2ZRGA

Msreca q196n datp form ii'
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
326
structure length
309
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRETGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 76
structure length 309
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrgA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrgA01
1E2KA 1F5NA 3WXMA 1FNMA 2O8CA 1W47A 1NRJB 1S4QA 3T06B 4EPRA 5SZHB 4DCNA 2XEXA 2WJIA 1MO5A 4A1FA 4DT1B 1QG4A 3PEWA 4HAUA 3IHLA 4FMDF 3FDIA 4UXHA 2FG5A 2CJWA 2UZIR 5CDFE 4GNKA 3AKEA 2B8WA 4MQBA 2DR3A 4PAQA 2NGRA 4A0GA 2CNWD 4N0EA 1SZPA 1DTSA 2GCPA 5B64A 1EWQA 4FMBB 4DBLC 1KO7A 3PG5A 1KO4A 3QE0A 1DG1G 5EUMA 1SHZA 1W1WA 4YQFA 2ZS9A 4AWXA 1XJQA 2I4IA 1N0UA 2ODNA 1FQKA 5JI2E 2F6RA 4I1SA 2HCBA 4LYJA 4TL6A 4Q9IA 3A1VA 4MYUA 1P5ZB 1D8TA 2CHVA 2FSHA 1YZQA 1E2EA 3TUZC 3DM9B 2QMOA 4JVNA 2GJAA 4NYIR 2AD5A 3W5JA 4YMWA 1H8HD 2QGZA 5FR1A 3GLGE 1Q0UA 4B74A 1OIXA 1UBEA 2WOOA 3O8CA 4JSYA 4TMZA 1XTRA 4KHZA 1SHKA 5A0FA 2C5LA 4KSCA 1G3MA 1XD2B 3ICQB 4PFSA 1G5RA 1TF7A 2FGKA 2GXQA 4FW9A 4G5GA 1OH5A 2DYKA 1R5BA 4OHWA 2C96A 1DARA 3SBEA 3WBJA 4DCSA 1CJTC 3K09A 5JJLA 3DMNA 2IBMA 1CJUC 3WMGA 1E2MA 3KXIA 1S3GA 3K53A 2PCJA 2XZLA 2XXAB 1NLZA 3SJZA 2OEPA 3SBDA 1FFHA 2V6IA 2HV8A 521PA 1T6NA 1E2IA 4KFRA 1FW6A 1KGDA 2P0EA 5J5CA 2NTYC 2QM7A 4G01B 2WJGA 3R7WB 3FOZA 4FWIB 3I92A 3LX5A 4V0KA 2H5EA 4DSTA 1G6OA 4CEJB 1JEDA 1D2EA 4US2R 1KI3A 2PJRA 4BLSA 3ZZTA 2IYZA 2VSXA 4OQLA 1J7KA 3CX6A 1JPJA 3HP1A 2FA9A 3C5HA 1JB1A 1SVIA 4LPSA 5J4HA 1MR3F 1Q1QA 5H70A 4ZDWA 2PZFA 1JPNA 1W0JA 1XRJA 4OHVA 5J4VA 2IX3A 1HA3A 4IVQA 3VAAA 3BERA 2X8AA 3KKNA 3FMOB 4XTCS 1XBTA 1FZQA 4F38A 3CPHA 1T91A 4ZIRB 1X8KA 1CP2A 3PFIA 3EPJA 1XTJA 3U44B 2CK3D 3CWZA 5EUQB 3FKSD 3OFND 5JS7A 1AA3A 2J87A 3LD9A 4OI4A 1KSJA 3KKQA 1RE0A 1IN5A 1SVOA 4PZLA 1VG9B 4DUGD 5IRCD 1QHNA 1DAMA 4CW7A 5B58C 3L0IB 2L0XA 5CJ2A 5FI0B 2QRNA 5GJVC 1C4OA 4BFXA 4D0NA 4QJ4A 5L3SA 4AYWA 3SJCA 2EW1A 3DZDA 1KMQA 1O87A 3EC2A 4RY2A 4XD7D 5DHAA 5KNBA 1Q1BA 4QJ3A 1H65A 3RC3A 5EP2A 2ZE7A 3IUYA 3RSLA 3RS4A 3I62A 1GKUB 1GOTA 1UEJA 4Z1MA 3G82C 5FPKA 4Q7MB 4Q1AA 2IWRA 4NYJR 2ZM5A 1C1YA 1GNQA 3LWNA 3VNVA 1W36B 4DIDA 3NHBA 2WV9A 4Q7LA 4AKGA 4MUBA 1G3UA 1WMSA 3NIBA 3DOEA 1OPXA 1FMLA 2YOGA 3C15C 3QG1A 3CLVA 4IVRA 2IEZA 4URXR 2JASA 3GLIE 5FH9A 1OHHA 1AM4D 5BYJA 1GRNA 5GVSA 5HPYB 2JLZA 4P4TA 4B6FA 4HAYA 3W6OA 5J4LA 2ERYA 2GK6A 2KSQA 2VHQA 1P2VA 1P60A 2EQBA 4JLJA 3RYTC 1OJLA 4WZBE 2C78A 2C9CA 4ACAA 2XGJA 5CJPA 1PJRA 4A0FA 5JWOA 3FMIA 3I3SR 4M1OA 2NPFA 1DAKA 4AKIA 5JCPA 2V54A 1GUAA 2IXEA 1YKSA 2ZE6A 3I32A 3NBYC 4Q4JB 2ZJBA 4L8GA 3MWKA 3V9PA 4IHQA 3LAWA 3UMFA 3WP1B 1W36D 4C0SA 4PQRA 2IEYA 2WSSD 4MDEA 4CVNA 4IXNA 1UKEA 1T0HB 1N5JA 2DFKB 3B82A 2BBSA 1N6NA 2ZSFA 3OZXA 4V02A 4PANA 3TQCA 4URVR 2JGNA 3GLHE 1G291 1G18A 1R5NA 4GPTA 2F1RA 1N3BA 1TU4A 2P6NA 4B76A 4BFVA 1RJ9A 4LGMA 3NEJA 2QBYB 2ZJZA 2V3CC 3TSZA 3Q7PA 2GEVA 2F1IA 4UJ3A 2V8OA 5JECA 3KB2A 4D0GA 2JA1A 4DDUA 4M21A 4TMWA 5JWRA 2IS6A 1JJ7A 3LBHA 3T35A 2ATXA 4FMCB 1E69A 1Z83A 4M9ZA 4CRWB 3TQFA 1KNQA 1II8A 2Q21A 2XSZD 4YONB 5CK4A 3CPEA 1RPZA 2IWHA 2ZR0A 1PLLA 1ZM2A 4A8JA 4FCWA 4EIWA 4C30A 2J59A 1VHTA 2ZJAA 2OAP1 3SS8A 2JIZA 4JJKA 4DB4A 4BZPA 3UANA 1T3SA 1ZNXA 4WIAA 4JVMA 2V7QA 3GPLA 1DO0A 2AK2A 2BJVA 5KSOA 4X8LA 3QVUA 4D26A 4PXAA 2GBLC 2FH5B 5FOXA 3EPHA 3RWOA 1FMJA 4MGYR 2GJ9A 3DOFA 1CF4A 2B6HA 2WKRA 4JVLA 1KSGA 5SZJA 3I8XA 4Q19A 1I4LD 3V4RA 4NE2A 1OV4A 4IDHA 5D3MB 3RWMB 1DS6A 1ZUIA 1ZIPA 2F7SA 1L4YA 2VTKA 1RVDA 2YJTD 3G0HA 3TNFA 4I1UA 1COWA 1US8B 1ZP6A 3ZDQA 2FNAA 3GFPA 1BMFA 1U0HC 5ANRB 1E0SA 2WJJA 2G9NA 1AA9A 4DLRA 2EWWA 2ODEA 4MDFA 4A8JC 5L3QB 3D8BA 4HLUA 1W4AA 421PA 1KJYA 2JCSA 5C1BA 2ZS8A 5DGXA 1F6BA 4V0MA 4JBXA 2KBEA 1RW4A 1GTVA 1KHTA 2JJ1D 4KSBA 1KY3A 3QPUA 1QDEA 2JDIA 3IIMA 4US0R 2ZRFA 4L15A 621PA 4C0AC 4R2HA 2XOKD 4W5WA 1M74A 5B57C 4TYPA 4A15A 3MAAC 1R8QA 3IEUA 4NU0A 2G83A 4XSGA 4B35A 1YZNA 3K9NA 1G17A 2GXSA 2R6AA 3AQ4A 3LW8A 1II9A 4FWTA 2WVJA 1WP9A 1E94E 4KODA 1EWRA 3H0KA 1N25A 4TLCA 3NTUA 4HB0A 3U7EB 4B48A 3I5YA 4NYIQ 5FR2A 1E9DA 1U98A 1ZM4A 5F3WB 2CLDX 2ZJ5A 3BWDD 1KJZA 2X2EA 1FTNA 5HR5A 4RKEA 2DFLA 2IYSA 1BKDR 2QZ4A 3BH7A 2A9KA 4ZO4A 5F9HA 1WXQA 4BFTA 4JLPA 5JS8A 1N6KA 1EFRD 1JR3D 2GJ8A 1R2QA 2E9SA 2VYFA 4KO8A 1IY2A 3B2EA 4RFVA 1ESNA 1WE2A 4MGKR 3A6PC 4OL0A 4KCGA 4EPYA 4KU4A 3CR7A 2QP4A 3H86A 3UG7A 1AZTA 2W00A 3G5UA 1RZ3A 1W4RA 4JT4A 4AY2A 3T12A 3V00A 1R0ZA 2KB0A 2WOJA 1HTWA 3KZ1E 1IN6A 2C99A 1YZTA 1RJ9B 3Q7QA 4DSNA 4RZUA 1AS2A 3EC1A 2WJYA 1E98A 2ZYUX 1LB1B 3VMFA 4M1MA 1XXHB 1IN8A 3O8DA 4I1OA 4DCVA 1CLUA 3CM0A 3HR7A 1TADA 3UWOA 4QM7A 2O8CB 1P4SA 3DM5A 5GJBA 1P2TA 4YMTA 1RRGA 3CBQA 4O25A 2VHJA 3MG9A 1FP6A 2GILA 3QBTA 2J7PA 3KXKA 2QM8A 2CCJA 3CR8A 2H92A 4TMTA 4PQYA 1XMJA 2E1RA 1A2BA 4JLKA 3CZPA 6Q21A 1G21E 1U0LA 1VPLA 3BGWA 4Q18A 5KHOC 2V6JA 1YR7A 4DCUA 3W6PA 2VP6A 3FHCB 1GIAA 2PMDA 4LJ8A 2IYVA 4I4LA 1HT1E 4IEEA 5EP1A 5KO2A 5E4FA 1HE1C 1OHHD 1ZAKA 3W34A 3RHFA 4JSTA 3AKYA 5DSZA 3BJIC 4TQAA 2GETA 5CLLA 3GLFB 4TL7A 3AP2A 1G9XA 4NH0A 5UKDA 1II0A 2AD1A 1HT2E 4O2LA 4GFDA 2V4ZA 2HT1A 1JXMA 3R7WA 3VR4A 1KK2A 5AJYA 2ZRAA 4TYQA 5EXSA 1NJFA 4R71A 2VRWA 1L7VC 3QBVA 1KYIA 1SXJD 4NYJQ 5DHFA 1P6XA 2YYZA 1G19A 3HWSA 4NCIA 4DIEA 2DWOA 2NZJA 4DLZA 4X8HA 4KVAA 3SDZA 1E9EA 2JJ2A 1NBMD 1KZGB 1JNYA 5JSZA 3D7MA 1KDTA 3ZZUA 2J41A 2ZSBA 5FBWB 4QRHA 4DB2A 2XJ4A 2PLFA 4JL5A 2J5XA 4UNQA 3AF3A 3WYFA 4EJSC 2IYXA 1DO2A 2FZLA 2O0HA 4A0RA 2GAOA 3GFTA 3K0FA 1HV8A 4HLUC 4I1VA 2ZS7A 2GAAA 3AKDA 3L43A 4JL6A 2J0UB 2VP9A 3AUYA 3ETLA 1ZD1A 4LV5B 3GQBA 2OZEA 1EG7A 3QF7A 2EU8A 3GJ7A 2D4HA 5HCIA 3KQLA 1GITA 2VF7A 4XWOA 2QL6A 2R6DA 3OF5A 2JLQA 4XVQA 2F1JA 2G1JA 3P1JA 1SKQA 3CH4B 3QVVA 5J4YA 1KI6B 1W7AA 1NJGA 4IEIA 3U7HB 2SHKA 4LHYA 1XXHE 2WPDD 4GBMA 3BAFA 2XNDD 3SHWA 2GJKA 1SVKA 3TLXA 1DBSA 3ADCA 1J8YF 1P75A 2GEDA 1KSFX 3BK7A 3BFVA 1XNJA 4L4UA 1GKIA 3SU8A 3AVVA 4M8NE 2VQSA 5IK2A 1M7HA 1R0XA 1XU4A 3RAPR 1EX6A 1B0UA 4TTRA 2WWFA 4V0LA 2E87A 3VR2A 3CIOA 1Q1EA 3PUZA 3CF6R 4GP6A 2HYDA 5KU1A 3TSWA 4JIMA 2VHCA 1XF9A 4GDFA 4LHVA 1ZM9A 1FNNA 4NKRA 2WTUA 3L8YA 2ZUCA 4IDOA 1N0WA 2QAGA 4QL3A 4BFWA 4F93B 4MRVA 3E5HA 2A5FA 3QQ5A 1E9CA 3ZIAD 2ZRGA 3GLFE 1W0KA 5K8UA 3OESA 4D81A 4B47A 3AVQA 3RS3A 2EYUA 2VHUA 3NDPA 1MO6A 2OG2A 4AIIA 2JLVA 2J1LA 4OBEA 4YXWA 1AKEA 1OW3B 4YMUA 2B21A 5C4GB 4MRNA 1S8FA 1NMYA 3UIEA 4LRWA 3ZS9A 4G0NA 4U00A 2QT0A 1EFUA 1ZIOA 1T3HA 2HLDA 1YZLA 2VO1A 5EJEA 1A7JA 2NOAA 1S9DA 3K8YA 1TF2A 1XFAA 3NG1A 3OEHA 5KOYA 4GZLA 4JYBA 5GJCA 1LY1A 1KDPA 3UMSA 4QJ5A 3RANA 2JJ8A 1CR1A 3R20A 1NBME 4BLRA 4B3CA 2AK3A 1SVMA 2KJQA 3IKJA 4MGIR 2ZI4A 1PV4A 1XTQA 1OIWA 4TMKA 3U4QA 1RRCA 1W4BA 1CU1A 2FMXA 2ZU6A 2G1KA 4AG5A 3EPKA 3GLIB 3BOSA 3MWJA 1GFIA 2ZITA 2A5GA 2H7VA 1ZU4A 5HTKA 3TSOA 2UVQA 3T5GA 1NIJA 3QNUA 4DXAA 1YRAA 5DN6D 3SJAA 5JRJA 2H1LA 3LXRA 5FTNA 4WXRA 3EZ2A 5TVKA 1NN1A 3U6BA 3OEED 2RHDA 2CXXA 3OHMA 3QEOA 3GJ4A 4QHYA 3BE4A 5FPTA 3RNLA 1EFRA 4UKDA 1A5TA 3QSYA 5FBRB 4W9MC 2PMKA 5DO9A 3SFVA 4POAA 3LA6A 3SR0A 1N0VC 4C0KA 2R44A 4AYXA 3SZRA 2PZGA 2GVDC 3TR0A 1NIPA 2B7CA 1J90A 3B85A 5E7JA 2RCNA 3AUXA 1MOZA 4H1UA 4UQOA 5C46F 1PVOA 2ZUDA 3B7GA 4DLTA 4PC3A 3T61A 1ZNZA 2J0SA 1YJ5A 1OFIA 5FPHA 1GWNA 5DE3A 1GL9B 2ANBA 1ONBA 2NMVA 2UZ3A 2RAPA 4B73A 5SZIA 1QZXA 1Z07A 2VLIA 2OILA 4URUR 4TMVA 4LBYA 2O8EB 4LPKA 1S1MA 4HB4A 1H8ED 3QKSA 2CLCX 1Z6XA 3B1VA 3GJ8A 5FUYA 1Z6AA 4XTRA 4CT4B 3B60A 3VHLB 2W2VA 4BLTA 1EFHA 1XB2A 5LB4A 2FDCA 1U99A 2FV8A 1AS3A 2XAUA 1F2TA 4U5XA 4QKQA 5AUPB 3B78A 2C2HA 2QP9X 5JWHA 4ARZA 4BEBA 1OH6A 1SVSA 4X8MA 3PUXA 4US1R 2WIAA 5A4JA 1RYFA 3EWSA 3KTAA 1NLYA 2ZRPA 1Z0JA 2XITA 3THXA 3T1TA 5AJWA 2R6FA 1M7GA 3ZH9B 3OE7D 4MYTA 5A5GA 1I4DD 3AEZA 2RHMA 4NCHA 1G4AE 3WNBA 2Q3FA 5GADl 4HDOB 1Z63A 1E4YA 1I2MA 3GD7A 3U2QA 1YRBA 1ESMA 3KFVA 2VF8A 3ZD7A 2RGGA 4A92A 4EQ6B 1NG1A 2AN9A 3CRMA 2PT5A 4TLDA 4DJTA 5AUOB 4W7SA 5K8TA 2IK8A 1Z29A 3P4XA 2WBLC 2BM0A 4NPHA 5FBQB 5CLQA 2OBLA 1VYUA 2JLUA 4QBGB 4WOPA 3R9IA 3HJNA 4Q1EA 1XJCA 3MJHA 3VR3A 1S96A 1DAHA 3B9QA 5JJIA 4BUJA 1QF9A 3CUEF 4LOAA 5EE1A 4OK6A 3SYNA 5JRZA 2W58A 5GVRA 5IF9A 1E32A 5AJXA 2F9MA 3QY0A 2LKDA 1XWIA 3KJEA 2WKQA 1K6MA 3R8FA 3M4YA 3TE6A 1CR0A 2XB4A 1UAAA 3LX8A 4M9XA 1ZCBA 3GLIA 1QRAA 2PEYA 4LY6A 5EZ6B 2RGXA 2ONJA 2CE2X 1IXSB 1L8QA 4XVUA 2Z4RA 2F3TA 5JZVA 4Q9JA 4UXJA 4V0OA 4JLVA 2YWHA 1N6PA 4ASUD 4G5RA 3TRFA 3VNUA 4BRUA 3QXJA 1R0YA 5TXGA 4PTLA 3QENA 4JMPA 1HUQA 2ZYWX 3O8BA 1ODFA 5HE8A 4MUAA 3W8RA 3PQCA 4LJ9A 3FWYA 3K0AA 4Z8YA 1OFUX 5TDHA 2QTFA 1KO1A 2IF2A 2Z4SA 4NYMQ 3ADDA 1M1YE 1IQPA 1E2QA 5IDVA 2Q9CA 1UJ2A 4P31A 1E96A 4WAUA 4Y0VA 5AK0A 2GXUA 4QC2A 2ZYVX 4ZIRA 4LHXA 2ZAOA 5JLJA 2A5JA 4DVGA 4HATA 4Q00A 1FQJA 3SC3A 1LFDB 3QKTA 1P62B 5KNDA 2QUZA 1N6RA 2OCBA 4PO9A 1JECA 4JJZA 5DYIA 3PIRA 2DHRA 2Q3MA 4L9SA 3A1WA 4JLOA 2W6ID 4QXAA 5TMPA 2BVNA 1EGAA 4L16A 1X86B 2QPAA 3IIKA 3PENA 1IY0A 5JBQA 3SQXA 2QMHA 3CF0A 2F43B 1X8JA 1JJVA 1U8ZA 4TL9A 3CNNA 4PX9A 4DKXA 2OO7A 2A30A 4C0QC 4BGDA 2FZ4A 2RGNC 2IT1A 2QE7D 3MMPA 1JQJC 3MWLA 4LBVA 3PEYA 2O8FA 2ODBA 1Q22A 1F3OA 1WA5A 4BQSA 4F92B 2ODWA 2YZ2A 3FPAA 1Z2CA 3TUJC 3CX8A 1VIYA 3WP0A 3QF4B 4MKFA 2JLWA 1AJEA 1TUIA 2QEQA 2VP2A 5J40A 2BMEA 3N70A 3SNHA 5JJKA 4FINA 4DSOA 3CRQA 4QHSA 4C0BA 5DI3B 4PSAA 1XEXA 3SHFA 4R2IA 3NWJA 1UDXA 1NVWQ 5BN3A 2NO7A 2NO1A 2VEDA 2QSZA 3K09C 3UATA 1MRNA 2PLRA 5FOVA 4TSFD 2ZAMA 1W5SA 3OAAD 4DWJA 4PPQA 3PITA 2IA5A 3JVUA 5FUXA 1OH7A 1KNXA 1ZU5A 3HU1A 1WRBA 2X2FA 4BFYA 3THOA 3U5ZB 2O8BA 5LD2C 3L0PA 4PC2A 3MUFA 1CJVC 1KK3A 3WYAA 5BN4A 2PBRA 2C9YA 3QPVA 3E1SA 2IUTA 4ABYA 2GF0A 1NMZA 4DLYA 1B23P 3BRWD 1I4TD 2OFOA 3X1YA 1CS4C 3Q3JB 3U3KA 2MMCA 1XMSA 1LS1A 4TZ0A 3ZLJA 3EG5A 2YC4C 4EJSB 1Q57A 4PZYA 1JEEA 2ZRNA 3GLHA 5DIFA 4IW3B 1IXRC 5TY0A 4PPNA 5JSZB 2ZVQX 4JKYA 2CL0X 2QU8A 1PLKA 3KJHA 4OHZA 1XTKA 1KJWA 2X19A 5K8IA 2D7DA 2WZQA 2CK3A 5E7IA 1HY3A 2W6JD 3MCAA 1NP6A 1GL6A 3SFZA 4WZAE 3CONA 3HU2A 3HPQA 1OXTA 2VHTA 2BJWA 3I72A 3TUIC 3NKVA 2ASEA 1SGWA 5G3ZA 5C2JB 2DY1A 1XZPA 1D2NA 2OXRA 2V9PA 2JATA 1Z47A 1E9RA 3TBKA 1OIVA 3IPXA 4HUQB 4CEIA 2ECKA 1SVWA 4IFEA 2Q3HA 1NVVR 1PUIA 1E99A 2JLYA 1D9ZA 1LVGA 3ICEA 2ZJOA 1BYIA 4NHOA 5CB8A 5LPNA 4TT3D 2JAQA 4C2TA 3NBZC 3X2SA 1XTSA 2W0SA 3K0AB 4Q4AA 1M2OB 3U7FB 1MO4A 4H1VA 4ZDIA 2A5DA 1A4RA 5G3YA 1BH2A 4EDHA 1G8GA 1R10A 1YQTA 4HUTA 2WIBA 1YZGA 3CKLA 3A1SA 5DYGA 2ZSEA 3AF0A 5BN5A 2B92A 2CJWB 2G3YA 3REFA 5AUQA 5KSZA 4ON9A 3THWB 5LD2B 5L3SB 2P6UA 3QJYA 4UJ5A 5KPDA 3HU3A 2OV2A 4Q21A 4EAQA 3KKMA 1VCOA 3DL0A 5FL3A 1NN0A 5HKKA 4GP7A 2OSBA 4C3ZA 3B1YA 2QBYA 4PC7A 2YWGA 1XPOA 2Z6VA 4DZZA 5AJZA 4IDNA 1YZUA 2P5SA 2VPPA 1LS6A 3EW9A 1JALA 5FL7D 4LYAA 2AR7A 3MWYW 3REGA 3R9XA 1GRRA 1Z6TA 2C8VA 3W3AA 5DNYB 3CO5A 3A1UA 3ND8A 2YWEA 4KJZA 4RZ3A 3RLFA 4ZDJA 1D9XA 4LV6A 4V0NA 2MSEB 2VSFA 1E79D 3PVSA 4IRUB 1OB5A 3FMFA 1XPUA 1T5LA 4WW0A 1X1SA 3L2OB 1KK1A 4RD3A 4ZCMA 3AVYA 1N5KA 2BCGY 2EWVA 2O52A 1XTIA 5L3VA 4U02A 2Z43A 1UF9A 3FFBA 4DUGA 3KUDA 5GJWC 1Q3HA 4OQNA 2N1BA 1HQYE 1KAOA 4DC9A 3PJRA 1YR9A 4Q9HA 4UNRA 1AGRA 4HSEA 1CTQA 3IEVA 4DDVA 4BZXA 4OJKA 2A78A 2DFNA 2HXYA 4DHEA 5KDOA 4O3MA 1IXZA 3JVVA 1Z08A 2HEIA 3C14C 2HLDD 2WWWA 5CB6A 3FHTA 3IILA 1G7CA 4XVRA 2NIPA 2OE2A 3KTAB 3ADKA 4D4KA 5G41A 5JEEA 3CW2A 4II7A 2J45A 1UKVY 4QGAA 5C18A 2P6RA 4R7ZA 1NG9A 1G3IA 3AGPA 2W0MA 1R5OA 1HQCA 4BFZA 5JHGB 4XIGS 4Q1FA 4GOKA 5EZ5A 1HEIA 4BLQA 4PR0A 3EX7C 2QROA 4HDCA 2OESA 1OYYA 2FFBA 1OKKA 3Q9LA 1E2JA 3QXCA 5EXTA 2GDJA 2PJZA 4GZMA 3I5XA 3DPUA 3N2IA 3FVQA 2GRJA 5DN6A 5BXQC 1E9BA 2KE5A 3ECCA 2HXSA 4NZYA 4RZ2A 4AYTA 1EFTA 2FFQA 2QQEA 1G5PA 2XZOA 1T9HA 5TARA 2XTNA 2OAQ1 2P65A 1UPTA 2ZJYA 3THYA 1OH8A 4AI6A 2GESA 4LCBA 2WJVA 4UXIA 1SQ5A 1SXJC 5B30A 5JCZA 1NN5A 2FFHA 1M7BA 4N1AA 4PHGA 2XXAA 3DEFA 1T3LA 1YZKA 4NYMR 3TK1A 3J81k 4I81A 1IAQA 1QBKC 3GEHA 4LC1A 4A8JB 4HUQA 4CEIB 2C9OA 2XZPA 3AVUA 5AWFC 2W83A 4XD7A 3ZVNA 3SN6A 2UKDA 2FEOA 4YDSA 1RFLA 2F9LA 3QKRB 4LZZA 4I99A 3Q85A 5IT5A 2OM2A 4BECA 1G5TA 2PX3A 3EZ6A 1CBUA 5JEDA 1X6VA 2Q9AA 1N6IA 5FTMA 3THYB 3EZ7A 1P9NA 4B3DA 1Z2AA 5C4MA 3BB1A 4M22A 3GP8A 4MITA 5P21A 4CEHA 3E2IA 4PC1A 2WMNB 2DWPA 3N2EA 4TYNA 2GA8A 4JLMA 2FN4A 4BE7B 1OFTA 2D74A 3K9LA 3T34A 3VQTA 4B3BA 1UM8A 3UKDA 3F0TA 4E09A 3KUCA 1VCIA 1X8LA 2D06A 4JKIA 4K46A 4OYHA 2GKSA 2HF8A 3CNLA 3BFKA 3L82B 5EE3A 2CHGA 4DEXA 3GJ0A 4JLAA 1TUEA 3DVLA 4LJAA 4MRPA 2IYLD 2N42A 2BKEA 4LBZA 2WM9B 4M1TA 3AP3A 5BWMA 3EA0A 3WHKA 2IW3A 4EUNA 3LRPA 4C0LA 2LKCA 2NQ2C 3WRYC 1KSHA 2ZEJA 3OE7A 2PEZA 2QAGB 1XEWY 4PAMA 2J7PD 1ETUA 1NVXQ 1NL3A 2IF0A 3IO3A 2Q6TA 1FPMA 1ZD8A 1CJKC 5KPJA 5FOSA 4FCTA 1JXOA 8OHMA 2XNSA 1Y3AA 4P4SA 2ZRBA 1OXSC 4S2EA 2FFAA 1SKYB 1COWD 4XWKA 4DLUA 2GCNA 2RH5A 1Z8FA 4R98A 1F2UB 1E9FA 3SQWA 1CIPA 1HH4A 1ZYUA 5FTJA 3W5IA 2PH1A 2GEUA 3WBKA 4BLOA 2DPXA 3GLFA 2H18A 4HI0E 4IDQA 4RD0A 5LB2A 3WRXC 4D82A 3EIQA 1GP2A 1G7SA 4LJ5A 3GMTA 3B1XA 3EXAA 3KKOA 1JR6A 3GCGA 1W0JD 5M04A 5KUTA 2F1HA 4OK5A 1ANKA 3DDCA 4AC9A 1DAEA 3AVWA 2QGNA 1ZMXA 4M53A 1ZBDA 2VBCA 3A58B 5AJVB 4FIDA 2FF7A 4PHTA 1S2MA 4QHTA 1MH1A 2ZR9A 1OT3A 2REOA 5J47A 5KDDA 4LBWA 1DG3A 1MKYA 2J9RA 2DBYA 3FB4A 5EXXA 3LBNA 4L9WA 2REXB 3DHWC 4Q7JB 4D4MA 1XXHA 1G7TA 2ZRMA 3WMEA 2MSDB 3W9YA 2Y8EA 3PR1A 1N6HA 1P72A 1LV7A 3GJ6A 1AS0A 4ASUA 4HDQB 1QHYA 1QHSA 2AXNA 3BD9A 3DO6A 4F4JA 5KTYA 1RRFA 1HYQA 2LCFA 3RS2A 3LVQE 1WB9A 1U8YA 1UKYA 3ND9A 2HDNB 1E0AA 1NVVQ 121PA 3RS5A 1JR3E 2BOVA 3GJ3A 2OCPA 5DH9A 2AX4A 2R65A 4NCNA 3AM1A 2TMKA 4URWR 5E95A 3K1JA 1YVDA 4Q4LA 2QTVB 5H68A 4A6PA 3ZVRA 3PUWA 4TLBA 2BWJA 2CVHA 2FPKA 2NO9A 4TMXA 3SI7A 4DLVA 2J0UA 3KL4A 2ORVA 2JJ1A 3WYGA 4TZ6A 4B3FX 1LW7A 2GCOA 2C95A 5JMTA 3BS4A 1MABA 1X3SA 3CF2A 4ITRC 4Q1BA 3EASA 3WHLA 2ORIA 4G5SA 2W2XA 3ZJYA 4DCTA 3VKHA 2A2ZA 2DFTA 1RKBA 2W6IA 1U2RA 5E7MA 1KMHA 4AKHA 4PZZA 3RABA 4F7WA 3C5CA 1NI3A 2CE7A 1E1QA 3OIWA 1TQDA 4HLDA 4JBWA 3S1AA 4OI2A 2Z83A 4A36A 3RRZA 4DDWA 1J70A 1T8UA 2B7BA 1G7RA 4JZKA 3FGNA 1TEVA 1R8SA 1VG1A 2OCAA 5HCNA 5FOWA 3BFXA 2PX0A 4EPVA 3CRW1 2OBMA 2IYWA 1QHXA 3BH6A 4E03A 2GNOA 2CEAA 4Q9LA 2RKOA 3HR8A 4KLNA 3O47A 4HAXA 4LYHA 4NCJA 3U3RA 1HE8B 3QXSA 1NVUQ 4MYHA 4XH9B 3THXB 4CYMA 1KOFA 3UXMA 3FE2A 4QGHA 5ELXA 3TW8B 3PCRB 4BRWA 1TTTA 2O8DA 3VKGA 4ARZB 3QUSA 4EPXA 2KBFA 4A6XA 4B43A 4ILEA 1CRQA 4B2LA 2LWIA 4JLNA 1DEKA 2RGNA 4PO8A 2VSOA 2ZJ2A 4ACBA 2CBZA 2EFDB 4Q03A 4D25A 4LJYA 5DLQC 2BMJA 2VIIA 4PAOA 3C4JA 1P2SA 1WBBA 1NNEA 1BIFA 1ZUNB 4E5UA 1U9IC 2JIZD 2D62A 3KJGA 1G8YA 4B34A 1Q20A 1P2UA 2VP4A 3LXXA 1NLFA 3NC1C 2BHRA 1PZNA 2BMFA 1G6HA 1NBMA 4MRRA 4HB2A 5CYPA 2R6GA 3UG6A 1W2HA 4F91B 2EFGA 1XEXB 4QGFA 4UNNA 1UBFA 5G40A 3IIJA 1AKYA 2YOFA 3D6TB 4WVFA 4P0TA 3FTQA 1KKLA 1KK0A 3PUVA 1RIFA 1W49A 2G0NA 2JEOA 2RGDA 2YHSA 2WAYA 4QGGA 4M2LA 3OEHD 1IBRA 4D80A 1Z5ZA 3JZAA 1IHUA 1MRSA 1KI2A 1G16A 1G20E 1TPZA 4EFLA 1G8PA 2WWXA 3RSOA 4A2QA 4YLGA 2ZIAA 4Z51A 2WWYA 1BMFD 4Q66C 2H8KA 4RCZA 2J7KA 1U9IA 2CNWA 1NY5A 2ZUBA 2I3BA 221PA 1RYHA 1XMIA 2ZRCA 1ZC4A 2RMKA 2QAJA 4ERNA 4PSVA 1AK2A 2I1VB 3LQQA 1E2NA 4TLEA 1VHLA 4W5JA 2O5VA 2RGCA 1GKYA 2QPTA 1K5DA 1T4GA 4NBSA 3NH9A 4AD8A 1E0KA 1N6LA 4AG6A 3CNOA 5IHPA 2JDID 1P73A 3OIYA 2K5UA 2CVFA 5FPYA 4LK2A 4IFBA 4IJMA 1SKYE 2NO0A 2QG6A 1U0JA 4FN5A 3TAUA 3X1XA 4Q5IA 2ZROA 1E4VA 1Q3TA 3MD0A 4CT5A 2GK7A 5FBVB 2QSYA 4OQFA 1WQ1R 5EQTA 1GZSA 3C41J 2RGEA 1IM2A 1WCV1 5TB5A 4FD2A 2ZQ5A 2BV3A 2HJVA 4V0ME 1TQ6A 3JZMA 4DT1A 3DMDA 1EESA 3IBGA 3P20A 2ZE5A 4GOXA 4KYIB 4Q7KA 4ZV4A 3ZIAA 2IS1A 1SVLA 5HZKA 5FOTA 4M9QA 1TL7C 1GNPA 1YR8A 3I1FA 4Q02A 2CL7X 2MMGA 2CLSA 1TEXA 2X1VA 1T8TA 2BCJQ 1ZCAA 3A4MA 3QEJA 4F4CA 4Q4HA 1VYTA 1E3MA 1VYVA 3AKCA 4YXWD 2OT3B 1BYUA 4ESVA 1QHHA 1KI9A 2ZXUA 4JT2A 3I8SA 2RGAA 3RRNA 4U7DA 1YU9A 2BC9A 4LUCA 2JLXA 4D4JA 2IYTA 2ZANA 3B6EA 2GVZC 1XD2A 2P5TB 3KB1A 3AB3A 1OXUA 1XP8A 2AHOA 3NC0C 4O0MA 2O8FB 2OHFA 1KI6A 1DAGA 3AGQA 4L5BA 4WBSA 1DOAA 1V43A 1HURA 5KDLA 3ASZA 4OK3A 1XCPA 1H8HA 1DAFA 1V5WA 2HF9A 1E2GA 2XNDA 2XJ9A 3KKPA 2OXCA 2NG1A 1EK0A 1VG8A 4CDGA 4IVPA 3D3QA 4Z54A 1D6JA 4ZPXA 4DRZA 1Q12A 2BKUA 4X8OA 2NO6A 4C9BA 4TYWA 1YR6A 1W48A 3BBPA 3NHAA 2G77B 2Q9BA 2VL7A 2YKGA 5EE9A 2QMUA 2R2AA 2VA8A 2VH5R 1E9AA 3H4MA 4JLDA 3T1VA 4KITB 2FE4A 4KFUA 2A7QA 3QKSB 2R6CA 2EFEB 2FWRA 3OEEA 4M9SA 1IJEA 1ZINA 2XTZA 1D2MA 3B5JA 2BBTA 1S1CA 4FI3C 2ZU0C 5BQ5A 2IHYA 1OXVA 1ZM3A 1IJFA 2B8TA 4DSUA 3K0EA 4IXMA 3GJXC 1KMHB 4D2IA 4IOMA 4GOJA 3VR5A 1IY1A 3DKPA 1AGPA 3I61A 1QHIA 1TAGA 2IL1A 4JLBA 3UMRA 3N5CA 1BO6A 4PQFA 1Z28A 4RSGA 3TIFA 5E3HA 3NBXX 4Z1MD 3K0SA 1UDWA 2H16A 4HZUA 1ZJ6A 4A82A 2YOHA 3VX3A 4NONA 1KIMA 2A5YB 2AL7A 2WWGA 1N5IA 4QM6A 5FTLA 3P4YA 3LQRA 1EX7A 1UBCA 1GSIA 4TTQA 2FGJA 3EAQA 1P9WA 3HPRA 4XJXA 1CXZA 2WHXA 2AKYA 4EFNA 3IPYA 1FL9A 3CX7A 3HDTA 5KNCA 4PPFA 2YVUA 5AUNB 2BBOA 3FKQA 2Q0HA 2ZI9A 3T1OA 4OHYA 3EWAA 4RD1A 3L0SA 1H8EA 4JVSB 1QVRA 1E2DA 2QP3A 3B8HA 4B2IA 4HLCA 4KFSA 2IS2A 3RVBA 4RD2A 2XB2A 2WICA 1F2TB 1CKEA 5EP4A 4Q9KA 1Z0FA 2FJUA 2WKPA 4M1SA 3GEEA 2FX3A 3KJIA 4IOLA 1XD9A 4KBFA 1ZVQA 3GEIA 2J0VA 4QBFA 1IOZA 5CDFA 2J46A 3NEYA 1WF3A 4M1YA 1J8MF 4G5OA 1A1VA 4KI0A 3ZQJA 1KI1A 3KX2A 2RGBA 2DB3A 4M1KA 3RRYA 4DLWA 5L3QA 4YC7A 3SEAA 1E6CA 1Z06A 2IXGA 3IQXA 1N2CE 2ZRHA 2YNMA 4ZKEA 5CYOA 1LNZA 3KXLA 4MYCA 4HAZA 5EE0A 1NSFA 2BM1A 1R0WA 2V55B 3M6AA 4B32A 3QKRA 5IK2D 3TH5A 3A1TA 2CMKA 2V1XA 4C0JA 1CULC 1TF5A 721PA 4BLPA 4CZ2A 5DISB 3U3JA 2YINC 4JBYA 1M6NA 1N6OA 3LO5A 1QG2A 3P27A 3KQNA 2FEMA 3SOPA 3MRSA 4Q47A 1W5TA 3U4QB 2H57A 3B1WA 1E9SA 1Q44A 2G0TA 4KV9A 2WSSA 2XSZA 1US8A 4LI0A 4QG7A 4ESHA 4JYCA 2IS4A 3P26A 4LYFA 2O8BB 1AN0A 2QY9A 2NPIA 4Z8XA 1Z0DA 3VKWA 1NN3A 1QHGA 3MFYA 5EP3A 1DELA 1KY2A 1JAHA 3C7KA 2O0JA 1YE8A 3PUYA 4KBGA 5B2ZA 4RVCA 4R9UC 4AK9A 1KDRA 4B44A 3EPLA 5H1YA 3ZZ0A 4EPWA 4LV8B 1VG0B 3LVRE 4A4DA 4KFTA 1A82A 4OQMA 1CR2A 3UWKA 3ZYCA 1JQLB 4JL8A 4C4PA 4B3GA 3LY5A 1F2UA 1Z3IX 2F43A 4ZI2A 3NBFA 3SYLA 2ZSDA 3GLHB 4S35A 4TSFA 5DI3A 2QT1A 3EZFA 4K81B 1UBGA 1VCNA 2JLRA 2ZYTX 1IN7A 3F8TA 5FUVA 4Q1DA 1SXJA 3SE0A 5F98A 2IYQA 5BW8A 1J99A 4B2PA 2GWHA 2X77A 4LJ7A 3TAHA 4B3XA 1Z0KA 1S3SA 1VTKA 2F55A 2ZJ8A 4DEYA 1UKZA 2ANCA 1E2FA 1L4UA 3AF1A 1OE0A 3K70C 1P61B 5AR1A 2ZRLA 4V03A 1W44A 3W6NA 5FUWA 3VTKA 3U3MA 1N5LA 1JBKA 1K5GA 3B1ZA 2GZAA 3KQHA 3ADBA 1DVRA 2C03A 3OFNA 2QTHA 5JI3E 4M1WA 3KQUA 3VU9B 4B33A 1G4UR 1SXJB 1MABB 1Q1ZA 1U90A 2ATVA 2XTMA 1ZM7A 4TQUS 1G41A 1P3JA 3VR1A 4ZKDA 3U3OA 4D4LA 1T0JB 1TQ4A 1FUKA 1DPFA 4MRSA 1GDDA 3L8ZA 4GMDA 3T5DA 2D3WA 4RFSA 1KI4A 3U7GA 3CRRA 1PLJA 1GILA 3PXGA 3SYKA 4BFUA 3K0CA 3U61B 2IYYA 3AH8A 2QQ0A 1BOFA 2EFCB 4LSGA 1XCMA 3W90A 3TGPA 4TLAA 1R6BX 1Z0IA 3A4NA 2EVWX 2DCUA 1OB2A 2OLKA 2D7CA 2R8RA 3AVPA 4B6EA 4BFSA 4OQXA 4FCVA 1E1RA 2IHBA 1ELOA 1ZUHA 4LDJA 2BEJA 4TL8A 3TVDA 1O3YA 2O8DB 4LHZA 4Q01A 4NMMA 3QG5A 4Q4JA 3MGCA 4K8OA 2AWNA 2QORA 1YHNA 3EIHA 1KDOA 4HAWA 1KO5A 4B71A 2REBA 1ZRHA 3W3ZB 4HAVA 3PV0A 4GI7A 1KZ7B 1XEFA 2ZTSA 4N0DA 2P2LA 1NMXA 5FPSA 4KAXA 1KTVA 4FXPA 2AFIE 4RCYA 1AQUA 1Q21A 1SXJE 3U60B 2OFWA 1DAIA 821PA 4IOKA 1M34E 2AXPA 5LBIA 1D5CA 1KO8A 4GMXA 4CF7A 1FX0B 2EFHB 1OF1A 2QA5A 4YMVA 3EA5A 5EE5B 2CCGA 2ZR7A 1JR3A 4Q4AB 1TMKA 1Z6GA 3R9WA 1U94A 4Q1CA 1IONA 1CJMA 4JS0A 2QE7A 4NL4H 1OLOA 3K70D 3MJRA 5HZHA 1KKMA 4A9AA 2IYUA 3B13B 4LJ4A 3K9GA 5FOUA 3GJ5A 3RRMA 2G88A 3UK6A 4GT1A 2GTPA 1XPRA 3X1WA 2ZI7A 5L8VA 1II8B 2FSFA 2GJSA 3CH5A 2DWQA 4DLXA 3LH5A 4HZIA 4P4SB 2I1QA 1M8PA 4M4SA 2P3SA 3ASYA 2ZI3A 3TVTA 3VU9A 3IQWA 4PPGA 1WDTA 3LLMA 1R7RA 3K70B 3AP1A 4G5QA 4A2PA 1K8RA 1LF5A 3GLGA 4J0QA 5G53C 4GRAA 4MKIA 1ZNYA 2BIFA 3QKUA 5FTKA 1IN4A 3RS0A 3AF4A 1MO3A 2PT7A 3OIUA 4A2WA 1JI0A 4GL2A 3FKSA 3W8NA 3TJZA 4PSKA 2C77A 4WXPA 4DLSA 3LFUA 2GHIA 4KXFB 3LLUA 2BBWA 2ZPTX 2CHQA 2IUSA 5KSYA 1NSTA 3RS7A 1UEIA 3WMFA 2V1UA 3QPWA 3QXXA 3QI2A 2BDTA 1I2DA 2EYQA 2GBLA 3Q8XB 4YDHB 4ZCLA 3S1AB 4ZDKA 1P9RA 4EJSA 2PL3A 1Z6YA 5F9FA 2O0KA 3I4LA 2QI9C 2ZI5A 4EQ6A 2QN6A 2NZ8A 2QRZA 4PHFA 4UNPA 4LC0A 1TU3A 4H9GA 2R9VA 2ZRKA 1XDBA 4URYR 2ZRIA 4WZ6A 2ONKA 4EPTA 2GZHA 1AQYA 4FMDB 4BWYA 1GVNB 1NY6A 3L0OA 4EFMA 2P67A 2KI5A 2W2TA 4QOSA 1S0UA 5BYKA 2FPLA 1A2KC 2ZSAA 4M0LA 2JLSA 4N3NA 1LF0A 4P3YA 1QHHB 2FSIA 4RFSB 5SZKB 1E2HA 4TQ9A 1G1MA 2IYRA 1RRPA 3TR5A 4D6PA 4W5HA 2WPDA 4XSHA 4ZI3A 2WWIA 2AFHE 3RC8A 2GF9A 3CB4A 1VIAA 1EXMA 4TTPA 1E2PA 4TT3A 4RKFA 3BXZA 3PEVA 2IXFA 3LNCA 4E07A 3BH0A 4Q48A 4MKGA 1W2GA 3QOFA 5D3MA 1OYWA 2FU5C 5CM9C 3Q72A 5FBLB 5LDDC 1EFCA 1FTSA 4PC6A 1GNRA 1NKSA 3BB4A 3E70C 4KYUA 3QXHA 2ZVPX 1ZNWA 3ZQ6A 3NXSA 5JFGA 4LHWA 3CZQA 5EXPA 4EKDA 1GRQA 2GXAA 3HYTA 4C0HA 1KI7A 2R62A 3F3YA 3AVTA 5KSPA 2FOLA 3AVXA 1WBDA 2AKAB 1Y63A 4C7OB 1XEWX 2ZRDA 2D2FA 1E0JA 1GG2A 3ONWA 3P32A 1QVAA 2N46A 3U6KA 3TMKA 3C8UA 4CEHB 2OLJA 1P7CA 4Q4HB 4CGZA 3C16C 2H17A 5JHHB 3CRVA 1G8FA 1E79A 1F60A 2XX3A 2ERXA 3RDPA 4FMCF 3T15A 3OAAA 4RD6A 3A36A 2J0QA 5CIQA 1NF3A 4QFMA 4AKEA 1X1RA 4CEJA 4BEJA 3ZD6A 1GL7A 1VCMA 2A3RA 3FMPB 3FYHA 3MLEA 4C7OA 4QBHA 1GAJA 1W0KD 1CRPA 3NVAA 2V7QD 2CCKA 4DDTA 3O8RA 1RC8A 1KI8A 4NTZA 5TV2A 4BZQA 4IKEA 4OHXA 1XMVA 3LDAA 4PHHA 4RD4A 2OBNA 2Z5FA 3H2YA 5FI1B 2PCLA 3B9PA 1W46A 4RJLA 3T1QA 2ZREA 4AURA 1FOEB 2QPOA 3IBYA 1XJ0A 1NKTA 4MA4A 2WSMA 3QF4A 2VP5A 3UPUA 4HLQB 1VECA 1UFQA 4ZCIA 1ZC3A 5FFMA 3ZGXA 1E1RD 2W6JA 1OSNA 2WAXA 1VDZA 1SULA 2HT6A 3VX4A 1MT0A 4MKHA 3M1IA 3BIFA 4KLZA 3F5FA 2C98A 2YC2C 2ORWA 2HCJB 1W4CA 4P32A 3VFDA 4C2UA 1FX0A 1VKJA 1OXXK 1ZD9A 3IO5A 5J4KA 1J2JA 4TYYA 1FUUA 3DZ8A 2ZI6A 4QNRA 4OKSA 4A0HA 1TQ2A 4QNMA 3TW4A 3K0FB 3IDQA 4OI0A 3FFAA 5K8LA 4MGZR 4XWAA 1CR4A 2XOKA 3BORA 2CL6X 4NDZA 4G3XA 2VP0A 1W36C 3LBIA 1CEEA 3TKLA 4OJQA 4IDPA 1OFHA 3IGFA 3THWA 2JJ2D 4HB3A 3X1ZA 3GLGB 5HE9A 3BC1A 2RB4A 1VMAA 1L2TA 1XCGB 3A4LA 4P4UA 4NP6A 5CIWA 3ZVMA 1MV5A 2ZETA 2F3RA 3M0EA 3MSXA 2KWIA 2D2EA 2ZRJA 3Q5EA 3VR6A 1XD8A 5KYKA 2WWHA 5HKKD 3GFOA 2O8EA 1C9KA 5CK5A 5FL7A 5D3QA 2OCYC 4LWZA 1E2LA 3HYRA 1FP7A 1T5IA 1G64A 2BEKA 1DE0A 3BB3A 3R8CA 1PUJA 2BMDA 1E1QD 3NDBB 1XZQA 1DADA 4RZXA 1Z22A 4G1UC 2HUPA 4D0LB 3EARA 3CPJB 1GM5A 4WA7A 1R4AA 2PZEA 3AVOA 1ZW6A 4GSYA 3I73A 2MSCB 3A8TA 1G8HA 3PEUA 3V4FA 3NH6A 4BPBA 3H84A 3ZVLA 2GCOB 3KFXA 3WY9A 5H8WA 3EZ9A 3KDSE 3QIAA 1AIPA 5CITA 4Y0AA 2HJGA 5L3RA 1Z0AA 3CWQA 4QBIA 2YWFA 2IUUA 3AF2A 2FSGA 3Q5DA 2ZE8A 4F4IA 1S9HA 4PO1A 2Z0MA 3K9HA 4HEJA 2OUKA 4BASA 4CIDA 4HYYA 3D31A 1U8AA 2IC5A 4NCKA 3K0CC 5DI9A 2HYIC 3U44A 4IOJA 4MH0R 1UADA 4TN1A 1AZSC 3ZS8A 2QAGC 1U81A 3IHWA 4LJ6A 4OI1A 3DKVA 1JAIA 3A37A 3OIVA 3VHXA 3WNDA 3EIEA 2G6BA 1G3QA 2CDNA 2OFXA 3WNCA 4E22A 4TWZA 1TX4B 1XX6A 2FPMA 4LX0A 2WJHA 4O2RA 4URZR 3KQKA 3LV8A 2AWOA 2J3EA 4XOIA 3H1TA 2QENA 4YMSA 2QNRA 4P33A 4KVGA 3X1DA 5F2EA 1KAGA 2WMOB 4UNSA 2YV5A 5CM8B 2QMEA 1LTQA 1TNDA 2GZDA 4B75A 4HZUB 1OKKD 3SJBA 1G3RA 1BS1A 1F48A 2C04A 3FHOA 3AV0B 3LW7A
chains in the Genus database with same CATH superfamily
4FJ1A 1E2KA 1FDSA 4R68A 1EUCB 1FNMA 1GR1A 5DLDA 4YP9A 4DCOA 3V1NA 2Z9DA 2CEKA 4R9VA 1PU2A 3T06B 2JIOA 2ADFA 2PZKA 1IEQA 3GB9A 3I9V6 4GC9A 2MSWA 5I9MA 3OJOA 2XWBF 4A1FA 4DT1B 4CCAA 1QG4A 5DTIA 2G1PA 3WIUA 4L4RA 3P0EA 2UZIR 3CKKA 5BWNA 4NEGA 3NHMA 5JO0A 1J0BA 1FU8A 1Z4NA 2B8WA 2DR3A 2ISSD 1CNMA 4M1EA 1OUMA 3G7SA 1MA3A 2OC4A 1E8DA 4FMBB 1NQTA 4FKMA 1P19A 1PL8A 2J08A 4U8GA 3QE0A 4DBLC 4BNNA 4UBIA 1IHDA 5BSWA 4CKCB 5L53A 2GTIA 3FYTA 4O3FA 4GBJA 4GGMX 4ENSA 1W1WA 3N1UA 5HK8A 3TL2A 2O19A 3WRWA 2BW0A 4Q1VA 3T9CA 3COSA 3QEMA 3TO5A 1N0UA 2ODNA 1FQKA 3R5KA 5H80A 4ZEOA 1GQ2A 2CKDA 1QOZA 4WASA 4Q9IA 3EHEA 2VTEA 2X4DA 4F11A 4QNNA 5DXAA 1D8TA 1EZZA 1NJ6A 3FROA 3JXEA 2OAEA 4CM1A 3DM9B 2O2SA 4F8YA 5I7FA 1VCHA 1ZVVA 4LDPA 1ATIA 4JVNA 2WRZA 3VNRA 1SQFA 2AD5A 5BSHA 3NTQA 3CNBA 4YMWA 2QGZA 5FR1A 1T1EA 1Q0UA 2AI2A 3QX9A 4W9NC 3TRDA 4B74A 4CKCA 2NW6A 4W63A 1YO6A 1KGSA 2DSNA 3A2NA 3DO5A 3ZY3A 4ZEVA 4H77A 1C0KA 3ICQB 4PFSA 1G5RA 2P78A 2GXQA 4ZYUA 4X92A 1X2EA 1XA4A 3T7KA 1SCQA 4MUMA 1OH5A 4LF5B 1Y7IA 1E7SA 2C96A 2YHUA 4QE3A 3OTIA 1GPKA 5JYEA 5BR4A 4V2IA 4A8PA 3WOHA 3K09A 1ADCA 2X0RA 3DSRA 3QPBA 4JI3B 2IBMA 2JCGA 2JFQA 2VUUA 4Q9AA 3ZLTA 2XZLA 3ZJ5A 2XXAB 2OEPA 3SBDA 4MLDA 1AUXA 1A8UA 1HDGO 4H15A 1EDEA 1KOLA 4BQIA 4UHCA 2QN7A 4F92B 2PD3A 3H65A 1AUVA 1NW5A 3NT5A 3N53A 3PSAA 2P0EA 3R7WB 2B78A 2WJGA 5IMSA 2RB5A 4X45A 2YRFA 2VJYA 3OLZA 4UHDA 4V0KA 2H5EA 1G6OA 3J7AC 1JHAA 2NAFA 4US2R 3H2HA 5BMOA 4OAOA 1EG2A 2ZSHA 3OCXA 2IYZA 2Z98A 3ZZTA 4JYZA 3HABA 3DWFA 4UZEA 3RC2A 1J7KA 2HU2A 1JPJA 2VHYA 3C5HA 1LLFA 4ZCSA 2V7TA 3Q0EA 4JWTA 4KXWA 1Q1QA 2PZFA 5G0SA 1JPNA 2X7HA 3OJCA 4ALJA 1XRJA 4GBGA 3VOAA 1U8FO 4N47A 3VAAA 1IEWA 3BERA 3KKNA 1T5SA 2MINB 1FZQA 1BEZA 4H1WA 1NNUA 1X8KA 4GVLA 3PFIA 4U8HA 2BSQA 4F72A 2CK3D 4U7PB 4XB6B 1NUAA 2F90A 1QCCA 2FDCA 1XTPA 1AA3A 1T0IA 4OI4A 3PDIA 3RJMA 5HRCA 1RE0A 1SVOA 2EW2A 1DEOA 3PQ2A 3L6UA 1VG9B 4PZLA 2ORYA 5IRCD 1QHNA 4PGMA 5IDYA 4YMGA 1O5OA 1QR6A 4NZMA 4CW7A 5CJ2A 1BFUA 4UU8A 5K8CA 4OYRA 1C4OA 1NPDA 4WX2B 3DYVA 4QJ4A 3UJ6A 3DZDA 1YS7A 3N8KA 1CDDA 1XP5A 3L41A 1FFDA 1PVDA 2D1QA 3DUWA 4Q05A 5KNBA 2PIAA 3DBRA 2YY7A 2JFOA 3PVZA 4QJ3A 3RSLA 4UEQA 3RGWS 3SF0A 3P8ZA 1B6RA 3M6UA 5HIJA 1ENOA 4EKYA 2BH9A 3AYZB 4KG7A 3NTLA 2ZM5A 2WTNA 3SR4A 2REQA 1RMYA 1JJIA 1VE1A 2ZW9A 3LWNA 2I65A 4DIDA 5BXYA 3VNVA 3URMA 4Z2YA 1KZHA 2NTEA 4Q7LA 1G3UA 1RAAA 4TWJA 5D00A 2YOGA 5HA5A 4BNDA 4PVCA 2ONCA 1ULBA 4EY3A 2NVBA 3KZXA 4F9FA 4YAJA 4Z0HO 5BW4A 5FH9A 5L51A 1RP7A 3D6VA 1AM4D 1WXFA 1GRNA 1R15A 3KUUA 4IUYA 4BNTA 3IRVA 2KSQA 2VHQA 3ZK7A 3I6YA 3B6IA 4HGYA 3RYTC 4BWVA 4IDFA 3I01M 1UZAA 2HJHA 4A7PA 4WZBE 2XGJA 2E4UA 3EGOA 4A0FA 2WM8A 2YVQA 3I3SR 4BBJA 4AKIA 2B82A 2HA6A 2WAOA 3M82A 4CL8A 3SF8B 2INGX 2XMPA 2ZE6A 1C8BA 2EL9A 4EA7A 5JY1A 2ZJBA 4L8GA 1WF6A 3MWKA 3TQHA 3T95A 1TM5E 3UT0A 3LAWA 3UMFA 1SXPA 1SCBA 1L5HA 3R76A 4JOQA 4CKYA 4DLBA 2IEYA 1NXOA 1M34B 4PINA 2DM6A 2QXUA 2XKKA 1UKEA 3I2YX 1N5JA 1J20A 1SHLA 2PS0A 1ZPDA 1GPJA 3C98A 5A05A 2C7RA 4CUZA 1R6DA 2POQX 4YAUA 5BR8B 2ZSFA 3BD7A 3OZXA 4PANA 4V02A 3TQCA 1ZXBA 3MLBA 2FE1A 3PI7A 5B3AA 1DC4A 3A31A 1LVUA 2OXEA 3VU1A 2VI5A 4GPTA 4BZWA 4Y67A 3GGPA 2EARA 4J3NA 4IIVA 4RWZA 3HJFA 1CUSA 1QYVA 3NEJA 4KXYA 4DV0B 4BNIA 3TSZA 4OJNA 1RAHA 1NJ1A 1HE3A 1VMKA 4UVHA 5JECA 2VAMA 2DC1A 3QYJA 2EJVA 1T36A 4J7UA 4AJ1A 4TMWA 4N8EA 4GKAA 1D07A 4MVJH 3N2NA 4CKEB 1JJ7A 4FMCB 1P0CA 1Z83A 3HJUA 3IAM6 1NBIA 1VFPA 3CN7A 4MZDA 1FJXA 5KNCH 5IJXA 4H18A 1QV7A 2PS1A 3OQHA 4EMBA 3AIKA 3CPEA 4AY5A 4FQ5A 2IWHA 4MW2A 3PGJA 4BQFA 5K0BA 1PLLA 4PZ0A 1Z56C 1YVUA 4C30A 2J59A 3IR6A 2JIZA 2A3NA 4JJKA 3RE1A 4BZPA 3UANA 1ZNXA 3CA8A 3PQ6A 3QFSA 3GPLA 4NULA 2BJVA 3UK1A 4UPEA 5HMLA 4D26A 4MA5A 3U9LA 2HR1A 4PXAA 4HJXA 3M7IA 5GOTA 5C0OE 2WWVD 3P2JA 2GPAA 4KMMA 3PFGA 3AU9A 3TIGA 4YN3A 2WKRA 2ZJ3A 4J43A 1KSGA 4P7JA 1F0NA 4Q19A 1LUAA 4MDHA 3ZCXA 3OQJA 1ZA2A 2MINA 4OVKA 5AI6A 3V4RA 2O2ZA 4DUZB 1ZUIA 1Y3CE 2PYIA 1RVDA 1XG5A 2MT9A 3ASVA 2E82A 1V45E 3PFKA 2FNAA 5LOVA 3ONFA 3A9VA 1V4VA 2PO7A 4B6GA 4JX9A 3GFPA 4BLVA 2PQ2A 4MV3A 4A10A 1SCUB 5ANRB 2B34A 1E0SA 1SVUA 1SPBS 4KZKA 2G9NA 1C0IA 1AA9A 2BFCA 4HWPA 2M98A 2PQMA 4CQJA 1KZYC 4RTJA 1QQTA 421PA 2JCSA 1BSVA 1ODJA 5DGXA 2CFIA 2YX1A 4JBXA 2H2DA 1YT5A 2JJ1D 4JP8A 1FFBA 2B8JA 2HRRA 3NFYA 3LP6A 1F06A 4KSBA 1KY3A 3DMGA 2P5UA 3QPUA 4REQA 4WINA 2AI3A 2YIJA 1VBKA 5BV7A 621PA 3E8MA 4P5EA 3QPDA 4YGXB 2XOKD 4EKEA 2QRVA 2OXIA 4DWVA 2HSGA 4E7OA 1X1QA 1YOVB 4QYIB 3OTHA 3TDNA 3QPAA 3SNKA 5GQSA 3MQ4A 3H8VA 1REQA 5K45A 1J2EA 3AQ4A 2D0DA 2VZ8A 2WVJA 4QVIA 1WP9A 1UMBB 3OQBA 2OR3A 3ANXA 3IKLA 4KRYA 4KODA 4GEKA 4WNCA 4WUVA 3HJBA 2AW3A 4HB0A 4IQFA 5BSVA 2Q8NA 3M9LA 4MYRA 1T36B 1U0OC 1XVLA 3KQVA 3VV3A 1CQIA 2BN4A 4FGSA 2GAIA 5IZ4A 2Z57A 4R2XA 5HR5A 5CFQA 1J1IA 3ABRB 4GWLA 1EVLA 4RK5A 3AJ9A 1BKDR 4UPDA 5LZ4A 4QYTA 2QZ4A 2X40A 3VRHA 1YIAA 1QWSA 1CJBA 3KLNA 4KPUB 1OWLA 2G7ZA 3Q15C 3MTIA 3V8RA 4NPCA 2FJ0A 1U7ZA 3W2IA 1N6KA 2ZUVA 1JR3D 5EQJB 3KOOA 1R2QA 2J8ZA 2V9ZA 2X9VA 2JFYA 3MJDA 2OHXA 4KO8A 3W77A 4OSPA 4I5DA 5LC1A 5CT5A 1Z2EA 1NYQA 4YVFA 4G5XA 4QASA 2ZR8A 1P0QA 4GOLD 5LXTF 2DBZA 4WPGA 5CFNA 1PNVA 1WBJB 4PBRA 1WE2A 2BP7B 1UQTA 4OL0A 4EPYA 3A6PC 1WLSA 1WEKA 2RI1A 2HJ9A 4TWBA 3GLRA 3G5UA 1W4RA 4RNDB 1TECE 1ULZA 2KM1A 4UUMA 3I2KA 3HDVA 1P7PA 2WUVA 3H5TA 3ADOA 2AGVA 2WHYA 3FNBA 4G0YA 3GQBB 1IN6A 3HXKA 5ICSA 2Z9CA 4PWYA 3O75A 1JLLB 4E31A 3ZWKA 3AZOA 2R7KA 4OIMA 4Y9UA 5L4LA 2BZ0A 3C7TA 3WAJA 4EVRA 4YB8A 1LB1B 4BVLA 2X6QA 1XXHB 2BTEA 3GJQA 1D7AA 1XDSA 1CLUA 2J85A 3JV7A 3N7TA 1D03A 3I6QA 4DCVA 8AT1A 1P1CA 1ZGJA 3HR7A 4FZVA 3K6SA 2WTMA 1EUCA 4YAWA 3FCEA 1P4AA 4R16A 1H2ZA 1HZJA 3NOVA 1KAHA 5CP8A 2E4ZA 4AN4A 4NJEB 3HDHA 5HZGA 2GILA 1ISMA 1QU2A 1MXHA 2ZTMA 1A9YA 3O4JA 4OFBA 1SCNE 5EMKA 5LQCA 3N76A 1JF8A 1K2WA 1XMJA 3HCFA 1A2BA 1P7VA 1QTIA 3CZPA 1GZDA 3MHPA 4ITUA 4ROTA 4Q18A 5ALHA 2HDOA 1RLMA 6Q21A 5KHOC 3V8QA 5IFKA 3IAAA 4MKXA 5IBQA 3FHCB 1GIAA 3EUEA 2PMDA 1T25A 1R4MB 2Z5VA 4B4UA 3A9TA 5KO2A 1GYRA 2W11A 5FO1A 1ZAKA 2VSNA 3W34A 1ZOIA 1XRQA 3E27A 2CC2A 4JSTA 2G0AA 2ZSJA 3AKYA 3VPGA 1IB6A 2ARKA 1WS6A 2DMRA 2JZNA 3HRKA 3T4XA 3ZG6A 1CQWA 4BB6A 1RRVA 3AP2A 1EK1A 5HRUA 1M0TA 4G84A 5UKDA 1II0A 1X0VA 2AD1A 2J3HA 3OT1A 4XEUA 2GR9A 1XCLA 2DTEA 1R37A 1FTWA 2V6GA 2V4ZA 4OA8A 4GKVA 1VMEA 2WW8A 4XM2A 5A0TA 1I01A 1NRXA 2VJDA 2YUIA 3L1JA 3VR4A 1KK2A 4C4TA 2Q3DA 2ZRAA 4TYQA 3G2LA 4AZSA 4G5HA 10MHA 4PM4A 4I4IA 5AVUA 2Y66A 1ZVJA 2B7LA 3QBVA 5IAJA 2W90A 2WIJA 3C3DA 4MJLA 1CRWG 1HORA 1YONA 2YYZA 4GNRA 2C2BA 2DWOA 4HWRA 4KV7A 5AK3A 3TLYA 3C5WP 4DIEA 4DLZA 4X8HA 2P2NA 4KVAA 3IVXA 4QVGA 3SDZA 3QMPA 1KZGB 1Z33A 2JAOA 5JSZA 3AJDA 1DQRA 4TSRA 2NU8A 3BYZA 4QTUB 1R50A 4JY7A 4CKXA 1YI8A 4L73A 3UXEA 1FVHA 2FZKA 3DLTA 5I6DA 3BQ9A 5D5HA 5FOVA 2B36A 3HBJA 3R40A 1LC0A 4QRHA 1XR3A 3FLAA 4DB2A 1TCAA 1PD1A 1DO2A 2IYXA 2ZZKA 5ERGB 4BLWA 1CY0A 1HFJA 4E14A 4HLUC 3VAYA 2GAAA 5DT9A 3ACBA 2PPVA 2YMQA 4JL6A 3ETLA 2VP9A 3AUYA 4X93A 4Y1RA 3WZMA 3FSRA 3IBSA 1V1RA 3L4BC 3GQBA 1FK8A 3PE6A 1EG7A 1XTUA 4WXHA 2C3PA 3HB9A 4YTEA 2HQ1A 1F8FA 1ZJJA 4EUHA 5CX1A 5AD1A 1ZESA 4HAIA 4RPLA 2QL6A 1XROA 2C4VA 2JLQA 2F1JA 3BGDA 1O94C 1PGQA 1T2UA 3FZEA 4M55A 1D1QA 1T0BA 1Y1QA 3CH4B 4GWKA 4AJJA 2YVLA 1JS1X 2AFHA 4LRXA 1NFQA 4IEIA 1H66A 5B1HA 4MVJF 2WPDD 3LDFA 2XNDD 3JD3A 2FZCA 4UM7A 3TLXA 2ZIZA 2RBEA 1J8YF 1N2SA 3DQPA 4E70A 4HXEB 4RTQA 2X4IA 4ZODA 2D59A 4ZOBA 1ODIA 4YJ3B 3SU8A 3AVVA 1VYHA 2V98A 5DT2A 1SK9A 1B0UA 3QYAA 4TTRA 1EINA 2WWFA 3C2QA 1FTGA 3CINA 4V0LA 5CNIA 4G56A 4UC0A 5DXFA 4QA9A 4B82A 1A8QA 1YV9A 3LFTA 4CTKA 3JD2A 2FUG6 2PKYX 2HYDA 2JIPA 3QLTA 2VHCA 2XUZA 1Y3HA 3CZ9A 1VL6A 4LHVA 4YEDA 3QVWA 2XUFA 5AW0A 5JDCA 4B84A 2ZUCA 1T9DA 5FAXA 1N0WA 3EMVA 1R1DA 2QAGA 1JV2B 4FKBA 4OBWA 3EY9A 4N7JA 5EIBC 4F93B 2BSAA 2A5FA 4ZU3A 2H08A 3AFIA 3QQ5A 4NDAA 1W0KA 2R97A 3UM9A 3VKUA 4DJDC 4YRFA 1KYQA 3IUEA 5T8KC 3AVQA 2XUGA 2YFYA 4D3XA 2VHUA 3A3NA 1MO6A 2P9HA 2HWXA 3QKWA 2JLVA 1NC1A 2J1LA 3DEAA 1P5HA 4WLUA 2B21A 4MRNA 3PXUA 3CUVA 3L7MA 2XT0A 3TTTA 4OIFA 1BWSA 1JDTA 2H2GA 4NIMA 1C4XA 3N6VA 1YTUA 1ECGA 3MUEA 1M6WA 4X71A 1ZMRA 3T7EA 1IQUA 1HFWA 1L5SA 2JIDA 2Q0SA 1A7JA 1VIDA 1VSUA 5IW8A 4S05A 5DGHA 4U0JA 3VVLA 1K86A 3I53A 3DOCA 1XFAA 1XTBA 3FGOA 4GF5A 3U4MA 1OX4B 3AFMA 4YI5A 1LY1A 1FEZA 2YYYA 2PMBA 5C8YB 9LDBA 1EDDA 1EXVA 4NK5A 3RANA 2JJ8A 3DXYA 1CR1A 1NUHA 2IDZA 1NBME 3R20A 4GX1A 1SCIA 1CRLA 2AK3A 4LE2A 2I4NA 2Q5CA 5I7AA 3SHQA 3EXEA 4RENA 3NMUF 2VAXA 2PRYA 1DUVG 4RABA 2BCEA 2ZU6A 5HKLA 4AG5A 4YLYA 2G1KA 3K4PA 4QGSA 4EI9A 4CNBA 3GLIB 1SBQA 1VPEA 1SIBE 2PAAA 2ZUUA 1GFIA 3ZW9A 5CX1B 3TSOA 2JIRA 3PX3A 4MR9A 3M2TA 4TV9F 3V1UA 1YZYA 5FJJA 5DN6D 3F4LA 5FTNA 4KRXA 4D41A 1FFWA 5TVKA 1XIVA 5LA6B 1TA9A 1YS4A 3RJZA 4E08A 4KR2A 1KL7A 5H0IA 2BR3A 2IZ6A 5ELLA 3EZLA 3H19A 4H7EA 1Z4JA 1V7ZA 3L0CA 4M0EA 3LU1A 1EFRA 2OZLA 3RNLA 3RT9A 2FUG1 1JDSA 4FR2A 5FBRB 2HLPA 4FX5A 3HTXA 2GLXA 2WWTA 4NMWA 3D6FA 3GGDA 1HGXA 3LA6A 2Q4TA 2NNLD 5A7GA 1QIFA 4JBIA 1B41A 3VH2A 3S1SA 1CJCA 1YL7A 4IRXA 1N0VC 4L7QA 5FP0A 1HNZB 2R44A 4AYXA 4H7JA 3PR2B 3DD1A 2FCRA 3PGMA 4YX9A 3AONB 5E7JA 3DVQX 1MOZA 3DLCA 2N1MA 3GCZA 4BB0A 5C46F 2ZB8A 1XO1A 1KP3A 3B7GA 3F6YA 1E89A 4ZOQI 5CA0B 1J39A 3N0TA 4UHEA 4DNXA 3T5CA 2CXSA 2F48A 1IBKB 3VGJA 1A2OA 5IVKA 4BJ6A 4JP5A 4B45A 4RLFA 4MQLA 3P9SA 4RMNA 3SS7X 5DE3A 1GL9B 3LNTA 1DUIA 2NMVA 2RAPA 3V1MA 3D4LA 2ZUTA 1EH5A 4W7HA 2CXTA 3IKTA 3F71A 2RIPA 4P5DA 4DLKA 4EG3A 4F8JA 4LY0A 1BQ4A 4IIJF 3TPCA 4D56A 3DV2A 3SJUA 4K9NA 4BO9A 2RBKA 5CA1A 3SPXA 4D45A 4HB4A 2CLCX 1Z6XA 1YS6A 5B3LA 3BTVA 4ER0A 3R0IA 1XJWA 2GA9A 4YRJA 3TM5A 1RLUA 4FTWA 1XLTC 4X1OA 5DMHA 5K0CA 1F2TA 4U5XA 3FCCA 4HMOA 4ARZA 2QVBA 1SVSA 2PZ8A 3IERA 3NANA 5JAUA 2WFLA 3L8EA 3PUXA 4NATA 4US1R 3DOIA 5GWXA 1NE7A 3ONVA 3EWSA 3OQOA 3C3KA 1DNPA 2WPNA 1FP2A 4U5QA 3RIGA 1NVMB 1I10A 3IVCA 3CF4A 3PNMA 3ZH9B 3UGKA 3OE7D 4X62B 4EG4A 3O26A 4PSUA 3H8SA 2OL4A 3WNBA 4KWEA 3JPYA 4NWIA 1DWUA 1W75A 1E4YA 4BV9A 1F4PA 2JHAA 2AQHA 2V0GA 3WYBA 4EB0A 3PNVA 1G5HA 1EFLA 3SHTA 3O3OB 2VF8A 2RGGA 3P19A 2O2YA 4I14A 1BKYA 3UFXA 1G55A 2PT5A 1KBQA 2Q5LA 4QT4A 1MTZA 2HD4A 3CMCO 4E7PA 5K8TA 1K66A 1QOPB 1XQWA 3WK6A 3LJKA 1QP4A 1JHPA 2OBLA 4PXYA 1PR9A 4NLLA 3ZNOA 3GUYA 4B3RB 1MX3A 5ECDA 3R9IA 3HJNA 2HH9A 2NSHA 1CY7A 1XJCA 3MJHA 3OO0A 1R8JA 1YZ3A 4ZVNA 3VR3A 3PIIA 1QH1A 4XX0A 3C3AA 4ARUA 1F7VA 5B1IA 1V8FA 3EVEA 4FFWA 1OWNA 2SCUB 5FWDA 4EG0A 3E22A 4QT0A 4RIGA 5EE1A 3TKAA 1LK0A 5KNBD 3OZGA 2W58A 4R7GA 3SQMA 1DX6A 2Q6VA 5AJXA 4Q9DA 1XWIA 2WKQA 1K6MA 1I7PA 1Y9EA 4C6HA 1U2SA 2H3HA 3FNIA 3M6WA 4M9XA 5DZSA 3V4VB 5CA0F 5L4SA 5CGQB 1GUYA 3BPSA 1X0XA 4P0QB 1ISPA 2GVNA 3VO1A 2EZ9A 4KR7A 4URHA 5K09A 2JH9A 2XQFA 1RHQA 3MWDB 3MT7A 1SUEA 4M0MA 2CE2X 2HHJA 1IXSB 3UNXA 3C39A 1L8QA 3LYUA 3OCUA 3ST7A 2VQFB 3NHZA 3LUPA 1L1EA 3Q7TA 4NAHA 3FLBA 4MS4B 1MB0A 1V25A 1VB3A 1GGFA 1M8JA 2Z4RA 5DP1A 1Y8QB 4ZVRA 1ZKMA 3LC1O 4JOCA 1G8MA 5KTRA 3Q6MA 4OKNA 4Q9JA 5BR1A 2QUAA 3AEYA 2XYHA 3AR4A 4IUCS 1VM6A 1UBKS 1NE2A 5A9TA 2PIDA 4BRUA 1MC5A 5AKGA 3AEUA 4HVAA 3VZBA 3WKEA 1USVA 4Q4CA 1ODFA 4F56A 4MUAA 4O1HA 5IS2A 1QM5A 4LJ9A 1V3QE 3HWWA 4TKMA 2CJFA 3DTVD 1L7AA 1OFUX 1R6VA 4OFZA 5ICFA 5ITWA 1PNRA 2IF2A 1P77A 1GRVA 2C57A 2VWHA 1YC5A 4I4TA 5C52B 1ZXLA 1XAHA 4P31A 1E96A 1UXOA 4WAUA 5AK0A 3THRA 1AXEA 3IDSA 3IVAA 3ZLUA 1BXGA 1M8KA 5CXUA 3F73A 2DH6A 4IDAA 4PNHA 4ZI7A 1P4GA 1EMDA 2G82A 3M6IA 4LHXA 1WSBA 2YXBA 2OV6A 5AVKA 2Q7OE 1G59A 4NZPA 3SC3A 1FQJA 4E94A 3RF7A 2LXNA 1LLDA 1N6RA 4Z5XA 3NM4A 4F86A 1SCDA 3PIRA 4UEOA 5JAQA 3LC7O 1LC3A 1M2GA 2E85A 3L1UA 3QM1A 4G4SO 3IODA 3RYCB 1BEEA 2RK4A 5TMPA 2BVNA 5ULLA 3WSWA 1G8SA 4ZZIA 2HRQA 1PNOA 1PZGA 1IY0A 3PENA 4RBNA 1Y80A 1XWFA 2WSYB 2QMHA 2VHEA 1IMJA 1N78A 4I55F 1JJVA 3M81A 4IIGA 1L1FA 2OO7A 4OFWA 4WQMA 2A30A 1N3LA 4D9BA 4OBBA 1RPJA 4FOTA 2RGNC 4JOSA 4GHWA 4MPDA 4C4AA 1DKOA 1QSGA 5B6PA 2IT1A 4TTAA 3UXYA 2JFHA 1H6AA 1JQJC 2JFBA 5L3QA 3PEYA 1JPVA 3CO0S 1THZA 4QOJA 4R8SA 5BSEA 4U2CA 2J07A 4ND1A 5G0UA 4BQSA 1USGA 4P9NA 1BX0A 1Z2CA 1GL3A 1VIYA 1MPTA 2JLWA 2VKTA 4IJVA 2D0OB 3FY4A 3I6IA 4DSOA 2XKBA 4QHSA 4EG7A 5DI3B 1OLUA 1DJQA 2FW0A 3PCTA 4MGEA 4PFKA 1XEXA 4F60A 5A9RA 5JS1A 1CC1S 4R2IA 2IV2X 4AN1A 4ARIA 2ZYAA 4MRMB 3EUFA 1AXRA 4L2IB 2I6FA 4B4KA 3QVSA 1PT7A 3AUUA 2NO1A 3Q3EA 2QSZA 1EGMB 4FYPA 3FSEA 5EMMA 3QTBA 4MB2A 4WECA 3EEQA 4U7WA 3EULA 2QD2A 3PFNA 3VC1A 1GA1A 2IA5A 3FMVA 2O3SA 4WADA 3BT7A 5FUXA 2W48A 3NEPX 3UK7A 4DIOA 1ZU5A 3IOEA 3A6JA 1FJHA 1UMDA 2Q1WA 1P7ZA 2PUJA 2X5XA 2VJKA 4MVXA 2PGLA 2ZSKA 4PC2A 5AW7A 1GT6A 1KK3A 4XGRA 4Y7CA 3TYXA 3TM4A 4DG5A 5MN4A 4MWDA 3R3UA 4KMSA 1ZKDA 1GKLA 2NXJA 2HGZA 4BP8A 1XDDA 2WAAA 1KS9A 1XZAA 3LUAA 3V8NA 3O9VA 2ZZMA 3U3KA 4YRMA 1Z8DA 4N5DA 3FGZA 1QE5A 2MYNA 4TZ0A 2WC1A 3EG5A 2YC4C 3NEAA 1Y33E 2IVZA 3GLHA 2LD4A 3PWZA 3RASA 4A73A 4PPNA 4D74A 3FTDA 2A0YA 2GJ4A 4ZOLB 3GGGA 1RCUA 1WCWA 4QZVA 5JIBA 5JG7A 1W34A 5JQGF 4BXOA 4F3KA 4MVJG 1MAUA 1X14A 1XTKA 5K8IA 4PWZA 1DTWB 3MMSA 4BQEA 4MWCA 2V7GA 4A5OA 1Q2XA 5D87A 1Y8RA 1RPAA 4DARA 3E03A 1OCEA 2AC4A 4RULA 1GQSA 2CFSA 7ABPA 2BJWA 4FLMA 3TUIC 5BQXA 1IHPA 2H4JA 1C1HA 4XFDA 1L7RA 1QIDA 3ZXXA 4AMUA 2YJ4A 1ULSA 1XVIA 2OGTA 4EKNB 1A8IA 2UUCB 2DY1A 1YMVA 2H85A 1RJFA 2OXRA 2CT8A 1Z47A 4WKPA 3TBKA 4HXFB 1AHHA 4EZIA 1CZHA 2OCIA 3GI1A 4EW1A 4BU1A 1P7YA 4ZOLA 5BUSA 5IASA 1LVGA 3ICEA 5C3UA 4K9MA 7MDHA 4DV4B 5CB8A 3I64A 3ANNA 1AOXA 1ZS9A 2WA2A 4RUKA 2DFVA 1RWMA 2CSUA 2GAJA 3PQ3A 3LYLA 1JNXX 1KEZA 1TT7A 3HXPA 4OMUA 5ALNA 5M29A 3K9FC 1ZL2A 4ZT2A 1E3WB 1OXKB 1WZIA 3EXG2 5G3YA 1BH2A 5AK4A 4YRNA 1K63A 2XTJA 2WIBA 1YZGA 3CKLA 3A1SA 2ZSEA 5CGZA 3KSBC 2CJWB 3FIUA 3YASA 3DVAA 3REFA 1TXGA 1UAYA 1GLNA 3QJYA 2OHGA 2YFQA 3PWSA 4EAQA 3ZDRA 2CVQA 1PX2A 2X1LA 5IUJC 3B1JA 1U3VA 1RXWA 1MJFA 3UMYA 3UT5A 3H11A 4QQKA 5ICMA 1WWKA 3BIWA 3GRCA 3R2JA 5DYNA 4DQUA 1Y42X 4P36A 2HWYA 5FPPA 3EDCA 5AKLA 5K4AA 2GYVA 4AULA 2YIVX 2OSBA 5B4UA 2E2WA 4QUEA 2YJZA 5TC4A 1P0FA 4Z4QA 4IDNA 1YZUA 5FL7D 1CZNA 1AKQA 3MWYW 3AINA 2M2IA 2F3SA 3D6HA 4NJOA 3QGMA 3CO5A 4EYGA 1T5BA 5ITZA 2Z8YA 3PHLA 1QGZA 1D9XA 2MHCA 2VSFA 4IRUB 1U28C 2SICE 3FMFA 1OB5A 5I3ZA 3D3WB 2Q1TA 3R3WA 4S04A 3L5OA 4X3OA 1DKRA 3H75A 3ES9A 4RD3A 3DMTC 4GAEA 5ESXA 1PFKA 2IKSA 5B3JA 2FHSA 1IY8A 1M76A 4YJ2A 2BCGY 4RIFA 2AA3A 2EWVA 4Z1OA 5TPZA 5CDYA 4HNQA 1AMNA 4MB0A 2PGNA 3VSEA 3D64A 5JZ9A 2Y6UA 4KAAA 1UF9A 2RHOA 4RDHA 3GAFA 1A8SA 4HRXA 3T1TA 4HUJA 3KUDA 2CYBA 1D04A 3LT0A 1KAOA 3D8NA 4LRUA 3MTJA 3U37A 4UNRA 4M83A 2XCOA 1WD5A 4QYWA 1LLQA 3LPAA 4DDVA 2D1RA 1ISIA 4RA9A 2QX8A 4BZXA 1FBTA 4NNJA 2A78A 3JD1A 4N5MA 1JEJA 3EF3A 5KDOA 4O3MA 4X3CA 2UXBB 5KYXB 4UM8B 4BO1A 1LDEA 4QVKA 1XZBA 2R8YA 2KQUA 1GLVA 3BWVA 1NU8A 4FYWA 3ZGNA 3FHTA 1P5FA 2BAGA 3VVBA 5BSFA 2DKOA 3L1VA 3VU3A 1M2EA 4D4KA 3LOUA 4KTVE 3WHPA 5JSFA 2C5BA 3NYWA 1I94B 1W5FA 3T3IA 1MTOA 4B17A 5LMZA 3OD1A 3KAPA 4QGAA 5C18A 2NXNA 1DZ3A 4R7ZA 2J9GA 4BE4A 2XT6A 1TJPB 3DYBA 3L7NA 3N05A 5EINA 1VRCA 2XE8A 4DJEC 3F4BA 4BFZA 3FVRA 4L0DA 3PUIA 1ONPA 2EBWA 1SBNE 3EZYA 3GDHA 1E62A 1NUPA 4XIGS 4GOKA 1LGYA 2AE1A 4ND8A 1ZI6A 1Y48E 3V97A 5EXTA 4O2AA 1OYYA 2FFBA 3Q9LA 1E2JA 4P3OA 3DPUA 4ZEMA 1PTKA 3GRFA 1LK7A 4GU5A 4X84A 4OHFA 1E9BA 2KE5A 3H8WA 3FWKA 1HBJA 1PK7A 2R1ZA 2XMRA 2IHTA 3FUXA 3NFRA 1IFXA 1EFTA 4HDNA 4RZ2A 3RC1A 1G5PA 3KOZA 2GN9A 4NJMB 1T9HA 3VDXA 5TARA 2FP4A 2ZJYA 1IOLA 3I12A 4GVPA 4IG9A 4PN3A 3G2MA 2H51A 3P96A 4AJNA 4ZZ0A 2V5AA 2FN3A 1SXJC 4YDQA 1C2TA 1UQRA 4CGYA 5JCZA 1UM9B 3SOOA 3TRHA 4JHLA 2C1XA 1R9MA 2D54A 4NYMR 1IAQA 1OC2A 1NRWA 1Q0ZA 1VSTA 1VBFA 3AVUA 5AWFC 2RJOA 2W83A 3TOXA 2Y05A 3IQHX 4XD7A 3ZVNA 1T35A 1ABEA 2F9LA 2AZDA 1I7QB 4I99A 3OFJA 5IT5A 3IEIA 1ISSA 1OAKA 2YZ7A 3D4OA 4JODA 5SYNA 2DEUA 3G49A 3OOWA 3PDWA 2QLLA 1SU4A 3R09A 5J5VA 3OX3A 4BYGA 3VHRA 3KRTA 3KQQA 4IS3A 4C4XA 1DU4A 1KRHA 4DNPA 2ZRQA 1H1TA 3RKUA 3GP8A 2RKBA 1S2LA 2VVTA 4LY9A 4QUHA 3IPLA 4JELA 5CRIA 5AI5A 4ZOCA 3HDYA 3WGMA 1ODCA 4CMEC 2GA8A 4K8RB 4DGSA 4EUEA 5BWCA 2GKGA 5FNVB 3K9LA 1CUAA 3T34A 4OU5A 1RWKA 1UM8A 3CU5A 1Y5NA 4E09A 2WT9A 4CTNA 5C7OO 4BNJA 3STXA 1PBNA 2RHTA 5AI9A 1ISJA 1TZKA 3BFKA 3PP8A 5ALVA 5IPFA 3W5AA 5EE3A 3KIPA 2CHGA 3AEUB 1IM8A 2VRCD 3GJ0A 3UUGA 2GD0A 3RIHA 1FVXA 5L7YA 4CFYA 3DVLA 3Q1KA 2P8JA 3U3ZA 1ISHA 1RBZA 4NE7A 3U26A 4FGKA 4PNZA 1DJPA 5EJIA 4MV8A 3C97A 1KSHA 3COVA 1PFGA 1UPXA 3WXBA 3LT5A 2VXCA 1SCKA 4S1PA 5BT9A 3FLEA 3GG2A 3B6MA 3ICOA 1XEWY 1SOAA 1PZHA 5IH3A 2IF0A 1NL3A 3PQ8A 1SG9A 4AZTA 3A0UA 3IO3A 4FJ0A 1I1QB 1ZD8A 4IJ6A 5JZOA 1SUBA 8OHMA 2QUJA 3WKCA 3LX4A 2VLBA 2FFAA 3RVKA 3L0ZA 5JD4A 4N9WA 2OPBA 3CJRA 2ZIVB 3GA0A 3L7OA 3NQ41 4RF4A 1YQ9A 1V35A 1PT9A 4JNCA 1UXIA 3CFYA 4MWTA 4NARA 1E9FA 4R98A 4IV0A 1GZUA 1P44A 1HH4A 2BM8A 3FPBA 3W5IA 5KMGB 5KTNA 1N36B 1EYZA 3DCIA 3GLFA 2ALJA 2LDBA 3O21A 3QLJA 5IXSA 2GM3A 2WNHA 4R31A 4V39A 1ZR4A 2X7JA 3SP1A 1GP2A 3M3PA 3HB1A 1G7SA 1LJ8A 3LUKA 4XQEA 4AJOA 4CL2A 3GARA 3B1XA 3BN3A 1USWA 2I62A 2QXTA 3DFFA 1W0JD 3TWOA 3WLJA 4WLFA 1USIA 1E3SA 4B46A 5M04A 3G13A 2PL1A 3WGLA 3V6MA 3DDCA 3DJYA 3RUEA 5EMJA 4YJGB 3NC4A 3G2PA 5F33A 1SBTA 5F35A 1BNCA 2FPGB 1HDXA 1XDUA 1ZMXA 2ZATA 4M53A 2E18A 1KDZA 3USZA 1L3BA 1BOOA 3A58B 3H97A 3KCQA 4HOYA 4FIDA 3GA7A 5AJVB 3DV0A 4PHTA 1E59A 1UANA 1S2MA 2ZR9A 4IGAA 5J47A 2WG0A 4LBWA 2OBFA 2W22A 1E6WA 2VJCA 3NUQA 4QEZA 3HYSA 1EHCA 3G9TA 4L9WA 5K3OA 2REXB 3DHWC 4GMKA 5I4IA 4G5FA 1KYZA 3WMEA 5KQLA 1ZW1A 3H04A 3KEQA 3CY6A 2ZWMA 4MPTA 5AW9A 1T9GS 3IV9A 4JI1B 3GJ6A 1AS0A 1PFUA 2FDRA 5K3SA 1QHSA 1GAWA 2AXNA 2OB1A 4ASUA 5KTYA 1P5JA 2AYXA 4FEEA 5DNCA 3PRKE 3CVUA 3E7DA 1JILA 3L8GA 4I6JA 1HX7A 1HXHA 1X39A 2G25A 2C84A 4MCHA 3RS5A 1QIJA 3IAS1 2DSTA 4H4EA 4QPPA 4XB2A 3UPTA 4N01A 1LLCA 1M10A 3GJ3A 3Q41A 1EGQA 2GN8A 1G2PA 3BZWA 2FSSA 2VC2B 1CHDA 2VDQB 3NDRA 2W2PA 4NCNA 2H0RA 3R3XA 4B7UA 1YCDA 4RIEA 4OXQA 2ZUSA 3QVOA 3VI3B 1J00A 2E1PA 2BZ1A 1SNYA 2YHBA 4EGCB 1YVDA 1YDHA