2ZROA

Msreca adp form iv
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
329
structure length
323
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 93
structure length 323
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zroA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zroA01
1P2TA 5KSZA 4DB4A 2VBCA 4DUGA 3AEZA 1E2NA 2ZS7A 3W3ZB 4QOSA 4KYUA 2PMKA 3VNUA 1ZM9A 3L82B 3QBTA 2WWGA 1JPJA 5GJWC 4IVRA 3FB4A 3B1ZA 3BRWD 4A2QA 3KQKA 4AG6A 2X1VA 4A9AA 3H2YA 1CBUA 1TX4B 1QBKC 2ZU0C 1OLOA 4IKEA 3EC2A 4PC7A 4F92B 1BKDR 2NO6A 3P4YA 1XD9A 1YR7A 1UPTA 2ZJBA 4QG7A 4WXRA 3B1VA 5DH9A 2V6JA 4Q02A 2ODWA 4Q7KA 3K9NA 1OH6A 3CM0A 3W6PA 4Q18A 2H5EA 5CM9C 5DHFA 2QP3A 1PJRA 4DLTA 2IEZA 4QC2A 2P5SA 4Q1EA 1GM5A 3OFND 1SVIA 4L4UA 3EG5A 2ONJA 4GOKA 5JECA 1OH7A 2VA8A 1H8HA 4MKGA 3WMEA 2OAP1 3BH6A 1EFTA 1HE1C 2V4ZA 3TAUA 4EQ6B 4CF7A 2ZRFA 3RANA 5P21A 4B73A 4WA7A 4PSKA 2IYVA 4Q4HB 2CHVA 5BWMA 2IYWA 4ZV4A 1HH4A 3T1QA 5KNDA 1H8ED 4L5BA 5EXSA 1TF2A 1TF5A 3X1WA 5J4KA 3KDSE 3CKLA 1QZXA 4FXPA 4KFRA 3AVXA 3U7EB 2KWIA 2ZJOA 1TNDA 1KZ7B 3CB4A 2X2FA 3QNUA 2REXB 4P3YA 4OHXA 2ZJ8A 2D4HA 4C0BA 5E7JA 3RS0A 5DIFA 4Q9HA 1T0HB 2G1KA 4GL2A 4KYIB 4CEHA 3DDCA 4B35A 2VSXA 4MKIA 1IN7A 5FR1A 2JJ8A 2HF8A 2ONKA 3Q7QA 1CEEA 3GCGA 2CL0X 4HB4A 1E0JA 4M1MA 4Q1BA 2G3YA 4Q7LA 5DYIA 4E22A 1G20E 3EWSA 1W4AA 2CE7A 2OCBA 3FYHA 3UANA 4QGGA 1U8ZA 3PR1A 4Q21A 2ZAOA 1GKYA 1E9DA 5H68A 4D0GA 3SOPA 3U3JA 4XH9B 3ZQ6A 2ZVQX 1RJ9A 1GP2A 1KY3A 4M2LA 3X1ZA 3BFXA 4ZIRB 2J87A 4LJAA 2WBLC 2BJWA 1SKQA 1TMKA 2C95A 2CK3D 2OZEA 3ETLA 2F3TA 2DPXA 2WHXA 1F2UB 3MCAA 2WSSD 4JZKA 2XTNA 4Q5IA 2XTZA 3I73A 1Q1ZA 3DHWC 4TLDA 3O8CA 4OQLA 2IHYA 3GLFB 1VIAA 2VP0A 1QVAA 2IYXA 1YVDA 2QAGB 2PBRA 1KMQA 1OXUA 3AVPA 5GJCA 1YHNA 2Q3HA 4FMDB 2OXCA 3VHLB 4C7OB 4TYPA 3I4LA 2J59A 4GBMA 3B9PA 3PENA 4ZO4A 3VR1A 4B3FX 2WJHA 1FMLA 4HYYA 1T3LA 4QKQA 4K46A 721PA 1NBMA 3KQUA 3P32A 3LO5A 1BH2A 1G7RA 3L0PA 1E4VA 3H4MA 3AVUA 1II8B 4IEIA 5TMPA 2F1HA 2G1JA 5KU1A 5AUQA 4D4JA 4A8JA 2GWHA 2AWNA 3S1AB 4A1FA 1ZC4A 4C30A 3C8UA 2W2TA 3IGFA 3ZYCA 2B7CA 2XZLA 3PEYA 2VLIA 5CYOA 2NPFA 2WSMA 3IPYA 3A4LA 4JLDA 4BFXA 3PQCA 4CGZA 3DKVA 3TKLA 2KJQA 2GXSA 1R7RA 2GF9A 2OV2A 1EFHA 2QMHA 3LQRA 5SZJA 2G9NA 3MLEA 4EFMA 3R7WB 3ICQB 3F3YA 4TTPA 1KJYA 1PLLA 2BBWA 2DCUA 4GSYA 4I1VA 3R8CA 5C4MA 5JFGA 3AP3A 1Z0IA 5FTMA 4V02A 3T35A 4D81A 1XX6A 3OE7D 2O5VA 4EPXA 2DBYA 2EQBA 1NLFA 3AVWA 2WKQA 5FBRB 3THXB 3VR5A 1CJKC 1JXMA 4QGHA 2ZETA 2QSYA 2RGCA 3A6PC 3EA0A 2GESA 4Q4AB 1HT2E 4P4SB 2QAJA 4HUQB 4MYTA 1E6CA 3R20A 1YR8A 4JBWA 1MV5A 3A58B 1WA5A 3BB4A 1BYIA 1XXHB 4HAYA 3TSWA 3ZZUA 1IJFA 1KSFX 4X8LA 4O3MA 2ZM5A 2XNSA 2EYUA 3X1XA 1R5NA 5JWOA 2IYLD 4WZ6A 3RS2A 3LV8A 1E0AA 4TMZA 4FIDA 2Z6VA 3B1XA 3BE4A 3GLHA 4LYHA 3OZXA 1HT1E 4QJ3A 3B2EA 1FNMA 3SFVA 2F1RA 2CJWB 4KXFB 4X8MA 4LJ9A 4QL3A 2JLWA 2VP9A 3H1TA 3C15C 2PX0A 3MRSA 3VQTA 4KLZA 1GL9B 2JA1A 3OAAA 3TMKA 2HT6A 3THOA 1L4YA 1QHNA 5FBVB 1UDXA 2ZANA 5F3WB 2VP2A 1COWA 2ZRNA 2FSGA 3A36A 2Z4RA 4Q1AA 1MR3F 5F9HA 1Y3AA 1C1YA 1ZUNB 4WBSA 4ZPXA 3I92A 1E2FA 1M6NA 1OIWA 1XEWY 3GEIA 4KFTA 1AK2A 3NHAA 2QM8A 4EUNA 1XPUA 4PHGA 1OE0A 1NKTA 1JR6A 4B6EA 2ZUDA 2XZOA 3PXGA 5KHOC 1SVSA 5JJLA 2OO7A 1E2MA 2QROA 2WKPA 4BECA 4CT5A 3ZS8A 5BN3A 2BJVA 4LUCA 1Z5ZA 2EWVA 4KCGA 1YJ5A 4V0KA 4ZI2A 3IPXA 1V5WA 4MGKR 3VX3A 1Q20A 1FPMA 3NXSA 1MABA 3NHBA 5DSZA 3FMIA 1IM2A 4TN1A 3FFAA 4QBGB 4C2UA 4MA4A 2HLDA 2VL7A 4XOIA 5FPSA 1SXJB 1E2JA 3WHKA 1FQKA 3GPLA 5CDFA 1JJVA 1MKYA 1XZQA 4P31A 2CXXA 1W36C 2YOHA 1T4GA 1Z6XA 3SQXA 1DADA 3FDIA 1Z0FA 1QHGA 3ICEA 3P26A 5JWRA 4G5GA 1FFHA 2QBYA 4AURA 4LYAA 1W4CA 5TXGA 4W5HA 3QVUA 4HLUA 1B0UA 1N0UA 4JSYA 4YDHB 4LHYA 3MGCA 4BQSA 4DHEA 5JJIA 3AKYA 4HLQB 4L9WA 1HQYE 3IILA 2JIZD 3AVOA 3D6TB 1R5BA 3IO5A 3ZZ0A 5CITA 1Q3HA 3C7KA 3K0AB 3IEVA 1HA3A 2A7QA 4JYBA 2O8CA 4Q7MB 4G1UC 4DDUA 4EJSB 3R9XA 5K8LA 3EZFA 1OHHD 4URYR 1ZUHA 4PPGA 3LBNA 1R8QA 4F4CA 1E2IA 4IDPA 2GCOA 1G41A 2IBMA 1E1QA 2PEZA 4JBYA 4P4SA 3JVUA 1I4TD 1JAHA 1NBME 3BFKA 4P32A 1PUJA 1CS4C 2ZE8A 1LS1A 3QY0A 4Q1CA 1BMFD 2QU8A 3MJHA 5FTLA 1XNJA 4DLRA 1IXSB 1LF0A 1AIPA 4NDZA 1YR9A 2PT7A 2YYZA 1N25A 3SJZA 1IY1A 4EJSC 1Z83A 1GG2A 5LD2B 3DKPA 4FCVA 3RSOA 4HB3A 4JLMA 3U4QA 2VF8A 2IYRA 1XD2A 2QP4A 1I2MA 3F8TA 4IDNA 4LJYA 4EFLA 1KO5A 4KODA 3ZVMA 4HAVA 2NZ8A 3BXZA 3UWOA 4BEJA 5GJVC 3DM5A 3ZVNA 1R6BX 2MSDB 4S2EA 3U44B 4E03A 1KSJA 5F9FA 4GMDA 3SBDA 2R6DA 2W0MA 1GFIA 1OH5A 1OV4A 1UBCA 2QA5A 4UXIA 821PA 3GLGE 2XXAB 2FSIA 4MUAA 2H57A 1GNRA 2WMNB 2XTMA 4JL5A 2G83A 3U60B 3FMPB 1XWIA 4GT1A 1F5NA 5FR2A 2RMKA 3RWMB 2P67A 2XOKA 3KQHA 1G4AE 1DEKA 4ON9A 4CZ2A 4TL7A 4DSOA 5L3VA 3GJ8A 1DAKA 1AJEA 4LC0A 1CP2A 1Z08A 1Z6AA 2VQSA 2NIPA 5EZ6B 1HE8B 2NGRA 2HJGA 4LY6A 2GBLA 3PIRA 4HDOB 4YMSA 2IYUA 4LGMA 3RABA 4V03A 2OLKA 3GFTA 1QVRA 1E9AA 1ZM2A 2BIFA 3A4MA 5JI2E 4N0EA 1G6HA 1XTJA 2OLJA 4NTZA 1G1MA 1P9RA 5GVRA 5TARA 1Z29A 5FTJA 5DI3A 2C9CA 4G3XA 3HU1A 1TUEA 1ZD8A 3FPAA 4CEJA 5IRCD 2BEJA 4KSCA 3FOZA 3ZH9B 1MRNA 4JLKA 1R8SA 2G0NA 5FL7A 3QKUA 1ZP6A 4AY2A 4QFMA 3AF1A 2EWWA 2HUPA 3X1DA 2LWIA 4RZ2A 1RRFA 1AS0A 1W49A 5FOWA 4NCIA 5TB5A 1Q44A 3ONWA 1QG4A 4MKHA 5IT5A 4R2IA 3A1WA 1RW4A 4OJQA 5HE8A 1ZNYA 3EPKA 2Q0HA 3L8YA 1LF5A 2J46A 3EZ6A 5LB4A 2G88A 3WHLA 4KVAA 1P9NA 4BZXA 2RGNA 1JI0A 4BLRA 1G3RA 4IOJA 4M1OA 2OFWA 1KI9A 2XXAA 3IBYA 3KTAA 4JS0A 1EG7A 1LFDB 1XU4A 2WOJA 2NO9A 4TL8A 3CRW1 2HXYA 3SJBA 1E1RA 2IYZA 3SDZA 1W1WA 2PMDA 4EFNA 4BRWA 3HU2A 3IHWA 4NBSA 2IA5A 3BWDD 3QUSA 3BBPA 3KJHA 3IDQA 1E94E 1M74A 1U0HC 2ZI5A 2ZSAA 2D74A 1VYTA 4GRAA 4NZYA 4QGFA 4Q4AA 4XTCS 5IK2A 4AYTA 5CM8B 2JLVA 5LBIA 3DMDA 5F98A 4Y0VA 1W0KA 1ZCAA 2BDTA 2J5XA 4OQNA 1XP8A 2XJ4A 1KKLA 1UBEA 1ZBDA 3DVLA 3RS7A 4PZYA 3HWSA 4LV6A 1XD2B 4BPBA 3QENA 4D6PA 4NU0A 1JJ7A 2D7DA 1G4UR 1EWQA 3RVBA 1XXHE 5FBLB 4XVQA 3E70C 4CW7A 1CJUC 1L8QA 4M1YA 4M22A 5JLJA 2I1VB 2CK3A 2VP5A 2NPIA 2BVNA 4WZBE 3FHCB 1M7HA 5KPDA 4OQMA 4HI0E 2ZRKA 3CF6R 3SU8A 4GDFA 4ZI3A 5AUOB 5E7MA 2JJ1A 4LRWA 2ODNA 1R4AA 2KBEA 4D80A 1KO7A 1RYHA 1AGPA 5K8TA 1W7AA 4G5RA 2O8BB 4ABYA 3CZQA 2VTKA 1NG9A 2E1RA 1W47A 2K5UA 2PLRA 4RFVA 4ASUA 3W8NA 3ZIAA 4JMPA 4NCNA 2DB3A 3WP0A 4GI7A 4PZLA 4RKEA 5JZVA 3LAWA 3B1YA 4BRUA 1NKSA 2FG5A 4Z8YA 3AM1A 3HR8A 3LW8A 1UEJA 4HDQB 5KPJA 1AA9A 2JGNA 5CYPA 3CBQA 3NWJA 4B2LA 3OEHA 3TVDA 4DLWA 2C9OA 2ZROA 3KQNA 4Q4LA 3Q85A 1RRPA 2J9RA 3KKQA 3SFZA 3TUJC 1RE0A 3OF5A 1ANKA 3GJ4A 3LNCA 5G41A 3DMNA 1GILA 2ZSBA 4DIDA 1XPRA 2QQ0A 4YMWA 2JDID 4JLAA 1VIYA 3SYNA 1LTQA 2P2LA 4RCYA 1JXOA 4CEHB 2ZS9A 3N2IA 1ZJ6A 1GTVA 5FI1B 4NHOA 3SHFA 4DCTA 2J7KA 2D62A 2PZFA 3BJIC 1G291 3HP1A 1ELOA 4G5QA 4KO8A 5AJYA 2ZRDA 1II0A 3L43A 2RCNA 2REOA 4X8OA 3KXKA 4XWOA 4A36A 2O52A 4B48A 1CRQA 1W4RA 1DAMA 3BIFA 1ZU5A 1DAEA 2YWHA 2J0VA 3CF2A 2QBYB 2AD1A 2IL1A 1GITA 4G5SA 4KU4A 4N1AA 1W2HA 2YC4C 5JEEA 1RJ9B 4MQBA 1TQ6A 1BO6A 4DEYA 4MITA 2PT5A 2QAGA 1R2QA 3CRVA 1HYQA 2OCYC 1EX7A 1YRAA 4MDFA 1P2SA 1W4BA 2Z0MA 4R98A 4WOPA 4B3BA 4PO8A 1AS3A 3JZAA 5AJZA 4H9GA 2DWOA 3K09C 1PVOA 5EE5B 1E1QD 4LPKA 2LKCA 3AF2A 1NY6A 2ZAMA 1KI6B 2FWRA 2FFBA 1P7CA 3RAPR 1XCPA 1KHTA 3WXMA 1KOFA 4Q4JA 4TZ0A 2C78A 2FEMA 3LH5A 3K70B 4LJ8A 4ILEA 4OQFA 4A0HA 4ARZB 1VG0B 1GL7A 3I1FA 1G17A 1BIFA 1XPOA 4B3DA 3I5XA 1D6JA 1P73A 5DO9A 2R6AA 1ZNZA 4XSHA 2QGNA 4LJ4A 1XBTA 2RH5A 1T8UA 3MWYW 3S1AA 2CVHA 3T1VA 5JJKA 3OIUA 3KB1A 2ANBA 4ACAA 4Q47A 4QNMA 1KAGA 1RIFA 2XSZA 1SULA 3TIFA 1W0JD 3GJ6A 4A15A 2GXUA 2YC2C 3RSLA 4EJSA 1N6NA 2DWQA 2VIIA 2E9SA 1KSHA 2FPMA 5CK4A 3VU9A 3J81k 4LI0A 2CCGA 3TQFA 4AG5A 3P1JA 1XCGB 4BFWA 4B76A 1Z63A 2O8DB 4RD6A 4AC9A 2HCBA 3FFBA 1XEXA 3OIWA 1U0JA 2ZE7A 4B2IA 4EKDA 3UG6A 1HURA 4A6XA 4R71A 1E9FA 2IT1A 3GLGB 1TTTA 1NJGA 4TMTA 2W6IA 4PQRA 3U3OA 1NLYA 2UZ3A 2GXAA 2JLXA 3ZQJA 2BCJQ 5ANRB 2AD5A 4U5XA 4QHYA 2D7CA 3I62A 4JLVA 3AGQA 3CX8A 1OYWA 2WAXA 1Z6GA 4JT2A 4CEIA 1U8YA 2CLCX 5LB2A 4OI2A 2A2ZA 2A5JA 2I3BA 1S9DA 3IQXA 3UMFA 2ZRCA 2ANCA 3Q7PA 3I61A 3CNOA 1T5LA 1TU4A 2IC5A 2JEOA 1ZNXA 4S35A 3MWJA 2DFLA 2F1JA 4B3XA 1G8GA 1TQDA 3QEJA 4OL0A 3BORA 5HR5A 4A0FA 2WJIA 3QPVA 1KJZA 3C4JA 4M4SA 1O87A 2AKYA 3HPQA 5HCNA 2BBOA 2QMOA 4C0LA 1CU1A 1NBMD 1OXTA 1ZD1A 2NZJA 4I99A 2ZYUX 4KI0A 3FKQA 4B47A 1E79A 3GJ5A 2OCPA 3THXA 4MRSA 3RS5A 4CIDA 4PAQA 3TH5A 3QF7A 1ZYUA 1N6IA 2IXGA 3W5IA 2OXRA 1E99A 3SC3A 1FX0A 1CULC 1EGAA 2FSHA 4LPSA 1OXSC 1EXMA 2QGZA 1GNQA 4D2IA 2AKAB 1NI3A 4NKRA 3OESA 2ZU6A 2CCJA 5E4FA 4NONA 4TSFA 1KZGB 2L0XA 3DZ8A 2KI5A 1W5TA 1F48A 1A7JA 3AKCA 3LVQE 3EA5A 3KZ1E 1ETUA 3BB1A 2FZ4A 4PQYA 1E2HA 5HKKD 2WWIA 4N3NA 4US1R 3UK6A 1Q22A 1NF3A 1TU3A 4B3GA 3UKDA 1OXVA 4JLJA 1YZGA 1KO4A 3KTAB 4BEBA 4YXWD 1M7BA 3HU3A 5FL3A 3U2QA 2ZR7A 1JR3E 1XTIA 2GJ8A 4I4LA 1E2KA 1DTSA 1U94A 1X6VA 2O8DA 2BKUA 1VCNA 3UATA 1NP6A 4MGYR 4IJMA 1KNXA 1X86B 4IHQA 1HQCA 2EFEB 3PUWA 4XVUA 2O0KA 4LHWA 5JCPA 4OQXA 3TNFA 2DFTA 2OCAA 1G19A 3THWB 2IX3A 2DR3A 3VX4A 4G01B 3QOFA 1E79D 1T3SA 2ORIA 1OXXK 4BLQA 3PEUA 1NN3A 4DDWA 3T5GA 1GVNB 1P2UA 1EFUA 2QRNA 3RLFA 1T3HA 1F3OA 1ZUIA 2GXQA 4IDOA 4KLNA 1XJQA 5HCIA 4YONB 2O8EB 4AKEA 2RGEA 3Q72A 2A3RA 1XEXB 4O25A 1N5KA 1UDWA 6Q21A 4OHZA 1G5TA 2V1UA 2QEQA 1F2TA 2ZE6A 3BK7A 4RD0A 1R5OA 5JWHA 5SZHB 2YZ2A 2AFHE 2ZR9A 2CVFA 4DLSA 2A5DA 4ZCLA 2ZXUA 3CPEA 2E87A 4URZR 2HDNB 5TDHA 3QXCA 2BWJA 221PA 4PTLA 4PR0A 3B8HA 1II9A 1KMHA 2BOVA 1XEFA 4GP6A 1KI8A 2B21A 1U0LA 2LKDA 2OM2A 5JS8A 5EXPA 4TLCA 1N2CE 3KJGA 3SEAA 3CUEF 1A4RA 1OKKA 4IOMA 5SZKB 1JNYA 5KOYA 4QJ5A 5EP2A 4L16A 2C77A 2R9VA 3A4NA 1Z0JA 3X2SA 4HLCA 4D0LB 3N70A 3OIVA 2GAAA 1UAAA 2IS4A 4C0HA 1G8HA 4LJ5A 4W5JA 3ADBA 1J70A 5EUMA 2JCSA 2AXNA 3T15A 2GEVA 1NNEA 4JKYA 3D3QA 4W9MC 2XNDA 3IHLA 1PLKA 2RGDA 4XVRA 3QVVA 1Q21A 1CLUA 2F7SA 5KNBA 5JHHB 4NYIR 2WWHA 2ZRJA 4Z51A 4WXPA 1P2VA 1NN5A 3AB3A 3ZIAD 1FP7A 4UXHA 3QF4A 2NOAA 2EFGA 3KUCA 1OB5A 3Q5EA 3A1UA 2CBZA 1ZINA 1E9EA 3PUZA 2QMUA 4HUQA 4I81A 3CNNA 2GVZC 4GP7A 3P20A 4WIAA 2CDNA 5B30A 4RVCA 1JB1A 3U44A 1Q12A 2FA9A 1Q1EA 3O8DA 3QKRB 2XAUA 3P4XA 1G7TA 3VKGA 4FINA 2P6UA 4XJXA 4RCZA 3I3SR 4JLNA 1KI4A 3ZVLA 4HAZA 2YJTD 1PUIA 2FF7A 3RS3A 2XB4A 3FWYA 2J3EA 1Z06A 5TV2A 4JVMA 1W36D 3OEEA 3GLIB 2W0SA 4ACBA 2ZYWX 3CIOA 2V1XA 1OSNA 3MG9A 4ZDJA 5FBQB 5GVSA 1KK2A 3EIEA 5KSYA 2W6JA 1GKIA 1G6OA 3THWA 2CLSA 3ADDA 3SYLA 2FE4A 3O47A 1XXHA 1HY3A 3QBVA 1GNPA 4PANA 3SHWA 4PSAA 1P75A 1TL7C 4PHFA 3LDAA 4QGAA 3GLHE 3QG5A 3EAQA 4XSGA 621PA 1OW3B 3QG1A 3KQLA 3L0OA 1XRJA 5JRZA 3LY5A 4DCNA 1U9IC 2IS2A 2CHGA 3MMPA 2MMGA 1DELA 2ZYTX 3CLVA 3NEYA 3AKDA 3RNLA 5CLLA 4LC1A 2BKEA 1Z8FA 1N6KA 1AQUA 2QPAA 2XEXA 4NL4H 1EFRD 4OHWA 1F6BA 3MD0A 4FMCF 2ECKA 2F9LA 1WXQA 2Q3FA 2QTVB 4M1WA 4DCUA 1WRBA 2AFIE 4EPTA 4PSVA 4DEXA 4AKGA 4UNRA 1YZTA 3HR7A 3MWKA 1IAQA 3B7GA 3NBFA 2RHMA 1IXZA 2X8AA 4C0QC 4GZLA 4L8GA 1QRAA 2I4IA 3OIYA 4F91B 1TAGA 4Y0AA 3CRRA 4TYNA 2ASEA 4QM6A 2WJVA 5LDDC 2V8OA 4UNNA 1W5SA 1UFQA 2CLDX 2YV5A 3DEFA 4V0ME 3WNCA 3MAAC 1E3MA 1E0KA 2F3RA 2GDJA 4NYJR 3U7GA 1Z47A 2FN4A 3A1SA 1C9KA 2EU8A 3SJCA 1ZM7A 1SXJE 1ZW6A 1TADA 4B44A 1A5TA 2REBA 1TQ2A 1VECA 5EUQB 1OHHA 3PEWA 4JYCA 4M9QA 4PC3A 1FL9A 1ZIPA 2WPDA 3W3AA 1D2EA 2OT3B 2NO1A 4I1OA 4UQOA 4A4DA 5KSOA 1W2GA 1COWD 3UMSA 3KJEA 1JEEA 1YE8A 3R8FA 1R0WA 2H8KA 4O2LA 4URUR 5B58C 1QHXA 5EP4A 2GK6A 2IK8A 2ZRHA 2GHIA 1DARA 1XJCA 4FCWA 4HLUC 3AVTA 1GWNA 4NMMA 4NPHA 2J7PD 1SXJC 4QBFA 1ZM4A 5G3YA 2V7QA 2FDCA 2HJVA 4ESVA 4XWAA 2XB2A 2YWGA 3EZ2A 5B2ZA 5DN6D 1DAGA 4PPNA 1KI1A 4PFSA 4RJLA 1QF9A 2WM9B 3TR0A 4K8OA 2VO1A 1UBGA 2HEIA 2OFOA 3SYKA 1A1VA 1E2LA 1SVLA 4Q9KA 3K53A 3VTKA 1YZLA 3MWLA 2OESA 4M21A 3T1TA 4MH0R 5J4HA 3HJNA 2W83A 1Q1QA 2DYKA 4HATA 4HAXA 4M1TA 1GSIA 1XTQA 3PUXA 4HZUA 2A78A 3A1VA 5C4GB 4D82A 3EIHA 2ZJYA 3GEHA 3K0EA 5JSZB 4DSUA 2GZDA 3BOSA 3LFUA 3NC0C 4BZQA 3CH4B 1D2NA 4RD4A 4AYXA 1KK0A 4Q9JA 4ZCMA 2FFHA 1A2BA 3GMTA 4OHVA 4URWR 3NDBB 3KXIA 4HLDA 5ELXA 3HPRA 2J0QA 4H1UA 3W6OA 4AIIA 3KL4A 3SQWA 3SNHA 3IEUA 4LHZA 3NBXX 1KSGA 1CJMA 4URXR 2F43B 4D4KA 2VH5R 4FW9A 1Z22A 4MGIR 1Q1BA 5KUTA 3TGPA 1KK1A 4ZDIA 4MRPA 1KAOA 1W36B 5J40A 5CJ2A 1FUKA 1Y63A 3AP2A 2GETA 1NSFA 2F9MA 4R9UC 3JVVA 3QXSA 1UKZA 5FPTA 1K8RA 1M1YE 2WWFA 2WPDD 2ZIAA 2ORVA 1NVVR 1G9XA 4B2PA 5M04A 1G18A 2QMEA 4DJTA 1CXZA 3EW9A 1X8LA 4Q7JB 1JBKA 5D3MB 3CWQA 1UM8A 1SHKA 2WMOB 4JL6A 5FUYA 1OFTA 1PLJA 3NVAA 2ZUBA 3L0SA 3GFPA 1P3JA 4QBIA 3CRMA 3NH9A 2IYQA 5KNCA 2Q9BA 3K70C 4ARZA 3RDPA 1I4DD 2ZE5A 3PUYA 4TTRA 2R6CA 1ODFA 2WKRA 1W44A 2GA8A 3P27A 4LDJA 4R2HA 4GZMA 5CK5A 4G0NA 5FOVA 4YQFA 4MDEA 2ZREA 4M53A 3ZZTA 3LQQA 1IN4A 1N0VC 3M0EA 1M2OB 2QT0A 3BH0A 3EASA 2VPPA 3PCRB 4L15A 1E2DA 4JSTA 3ZLJA 4TQAA 3CNLA 3NG1A 1MO3A 2BV3A 3IIMA 4M9XA 3NEJA 2P5TB 4U7DA 1P60A 2ZRPA 1DE0A 1N3BA 3EARA 2IYTA 3GQBA 1UBFA 5JMTA 4Q48A 5L3SA 3GLHB 3W6NA 4ERNA 3Q3JB 3AQ4A 8OHMA 2JDIA 1XDBA 1F2TB 4PPQA 3THYB 4C9BA 2BMJA 3U7FB 1NIJA 4M8NE 4LYFA 5GADl 2VP6A 1R0YA 1OFIA 4EQ6A 5HZHA 1U9IA 3U5ZB 3M4YA 5AWFC 1AQYA 3SI7A 2WWYA 4IXMA 3EPJA 3LLMA 3QPWA 1NMZA 2HXSA 4QXAA 3CWZA 1L4UA 1LVGA 3FMOB 5AJXA 1N5JA 1E0SA 5G40A 3SN6A 5DE3A 3EC1A 5GJBA 2GZAA 3JZMA 3LLUA 2JLRA 3QQ5A 1FMJA 1LW7A 4B34A 2ZSDA 4B32A 5FUWA 3RC8A 4MGZR 2W6JD 4DZZA 2P6RA 3NDPA 3B6EA 2GJAA 2FX3A 2JJ2D 1UF9A 4WVFA 1GUAA 1J99A 2QNRA 2NMVA 4HB0A 1L7VC 1NN0A 1NVVQ 4YC7A 5FUVA 1IQPA 4FWIB 1NL3A 2J41A 3KKOA 2Q21A 1HUQA 2BHRA 3CF0A 2N42A 1VPLA 5AJWA 4D26A 1VHLA 3B13B 4JBXA 4PAOA 5L3QA 2KB0A 4N0DA 4BZPA 3PVSA 1P62B 2VRWA 4I1UA 1VCMA 3B85A 1N6PA 3UXMA 2IUTA 2F55A 4OBEA 1G3UA 1XB2A 2ZRMA 2O0JA 4PC6A 2OILA 3X1YA 5AR1A 3GLGA 1JEDA 1OKKD 3ASYA 4PXAA 4YXWA 1SHZA 4DLVA 1NG1A 2EYQA 1IXRC 3L8ZA 1IHUA 2O8FB 3IUYA 4DLXA 4OK3A 3KKNA 1GOTA 5L8VA 3BAFA 2R62A 2RGXA 5DNYB 1G8FA 3E5HA 2YWFA 1EFCA 3GJXC 3V9PA 1E98A 1ZNWA 4US2R 4DLZA 4ITRC 2Q9AA 1FTSA 4EAQA 2YWEA 1G64A 1VTKA 1G5PA 2X2EA 1KTVA 3ADKA 4YMTA 2XNDD 3A1TA 4I1SA 4JVLA 4C7OA 1AN0A 3LRPA 2YINC 2VSFA 2FPLA 2PH1A 4B43A 3K9GA 3TAHA 1Z2AA 2BMDA 5A0FA 2ODEA 1XZPA 2AK3A 4Q03A 3TR5A 1GRRA 4YMUA 1XMSA 2HT1A 5JS7A 1YZQA 1NIPA 1JPNA 1TPZA 2WICA 3RRNA 3VR2A 3NH6A 3U3KA 2BM0A 2V3CC 3CW2A 3TW4A 1G3QA 3BB3A 3TE6A 3UIEA 4A0RA 2CEAA 3K70D 1Z0KA 2IYYA 1FX0B 1UKEA 1DS6A 4AK9A 3B1WA 3DOFA 2F1IA 4QHSA 2C99A 1JQLB 1X8JA 3RS4A 2GAOA 2UVQA 3GLFA 5FI0B 5HTKA 2PL3A 4FCTA 1KO8A 3U3MA 2F6RA 2UZIR 1UJ2A 4OK6A 1IN8A 3BFVA 2RGNC 4CRWB 1BOFA 4KVGA 4DWJA 3KX2A 5CB8A 1BS1A 2ZJ2A 4HUTA 3TRFA 1ZAKA 3IKJA 2OBNA 2Q6TA 2QN6A 4TQUS 2VF7A 5HKKA 1S0UA 2OBLA 2WJYA 3B60A 4HSEA 3QI2A 1SKYE 3FE2A 2FZLA 3IIJA 1DG1G 5A4JA 3K1JA 3TSOA 4BLSA 1SZPA 4TMKA 2Z4SA 4Q9IA 3T5DA 3CZPA 2V6IA 4JLOA 3WRXC 2WWWA 4LJ7A 2QENA 5D3QA 4RKFA 2WAYA 3FKSA 3AF0A 1WBBA 1X1RA 4DIEA 4C0JA 2GEDA 2DFKB 2ODBA 2ZVPX 3W34A 2SHKA 1W0JA 1YKSA 4LWZA 4LOAA 3PJRA 3GJ7A 1QG2A 2XJ9A 3Q8XB 3QEOA 4LBWA 4XD7A 3QXHA 2AWOA 3I72A 1E2EA 3EZ7A 1FNNA 1NVXQ 1E2GA 2QPOA 3C41J 1E96A 4HB2A 5EE3A 3BC1A 2XGJA 3FHTA 1OJLA 1WB9A 1GL6A 2VP4A 4MYCA 3U3RA 2GCNA 2VHUA 5TVKA 2PX3A 1KI6A 3ECCA 5BQ5A 3KXLA 4RD2A 2J0UA 2ORWA 4JIMA 2R8RA 3QIAA 1ZMXA 1VCOA 3N5CA 4GOJA 4JJZA 3GLFE 2FSFA 1KI3A 5KYKA 2IXEA 1FW6A 4FN5A 4DSNA 4OJKA 4D25A 2O8FA 4OK5A 1KJWA 2QORA 3WNBA 1S1CA 2WIAA 1GAJA 1W48A 2YOFA 2JLZA 4Z1MA 3CPHA 3WMGA 5FUXA 1WE2A 2GNOA 4AI6A 3OHMA 4B71A 4B3CA 5B57C 1FP6A 2HCJB 2X19A 3LXXA 4UNSA 1Z2CA 5EE9A 2R6GA 4C3ZA 1S4QA 3N2EA 2QZ4A 3B5JA 3WYAA 2XITA 4AYWA 4BFTA 4C0KA 3AF3A 4A2PA 4ESHA 5BYKA 3FKSD 1VKJA 2NO7A 3SZRA 3AUYA 3AVYA 1W0KD 4Q00A 2QY9A 4CVNA 1CKEA 1SXJD 2CCKA 4IRUB 4F4JA 2I1QA 4RFSB 2H18A 1P5ZB 1XF9A 4FMCB 3REGA 4KHZA 4DB2A 1MABB 3AKEA 1XMVA 1MRSA 2IF0A 1DOAA 2QG6A 2WWXA 2ZYVX 1Z6TA 4RY2A 5G53C 2H17A 3B82A 2JIZA 1CR0A 1N5LA 3TW8B 1M34E 2C2HA 3BS4A 2IHBA 4CEIB 2GF0A 2W2XA 4F4IA 2CHQA 4P4UA 2CNWD 2OAQ1 3NIBA 1R10A 1T91A 3QE0A 5CLQA 4RZUA 5L3RA 2NO0A 1RKBA 2QSZA 2RGBA 1CRPA 1W46A 2QL6A 3HDTA 4JL8A 4V0OA 4M0LA 3WBJA 2W6ID 4DC9A 1MH1A 2FGJA 2WVJA 3QF4B 1GIAA 1TQ4A 2QT1A 5EP3A 4DDTA 4BGDA 3RYTC 4E5UA 3ZJYA 1D5CA 1HTWA 3NBZC 4XWKA 1J2JA 1NVWQ 3QXXA 3RWOA 1QHSA 2FH5B 1ZM3A 2D2EA 3A8TA 4CDGA 4K81B 2HLDD 3FVQA 2JLSA 2NG1A 1E9RA 4V0MA 1S3GA 4HZIA 2A30A 4E07A 3D7MA 4KFUA 3KKPA 2EW1A 1NJFA 5JI3E 4H1VA 3BGWA 4BFZA 2O8BA 4Q1FA 1KO1A 3AGPA 1D9XA 2H16A 4AKHA 5K8IA 1YQTA 2RGGA 4PC1A 3LWNA 3VHXA 1VG9B 3VR3A 1DVRA 1XTKA 3CPJB 3AP1A 1XEWX 1C4OA 4HDCA 2KSQA 4IDQA 5F2EA 3WY9A 1OB2A 3KFXA 2GJSA 2Z5FA 5CIWA 4A8JB 3HYRA 1KKMA 1VMAA 4FD2A 1IY2A 1JALA 1E9SA 5UKDA 4FMDF 5K8UA 2Y8EA 1II8A 1T8TA 2A5GA 3I8XA 4FMBB 4JLPA 3PITA 2R44A 1P4SA 1AZTA 1P72A 4MYUA 3CH5A 2C04A 2FEOA 4PQFA 2ZJ5A 2UKDA 3GJ0A 3AF4A 5EE0A 2CMKA 2ZI3A 2GZHA 2Q3MA 2N1BA 1PZNA 3VNVA 2B8WA 2ATVA 4NCJA 3T61A 4BFSA 2G6BA 3AUXA 1YZUA 3TSZA 2AN9A 1AKEA 4POAA 1KDOA 1CF4A 1A82A 1HV8A 1OFUX 5E3HA 2J7PA 1CIPA 2IS1A 3T12A 3QJYA 4PX9A 4LZZA 1N0WA 5HPYB 1XD8A 3QKSB 1OT3A 1Z0AA 5DISB 2CL6X 4GPTA 1EESA 4IOLA 3IIKA 5FOSA 3F0TA 1MT0A 1KMHB 4NYMR 2B92A 1G8PA 3NBYC 2FFQA 5FBWB 5B64A 1KY2A 1JR3D 4EDHA 2WOOA 4UNPA 2ZEJA 3V4RA 1VYUA 1X1SA 2BC9A 1AKYA 3MJRA 2IEYA 4LX0A 4OKSA 1J7KA 4O2RA 3OE7A 2O8EA 1X3SA 3LXRA 1ZIOA 4WAUA 1KYIA 4A6PA 5IHPA 4Q4JB 4PO1A 4MRNA 5E7IA 1MOZA 4P4TA 4RZXA 2ZUCA 1NVUQ 5FPYA 3VMFA 5IF9A 4FWTA 1D9ZA 1TEVA 2ZI9A 3NC1C 1WF3A 1D8TA 2B7BA 1Z28A 4YDSA 1J8YF 1M7GA 2FFAA 2C9YA 2WSSA 4PC2A 3I8SA 1Q3TA 2ZSEA 4PHHA 5BYJA 3CR7A 3K09A 4IDHA 5DGXA 521PA 3WRYC 1FTNA 3CR8A 2G0TA 2N46A 4TQ9A 1E9BA 1VYVA 1UKVY 5AUPB 4P33A 3K0FA 2PJRA 3PG5A 2C5LA 3MUFA 1ZU4A 4IVPA 3PEVA 2NTYC 2IS6A 1US8A 4DKXA 4ZKDA 4PO9A 1ZC3A 5EXXA 4C4PA 3DL0A 4Q1DA 2DWPA 2R6FA 4Q66C 3RC3A 5JCZA 2ZJAA 2KE5A 4HZUB 4WZAE 3O8RA 3VFDA 1U98A 1E9CA 4XD7D 3L0IB 4NCKA 5BXQC 4GOXA 1GRNA 1JR3A 1S9HA 3ND8A 1CR2A 4XTRA 4BLOA 5AJVB 4TT3D 4OYHA 4UJ5A 3QKTA 1SKYB 3CRQA 1I2DA 3LBIA 1JQJC 3LW7A 5HE9A 4TTQA 4LK2A 2JJ1D 1G3MA 2BBTA 2BEKA 5CDFE 4MYHA 3VKHA 1SXJA 4D4MA 2WJJA 2GBLC 3A37A 3EWAA 3QKSA 1F2UA 3SS8A 2BBSA 3C14C 3LX8A 1VG1A 2PCJA 2R2AA 3BH7A 4KBGA 5J5CA 1ESNA 1AZSC 2H92A 1CR4A 1N6RA 2WIBA 2ZRAA 1H8HD 5TY0A 2R65A 4M1SA 1E2QA 5EP1A 4CYMA 4E09A 4BE7B 3TQCA 2GVDC 4A8JC 2OG2A 2GILA 5FPKA 3FHOA 1U99A 1QHIA 4KFSA 5DLQC 4WW0A 4B33A 1MO6A 4D4LA 1N6HA 1U81A 1K6MA 1NMYA 1XCMA 4YMVA 3R9WA 2JJ2A 2O8CB 4TLAA 3AVQA 2J0SA 2QUZA 4KSBA 2YNMA 5IK2D 1DAFA 2LCFA 1XTSA 3Q9LA 2ZJZA 3W8RA 3C16C 3O8BA 3RRYA 4IW3B 2ZI7A 1S8FA 4ZIRA 1Z07A 2V54A 3B9QA 1KNQA 2PZEA 1RC8A 3TUZC 3M6AA 4DCSA 4Q19A 1LV7A 4L9SA 5J4YA 1WDTA 2CNWA 2FU5C 2ZPTX 3W9YA 3WYFA 4C0AC 2IWRA 4LV5B 1Q57A 2JLQA 3SR0A 2IW3A 4TL6A 4BLTA 3U6BA 2OE2A 4KV9A 3U4QB 1KI7A 2OHFA 4A0GA 3K0FB 2QE7A 2VHCA 4KAXA 3V00A 1SVMA 2QAGC 1OF1A 4LHVA 4GNKA 3LBHA 4MRRA 4Z8XA 4B74A 2FNAA 5J4LA 1K5DA 2A5FA 1RPZA 2QTFA 1PV4A 1I4LD 1KDRA 2EFHB 3Q5DA 1TF7A 4R7ZA 3MFYA 1U2RA 4EPRA 5EXTA 2GCOB 4DXAA 4RFSA 2PJZA 5EQTA 5L3QB 1Q0UA 4J0QA 4W5WA 1QHHB 3DO6A 4JKIA 4TMXA 4DLYA 4C0SA 2GTPA 2ERXA 2VHTA 5EE1A 2X77A 4ZDKA 3K0CA 5KTYA 3NKVA 5FPHA 1AA3A 1YRBA 1T0JB 5KDLA 1X8KA 1XMJA 2P0EA 1Z0DA 5KO2A 2QE7D 1AM4D 4LV8B 4OI0A 1BMFA 1DO0A 1AS2A 1N6OA 3NTUA 3OEHD 2VSOA 1F60A 3EPLA 2RAPA 3KFVA 4MRVA 1S96A 1QHYA 4TMWA 2YVUA 3EXAA 1CJVC 1RRCA 4DVGA 1RFLA 2EVWX 2P3SA 1WBDA 4BUJA 4GMXA 1HEIA 1EFRA 5EJEA 5CB6A 2TMKA 3WBKA 3GLIE 3R7WA 2DY1A 2QQEA 2WZQA 3KUDA 4X8HA 1B23P 1OIVA 3RRZA 1S1MA 2XX3A 2FGKA 4B75A 2H7VA 3ZVRA 1VHTA 4EPWA 2QM7A 3L2OB 3RRMA 1H8EA 5FFMA 1OYYA 2AR7A 2ERYA 2QP9X 1GKUB 1ZD9A 2CJWA 1E69A 1XMIA 2B8TA 1SVKA 2P6NA 5SZIA 3VAAA 3GEEA 4NYJQ 3ND9A 5H8WA 1G21E 3F5FA 3KJIA 4TMVA 4GFDA 3H0KA 3CONA 5KDDA 4URVR 4A92A 3M1IA 4C2TA 2OEPA 4RZ3A 121PA 4JT4A 4JLBA 3KB2A 4BFVA 1LS6A 1YZNA 2WJGA 1IN5A 3E1SA 1IONA 1S3SA 3DM9B 1FOEB 4CEJB 4JVSB 5H1YA 1NSTA 1NMXA 3EPHA 2IF2A 3TUIC 1NN1A 2ZI4A 4M9ZA 4PPFA 1DAHA 3DPUA 1CR1A 3K9LA 4OI1A 2RB4A 1XFAA 1GDDA 1LY1A 2YOGA 5JBQA 2FJUA 3D8BA 1WP9A 2AHOA 3G5UA 2OUKA 5DN6A 5LPNA 3CX6A 5JRJA 3H84A 2F43A 1GRQA 4QNRA 2AK2A 5BN5A 5LD2C 4KJZA 1QHHA 4G5OA 3FGNA 2EFDB 1DAIA 2ZRGA 2V9PA 3GJ3A 5AUNB 3C5CA 3UMRA 1G7SA 1IOZA 3TLXA 3QSYA 2W2VA 4A2WA 4P0TA 1N6LA 3QXJA 2CE2X 4DLUA 1SGWA 2ZR0A 2AL7A 1KI2A 2ZITA 1RRGA 5FL7D 2DHRA 5G3ZA 2Z43A 3VKWA 4AWXA 2AX4A 1KGDA 1WQ1R 3EX7C 1L2TA 2GJ9A 2QTHA 2BMEA 4IVQA 2WV9A 5DYGA 1DBSA 3LD9A 4TYYA 4M9SA 2DFNA 2D3WA 4LBYA 4NP6A 3GP8A 3I32A 1O3YA 3LVRE 3WYGA 1G5RA 3WMFA 4F7WA 4Q9LA 4UKDA 4PAMA 3REFA 2HYDA 1H65A 5DHAA 4A82A 4TYWA 4XIGS 2J0UB 5JHGB 5FTKA 1EK0A 4MKFA 1LB1B 3DOEA 2BM1A 3FTQA 4TLBA 4IFEA 1SQ5A 1NLZA 5FOXA 1E2PA 3C5HA 3DZDA 3TJZA 5C18A 5FTNA 4IOKA 2MMCA 4IXNA 3R9IA 3UPUA 4LCBA 3UWKA 3SJAA 2J45A 2B6HA 3FMFA 3K9HA 1U8AA 2GJKA 3U61B 4OHYA 4NYMQ 1GZSA 4TT3A 2AXPA 3TVTA 3AVVA 2YKGA 1YZKA 3ZD6A 4BFYA 2GEUA 5FOUA 2C8VA 2XOKD 3ZDQA 4ZCIA 4AKIA 1SVWA 2IYSA 5C2JB 4NCHA 3THYA 2PCLA 2V7QD 3LA6A 5L3SB 4IFBA 4TL9A 5KSPA 4RD3A 1VG8A 3T06B 2OFXA 3I5YA 5BN4A 3G0HA 3ASZA 2IUUA 1OIXA 3VR6A 2YHSA 1VDZA 4LBVA 4PZZA 1S2MA 3QPUA 3RHFA 4US0R 1P9WA 4EPVA 2JLYA 3ADCA 4TWZA 1Z6YA 2D06A 1P6XA 4UXJA 4QJ4A 1JAIA 2VHQA 2BCGY 2D2FA 2XZPA 4QHTA 1TEXA 4DDVA 1K5GA 2ZSFA 1T9HA 2GKSA 1M8PA 1KDTA 4QBHA 3EIQA 3K0CC 3OEED 4II7A 1YR6A 1XTRA 1R0ZA 5AK0A 3AH8A 1G16A 1UEIA 2GRJA 4PHTA 2IWHA 1LNZA 1J90A 2FMXA 1ZCBA 1US8B 4JVNA 4AD8A 3G82C 3UG7A 1ONBA 4OI4A 1T5IA 1RYFA 3TBKA 1A2KC 3V4FA 3U7HB 4Z1MD 5CIQA 4ZKEA 3W90A 1AGRA 1IN6A 2JATA 5J47A 3BD9A 2ZRLA 1V43A 1CJTC 3WNDA 2VYFA 1IY0A 1ESMA 1OPXA 1WMSA 2C98A 3IQWA 4LJ6A 1SVOA 1NY5A 4DT1B 1JECA 1N5IA 2OBMA 1ZRHA 2J1LA 3LX5A 5BW8A 3AV0B 5JSZA 2EFCB 4BWYA 2PEYA 3K8YA 4EPYA 4O0MA 4V0NA 4LHXA 3ZS9A 3E2IA 4V0LA 1D2MA 2NQ2C 2HYIC 1E4YA 3EZ9A 4IEEA 4TYQA 4TSFD 3D31A 4RD1A 1FQJA 2QI9C 4Q4HA 4W7SA 5E95A 3CX7A 2OSBA 3IO3A 1EX6A 2RKOA 4DBLC 3SE0A 3GD7A 1DG3A 3U6KA 1FUUA 1IJEA 2Q9CA 1E1RD 4KBFA 1WCV1 4U00A 2PZGA 4U02A 4UJ3A 2WTUA 3TK1A 2FV8A 3T1OA 5JEDA 2V55B 4LBZA 4DUGD 3SBEA 421PA 1EWRA 1OH8A 4MUBA 2P65A 1MO4A 3PFIA 4UNQA 1VCIA 2BMFA 2ZTSA 3GFOA 1DO2A 4RSGA 4KITB 4D0NA 3T34A 5HZKA 4BFUA 2ZS8A 3KKMA 1KIMA 2HF9A 4F38A 5DI3B 4Z54A 4ASUD 2MSCB 5FOTA 5J4VA 2QPTA 1RZ3A 4HEJA 4HAUA 1T6NA 2H1LA 2JASA 3H86A 1E32A 4JJKA 4DSTA 2PLFA 1DPFA 4Q01A 1RVDA 2FOLA 3VU9B 3ZGXA 5KDOA 4QM7A 4F93B 1XJ0A 2FPKA 4B6FA 5IDVA 4BASA 2C03A 2HV8A 2Z83A 4DRZA 3IBGA 2G77B 3W5JA 5C46F 1G7CA 2RHDA 4NH0A 2XSZD 4BLPA 2KBFA 2CL7X 5H70A 3QKRA 1MO5A 4LYJA 1J8MF 4EIWA 1IBRA 3B78A 3PUVA 3OFNA 2QRZA 2O0HA 5DI9A 1QDEA 4YLGA 5C1BA 3CO5A 1Z3IX 4DCVA 1BYUA 3MSXA 1R0XA 1G3IA 2VHJA 2ZI6A 4DT1A 1NRJB 3K0SA 4FI3C 4ZDWA 4QRHA 2ZQ5A 2IUSA 2A5YB 1YU9A 3WP1B 2RGAA 2MSEB 1UADA 5CJPA 1ZVQA 1U90A 2JLUA 1FZQA 1G8YA 3K0AA 2GK7A 1OFHA 1TUIA 2ATXA 2A9KA 1KK3A 3PV0A 4HAWA 1KDPA 4NE2A 4LSGA 1CTQA 3BERA 4M1KA 4TLEA 4CT4B 5FH9A 3GLIA 4NYIQ 2ZRIA 5D3MA 2GCPA 5EZ5A 2ZRBA 1UKYA 4TZ6A 2W00A 2W58A 2VEDA 3ZD7A 3VR4A 3HYTA 3OAAD 1P61B 2JAQA 2C96A 5A5GA 2IXFA
chains in the Genus database with same CATH superfamily
1P2TA 4MVJM 4CCWA 4HNQA 3MCWA 1E2NA 4QOSA 2Y6UA 3HYLA 2PMKA 4RTRA 1ZM9A 2ZXEA 3L82B 3OETA 1R18A 5E9QA 4MV8A 3D43A 3CLSC 1JPJA 4HO1X 4IVRA 5GJWC 4AIRA 5D5HA 4WFQA 5HBGA 1MPTA 4EUEA 5K9ZA 1UC4B 4AG6A 5EAIA 2Q1SA 4MHOA 1YCDA 1QBKC 2GCGA 5MF6A 3L6EA 4P7JA 2NO6A 3P4YA 3CKKA 1DJMA 3D54D 4NABA 3QVSA 1KJQA 3MD9A 2O1EA 3DD5A 2VDWB 2M32A 3L6UA 3LKZA 2UYYA 3V32A 2ODWA 2VUSA 3K9NA 4KQ9A 4LF7B 3CM0A 3W6PA 2H5EA 2PUVA 3O75A 4RTOA 3CUKA 2HWUA 5LJLA 3A3OA 3M4JA 5KVQA 5EHZA 1JVBA 1SVIA 2BGKA 1AGYA 3ELBA 1Y8QB 4M38A 5FEMA 3S28A 4FB4A 1MNQA 4AG3A 3R7LA 3Q1KA 4CF7A 3OJOA 1JEJA 2GTIA 1NDHA 2KMLA 2VYVD 3AB8A 5EIOA 3VHQA 2ZRFA 2I4RA 2ONYA 2PL9A 4WA7A 2J3KA 4F5ZA 1NJ2A 1M0EA 1SUIA 4CKXA 3ETGA 4D4GA 2WV7A 3GLTA 4ZYLA 1HH4A 3RVNA 2VOEA 5BPHA 1TF5A 3IMEA 4HNAA 2ZJ3A 5J4KA 4HMOA 3RHSA 4GMFA 4AUMA 2FN9A 3A4TA 4XASA 1HZZA 2WG2A 1YV9A 2A6PA 2PUHA 2ZUEA 1TNDA 4AZSA 3CB4A 2X2FA 2X7XA 3L1UA 4OP3A 5LR6A 1CIJA 5KQLA 3RS0A 5DIFA 3WO0A 3UHAA 2R7AA 3PNOA 1SBCA 1TMGE 4CEHA 5FR1A 3RF7A 1IEVA 2XUPA 2ZFUA 1IWOA 2LE0A 2F8SA 2HF8A 3WK7A 4DV5B 4XIYA 4MMYB 1EXVA 4E22A 1UPCA 4P0QB 2IHTA 2EV9A 2ECOA 3EWSA 2FQ1A 1BQ4A 4M46A 2OCBA 2P79A 1C0EA 2G72A 4QGGA 4E2XA 3VPXA 3NZEA 1U8ZA 1FS6A 3LK7A 3LU1A 1E9DA 3EGOA 1MA3A 4RTLA 1KYQA 3U3JA 1TPYA 4IWYA 3ZQ6A 2ZVQX 3NIWA 1SUPA 1RJ9A 1A5BB 3ODGA 3TRKA 1UXJA 4I4TB 4MK4A 4NZOA 3ASVA 3CY6A 1ZA2A 2G04A 1EGQA 4N65A 4JZKA 4Q5IA 2WHXA 4KG7A 4ZFNA 5BRAA 3Q15C 4XLZA 1FFXB 1EHIA 2AQHA 5EHNA 1KWKA 4KI7A 4OHCA 1X70A 1IEXA 1VIAA 2IZ1A 1K08A 2Q62A 3BK1A 4PWYA 1ODSA 2CFRA 2DBRA 1EUZA 1D1QA 3SQLA 2PBRA 4U2CA 3HCCA 4JFAA 3FTFA 5I7RA 4FMDB 3MQ2A 5BY2A 1X7XA 3VHLB 4YAGA 1LPMA 4TYPA 3I4LA 5FI5A 4D5GA 3T3NA 2B3TA 3A3NA 2HQSA 2E4XA 2WJHA 1FMLA 4MWSA 3COPA 1O8CA 1T3LA 2ZZKA 1JHDA 4LZPA 5LQUA 4BKRA 4G0PA 1NBMA 4PYNA 4CU5A 4ER0A 2YQ5A 4E12A 3QOYA 2IHKA 3L0PA 1YQWA 3RTDA 5JATA 1NQXA 1RYZA 1L6IA 1U5AA 5TMPA 4G4GA 3FF1A 1UBMS 4QYTA 4IUCS 3S40A 3STXA 1PS8A 1VLQA 2Q9UA 2RHBA 2CMHA 1JRLA 3AM4A 3E9RA 4G41A 2Z6QA 2DHCA 3OTQA 2PGAA 3NTVA 2AWNA 1YQQA 4JC5A 4MV1A 3TKYA 4ZYTA 3RAFC 3C8UA 3OLWA 4Q1VA 3ZYCA 2B7CA 2PBZA 3CMMA 3PEYA 1YT5A 1E3EA 2H0RA 2VLIA 1ULUA 5CYOA 4YRTA 8GPBA 5KYUB 5I9IA 4BFXA 4CGZA 5T64A 2M1ZA 4BNDA 1FDTA 1HI9A 3DKVA 2ZJ6A 5JQGB 1YI8A 3IVCA 1TCVA 1EFHA 1RBMA 3AJEA 2ZAGA 3HKBB 4QEZA 1NMEA 3MLEA 4QYWA 1AQIA 4EFMA 4UEJA 5BMOA 4MWCA 3R7WB 1BXRB 1H94A 3F3YA 4TTPA 2DCUA 4GLOA 2AVDA 2HRZA 5FTMA 1GUZA 3TMYA 4AQYB 3DT8A 2AF3C 3T35A 1M34B 4K9KA 3OX4A 4GVPA 1A8HA 2QJFA 2EQBA 5BSMA 4TXNA 2AJCA 5ITSA 2H31A 3THXB 3G0BA 1QJ4A 1SOWA 2WTBA 3IUEA 3L0DA 3KQMA 3RLIA 2P9CA 4ZI7F 3VJLA 5HZGA 2QSYA 1V8OA 1XLTC 2RGCA 4RULA 1N9KA 1JFLA 2GESA 1TU0A 4UE6A 4O4IF 4X97A 2HWYA 4R9RA 1Y5MA 3IMFA 3IE2A 3SC2B 3PHJA 3WGNA 3WRVA 4ZMBA 5JW6A 2B8NA 3DFFA 1WA5A 1VC2A 3JQPA 1B73A 1P31A 1YO6A 4X8LA 1B3RA 4O3MA 1OC2A 2GK3A 3X1XA 1BMTA 5JWOA 2IYLD 3I2KA 3RS2A 3ME5A 2XRMA 1IG3A 1QNFA 3I3OA 1M6YA 3LV8A 4Q3EA 2Z6VA 3E0QA 2E5WA 3GLHA 3KOUA 1X7WB 3DWIA 1RWQA 1WLSA 4YR9A 1Y98A 1FNMA 3BTSA 2F1RA 4WKOA 1JYSA 4AB1A 3E22B 4R1OA 4KXFB 3BUSA 3TL2A 3C98A 1KRXA 3KSBC 1RYNA 1CNFA 4OIFA 3E2PA 2PX0A 4JBIA 1P4RA 3T9AA 4WWHA 4EYQA 5T4BA 2JGMA 1GL9B 3C6MA 3L01A 1PFQA 1SZDA 4PZ9A 4YAWA 4ZYUA 2V9ZA 1QHNA 3FRHA 3NS7A 2YBDA 1YMVA 3FJ1A 3JQ6A 1IWPB 2DUNA 4O2AA 4C1BA 1DQPA 1V2HE 2VCYA 1ZN8A 4ME6A 5EPEA 3U17A 1UBRS 4FFMA 4CNQA 3CN7A 1DC6A 4Q1AA 4RVSA 4TROA 4L8YA 4BWFB 1TZKA 3MGAA 4TXMA 2AJDA 4FQ8A 3NNDA 3W8DA 4WBSA 1B3BA 5DP1A 3EB9A 2XYVA 1SG9A 2OB1A 4ZQFA 1TAQA 3SS7X 4X1YA 4EMSA 2YW9A 2VPXA 2QM8A 1DCKA 4EYSA 4HDMA 1DJNA 1SQ0A 2VNSA 3DKRA 4G9BA 3WGIA 1NKTA 4OP2A 3FI9A 3GROA 4FM9A 3PXGA 1Y4AE 2NP7A 2V98A 5F23A 1JN0A 2HFKA 4R0VA 3R7DA 1EFDN 3QVJA 4CT5A 4FDUA 2ICAA 1XP5A 3ZI4A 2X8LA 4GDMA 4TWAA 4YB8A 1XA0A 1Z5ZA 3DWFA 3LQYA 3GBVA 1KYTA 4V0KA 1NAHA 1KQ3A 1GGJA 4RY9A 1FPMA 4XGNA 5DSZA 1QR6A 4TN1A 1VPDA 1ETHA 3FFAA 3EUWA 3R0QA 4FOLA 4QBGB 4XOIA 3P0EA 3TTWA 3RSHA 2EW2A 2CHEA 2YJZA 3ZE1B 1JP7A 3H9JA 1XTTA 4HWKA 3WV4A 5K0CA 1MKYA 1W94A 3GT4A 3PTLA 1AX9A 4YGYA 2EP7A 2ON6A 2VSNA 3M5DA 4CTMA 4GLBA 2FW0A 3AIMA 1L5WA 4EG5A 1MV8A 1NU6A 1QHGA 3MPUA 5CB0A 1KTIA 3ICEA 5H83A 3P26A 4OVKA 1G8JA 2NZWA 4G5YA 4H6WA 3FXAA 4A2CA 2G07A 1WHSA 4B6QA 2PR2A 4JXKA 1UPFA 5TXGA 1E1KA 3GUZA 3QVUA 3Q8KA 1WOYA 1T9CA 1NNI1 1WD7A 4JSYA 4LHYA 1EP3B 3MGCA 3AKYA 1SIUA 4O4HF 2P3LA 3H75A 4HK4A 3DC7A 5FA5A 4AS1A 3IO5A 3SLKA 2G63A 4RF2A 3E61A 1SK8A 1HA3A 4JYBA 3PWZA 5JSYA 4E32A 2O8CA 1G66A 3B8EA 4G1UC 3GVHA 3M33A 4IDCA 3CR3C 4DDUA 5ADWA 3EZFA 1OHHD 4EW2A 2E4WA 3TQRA 2GUGA 1V1MB 3K94A 2X1LA 4UARA 3OFJA 4F4CA 1E2IA 1F12A 3D9QX 2BFPA 1E1QA 1CQPA 1G8SA 2KLBA 4JBYA 2W6QA 4P4SA 4RTJA 3BFKA 2XUHA 1V39A 2I4OA 1MC5A 3L5KA 3PWTA 3MJHA 1LK0A 3C74A 3EZXA 3D2BA 1VE6A 3E05A 4ZOLA 4NAUA 1AUVA 4DLRA 4XFDA 4QSMA 4CM7A 2FEWB 4JI7B 2MYTA 2YYZA 3QFSA 3SJZA 1YCHA 1SCIA 3K31A 1GG2A 4TKZA 3ZWXA 4EJSC 5LD2B 3DKPA 4FB5A 3MB8A 1Q92A 2BGMA 3O4GA 4ZN6A 3G23A 4MJXA 1M5UA 1R74A 3LLSA 2FZ5A 5F33A 1UIMA 2XOEA 1EP1B 4IDNA 4IXDA 4CMKA 4GKKB 1KO5A 3RSQA 3G6KA 3G8YA 2ZTHA 2NZ8A 3S8EA 4PTYA 3F8WA 3ZVNA 5GJVC 4IJ5A 4K87A 3U44B 1NUAA 3A1DA 4KQGA 5JSQA 1ORWA 4MS3A 3Q87B 3UNXA 4GMDA 4X00A 2JGEA 5B1HA 3SBDA 1EM8A 3W2HA 5JT1A 3J7AC 5ALGA 4EHDA 3KAPA 2QA5A 4EFDA 2Z57A 3GLGE 2DXIA 1YVEI 2XXAB 2FSIA 2QTLA 3JQRA 2XTMA 4NHEA 4I5FA 4RK4A 5KTPA 4JKOA 4MUFA 4ZO9A 1H0RA 2F8MA 2B4TO 3CNEA 4Y7DA 2SECE 4PYLA 1WU7A 3BJEA 3GR6A 2RMKA 3N75A 4YQZA 4ALNA 1XZNA 4BB5A 3DE3X 3GLFA 3C3XA 1G38A 1KGSA 3C3KA 1G4AE 2XQGA 2YN0A 3FPSA 3HXTA 4JU8A 4ON9A 3MM4A 4CZ2A 4E3WA 1XZLA 2AS0A 1RXWA 2JH8A 1AJEA 1P4GA 1R0SA 2ID7A 1Y37A 4G9GA 2FMUA 3IT1A 4KH1A 1Z6AA 1D0VA 3TZHA 4RQAA 4YLEA 4CE6A 4NF2A 1XAHA 3JQBA 2GEFA 3UK1A 4LY6A 1M8FA 5TC4A 3ROTA 4ETNA 2Q27A 3AX6A 2BEUB 1ST2A 1XWWA 2ZZNA 3W4JA 3L7AA 1PDOA 1O7JA 3OQIA 1QVRA 5E8RA 4M36A 4U7GA 4MQEB 5JCOA 3A4MA 5JI2E 1M8GA 1QYDA 1OC4A 4N0EA 4XLLA 4DARA 1TTQB 3R5JA 4ENWA 1JDBC 3E9MA 4JBHA 3VRHA 4FHDA 1TZBA 4O1MA 3LL7A 3H9UA 1O6GA 3F1LA 5D00A 2QRMA 4R7GA 4G3XA 4OB7A 2Q45A 5CW1A 4MP8A 3HU1A 3WHPA 4H7DA 1OZHA 5CP8A 4CEJA 2PYDA 2V8BA 2YVAA 2QVLA 4NX2A 1RWBA 5J2UB 1PD1A 3KZCA 4MS4B 2NNWB 3AIIA 3KXPA 5FL7A 3QKUA 1NNUA 3L0YA 1OFGA 4CKWA 4AY2A 2SKCA 1GUDA 4QFMA 2E49A 3H9QA 2D8AA 4JOQA 2CUTA 4WEOA 3TBHA 1WR8A 3VBCA 4MZXA 2HUPA 4AFNA 2XADA 3X1DA 3H5NA 3KQTA 3SXUB 1RRFA 1AS0A 1A9QA 5IT5A 3ONWA 1I14A 5L95A 3A1WA 1NV8A 1RW4A 4OJQA 4RESA 5AP9A 5B7GA 1XRMA 2IDKA 3FPKA 1Q6ZA 2Q0HA 4YN3A 4CM1A 3EZ6A 1TXGA 1Z2OX 4G4SP 4MR9B 3KUKA 3PXAA 4DN6A 4YRQA 1JI0A 2QRVB 2BI8A 4IOJA 4D46A 3GRVA 2JLBA 4XYBA 1HOTA 4OQPA 4EO9A 4TL8A 1LQUA 4UM9D 3ESBA 1OZGA 2HXYA 3SJBA 5KJ1A 3NO4A 1E1RA 1ZVKA 3GAZA 4IIJF 3T3MB 1W1WA 4Z53A 2HJ9A 3GEPA 4BRWA 4Z7JA 5ALEA 3B7PA 2JFPA 2ZPAA 5K0ZA 2MSKA 3O38A 1TA9A 1S2GA 4QGFA 2ZSAA 1MCZA 1BS9A 3FBTA 3ET5A 4GRAA 2ZBRA 4R8RA 5IK2A 4OV6B 2V6GA 3WRXA 4AYTA 4II3A 4Y30A 5LBIA 2AHRA 2YXPX 1J8QA 4FYXA 4RADA 5F98A 4Y0VA 1ZCAA 4K9MA 2MJLA 2PKQP 2Q2OA 1XP8A 1GPH1 1A1SA 1KKLA 1ZBDA 3RS7A 2X58A 4MHTA 1DNPA 4PZYA 4FYIA 4PIMA 2Z1NA 3KUUA 2I6UA 2WG1A 2AJLI 3PI6A 2M1XA 4GLJA 2NUAB 9MHTA 3W2TA 1H85A 3QENA 2H59A 4HGNA 2D7DA 3HJHA 3RVBA 5FBLB 5EN4A 2WF9A 3C8HA 3LZDA 4HYQA 4M22A 4E15A 5IYZB 3R3ZA 1A9PA 3AHHA 2NPIA 1IHYA 3FHCB 5BVGB 2JFUA 3QEBZ 4OQMA 2EIHA 4HI0E 4KNVA 4AKSA 4ZJYA 5E6SB 2FPRA 1Q0RA 2R1UA 1MG0A 2B69A 1GAXA 2KBEA 4RZHA 4E7OA 1DXOA 5BQOA 3WQRA 4BNUA 1RYHA 1L8OA 3QQPA 5K8TA 1YGPA 2FMTA 5AW5A 1UFKA 4UEQA 1TCCA 2O8BB 3P2OA 2X5KO 4BNJA 3V7YA 2P7HA 1C9JA 1XWFA 3HN2A 2JH3A 3RU3A 3W8NA 2PZBA 1PFUA 4M99A 3D4PA 4N3BA 1PEDA 1G5FA 3TGLA 5IVHA 5C7IO 3ZEAA 4KRYA 2RK4A 3CGWA 3GHYA 3HR8A 1SPBS 1QIIA 1UEJA 4LJSA 4FYVA 3D64A 1AA9A 5CYPA 1DXYA 3WK4A 5JCXA 3QHPA 3PNQA 2FYTA 3DKKA 5LQJA 2XE7A 2CXOA 4D3SA 1A3CA 2DY0A 4LTNA 5BN4B 5GQSA 4DAOA 1RRPA 5AVWA 2J9RA 3KKQA 2HMAA 4H08A 4R2JA 5IFLA 2H7XA 4GI1A 4FKZA 3S4YA 1NZDA 1XYYA 1NSYA 4Z7QB 3VOBA 3UMGA 4IS3A 4YWJA 6AT1A 3HSYA 1WHTB 4W1PA 1GQQA 3K2QA 3GHHA 4YJ3A 5G41A 3DMNA 3G8AA 1DJLA 1EVKA 1GILA 4QOIA 3V8VA 4D3FA 3DAPA 5L3SA 3SIWA 2I76A 4C2UA 1LTQA 4HGOA 4RCYA 5T6BA 3UICA 1YOVB 3HXKA 3N2IA 3AR9A 1ZJ6A 1GTVA 1KRHA 3FDZB 3AU9A 1I6WA 4DCTA 2D62A 4D98A 1ACJA 4ZEWA 5CCXA 2PZFA 3BJIC 3EMVA 3QX9A 3AJ9A 3HP1A 2EBUA 4IINA 1W9MA 1B8VA 1ZICA 2JF0A 3Q2OA 4HQNA 4X44A 5IX8A 1K0FA 4BY9E 3A6FA 4HH0A 4A36A 1W4RA 2A33A 2AFHA 2FOIA 3LQ4A 3OZSA 2FMFA 4NULA 3U40A 3ZWMA 4CKWB 1U3DA 4DLKA 2VRNA 1ZU5A 3KG2A 2H4HA 3OCCA 3ONEA 1NF9A 4UAUA 1DAEA 2YWHA 1T1JA 2J0VA 3WBFA 1WPRA 1UINA 4UC0A 4ZA2A 1CPYA 4G5SA 2YC4C 4D0RA 3EEFA 4MB2A 5DLQC 4DEYA 3A3YA 1R2QA 1R0RE 3AUUA 2K4MA 2NV0A 3ZDCA 3DGFC 1FQWA 1YRAA 4EHBA 1P2SA 2B34A 1D7OA 3LX6A 4R98A 4ZV9A 1E1LA 4B3BA 4ZALA 4BO8A 4XX0A 5CA0B 1AS3A 1B43A 2WINI 4NV0A 5AJZA 3TIXB 4ALKA 1EXNA 1K6EA 3H2HA 5FBKA 4YT4A 3K09C 1E7WA 5AK3A 3IKTA 3NUQA 2IEAA 3PDIA 1NXXA 3EXG2 1CUUA 3VV3A 1BMDA 1CFZA 4UBOA 1NY6A 5IF3A 2C1ZA 2I55A 1NUSA 3ACBA 5AW2A 5H59A 1WY5A 3GAMA 5BWNA 4IP0A 5CLGA 4LXIA 3VM6A 5CXQA 2VHEA 1CY4A 4Q4JA 4TZ0A 4F5YA 5AM0A 2D1TA 3HL4A 5G1PA 3DE6X 5ALTA 3K70B 2JAHA 2W93A 3BA6A 3R75A 3UMBA 1NUHA 2FWPA 2XMPA 3FPCA 5E4TA 3S70A 4PQEA 3W7VA 2X23A 1X14A 5KOHA 4UHKA 4PFQA 3S2FA 1P73A 1RWNA 2H07A 1ZNZA 3VJKA 2YJGA 2QGNA 4JQSA 3C3JA 1XBTA 4D44A 2PUCA 2CNKA 3JYHA 4OLHA 1A98A 5FQOA 2ZJ7A 3SX2A 3WAGA 1KZHA 3OIUA 3H5AA 4XQGA 4GOND 1DRKA 2I7TA 2PFSA 1JMKC 4QNMA 1KAGA 1RIFA 3T54A 2FQQA 2QXTA 3TXXA 3VPBA 4B4WA 5K0GA 4EJSA 1JLRA 1N6NA 2G71A 2IPXA 2RIPA 4B4DA 1TM4E 4KQ6A 3G7NA 2XDQB 4LI0A 1A95A 3DBIA 4F60A 4A1OA 1PT9A 4MVXA 4B76A 5B3KA 4RD6A 2O8DB 2WHYA 4E5NA 1U6IA 2HWKA 1T6XA 1NRIA 2P3OA 3HKEB 3FFBA 1XEXA 1MX3A 3H19A 1U0JA 5JNVA 2WHPA 1HNNA 3ND5A 4MAAA 4EKDA 1GCUA 1GLVA 4H2DA 2JHCA 5DTMA 1U0EA 1VBNA 2E3JA 1PU2A 4A27A 2E5FA 2FWAA 2CLHB 3IRVA 4DIUA 4PQRA 3JZFA 4O3FA 4RA9B 3U3OA 1LBSA 2FVXA 3L02A 3RQSA 1BN7A 5ANRB 2AD5A 1HDCA 2FN3A 2XIJA 3D6NB 4G4JA 4GBED 3JYQA 1FLNA 4JLVA 4XUDA 1OYWA 4PLHA 5HDQA 3SR4A 1Z6GA 1DZIA 1SR8A 2P9TA 3EZYA 3G5AA 2IHUA 1LQ2A 2V9CA 3UTCA 2DJ5A 2GCEA 3STUA 4JQYA 3AXSA 3F2IA 2ZRCA 2ANCA 2Q4TA 5KSWB 2OKCA 1QTIA 4S35A 1X42A 1Z37A 3EGDB 2G1AA 5C81A 3ND6A 1N9GA 2I99A 3BORA 1I9GA 4QVKA 2WJIA 1S2LA 2FW6A 4YJGB 3T4UA 2JLXA 3DONA 1XRQA 3E9CA 3GLVA 3T9BA 5HCNA 2HU7A 4PSDA 4C0LA 4JT9A 1YA4A 3IUQA 2H4YA 1OXTA 1ZD1A 4BV8A 2NZJA 2ZYUX 4KI0A 2D00A 3FKQA 2CNNA 3INRA 4KH0A 1UDAA 4FW8A 3FZYA 4LRTB 1N2CA 4GMGA 4F9FA 5GTDA 3C39A 4B8YA 1ES9A 2P9QA 3P0JA 3RKRA 3OZCA 3W5IA 2EJUA 3SC3A 4H3HB 1CULC 4JGGA 4MQ5A 2FSHA 5BQFA 1JDNA 1SO8A 1HG1A 5I45A 2Z04A 3Q8LA 1JFFB 2VXCA 1DBVO 2AKAB 1NI3A 3HJAA 4OQEA 4QT0A 5TPZA 3T95A 3UAYA 1R1DA 4B7UA 3RAJA 2I91A 4TSFA 1KZGB 3K8QA 1QONA 2BFOA 1X1AA 3DZ8A 1BG6A 3F6SA 3H04A 4V3BA 3SIRA 1EUDA 5FIUA 4R9VA 3GRAA 2OK8A 5B4TA 4P53A 4HEQA 2YRXA 1P1FA 4L5AA 5GV7A 1BDHA 1YAJA 3SZLA 4MSUA 3ZDZB 3D5QA 3GIWA 4QFBA 3LHIA 1TW2A 4EY7A 2Q50A 3KS9A 5JRDS 4DF3A 1OXMA 1W34A 1H2ZA 5CNIA 2WWIA 1AKRA 4AXXA 2GZRA 5MN6A 2OV6A 1CP3A 1NF3A 3ZXXA 5EOVA 2J67A 2GN0A 1B1AA 5CFQA 1MW9X 1M7BA 4QXOA 3U2QA 5J2TB 2ZR7A 1XTIA 4W9RA 2ZTMA 2C1XA 1DTSA 1JQKA 1K27A 3K4QA 4WKBA 5LDHA 4OU4A 2PL1A 4IYJA 2AW3A 3R9KA 1K75A 1N1EA 2ZSKA 3TZKA 1H6BA 4P38A 3UATA 1PWXA 3WHIA 1KNXA 1NQ5A 4LE2A 4NOMA 4IHQA 4MKRA 4CKBA 3RUDA 3Q3IA 1HQCA 3PUWA 3QOWA 1E1YA 4R0NA 2L2QA 4X71A 3ELWA 1XDDA 1MVNA 4EZEA 2WI8A 3ZTYA 3THWB 3T4XA 3VX4A 1RWKA 2Y6VA 4G01B 1FXSA 4BB6A 3U5TA 1X1EA 1E79D 2FB9A 3LY7A 1T3SA 3F1KA 3WZLA 5EPUA 2C92A 4ZI5A 2X0JA 4H77A 1T0PA 4FQ7A 4DDWA 3T5GA 1IBMB 2QRNA 1NXWA 2EC5A 1U1DA 1R3UA 2PLWA 2GXQA 2V7BA 1J49A 5JLAA 1UPUA 4OMDA 4IDOA 2G5TA 3VYUB 3HE3A 1XJQA 5HCIA 4IJKA 1MFPA 4YONB 2E37A 3H1PA 4LHEA 4RIHA 4DW8A 3BF8A 2QIPA 3IAUA 1XEXB 3L1JA 1N5KA 2FWNA 1UDWA 1D4FA 1K89A 4G25A 3AJDA 1ZMTA 1F2TA 4RD0A 2OAGA 4EITA 4DQXA 1R5OA 7MDHA 4ARUA 4X65B 2AFHE 2VPWA 3E9EA 2ZR9A 2A5DA 4URZR 2YHBA 1U1FA 4XB1A 3RFVA 5LIPA 4PTLA 2F8LA 4JOCA 5THQA 4BHTA 3CEMA 1XEFA 3HBMA 4GP6A 4DIBA 3W5UA 2BHTA 5HNKA 4P7BA 4AW9A 5BW5A 2B21A 1XG5A 2CXTA 1V7ZA 2WQZA 3FLBA 4R9NA 1XF1A 4OHPA 5A4KA 4U2KA 4NAHA 4DWOA 1X1BA 5IUKC 5KYWB 1M6HA 1M1ZA 2DQYA 1XQ9A 3CUEF 1A4RA 4KGDA 4EO7A 2FEXA 4BNYA 2PGLA 1JNYA 3I1YA 5DJ5A 3S5JA 3UUEA 5KOYA 4HQLA 4L16A 4C78A 5K6RA 4TTVA 3H11A 1KH2A 5K6AC 4HG2A 1Z0JA 3X2SA 2ETVA 3OIVA 1B14A 1D09A 3WB0A 2H11A 4N7JA 1I7NA 1QQ5A 2WSBA 3ADBA 5EUMA 4G6ZA 1X3LA 2CNDA 4M60A 1JLLB 2X0IA 1IK4A 3FCSB 3IR5A 1O6BA 1XTUA 2FR8A 2BT4A 3FNGA 3CNHA 3SSAA 2O23A 4JKYA 1ECFA 1M67A 3WQBA 3OE4A 1PL0A 3PXCX 4EYKA 1HF3A 1PQYA 1Z8HA 3QVVA 2F7SA 1CLUA 3QTBA 3R0IA 3GFFA 4XVRA 1YFKA 3FNBA 5EJGA 2O2IA 3NHSA 2PS9A 5BRNA 1I9CA 2JGDB 2VPIA 3TVYA 4E4YA 4MLCA 1P2VA 3N2ZB 4RMNA 4U8GA 1N1MA 1QWOA 4M87A 4NG4A 4PCUA 3TSAA 1C2TA 3WYCA 1FP7A 3ZIAD 4UXHA 1DUIA 2P2GA 3FDZA 3RSGA 3I6ZA 2MU1A 3Q5EA 1PNQA 5CM2Z 2Q5HA 3GFRA 1ZINA 3KSRA 4I81A 1SIOA 3M1LA 3V7NA 2UUOA 2O3RA 3UW1A 2CDNA 4F3RA 5EGNA 3H9EO 2X4GA 4RVCA 1O97D 1PT8A 3GNSA 2FA9A 2SKEA 4F8YA 2DLDA 3O8DA 1WHTA 4PZUA 4RK0A 5E9JA 2P6UA 1HDOA 1UMCA 1G6KA 2H51A 3I3SR 1SOMA 5K8VA 1KI4A 1JHPA 3N6XA 2XB4A 1XKLA 2FK8A 4NJMB 3TFOA 4W1SA 4I55B 2GBPA 1MENA 2Z3ZA 4LRSB 4JB0A 5LP1A 3MWDB 5KX5F 2V7EA 5KZMB 3F46A 4ZVPA 4CQMB 3LPDA 3MG9A 2AMLA 5JSKA 1SU7A 3ROZA 1JDZA 2X8JA 1OD6A 2E55A 1KK2A 3EIEA 3FA2A 4I1YA 4GI3A 3KUXA 1E1DA 4BP8A 4Y2HA 5KSYA 2W6JA 4CN9A 1G6OA 2I0FA 5EVJA 4BNHA 2WABA 4KVFA 1W5AA 5JDCA 3QBVA 4PANA 3CVJA 3LF2A 1NVTA 1T8SA 4ZCPA 4DXHA 1GYQA 3GPIA 4B3IA 1M1UA 3LDAA 2C8LA 3B7WA 1AQNA 4LOHA 3BMNB 1Z39A 8ADHA 1ZR4A 3UUWA 1C8LA 4PYIA 5LP6C 2UXDB 2OMEA 4YAFA 1YJ8A 2DLCX 1PR6A 1NWCA 4MQ6A 2I6SA 4JK3A 3TLGB 4AUKA 2W11A 2VSQA 3LA8A 1Z4MA 3ZOZA 3R3JA 3WG9A 1ITZA 1DC4A 1CUIA 4JOSA 3IVRA 1T15A 1KQGA 1ZOOA 4J94A 3NEYA 4HXFB 2QS9A 3D1JA 4ZVSA 1ARZA 5CLLA 1NONA 3RVDA 2JIDA 2IE8A 3BSYA 5F5XA 3WGUA 1Z8FA 2H1OA 2YIMA 4NL4H 3EIXA 3GRFA 3PHLA 3W8FA 2YASA 1IWBB 3C4VA 1U1CA 3DAYA 4AJKA 4EKIA 4FMCF 2DT5A 4BO1A 2F9LA 5KOJA 2JFZA 3A6GA 4M1WA 2IBSA 4CIVA 3MT0A 1J2RA 4P58A 2IUEA 3N8KA 4B3TB 4PSVA 5EKDA 2D5BA 2XWSA 1J09A 2WSLA 3MWKA 4RA9A 2XV1A 3B7GA 3GGPA 1A69A 4X24A 2GARA 1LSOA 4UHEA 5DHQA 4G97A 4NESA 5IN5A 3CRRA 3KJQA 1WCWA 2ASEA 4UMEA 1A9ZA 4QM6A 3OFKA 5ES3A 2V8OA 4ENVA 2QRVA 1W5SA 2CLDX 4O63O 4QOEA 3DEFA 1KDZA 3BCUA 3WNCA 2FK7A 3KZVA 4KSYA 1EVLA 3DEKA 2GDJA 2FETA 4K26A 3U7GA 3FNHA 3ZNPA 5ICSA 2FN4A 3K6SB 1JIKA 1PX0A 1ZM7A 1ZW6A 3B5IA 4Z86A 2C3OA 3LUKA 2REBA 5EUQB 4AY4A 1ZJ4A 4BC0A 1B76A 2GF2A 3HMQA 3A9UA 3KR0A 3OSUA 4M9QA 1PFYA 2XHZA 3FWNA 4BQQA 2OT3B 2VAVA 4I1OA 4UQOA 1JWLA 2BTEA 4L85A 1Q11A 1MVOA 1V0JA 4BKPA 4JXZA 3R8FA 1ZG3A 3I4CA 5JBNA 5MGNA 10MHA 2ZIXA 1R0WA 4O2LA 5B58C 1WETA 1Q0LA 5EP4A 3JRNA 1KY5A 2EFYA 2IK8A 2O2DA 5EG5A 4Z9FA 4EHLA 4XSVA 1XJCA 4FCWA 3RW9A 1E1NA 1IOWA 4HLUC 4NPHA 4KAAA 3VPDA 2J7PD 4KQXA 3EQ7A 4B84A 1ZM4A 2V7QA 4EI9A 2OOSA 2YWGA 1NXSA 3JARB 3MOSA 4PPNA 2ZB3A 3BEOA 4MUHA 1N1GA 1W96A 2AUNA 4XARA 5B3LA 2JANA 1IHDA 1T9GS 2IEIA 1OCEA 1XVVA 3H5RA 5JXIA 1E2LA 1ZBQA 2YICA 3GCZA 2PSSA 4Q9KA 3VTKA 1V4VA 3R3WA 4ZVKA 5LQKA 2ZBQA 1YTUA 4M21A 4ENSA 1OLSB 1ZX1A 3IP6A 4ZO8A 4D9HA 1BC5A 3E3MA 3NBQA 1V45E 2O2HA 4G0ZA 3KWJA 4HAXA 2VQFB 1Y8ZA 2BD0A 2R60A 2X9QA 2G40A 2ZIFA 4FFNA 3I5UA 1IBSA 2I80A 3M83A 4Y6OA 3CW8X 5IABA 4DM4A 1D04A 1NT4A 1XVTA 2D2IA 3M3DA 3R7BA 2W7TA 4XWWA 3WWDA 3NC0C 4Q9AA 1NM5C 1KK0A 2IX9A 2DF8A 4YJ3B 2Y76A 3ZWDA 1PTKA 3GMTA 3OP1A 4GPEA 1N8TA 3JQ7B 3KXIA 1JIQA 3VSBA 3GLQA 2XVXA 4O6VA 4EI8A 4CI0B 3IOBA 3ZDFA 4YP9A 1T1EA 4HH1A 5ELXA 3W6OA 1EVQA 3I37X 1RKXA 1IHPA 2FQWA 4CM6A 1E7RA 4BKMA 1FA9A 1MC1A 3DDNA 3IPCA 2OGUA 4PLPA 3PX7A 1SXGA 3QEMB 4MR7B 1Z22A 1PS0A 1YJXA 2VPYA 4C2BA 3SP1A 1A7KA 1GGHA 2C3MA 3AVWA 1R4NA 2YN2A 3ABSB 1Y63A 4YCAA 4D0SA 2I03A 3OF3A 5B6JA 4MS3B 4GUDA 1GDHA 2WD9A 3FYSA 5FPTA 1QTRA 3WWYA 4Q3LA 1K8RA 4QASA 1WY7A 2WWFA 4Y2TA 2ORVA 5F64A 1ZD2P 1Z18A 1U8FO 2V5UA 4N54A 3ZZ1A 4ZTUB 4B2PA 1YNSA 2BGNA 1DKOA 4KR2A 2V58A 4WLNA 1WXHA 4EECA 3HDQA 3OZGA 1CXZA 4C6HA 3CWQA 1CIVA 5FUYA 1TO2E 1OFTA 2I7CA 3HA7A 5B53A 4BDTA 2VLBA 2ZUBA 3GFPA 4DG8A 4AUEA 2Q9BA 3WYBA 3DV0B 4IX9A 3K70C 3CLUD 5C34B 4ZO6A 2I3AA 4G85A 4ARZA 1IQRA 2C0PA 2OXTA 3W5HA 4F6RB 2Q7XA 2YMPA 3DTVD 4K2AA 2VUTA 3H0EA 1FP2A 3P27A 3VMMA 4QPZA 2A0YA 4RDCA 2WUEA 3WLPA 1UPBA 3JALB 5JALA 1JBEA 3CKMA 3IJRA 1LDGA 3L8FA 1CYDA 3MUEA 3QKIA 2XLCA 1E9VA 1U7ZA 3KWMA 4J49A 1M2OB 3BH0A 3EASA 4FX2A 5DNWA 1H0KA 1U3TA 4L15A 5DEOA 1E2DA 4ZAYA 3SC6A 1XDWA 4BZWA 3D7RA 5FP0A 5KYYA 2Z6UA 3B5EA 5BSGA 2BV3A 2FPIB 1ZH4A 3NEJA 2P5TB 1HE4A 4U7DA 3NDRA 4ZJPA 5BOSA 3VH3A 4E30A 2I29A 2IYTA 5HUQA 2CFSA 4D74A 1UBFA 4BFLA 3O6VA 1GZ3A 1WSAA 2NXWA 2Y66A 3TX2A 3Q3JB 5CLFA 2JDIA 4TV9A 5AVQA 1B93A 5GADl 3LWBA 4B5LA 5HZHA 2UU9B 3M4YA 5AWFC 3TZEA 2WWYA 3WGHA 1N5DA 3LLMA 3DBRB 4E13A 5L4NA 1HC7A 5KYVA 2P62A 3L0CA 2WWTA 3F6EX 5AJXA 1N5JA 1E0SA 5CA1A 4FMPA 4MKXA 5DE3A 4YUXA 3EC1A 1FMJA 1LW7A 4I8XA 5KJ6A 3H0CA 2W6JD 3PXUA 1YCGA 2IIVA 4LCEA 2P6RA 1L4NA 1ORTA 2GJAA 5TLSA 1SEVA 1UF9A 5JHGB 2J85A 3DJYA 1V6SA 1E3QA 1GUAA 3LUPA 4XGKA 1BXKA 4JELA 4B4OA 4QUKA 1EPUA 1KZ1A 4YC7A 1IQPA 5B6IA 3BGOS 1QMPA 1NL3A 2BSXA 2J41A 3U48A 4HDMB 3TWOA 2QVZX 1LNQA 3W77A 5F1KA 4F9EA 4NMXB 4JUIA 4CM4A 2FP4A 1UDBA 4IZ6A 2O2EA 1WKBA 1P62B 3I2IA 5DM2A 3PA6A 1N6PA 2IUTA 4D9CA 5EZSA 1ENOA 1CUVA 2BF4A 3T0GA 1OBVA 2DULA 4YJDA 3TQTA 1G3UA 2CC2A 3V8RA 2ZRMA 4PC6A 4IILA 4X91A 3MRTA 3SX4A 5HMMA 5SICE 1JEDA 3ASYA 3ZC3A 3N8IA 4IG9A 3L8ZA 1MB0A 4DLAA 3PHBE 2I22A 4ZVMA 3O1LA 1MAAA 4OK3A 5I9NA 2Q0QA 1BA2A 1L7XA 1OUMA 2X0KA 4RPKA 5L8VA 2R62A 3UAGA 4BLWA 4QBKA 1BVYF 3GJXC 5H82A 2YWFA 1EFCA 3T41A 4Z0PA 1HDYA 2WTXA 1H6CA 1RTKA 1ZNWA 4LIPD 1GTL1 4ITRC 3T7AA 1LA2A 1FTSA 5G4LA 5LMUB 2FMHA 1ENYA 3GRUA 4DLNA 3R0XA 3QM1A 2XNDD 4I1SA 5AOCA 5A06A 3ACCA 4QOJA 1AN0A 3K1YA 1OREA 1J39A 5M34A 1I94B 3LRPA 4UDOA 4HQ0A 4I7EA 2YINC 3DE2X 3OUZA 4F12A