The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
76
|
sequence length |
326
|
structure length |
309
|
Chain Sequence |
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGHVGLQARLMSQALRKMTGALNNSGTTAIFINNLRETGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Mycobacterium smegmatis str. mc2 155
|
molecule keywords |
Protein recA
|
total genus |
76
|
structure length |
309
|
sequence length |
326
|
ec nomenclature |
ec
3.4.99.37: Deleted entry. |
pdb deposition date | 2008-08-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00154 | RecA | recA bacterial DNA recombination protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Rec A Protein; domain 2 | RecA protein, C-terminal domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |