3RRXA 2NU7A 1UMCB 1W25A 2ZRQA 4RK7A 5LP1A 4C7OA 1PD1A 1U7TA 3L7MA 3OY2A 1PWHA 5AOVA 1OX5A 5JSYA 1W9HA 2CEAA 1FA9A 4EMSA 2WD8A 1J42A 4LJ7A 1KC1A 1SURA 3ZLTA 1JI3A 4YJ2F 1SBTA 2N75A 1TJPB 2F1IA 4AZ0B 1WSDA 1QOZA 2I6QA 4J0HA 1P0FA 4O5OA 3KKZA 2DR3A 3NV9A 4KMOA 3O4HA 2LDYA 1NFRA 2JRBA 4JYBA 3N7UA 4L07A 5I9MA 7ABPA 5K7SA 4M8SA 4RPKA 1HE5A 2E4XA 1T3LA 2QA5A 4P98A 3FNGA 3PGVA 3UKJA 1SQ0A 3DH0A 3EPRA 3C5CA 4N82A 2CXTA 4ARZA 1E3LA 3NAZA 2N47A 3BWYA 2XPCA 2DT5A 1WU8A 3OSZA 5EPUA 4KWTA 3GT3A 2ID9A 1IXSB 1LH0A 4H0NA 3S27A 1LX7A 3M9WA 1NZFA 2X14A 2EYUA 3I6YA 4FBLA 4BJHB 1N5OX 1WQ3A 2XUHA 2WWGA 1J39A 3MVEA 3CKMA 1NHGA 2P2NA 3INTA 1R0CA 2V6BA 5M5BA 3BYZA 2OK8A 1P7YA 4PLWA 1F17A 4BZPA 1C1HA 421PA 3A4MA 2GBIA 4UM8B 3E7XA 3WA6A 3RK1A 3C6KA 5FLKA 2AR9A 2ZM5A 3F46A 4KGXA 1KJQA 3P9ZA 4ZOCA 4LFBB 1PHPA 1IWOA 2QRVB 1AZSC 1BH6A 1K8XB 1GUAA 2QG4A 2ADOA 2XYPA 2P7IA 1ZEJA 1QMGA 4I2VA 5EJ4A 1I2MA 5E3JA 4LNUB 1SVIA 1ETHA 3NPMA 2Q4OA 3R7BA 5HQ3B 3PNYA 1SG0A 1GG9A 5J43A 1GCOA 1NQAO 4N3GA 3LZ6A 2JIOA 3HJTA 4KN5A 3L0PA 2NQ8A 3F2IA 4TLLB 1YI8A 1KJ8A 5H02A 1K7FB 1WETA 1W8IA 1KS2A 1XKQA 2IW3A 3PC4A 3PHLA 2GZ2A 1DEOA 3JALB 3R4VA 2GT1A 4G4SP 4Z0TA 2OZLA 5EJ6A 5DYTA 4YCMA 4MQ5A 1J00A 2H5JA 3T7TA 1Z29A 1T2UA 3B82A 1YQTA 4BOYA 4NK4A 4DBVO 2WHQA 1CF9A 3P2EA 4ML3A 1VTKA 5CM9C 3ZWAA 2F43A 3OE5A 5I4IA 2ADMA 1AKVA 3W2IA 2UUBB 4TTJA 4FOOA 5BQXA 2WF9A 4F46A 4UAGA 5IJ0A 3T3PB 1H69A 4JBLA 4YMLA 4TRRA 1YNOA 1G291 4KSBA 1E2LA 1ULTA 4MPDA 4JBIA 1AV7A 4O3FA 4ND1A 2GVNA 1ZC3A 2IU6A 2C4UA 3E48A 3G82C 4KYTA 5H3CA 3FCEA 1ZD4A 2C3MA 4L4XA 4RAOA 2AKYA 4L57A 3V97A 1EJ0A 3O31A 2CF5A 1PF7E 5ALYA 2RFLA 2VI5A 3TLEA 3GFFA 5U4QA 4DXHA 4MI3A 1NN3A 4UNSA 2XNHA 1EIZA 2A9RA 2FPPB 3PQDA 1IVSA 1IWBB 4R2KA 2ES4A 4K86A 4QTUB 5IPFA 1WY7A 3C97A 4RLSA 4NV1A 2WNSA 4M55A 4YP7A 3X0DA 5FUQA 1K88A 1K3TA 5FTJA 1IZYA 4O4IB 4E5UA 4IGAA 3B6KA 2BGKA 4M87A 3MAJA 3OIDA 4NZ9A 4NH0A 1G8GA 3F96A 3RIYA 4JLJA 1P2DA 5E6RA 1RJFA 5TEVA 3EY9A 4MW0A 5D6NA 3C0KA 2VF5X 1YC5A 1AXEA 4NENB 3SIPA 5JWRA 3EEOA 2VDPB 1F0PA 1A69A 4QM6A 3QXXA 2BFOA 3GU3A 2G0AA 2HPVA 4LHEA 3RC1A 5T5QA 4Y9DA 3U5TA 1YS1X 1EDBA 2FH5B 4OQNA 3STWA 2P4EA 5T8KC 1CUVA 4EHIA 3X1XA 1II8B 4YMWA 2O6HA 4MWTA 4ZD6A 4F8EA 2C54A 2O07A 3AVQA 821PA 1SCQA 2MSCB 4A8PA 3KTAB 3LKDA 5ICMA 3O1HB 2Q7XA 4TSFA 5JS1A 3CZRA 1V8ZA 2ZYVX 2AGVA 4GYKA 2BMDA 1VL6A 4A8HA 3E2IA 2FZGA 1XTRA 5TPZD 4DABA 1IYZA 4E6EA 4L9RA 2Q99A 1Q50A 1EDEA 4DMLA 3D1VA 2PKCA 3GJ0A 1YJXA 1VE1A 3N05A 3GW8A 4I4TF 4NCJA 3GLHB 4QUJA 1UK7A 3RU7A 3V8PA 4GL2A 3PL5A 2HPZA 3WYBA 1IM8A 4KODA 4OJNA 4YLYA 1CRWG 2BFAA 2X5XA 4FE4A 5CFLA 4P5PA 3ER9A 1E4EA 3JQ8A 1ZGCA 4G8JA 3BTVA 4TGLA 4X1KA 2NGRA 4RX1A 2FZLA 2R00A 4DAEA 4GVXA 2I3GA 3KYBA 4FKMA 3UYLA 4N76A 4RO0A 5TQ0A 3K8ZA 2FN7A 3WLMA 3TKAA 3V9PA 4NECA 5T64A 2R11A 3U4IA 4ZICA 3ISTA 4F4CA 1G2PA 2DHRA 2BELA 2IOFA 4WXRA 1FVFA 1IY2A 1N77A 3EJWA 3QNMA 2EJWA 4BP1A 2M2IA 5IF9A 2W0SA 5B4VA 5JG7A 2XHEA 2ZI6A 3IUMA 5K0BA 1JF8A 2JGAA 1BDJA 1RDFA 4KQGA 3FROA 3SHVA 4H3HB 1XMSA 3GPLA 1Q0LA 1OA1A 1OAOA 2ZYTX 2YNMD 3SM3A 4J4HA 5E4FA 5HKOA 2OC9A 3O75A 2J87A 4R2LA 2J6IA 4WVFA 1PGJA 3ZU3A 3B78A 4C7VA 2APJA 5B2EA 3ZD9A 3BL8A 4XWYA 3EFOB 3E9DA 4ZHSA 3QPUA 3I37X 3GEHA 3T7DA 1V6SA 3CNBA 1J0EA 3EWSA 3L1KA 3LAWA 2GVZC 2JHGA 3A70A 4MHTA 3CBGA 4Z7JA 4MQMA 1L4YA 3RJ5A 1WU7A 2DTDA 5EFOA 3R6DA 5KO2A 1OVGA 3C3MA 4V0MA 7REQB 1XTIA 2G1KA 2JGIA 3DO8A 5IJ9A 2F3SA 4RNCA 1Z2NX 1SXJD 1T3HA 2WB4A 1MH9A 2RB5A 2WIAA 2PZEA 2GPTA 3KQTA 1WW2A 3PF9A 4E22A 4QT4A 4X90A 5KNBH 1SD2A 4FMDB 3ZZTA 3EGVA 5TV2A 3WMWA 1JQEA 2HJGA 4P4NA 4YJ2A 2Y92A 3ZHQA 5HRCA 1H2EA 1Y3BE 1ZNYA 1XWWA 2R62A 2IKSA 2IXEA 3QM1A 4MVJF 4MV1A 3UMVA 2OQVA 3EZNA 4QO7A 1ZNQO 4RFSA 1O9HA 4RTOA 3F90A 3JVVA 3FPCA 3JZDA 2WG1A 5K3AA 4XE5A 2V5VA 3WE7A 3ZR4B 5JD6A 1G38A 4CNBA 2VBCA 3HY3A 1H3NA 3ZXSA 5B7QA 3KQPA 4PTYA 1YR7A 1BJTA 1MOPA 1XJ0A 1TNDA 3D8HA 3FZGA 3PHIA 4PSKA 4PX5A 5BWCA 1BRTA 1UMBB 3NT2A 2B8EA 1QRTA 4W8HA 1CY2A 2EKQA 4UZEA 5FWAA 1WMFA 4UTPA 1QQBA 2ZK7A 5GJWC 3VPGA 1XPUA 1KXJA 4KQ2A 5IH7A 3MLEA 3PNLA 3LLMA 1M0EA 2H1RA 3R3HA 1RE0A 4O4HB 4ZMRA 1U1DA 2EU8A 4YAIA 1EGAA 2GCOA 4RY2A 3TQOA 3M5CA 2OV1A 1RCFA 1XYGA 2AA3A 3HJNA 4RIEA 4D4LA 5J4YA 3AEYA 1K86A 3N2KA 1FMTA 4LJ8A 3FH0A 4UMDA 1XTTA 1QRRA 3JTMA 3A1FA 4A27A 1FJGB 1IUKA 2GN9A 3QPAA 3R74A 4ZEMA 4OBBA 2VZEA 4URUR 3CUEF 3QU5A 4MQEA 2REQB 5IARA 4EDHA 3TLBA 4JU9A 3QXJA 4R5HA 1JWLA 4UOEA 4XVRA 1XTJA 3HYLA 5AW0A 2QQ0A 5CT5A 3W2GA 1OLSB 1WUJS 2QLBA 3KHUA 3QUAA 4DC9A 1QU2A 4WFJA 4YRGA 4ZKDA 3VTAA 1RKUA 1UBHS 1XTPA 3FGOA 4HAUA 4UHEA 2NU8B 4DWJA 4R8MA 1G6Q1 1QF7A 2W2TA 1FSFA 1S1MA 5JSHA 3G1WA 2FG7C 3PFBA 4FR2A 5FPHA 4LWZA 2IODA 1Z07A 3WGOA 3OT5A 1KKUA 2W6MA 2OCLA 2W98A 5BSVA 1JWBB 4UQLA 4NAUA 3U2QA 4URVR 1NJGA 2V3VA 2D5BA 2H18A 3K9WA 3M5WA 4LXTA 2HAEA 1CDZA 3BGWA 3GT0A 4RVGA 5DBHX 5EWLB 3TIXB 1VIDA 4AVYA 4D9NA 3ZVMA 1GQOA 3UANA 4INOA 2CMHA 4F93B 3B9QA 5AKLA 5KBYA 1H2AS 1W2HA 5L7WA 1CY7A 4AKSA 1BKYA 5EZYF 1GARA 1ZH6A 1MZPA 1XAJA 2QV7A 1NPYA 1QOPB 4B0PA 2CHQA 3AVOA 1CNMA 1Q0UA 2OY0A 3B2EA 1FUKA 5KTSA 3BXOA 3N0WA 1Q0SA 2LVBA 3NKVA 1MAVA 4E88A 1I3CA 3WL5A 3CEHA 4ZC1A 4KQJA 1TO2E 2WE7A 4PF1A 8AT1A 1WHSB 2HRDA 3IHWA 1Y42X 2XTAA 3K31A 3QPDA 1KVUA 4U2FA 4X93A 5CTJA 3DPUA 3H2JA 5HCUA 4F8JA 5LZ9A 2QLMA 4LMAA 4WKPA 1LD3A 5FPKA 4C22A 2TMDA 1X1RA 3FB4A 3PEVA 4Y6OA 3VX4A 3AJDA 2ZIVB 4MA0A 7YASA 3AKZA 3L6OO 1E8NA 1NXVA 3DT8A 3NBUA 4IG9A 1CC1S 4DCJA 1LKZA 1KFBB 1PUIA 2BCGY 3FZNA 2EKLA 4GVPA 2ZE7A 4O6VA 4QZVA 3O8DA 2VTDA 1NF8A 1NJ6A 4GRAA 1KO7A 5JR3A 1BMFD 4RH0A 1NJSA 4BRUA 3NBQA 5D3ZA 1K8YB 3Q0EA 1V8DA 4JEIA 4MRRA 4R68A 2B9VA 5TRTA 1I9GA 1VPVA 1W5SA 4IF6A 4IKOA 1PFKA 2DLDA 3S6JA 4EW1A 1MGOA 4KX5A 3R9IA 5B1YA 2V7QA 1FEZA 2IOHA 3IT3A 3KR0A 5FD8A 2YN0A 3FNEA 2JG3A 2BC9A 3A4IA 4QQNA 4R5MA 1ZS9A 5EIFA 1CXZA 1PZXA 1W6RA 1GZ7A 2PRKA 3IUSA 3N87A 4WUVA 2Q3LA 2AS0A 5TR9A 3DW3X 1RT9A 3SQOA 2HI0A 1U3WA 3OJCA 3C3EA 2O2CA 1FUUA 2AYXA 2GARA 9MHTA 2R87A 2D5AA 1P4SA 4PZYA 1J22A 3K0BA 4JX8A 4XQCA 4DB4A 1W94A 2FSUA 3PKZA 4ARBA 1L1EA 4R2XA 1IEQA 1B8OA 3LT0A 3I8OA 1I1HA 5FTKA 1H9CA 4M1TA 5EPEA 1C3OB 2A0YA 1K8RA 3CW2A 3TQFA 3OZTA 4RL6A 2BZ0A 2I55A 1CJVC 5I7FA 2VCHA 2J09A 3GLFE 3KC2A 3MNFA 4I4TA 3IR6A 1DI0A 1TMKA 1Z7BA 4UDXX 1S9HA 1VL1A 4Q9IA 4ZRMA 3DXZA 4NCXA 1Z4LA 1YVUA 1ZZEA 1IG3A 1X7HA 3NPAA 4O3MA 2HCRA 3R3VA 1AVTA 5FOXA 2EKZA 2UXBB 2P9EA 3QVXA 4BY9E 221PA 1TVEA 1XHLA 2R96A 1T5BA 1I94B 5LVAA 4UTXA 4MRSA 4FWTA 2FF5A 1J0AA 1B8NA 1J24A 3EF1A 3AJEA 1IZ7A 2XOEA 3N8GA 4PCAA 1XRPA 5BNIA 3X1DA 2MU1A 3OOHA 4I50B 4YMVA 4BO2A 4WY8A 2KBFA 3CF0A 1NG1A 1VMDA 1HX7A 3C6YA 4TWRA 1O8BA 4TPKA 1THZA 3WGKA 2QR5A 4FZ3A 2O3SA 1QV7A 1P80A 5IC4A 3PSHA 4OOEA 1J8VA 4EOGA 1SUSA 1WLSA 3HZOA 4J0CA 4JSTA 2JHAA 4QUHA 3UO8B 1CQXA 1WM1A 8ABPA 4W9NC 3AC0A 4QQ8A 4R7TA 1XN4A 2ZRAA 2QUKA 2QTAA 4HP8A 1ZU4A 4FYYA 1Z39A 4REQB 5THXA 1E3MA 4OH1A 3PGLA 1R7RA 2J4CA 4TT3D 4D9MA 4TKUB 1SM4A 1GPDG 1TKBA 3CWCA 3DFKA 1BOOA 4Z7OB 5K0FA 3G2PA 4NV3A 4JA0A 5FTLA 5ITZA 1A8SA 4TVBA 2CNDA 1QIFA 3OPMA 4C4AA 2J0QA 1PTKA 3G0DA 4RFLA 3CT6A 5A7HA 5A3QA 2A86A 3AM3A 5H16A 3ZHRA 1YXMA 4EGQA 3G13A 4GM1A 5AW6A 1UPBA 2FOLA 5D1HA 1ACMA 4MVJA 4WFQA 1PTJC 2RGWA 4BGEA 2V1XA 2ZE5A 3D4IA 2Q8PA 3LGAA 4P53A 1AGRA 1GILA 1V25A 4PQRA 3N2GB 3DEHA 4RZXA 4XEHA 5TARA 1B8VA 1M1YB 3NONA 3BMOA 2J9RA 3ENVA 3WWPA 2PLFA 1Z88A 1AGYA 1PJ3A 1WD7A 2Y9MB 3QVTA 1UBCA 2VK2A 4GOLD 1ADFA 3EVCA 4PWYA 4ZODA 5ARBA 3O4GA 2V7EA 3CYFA 4J7UA 4YRBA 4JJFA 5GVRA 2O2YA 2JGFA 3HFGA 3AF2A 3GRYA 4CPDA 1TJ4A 1IJBA 1UKCA 3GRVA 5CX1B 5JDCA 3VPHA 3UKOA 5C1BA 1QGAA 1GNRA 3ZLUA 5A6SB 1VECA 3AUYA 3AKEA 3PNPA 4KUHA 5C31A 4H17A 4HNVA 1EFHA 3E9NA 2OVFA 2BZSA 3IP3A 2ACEA 3WMXA 3TVDA 4OVKA 3USZA 4B4DA 1WD5A 1KEEA 3K9GA 2LKDA 1UC5B 2OSVA 3HB0A 3FSGA 5JI2E 1KBQA 1EFDN 4YI3A 3SR3A 1H5NA 3ELBA 5A0VA 1RWXA 3CH4B 2QZPA 4Y2JA 1FU4A 3R7WB 2JGLA 3DUFB 3S55A 1S2MA 4AJKA 4DPMA 4ZI7F 5IVKA 2A9VA 1IWPB 4N5IX 1U1GA 3LDUA 4RDCA 2WMOB 2H8GA 1KYVA 3LXMA 4IGEA 4D1YA 4NWIA 1WB6A 2FUG6 3KCQA 2GZDA 3L1HA 3MB5A 1HI9A 2VBIA 3Q5DA 4D8UA 5L6MB 3DOIA 1RHJA 3M4XA 2PSDA 3SS8A 5JALA 1RM3A 3EA4A 2BPOA 1P0QA 1XMXA 2DPYA 3P2OA 4Y1RB 3AJ9A 3QMVA 2BBSA 1Y34E 3AB3A 1DDIA 2UVDA 3GCDA 3B7WA 1CY4A 2A94A 3LHKA 3PQ7A 2A1TR 2X0EA 4AP6A 2HT1A 4HOYA 5KVCA 4B6EA 2JIQA 1R5JA 4MW2A 1P60A 2VT7A 5SYNA 4A16A 2ZUFA 1NURA 4HQOA 2XR1A 1GAXA 3AF3A 1X0XA 1N1DA 3L6BA 2RI6A 2OXRA 2BGLA 4CT4B 4ZZ0A 3GA0A 3IO3A 3IO5A 4KDCA 1JHMA 3ET4A 3JW8A 3F6EX 4KQEA 4V0NA 1ZXLA 4Q9HA 4YMGA 5K20A 2AEMA 3WIUA 3HG7A 1NWHA 2PR7A 3JQAA 5L53A 1ZWLA 3TOCA 4UOZA 1E9BA 3I8SA 3AFGA 4DCSA 4KV9A 1D1SA 5JH7F 3ENWA 4OM7A 1YZYA 2FSIA 2NVOA 1XRRA 4EYQA 4WCFC 1YRAA 2IF2A 4JC5A 4JOSA 5LUBA 5AVUA 3FPFA 3MPOA 1OPXA 1VE6A 3B1ZA 4D42A 3OO1A 1GZHB 4Y6RA 3UXYA 4W1SA 1SQ6A 2X6QA 4OHRA 1M74A 1QTNA 4ZJZA 3S1SA 2WSLA 1Z5VA 3L0DA 4MWZA 3KZVA 4HCJA 3O1LA 4OQ4A 3W06A 5JQGF 3CTMA 3LUBA 5HWSA