2ZROA

Msreca adp form iv
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
329
structure length
323
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
molecule keywords Protein recA
molecule tags Hydrolase
source organism Mycobacterium smegmatis str. mc2 155
total genus 93
structure length 323
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zroA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zroA01
3V9PA 3GEEA 4ZDKA 2K5UA 2ANCA 4OL0A 2GZHA 3K70D 4MKHA 1U2RA 3I73A 1IXZA 3THWA 4AKIA 4PTLA 4Q03A 5B2ZA 3UWOA 1NN5A 2IWHA 1AS2A 2C8VA 4IW3B 4Q9JA 1YRBA 3TLXA 2QGZA 1J90A 5HCNA 2H1LA 3RYTC 2HYDA 1Z6XA 1P5ZB 1BYUA 1FQKA 3EA0A 2ODBA 1XZPA 4UNQA 3U7FB 3SQWA 1JALA 3AP2A 3NIBA 4B3FX 1KY3A 3RRNA 5DN6A 5FBLB 3VR6A 1LV7A 1XWIA 1ZAKA 5SZIA 1GRNA 3TRFA 1COWD 3A58B 2WKPA 3K0AB 2IL1A 4EDHA 5TDHA 2F43B 1TX4B 3L43A 1SVLA 5DHAA 4EPTA 5JJKA 4AY2A 2DWPA 1NLYA 1MO6A 4NE2A 2VF8A 2Q3MA 3LXXA 3QG1A 3M4YA 5JI3E 3THXB 2RHMA 1UBFA 1N5JA 3K9NA 4RZXA 4EJSC 4ZDJA 1FUKA 1XB2A 1P9RA 3GCGA 5DI9A 1ZP6A 1A5TA 4OI4A 4IOJA 2GJ9A 1FQJA 1KMHB 1KOFA 1UADA 4MKGA 1P2VA 1E99A 2ZAOA 1FL9A 2GAOA 3P26A 1E0SA 1S0UA 1XEWY 1GKYA 1VIAA 2QPOA 3KUCA 3ZD7A 2B8TA 1DADA 2EVWX 3TAUA 3HR7A 1TUIA 4KLNA 5DSZA 4B44A 3MSXA 4Q4JB 4Q02A 2ZYVX 2E9SA 1VKJA 2ATVA 4HLQB 4C0KA 2Q21A 2BEKA 3VHXA 5K8UA 2DCUA 4TWZA 4JJKA 5JI2E 1I4TD 3FKSD 4N1AA 4HLCA 2QUZA 3CR7A 3QG5A 5EE5B 3THYB 2ZRDA 1VG0B 1Y3AA 4W9MC 4LJ9A 1KGDA 2ZSEA 4YLGA 4M2LA 5B58C 4JLMA 4ACBA 1CR2A 1NN3A 2WKRA 4JLDA 1XMIA 1AJEA 1S9DA 1Z08A 2JIZA 4OHWA 2N46A 1LW7A 2OV2A 4TYNA 4IJMA 2GK7A 3AVUA 3SJAA 1V5WA 1MO3A 4OK5A 3AVVA 4ZIRB 3L0OA 3T1OA 1WB9A 2W83A 1II9A 3KKQA 2V7QA 3O47A 3PJRA 1EG7A 1OFHA 1E2HA 3G0HA 1VG1A 5HCIA 1Z28A 4O2RA 4CT4B 1OFUX 3KB1A 4RY2A 3UWKA 4GMDA 3I92A 3KXKA 4BRUA 2V7QD 2P5SA 3N2IA 4D4KA 1E96A 5DYGA 4GFDA 3SU8A 2W58A 3CWZA 3UIEA 4JL5A 4FCTA 2VSFA 4EFNA 5C1BA 1J99A 3I61A 4WBSA 1KSGA 4L8GA 4E22A 2MSCB 4C0SA 3PVSA 2CL0X 1XCMA 1T5LA 2PX0A 5BW8A 1T8TA 1OIXA 4HATA 4PHHA 4TL8A 3EPHA 2D2FA 4TT3A 2BCGY 2A3RA 2C9YA 1AQUA 4KSBA 3OHMA 1YVDA 2VBCA 1HE1C 4LBYA 5JWRA 2DWOA 2KBFA 4HB4A 5L8VA 1HA3A 2F9LA 1W4RA 2FFBA 3AVPA 2FEMA 4F93B 4TLEA 3D31A 4P31A 4PC2A 1KYIA 5LB2A 2DFTA 1CRPA 5SZHB 5BN5A 4FWIB 1WF3A 3A4NA 3NBYC 2QRZA 3CRQA 4X8MA 5GADl 1JPJA 2E87A 1W1WA 5FL3A 4Y0AA 1QG2A 3IEUA 4OHVA 1CRQA 4RCYA 5F98A 4UKDA 1Z47A 4R9UC 1M8PA 2RB4A 3FHOA 2PLRA 4OYHA 2F1RA 1ANKA 2CL7X 4US1R 1HT1E 3LLMA 4V0LA 4IKEA 1XEFA 1RJ9A 3MGCA 2QROA 2J0SA 5J4VA 4LV6A 4ON9A 2EFGA 4F92B 3ZLJA 1UFQA 4E03A 1X8JA 1G291 5E7JA 1XMVA 2IEZA 3PUXA 3A1WA 1QG4A 4E5UA 2J7KA 3CH5A 5EXTA 2WAXA 4RD1A 3BXZA 4MYHA 1HEIA 3AUXA 1R5OA 2RGXA 4DHEA 3CR8A 4II7A 2VHJA 4E09A 1XCGB 1ZUNB 1BH2A 3LX8A 4Q4LA 1W36B 3KTAB 4ESVA 2AK3A 2OXRA 4V0MA 1G6OA 2PL3A 4B34A 2OCYC 3JZAA 2G1JA 1BIFA 2J46A 2YJTD 3IBYA 4B71A 4NDZA 3WYAA 3G5UA 1HH4A 3M1IA 4C0BA 2NMVA 5JS8A 1Z07A 1XEWX 3M0EA 1C4OA 3B1WA 5J5CA 3NEYA 3DHWC 2EYUA 4IRUB 3VX3A 4O2LA 4CGZA 4HUQB 3RANA 2AKAB 2OEPA 1JI0A 3ZVRA 4ZI2A 2AD1A 1S1CA 2J0UA 3KJHA 2D4HA 4JJZA 4DUGA 4HLDA 3FGNA 2QM8A 1VYVA 2BBTA 2OHFA 4AURA 3Q5EA 4DCSA 1P2TA 3OEEA 5TY0A 5FI0B 2NO0A 1TL7C 3HPQA 3DO6A 4GOJA 4QHYA 4HLUA 2J0VA 1AGRA 4DUGD 3WBJA 4V03A 4YXWA 1IN4A 4Q4HA 2BHRA 4N0EA 3QXXA 2GJKA 4JLJA 4BFYA 3QKUA 3QXHA 3W8RA 5FFMA 1SKYE 3SE0A 4HAVA 3T1VA 5IT5A 2R6AA 2XSZA 4V0KA 2ZTSA 5FOWA 3WP1B 4C0QC 2QP9X 2WPDD 2WV9A 1DPFA 2QN6A 1UJ2A 1ESMA 3IIJA 2GJ8A 4NONA 3MJHA 1ZNZA 4KITB 5L3RA 4B3GA 4C2TA 2IF2A 2G77B 1AS3A 1KI6A 1NLFA 3GLHE 2PT7A 2G9NA 1JR6A 2C77A 2QORA 4O25A 2XJ9A 1Z22A 3SJCA 1VYTA 2ZI7A 3TNFA 1U8ZA 1X86B 4IDHA 4TL9A 1Z8FA 3DL0A 1U99A 4A8JB 1T3HA 2ORVA 2B21A 1D9XA 3IHLA 3GJ7A 2GZDA 3HU3A 1LY1A 2OCAA 2PZGA 3LX5A 3MWYW 2O8FB 3VNVA 4P33A 5F9FA 4LHVA 3UMRA 4G01B 4C7OB 1F5NA 2PCJA 3ZZ0A 1YR7A 1SXJC 1SKQA 2OSBA 2WICA 1KY2A 2KB0A 3FMFA 2BDTA 3LLUA 1TF7A 4Q47A 1IY2A 3QIAA 1X1SA 1QHHB 3R7WA 3VR4A 2BBSA 4DLXA 1VCNA 3FMOB 4JMPA 1Q1EA 3QSYA 2P3SA 3VU9B 3W6OA 4BRWA 2XITA 4PR0A 4YMTA 1KKLA 2R6CA 2CHQA 2FSIA 1TNDA 2OUKA 1KDTA 4C30A 2NPFA 1DAIA 3EAQA 5FBWB 5FH9A 2RGNA 3BGWA 3RS3A 2WM9B 5FL7A 4CEJA 1MOZA 5D3MB 2VYFA 1I2MA 2GHIA 5H1YA 3TW4A 2OM2A 2KI5A 3IIMA 2W00A 1QVRA 3E5HA 1CU1A 1QZXA 3P32A 1MRSA 1RKBA 3R9IA 4C0AC 4Q9HA 4F91B 4EIWA 1F2TA 1VG9B 5HE9A 1F2UB 3ZS8A 2NOAA 2ORIA 1SKYB 1VCIA 1OXXK 3ECCA 3OAAA 3LWNA 1DAMA 1NY6A 2Q3FA 3RWOA 5DIFA 1T4GA 4BLQA 1DARA 4B43A 1I4LD 1Z63A 1W49A 4LK2A 1OJLA 4LPKA 4U5XA 2HT6A 2VP9A 2OE2A 3C41J 1OXVA 3QOFA 3SNHA 4HAYA 4GPTA 4TMKA 5EZ6B 1Z2CA 1GITA 2XTMA 3GJ4A 2CK3A 1E32A 3OAAD 4WZ6A 3MRSA 3GLHB 2Z83A 221PA 4ARZB 1UF9A 3PCRB 4R2IA 4C9BA 2VP6A 3BD9A 3I32A 1QHSA 1F60A 4UNSA 3GEIA 3REGA 4AG6A 1GL7A 2IYVA 5EXXA 3K8YA 4FXPA 4MGIR 4Q7JB 1Q1ZA 3D6TB 3VQTA 3CPEA 4Q4AA 1OFIA 3Q3JB 2W2TA 1BOFA 4FMDB 5FTKA 4D2IA 2JLRA 3PQCA 4I1OA 4CEHA 5JWHA 4B75A 4ZCLA 4TMVA 2X8AA 3RWMB 4B33A 2F1IA 5EXPA 1KO5A 1JR3A 2PZFA 1GILA 4I1SA 3SFZA 3ZQJA 2AX4A 4M1TA 4D81A 4DSOA 2QI9C 5B57C 2NPIA 1E2QA 1IM2A 5KO2A 2P6NA 3O8BA 4NL4H 3K70C 1BO6A 2PH1A 3ND8A 2H8KA 5KUTA 1ZMXA 3TIFA 1UM8A 2IUTA 1JEEA 3A37A 3SEAA 4XOIA 4GP6A 2WJYA 1JXMA 1NG9A 2VP4A 3EPLA 5G53C 1E9EA 4UJ5A 1OXTA 4ZDWA 3THWB 2WJVA 1P3JA 1NVVQ 1Z0IA 1XNJA 4TQAA 2FPLA 1ELOA 2ZRCA 1GNPA 3WMEA 1P73A 3D8BA 4BEJA 4RCZA 1OFTA 1UDXA 5K8LA 2GESA 3UKDA 5DGXA 2IX3A 1KDRA 2FN4A 5J4YA 1YZTA 1CEEA 2O5VA 3I3SR 3I8XA 3TR5A 4EPWA 3EZ7A 3EX7C 1FNNA 3ZZTA 1P60A 2ZE8A 5FPTA 2ZANA 1UKYA 5AJVB 4Q1FA 4OKSA 1RC8A 1DELA 4NHOA 2P0EA 4BZXA 4R71A 2ZITA 1G3MA 4D4JA 5JEDA 4KYIB 2GXAA 2V55B 1W36D 2EFEB 2ZI4A 1E4VA 5GVSA 2J87A 3LBNA 2ZU6A 5FPSA 4DEYA 3TSWA 3LVQE 3LW7A 2XAUA 1S96A 3W90A 3U4QA 5FOXA 1DAEA 4LWZA 2O0KA 3TVDA 4BFUA 1H8ED 2R62A 4HZUA 3F8TA 1FX0A 4KHZA 2J1LA 2HJVA 1W0KD 1QF9A 1S3GA 3F5FA 5LB4A 5P21A 1EFRD 3WHLA 2ZSBA 2ZRJA 2QQ0A 1HYQA 3X2SA 3GEHA 3K1JA 4US0R 3TBKA 2V1UA 1GL9B 2V9PA 4NU0A 1WE2A 3GLIA 2CNWA 3ZD6A 2QBYA 2AWOA 3FFBA 4M1OA 4KXFB 2QU8A 2ZRBA 1AS0A 3B1XA 3VKGA 2HXSA 2I3BA 4BLSA 1HURA 2C5LA 4TZ6A 2FNAA 2IS2A 2F1HA 4HYYA 2WMNB 3AVTA 1XDBA 4D0LB 1RRCA 1OYYA 2V1XA 3MFYA 4D6PA 3AGQA 2EWWA 1KI3A 4LBZA 4QBIA 2WWGA 2CCKA 4DT1A 3KQLA 4PHTA 2XX3A 2ZJBA 2PJRA 3LQQA 1N6HA 1FTNA 1EXMA 1K5DA 1W4BA 4V0OA 1H8HD 4GDFA 4DCTA 1FFHA 4B6FA 1IAQA 3ZZUA 2B92A 2VRWA 2MSEB 5LDDC 1P6XA 3PEUA 2WSSA 2QAGA 5JCZA 4D25A 2XXAB 3AEZA 2D7CA 4Q5IA 5F3WB 5AJZA 3WHKA 2REBA 1ZCBA 3E2IA 3KXLA 4DRZA 1E1QD 2R8RA 5CM8B 3I62A 1AKYA 4DCNA 4V0ME 2J41A 2FA9A 4MUBA 1KNQA 4F38A 3AVOA 4JVNA 4Q1AA 2LKCA 1TQ4A 2ZRHA 3ZJYA 5KU1A 2FGJA 3AP3A 3LH5A 4A2PA 4PPNA 2WWXA 1I4DD 2BV3A 2P5TB 3AH8A 5H8WA 4Z51A 3ETLA 4F4JA 3BB3A 2WJJA 3ADBA 1JPNA 1U9IC 4PZZA 3M6AA 3KJGA 2YV5A 1QHHA 3ZDQA 4KU4A 2FWRA 1ZM2A 3UATA 3WXMA 2BM1A 5J4HA 5K8IA 3LRPA 3L0IB 3GJ0A 1JQJC 4Q01A 3EIQA 3TVTA 4YC7A 3QENA 3ASZA 2ZJYA 1RFLA 2CLCX 4LV5B 1VCMA 4BZPA 5G40A 1NVVR 2XZPA 3CZQA 1FUUA 3FDIA 3A1VA 1R6BX 1E94E 1BS1A 2FSGA 3OIVA 4DVGA 2A5YB 5D3MA 1XRJA 1VTKA 2QEQA 4G5OA 4WAUA 4B76A 4IFEA 2VEDA 2GETA 3RSOA 2GCOA 1FZQA 4ZV4A 3VKWA 2ZRFA 3NWJA 4FCVA 2WTUA 4AK9A 1O87A 3SS8A 2YWHA 3RS0A 4DB4A 1UEIA 5HKKA 5LD2C 4FN5A 4PXAA 2CE2X 2VIIA 2YOFA 5D3QA 1WCV1 4ACAA 4LGMA 1RJ9B 3OF5A 1YZQA 4XD7A 3SOPA 4IFBA 1U94A 2LCFA 1NMXA 1U8YA 2FOLA 5A4JA 4URXR 5H68A 1R5BA 4D4LA 521PA 4PC6A 1AK2A 4HSEA 1M7BA 1NJGA 1UDWA 1TEVA 2J3EA 2BIFA 1IQPA 3WMGA 4TTRA 2VHQA 3BORA 4PPQA 3C7KA 3H0KA 2IXGA 3H86A 3KQHA 4WW0A 2OLJA 2Q9AA 2DFKB 5TARA 2GF0A 3HYRA 3NDBB 1JECA 2J9RA 4DZZA 1IXSB 1WBBA 4KODA 5EE3A 2NO7A 1DE0A 2W2XA 5DISB 4PO9A 1T3SA 4K81B 4DLZA 3K0CA 3D7MA 2VO1A 2QL6A 4TMTA 1D2EA 2AK2A 4HB3A 1W5TA 4O0MA 3O8CA 1TUEA 5F9HA 1OKKD 2X1VA 5EE0A 1ETUA 2Q0HA 3EWAA 1DTSA 5JSZA 3LW8A 2PBRA 2ZJAA 3C14C 4FMBB 3ZYCA 4MYUA 1FNMA 3SQXA 1IY0A 1RRGA 2J0UB 1SVOA 2FPKA 3EXAA 1N5KA 2GEUA 4B32A 2GBLC 2A7QA 1RZ3A 1AN0A 3RS7A 2ZSFA 1DS6A 4HAXA 1FMJA 3EZ6A 4JLOA 3LXRA 4I99A 2ZRNA 1PZNA 4H1UA 1XZQA 1GRRA 3I72A 4AG5A 1GL6A 4MRNA 4OHYA 1FMLA 2UKDA 1XU4A 2C2HA 2A9KA 3HU1A 1DAGA 4Q4HB 1XXHA 2JLSA 4PHFA 1E3MA 3P20A 4TMWA 3W9YA 3KQUA 3U61B 3B2EA 4TSFA 3SFVA 2QZ4A 1E9FA 1XD8A 1GRQA 2V54A 3FVQA 1Z29A 1GIAA 1PJRA 1YZUA 4HDCA 2ZRIA 5CK5A 3RRMA 5J47A 3K0SA 4MITA 3KKMA 1A1VA 5FOVA 1ZIOA 2Q3HA 3SZRA 3P4YA 4OHZA 5BYJA 1RYHA 5DN6D 4JIMA 3NXSA 2B7BA 2FU5C 2BVNA 1KI9A 1SHZA 2JAQA 3HR8A 2RGGA 2O8DB 4ESHA 4BQSA 1KI6B 2O8EA 2P6UA 3IQXA 2PEYA 4POAA 1KI4A 1Q21A 3A1SA 1L4YA 2OT3B 5DLQC 2YC4C 4DBLC 3DEFA 1TAGA 3DM9B 3H84A 4Z1MA 2ZPTX 5CK4A 3LO5A 1DOAA 4TL6A 4AIIA 3DM5A 3L2OB 2W0SA 2ZI3A 4YMSA 3OFNA 2CCJA 3E70C 1QDEA 3X1YA 1P4SA 4EKDA 3B5JA 2GKSA 3RS5A 4A0GA 4GP7A 1U0HC 2ZJ5A 1JR3E 1NIPA 1ZM3A 4KAXA 3THOA 3I5XA 1G6HA 3HYTA 3PUWA 1XTSA 5FBQB 2AKYA 1R0XA 1G5TA 1Z2AA 3A6PC 4I81A 3R9XA 3IPXA 3OFND 3K9GA 1O3YA 1P9WA 3CIOA 1OIWA 3KKPA 3NKVA 3NH9A 2ORWA 3FMPB 4OK6A 2NG1A 4KBGA 4WXPA 4ZCMA 3EW9A 4DSTA 3JVUA 3R7WB 3O8DA 2BJWA 3ZGXA 2VLIA 3B9PA 3IO5A 4QG7A 5AJWA 1E2DA 4BGDA 3KX2A 1EGAA 1MKYA 1ZCAA 2UZIR 4LHWA 3X1ZA 4MYTA 1XPOA 2PMKA 4KYUA 5IRCD 2DYKA 1A2KC 3OZXA 2XTNA 3R8FA 1KJYA 2ZJ2A 1GKUB 2XXAA 3UG7A 4MRRA 1SQ5A 1TEXA 3DDCA 3U2QA 2AXNA 2F6RA 2JIZD 3GLFA 2O8CA 3B1ZA 4UXIA 3TKLA 3U6BA 4CEJB 5FOUA 2OXCA 2BMFA 4MRVA 1DBSA 2AR7A 2P67A 4G3XA 2GVZC 1G21E 2EYQA 3T06B 2GK6A 1N2CE 4Q21A 2ZEJA 3Q7PA 4I4LA 2WAYA 1DAHA 3AKCA 1MV5A 3SBEA 3RNLA 1D8TA 1F2TB 1NJFA 2ZSDA 5AJXA 1E2IA 2CBZA 2ONKA 3QXJA 4GL2A 2F55A 4TLCA 2ZR0A 3PENA 2FE4A 4M21A 3U7EB 2WBLC 1C1YA 5LBIA 1JAIA 2R65A 2CE7A 121PA 2MMCA 3X1DA 2L0XA 3QKSA 2BKUA 1KSHA 4G5QA 3RC3A 1JJVA 3KQKA 1KSJA 1L2TA 1OHHA 2JLVA 2O8BA 3ZQ6A 4WZAE 2BOVA 2IUSA 3HWSA 2ODNA 2GA8A 1AQYA 1JXOA 1HY3A 1G9XA 4QJ4A 2BMDA 3B85A 1ZUIA 4JVLA 4R2HA 4TT3D 3NBFA 2C9OA 1MRNA 2GXSA 1G5PA 1EWRA 1T5IA 5CITA 2D7DA 4XSHA 3Q9LA 4FINA 4RD4A 3GLIE 4Q4AB 1J8MF 5IDVA 4DWJA 2EU8A 3LD9A 4FMCF 5AUQA 4BE7B 4CEHB 1SVMA 4CVNA 2JDIA 4MA4A 1UBGA 4QNMA 1KO8A 3NEJA 4YDHB 3CWQA 2N42A 4ASUA 5C46F 2EFDB 4XVRA 1NY5A 1KDOA 3KZ1E 2FEOA 4PQYA 2JDID 3CNLA 4XIGS 1II8A 4ZDIA 1NSTA 1Z0JA 3B13B 1QHYA 3C4JA 4NBSA 2OFOA 3VNUA 1BKDR 1E2NA 3QF4B 4HI0E 1CJKC 1R4AA 4Y0VA 3DKVA 4E07A 3GFOA 3DMNA 1L8QA 5L3QA 2FFAA 5AWFC 1NL3A 4JSYA 3BB4A 3S1AA 4JVSB 2ONJA 1E98A 3MG9A 1OH7A 1KI2A 3BC1A 4BFWA 4IDOA 1Z6YA 4DLTA 3N2EA 1F48A 3EIEA 4LJ7A 2RGAA 3K09C 3PXGA 5C18A 2ZR7A 5KDOA 3TR0A 2ZVPX 4BFXA 1B23P 2VH5R 3QVUA 1UKVY 5JEEA 2IS4A 3B1VA 1XJCA 5EE1A 5FBRB 4KV9A 2ERYA 5JS7A 5J40A 5EJEA 3U60B 1EFCA 2DWQA 5FUWA 1W36C 1CXZA 4TMZA 3WYFA 4LV8B 1P7CA 5KSPA 2DBYA 2IA5A 2QSYA 2UVQA 4A1FA 1N6PA 5KPJA 2QT1A 4CW7A 2HF8A 1M74A 4URZR 2BMEA 4RKEA 1KK3A 5DO9A 5AR1A 2FSFA 4PO8A 5IF9A 2ZRLA 4S35A 4U7DA 1A4RA 3FHTA 4LJ5A 3U4QB 5KDLA 1CJTC 1N6RA 2XZOA 2GCNA 4B35A 2AL7A 3IILA 4LJAA 4JYCA 4HZUB 4JL8A 4QHSA 4QBHA 3BERA 3R8CA 3WRYC 1FX0B 1KMQA 1R0YA 1P72A 1CJMA 2QY9A 4JT2A 5FUYA 1UPTA 2JATA 4LY6A 3Q72A 2QPTA 3VR2A 4BUJA 2VTKA 4M9SA 1OH8A 5FOSA 1XP8A 2ZQ5A 3QPVA 1R7RA 3OEED 4A0HA 3ONWA 2ZJZA 2VSOA 1YHNA 4LX0A 3TK1A 1R8QA 1U90A 3GLIB 3ZIAA 2WWHA 2QBYB 1E9RA 8OHMA 2OO7A 1CKEA 3QNUA 4YXWD 1EX7A 3PEYA 1A82A 2IWRA 2V6JA 5EE9A 2F7SA 4LSGA 2IHBA 2R44A 1FOEB 3QVVA 4A4DA 1G3QA 3K0FA 4QKQA 1PV4A 2WOJA 1N25A 3TSOA 4WVFA 1G8FA 4ZPXA 1E2MA 3BBPA 3KJIA 3NHAA 2XSZD 4DT1B 2O8DA 4BLRA 1E69A 4RD3A 2ZR9A 5TV2A 2DR3A 4IOLA 5EP2A 3AKDA 3T1QA 5JRZA 4PHGA 3A36A 1KI1A 5BXQC 1W44A 3EPJA 2B6HA 1P2UA 2AWNA 3AKEA 3HJNA 3LQRA 3LV8A 3ND9A 4L9SA 2P6RA 1T8UA 2QAGB 5DHFA 5EXSA 1ZC4A 3DVLA 4Q18A 4EJSA 1CJVC 4HAUA 2LWIA 4A8JC 4P4UA 4DDWA 2J7PA 4G1UC 5A0FA 1NBMA 1DG3A 1JB1A 4L15A 4PC3A 2OESA 3W6PA 2ODEA 2W6JA 2W0MA 1HQYE 1QHNA 2GNOA 3QEJA 4LJ6A 4QM6A 5JZVA 3SBDA 4G5SA 5AK0A 1M1YE 1SZPA 4B3XA 2J7PD 3CZPA 5EP1A 3K9HA 4D80A 2H7VA 5TXGA 2SHKA 5C4MA 1G8HA 2JJ2A 2BKEA 1NMZA 1G8PA 3LAWA 3QBTA 1DAFA 1KO1A 4LI0A 4B6EA 3CX8A 1CTQA 3EIHA 4NH0A 2EFHB 2JJ1A 3PEVA 1U98A 3SYNA 2ASEA 1Z6GA 1E9DA 2IK8A 2KSQA 1U0LA 2F3RA 4DLVA 4A36A 4WZBE 1ESNA 4XWKA 5BN3A 3UPUA 5FTLA 5B30A 4L5BA 2J59A 2JJ1D 1XXHE 1VMAA 4M53A 3BFVA 1UKEA 3H4MA 3AGPA 3CPHA 2WIAA 1XTKA 1SVKA 3ASYA 4M0LA 5BN4A 2WWWA 1Z3IX 2GCOB 3IPYA 4KLZA 1M7HA 2LKDA 5FL7D 3EASA 3P1JA 3KJEA 1ZM4A 5KNCA 4PZLA 4LOAA 5TVKA 4V0NA 1PUIA 2J0QA 2ZS7A 4P0TA 1F3OA 4PPFA 4Q00A 2FG5A 2ECKA 1YKSA 2ZE6A 1G7TA 3CO5A 4M22A 3DKPA 4AC9A 2XTZA 5TMPA 1NN0A 2Q9CA 4MDFA 1OT3A 5CYPA 5GJCA 2A5JA 1AGPA 1GZSA 1ONBA 2YNMA 3EG5A 5FTJA 5KDDA 621PA 2QAJA 1FTSA 3QY0A 4PQFA 2ZS8A 1ZIPA 4DXAA 2XNDA 4JKIA 1R0ZA 1UKZA 1AZSC 1WRBA 3EC1A 4MGYR 1CR1A 1GNQA 5UKDA 4TLAA 1WXQA 1DG1G 1P62B 1TF2A 2IYWA 4BLOA 4DC9A 1JNYA 2CK3D 2QM7A 1VG8A 3QKRA 1E2FA 4NTZA 3U44A 4B3DA 4DLRA 4TTPA 1CLUA 2XNDD 1Q57A 2WWIA 4EQ6A 1G7CA 1DO2A 1NVXQ 2NO1A 2Y8EA 3CLVA 3RLFA 3ZS9A 5JHHB 1XPUA 4TYYA 4MGZR 2NO9A 2DFLA 2YZ2A 2FMXA 4M4SA 3X1XA 3U3JA 3KUDA 5AUNB 1EFTA 3OEHA 4HZIA 5EUQB 3U3OA 4IVRA 3IDQA 2FV8A 3TSZA 4AKGA 1E0JA 1E2PA 2FFQA 3QPWA 1KI8A 4UQOA 2V6IA 4M9QA 1E1RA 1W47A 5JFGA 3QF4A 1JR3D 5JSZB 4JYBA 3Q8XB 5EQTA 1GNRA 1GM5A 5HR5A 2XJ4A 3OEHD 3B1YA 2RHDA 1EX6A 2ZI5A 3RHFA 1OXUA 1FP6A 2YINC 1OB2A 2REXB 4UNPA 4H1VA 4ZKDA 3GLFE 1QVAA 2GXUA 2QE7A 3FB4A 3Q85A 1ZBDA 5DNYB 3IEVA 5C2JB 3TMKA 2OFWA 4QJ5A 2RCNA 3W8NA 1WBDA 1XTRA 4RSGA 3HDTA 3I4LA 4GSYA 1VHTA 2HLDA 1TU4A 1XXHB 3BK7A 1CP2A 2FJUA 4DDVA 3MUFA 2D3WA 5FBVB 3BB1A 2PZEA 1D2MA 1TTTA 1G1MA 2R6FA 2H5EA 4JLNA 4GRAA 2HCJB 2AHOA 2G0TA 4DLYA 3HPRA 2VF7A 4MUAA 5DYIA 3NTUA 2HV8A 2PX3A 3RRZA 1US8A 2IYLD 1D9ZA 3W34A 4OJQA 4I1UA 2CHVA 4DEXA 1YZKA 2Z43A 3K53A 3AQ4A 2GVDC 3OIWA 1RVDA 2IYUA 4ZO4A 1N6KA 3VTKA 2O8EB 1RE0A 2A5FA 5CLQA 2JGNA 2YYZA 3AV0B 3R9WA 3AUYA 3GJ5A 1ZUHA 3ADKA 1YR8A 3FPAA 4CRWB 2DB3A 3CRVA 5E4FA 1OSNA 4B3CA 1W0JA 4LHZA 1OE0A 3UG6A 1IN8A 1MH1A 4MKFA 2I1QA 2EW1A 1LNZA 1GOTA 4NCHA 1J7KA 2A2ZA 1GDDA 1G4UR 1E2KA 1LS1A 5JRJA 1JEDA 2QP4A 2R2AA 2VA8A 4UXJA 4DIEA 3GJ8A 5M04A 1S1MA 1SGWA 2JA1A 4MH0R 4URWR 2QPAA 2X2EA 2CNWD 3PUYA 2XOKA 1AA9A 2X19A 2OFXA 3T61A 4LZZA 3TQFA 2N1BA 1M34E 1P2SA 2PCLA 4D0NA 4DDUA 2OBMA 5J4KA 2Z4SA 4LYJA 3QQ5A 2CXXA 4BFVA 1WQ1R 2RH5A 3MAAC 3TUIC 1E0KA 1N6IA 4TLDA 3PFIA 4KO8A 2AD5A 5G41A 2AXPA 2BBWA 4OJKA 3GLFB 2O8CB 2DPXA 1M7GA 1Q22A 5FUXA 2GRJA 4QGFA 5FUVA 2J45A 3BH7A 4PQRA 1Q1QA 2ANBA 4KFUA 2WSSD 4TTQA 1ZU4A 3ZVLA 2ZSAA 4FD2A 3L0PA 2ZAMA 4TYQA 1KTVA 1T91A 2JJ8A 4GBMA 1XD9A 4KSCA 4TL7A 1KO7A 5JECA 1G41A 2JLZA 4OQFA 4LC0A 4EPVA 2IXFA 2DY1A 4CEIA 2WJHA 3QKSB 5KNDA 3PUVA 4KJZA 1YQTA 1TQ2A 1AZTA 4U02A 4IVQA 4EPXA 3J81k 5EZ5A 3ICQB 3RC8A 2IYXA 4AYTA 3WBKA 1KDPA 3L8ZA 1BMFA 3T5DA 1ZM9A 2O8BB 2QTHA 5HZHA 4TYWA 4PANA 3GLGE 2PMDA 3FOZA 5JJLA 1KHTA 2WKQA 3H1TA 4A92A 3D3QA 1HE8B 2AFHE 3B82A 3A8TA 4IDQA 1OH5A 2NZ8A 4US2R 1XD2A 3NDPA 3B6EA 2RKOA 1CR4A 1OW3B 2W2VA 1W2GA 4H9GA 4L4UA 4LYFA 4RVCA 3ZVMA 4P4SA 1E9SA 1L7VC 4KVAA 1E6CA 1IHUA 1YZNA 2H18A 1TU3A 4IEEA 4Z8XA 1AIPA 3QUSA 3QPUA 1LVGA 3ZH9B 2ZROA 4PZYA 2BBOA 1VIYA 4WOPA 2IYTA 2GEVA 1G3IA 5AJYA 3VHLB 1II8B 3W6NA 3F0TA 5FTNA 1TPZA 1RRPA 1XBTA 4KFSA 4DB2A 1G16A 5B64A 3VR1A 5HKKD 3SHFA 3W3AA 2W6IA 3OE7A 2D2EA 3V00A 3KQNA 2Z0MA 2VSXA 1VDZA 1VECA 4OI2A 4URYR 5L3QB 2KJQA 3O8RA 1FP7A 3GMTA 4F7WA 3AVYA 4DSNA 3S1AB 4B2LA 4GZLA 2CMKA 4XD7D 1R10A 2WJIA 1R2QA 4LRWA 1HQCA 1NVWQ 4G5GA 1NBME 2QT0A 4Z8YA 5IK2A 3SYLA 2ZVQX 2BM0A 3FHCB 4B2PA 1K5GA 4UNRA 2BJVA 2QMUA 3X1WA 4B3BA 1R8SA 5KNBA 4GI7A 1MABB 1ZU5A 4QC2A 4ERNA 3V4RA 1PVOA 1ZD8A 2VHUA 4YDSA 1T0HB 1II0A 3KKOA 2RGEA 2DFNA 2ERXA 1WMSA 5CB8A 4FW9A 2C03A 4IXNA 1ZNXA 2HXYA 2R6DA 4AKEA 1OF1A 1VYUA 2CCGA 4B73A 1D6JA 2QMHA 4JZKA 1X8LA 2ZYUX 3CRW1 3LFUA 1E79A 4IEIA 5BWMA 3B9QA 1AKEA 4FMCB 3VX4A 2A5GA 4TN1A 3T15A 4QGHA 1Q44A 2WHXA 3NHBA 1R0WA 1IJFA 4A9AA 3AB3A 2OLKA 4PX9A 1WDTA 3RS4A 2P2LA 1N6LA 1N5IA 2YOGA 3CONA 4HLUC 3DZ8A 4A15A 1FW6A 4BLPA 1OH6A 4PC1A 5GJVC 1KO4A 4JBYA 3T1TA 2ZYWX 3VR3A 2D74A 2P65A 3QJYA 2BWJA 4B2IA 1I2DA 3IIKA 4TSFD 5HTKA 1EK0A 1G8YA 3SJZA 4DSUA 3K0FB 2E1RA 1COWA 5CJPA 3B7GA 1W4CA 5HE8A 4F4CA 4A0RA 4V02A 1LS6A 1NN1A 3SYKA 4UNNA 2C78A 1NF3A 2YWGA 1G7RA 1C9KA 4OQXA 4IHQA 5CIWA 4WXRA 1HT2E 3WNBA 4QGGA 1Y63A 2ZE7A 3KXIA 4NYJQ 4TZ0A 1Z0AA 3MJRA 4RFSA 4DCVA 4Q1CA 4AYXA 1IBRA 2ZUDA 4YMWA 3CF6R 3CKLA 3UMFA 4BEBA 4EJSB 4Q66C 2V4ZA 2RMKA 2O52A 1Q20A 4AD8A 3T34A 1U0JA 4C0LA 4Z1MD 1MT0A 1XTQA 2QMOA 2WWFA 5JJIA 4GOXA 1LTQA 3BOSA 5AUOB 2QRNA 1FPMA 4JLVA 1E2LA 1YU9A 3U6KA 4AI6A 3REFA 3CF0A 1E4YA 1DAKA 1N3BA 2I1VB 1X1RA 2R9VA 3FKSA 4LJYA 3RABA 1TF5A 5DI3A 4ZCIA 4CF7A 1X6VA 1G64A 2REOA 2BC9A 3H2YA 2VHTA 2PT5A 5FI1B 2J5XA 4JT4A 4DJTA 2FH5B 3VAAA 2A78A 1XCPA 3AF2A 3LNCA 2RGNC 2VQSA 4M8NE 2ZE5A 1LFDB 2HCBA 3C8UA 3W5IA 2WZQA 1LF5A 4DLWA 5KYKA 1EFHA 1NIJA 4N3NA 3N70A 4JLBA 3LBHA 4RD2A 1NSFA 4JLAA 4R98A 2CJWA 2VP5A 3KL4A 4PFSA 421PA 5L3SB 3Q5DA 3NC0C 1G8GA 2ZYTX 2H16A 4XTCS 1IOZA 2VHCA 5KSOA 2VP2A 3CX6A 2GILA 1E9CA 5BQ5A 1Q3HA 3PITA 1E2JA 3JVVA 1SVSA 3EWSA 4PPGA 1U9IA 1T0JB 1ZINA 1ZRHA 3AP1A 5FPYA 1IONA 1QBKC 4D26A 1E9BA 1OHHD 4LYHA 2ZJ8A 1G4AE 2HYIC 2IT1A 1K8RA 4LBWA 3T12A 3TW8B 4A6PA 5KHOC 1ZM7A 3QKRB 3U44B 3BAFA 5JHGB 2NZJA 2G3YA 3OESA 1N5LA 5KSYA 4EQ6B 3CUEF 1G20E 2ATXA 3MMPA 5H70A 3BWDD 4HUTA 4LC1A 4JBXA 1KJZA 2WMOB 4JLPA 2RAPA 3KB2A 3QE0A 3OIYA 5JBQA 3WY9A 4Q9LA 3U3KA 4HDOB 4ASUD 1ZD1A 4Q19A 1NVUQ 1Q12A 3TQCA 3GQBA 4EPRA 3T5GA 2JLYA 3VKHA 1KK2A 1ZC3A 4PSVA 4LJ4A 1LF0A 5CDFA 2GF9A 4NYMQ 3I5YA 2WIBA 4MQBA 1OPXA 4OQMA 3K9LA 3KFXA 1X3SA 3WNDA 4K8OA 1G5RA 4URUR 1GWNA 1AM4D 1G19A 2JLUA 4BFSA 1E2GA 4NYJR 1Z0KA 1N0WA 2ZUBA 3U7HB 2OG2A 5CJ2A 1RRFA 1PUJA 3BFXA 1W5SA 3A4MA 2GXQA 1MABA 1CS4C 1GG2A 3WRXC 2H17A 1E2EA 2NIPA 4CZ2A 3TAHA 1UBEA 3VFDA 4GNKA 5IHPA 2HDNB 1TADA 4Q9IA 4UJ3A 3NC1C 2JLQA 2HT1A 2XEXA 3QEOA 1VCOA 1SXJE 2XB4A 3B60A 1US8B 1CF4A 2IYRA 3MD0A 1X8KA 3KDSE 2AFIE 3CW2A 2G6BA 1IN6A 1Z06A 3CRRA 1T9HA 4NCIA 4AKHA 2YVUA 1GTVA 2ZIAA 4M1SA 4KFRA 1N6OA 1XJ0A 3GLGA 4PAMA 5G3YA 3K0EA 3NG1A 4MKIA 4RD6A 3PV0A 4BLTA 4TYPA 1RW4A 1XEXA 3CNOA 4Z54A 4O3MA 5E7IA 4DCUA 1UAAA 4C4PA 4IXMA 4GMXA 2GBLA 4HAWA 2NTYC 2ZRMA 3EC2A 5GJWC 4JSTA 2GEDA 5K8TA 1KKMA 1A7JA 1N6NA 4RZ2A 4WIAA 1Z83A 3CPJB 2D62A 4KVGA 2CEAA 5ELXA 4NCJA 3U3MA 2IXEA 4OQLA 3WP0A 4B47A 2QTFA 1KJWA 2Q9BA 3ZIAD 1HV8A 2UZ3A 4EUNA 4M1YA 5KSZA 5CM9C 5DH9A 1CIPA 1CR0A 3NBZC 5EP3A 1SHKA 3AF3A 5CIQA 2HEIA 2MSDB 2WPDA 3IQWA 3L82B 4Q9KA 3A1UA 3W3ZB 2IF0A 3RDPA 4OI0A 2V8OA 2JASA 1G7SA 4N0DA 4JS0A 3K0AA 1KI7A 2ODWA 2GCPA 2XNSA 4IOKA 4RZ3A 5GVRA 5JCPA 3FMIA 2MMGA 3IGFA 4UXHA 1XMJA 2F43A 3T35A 3GPLA 4LYAA 4QJ3A 5LPNA 3IKJA 4OQNA 1DO0A 5JWOA 2QAGC 1GKIA 1N0UA 2ZI6A 1JQLB 3NVAA 3Q7QA 5SZJA 3THXA 2PEZA 4JLKA 1K6MA 4OHXA 2HJGA 2BMJA 1QRAA 2Z4RA 1XPRA 4JVMA 2OCBA 2WOOA 1YR6A 4FWTA 1KMHA 3HP1A 3E1SA 5E7MA 2G0NA 3KFVA 1EFUA 2G1KA 2Z6VA 1W4AA 2ZXUA 1W2HA 1TQDA 2WJGA 3DMDA 3RRYA 3BJIC 1NBMD 3ICEA 5A5GA 4LJ8A 3GP8A 1MO5A 1Q1BA 2W6JD 1N0VC 1ZW6A 4Q4JA 4HB0A 4BFTA 4CEIB 3HU2A 2IUUA 2R6GA 3FKQA 1CBUA 3QXSA 4GT1A 1JJ7A 4JKYA 1SXJB 3UK6A 1XF9A 4ABYA 1RPZA 4BASA 3GFTA 2PLFA 1EWQA 3C5HA 1PLJA 2JJ2D 3L8YA 1Z6TA 1V43A 1W7AA 4NYMR 1S8FA 1S2MA 3THYA 4G0NA 2FGKA 3SC3A 4L16A 3RSLA 4P32A 3GFPA 3AVQA 2Z5FA 4QM7A 1XD2B 3CRMA 1G17A 1KK1A 1P61B 3C16C 2ZETA 1GUAA 2IYQA 4QBFA 4P4SB 3TUZC 5KPDA 1SULA 3ADCA 2CDNA 3CM0A 1HTWA 3TJZA 2PJZA 5KTYA 4ZIRA 2F9MA 1TMKA 5L3SA 3TH5A 1F6BA 2IW3A 2ZJOA 4NYIQ 1XJQA 1NI3A 1G18A 1YZLA 4M1WA 4XWAA 2FF7A 4CIDA 3AF1A 1VPLA 4DLUA 3WNCA 3LY5A 4PO1A 1JAHA 2WVJA 4HEJA 1XTJA 3I8SA 3N5CA 1YZGA 3MLEA 1OLOA 2D06A 3MWKA 1KAOA 2CL6X 4ZI3A 3PUZA 1RYFA 1MR3F 1ODFA 3AKYA 2CLDX 4LDJA 3TE6A 2FX3A 4QOSA 2IHYA 1EESA 3TGPA 2ZU0C 2YC2C 4M1KA 4EAQA 3UMSA 1KZGB 3EPKA 2QSZA 4B48A 1H65A 4A6XA 1KSFX 5FTMA 2ZI9A 3EZ2A 5G3ZA 1KK0A 2XZLA 2FZLA 1NKSA 3AVWA 1HUQA 3G82C 1GSIA 3UANA 1UBCA 3IBGA 4RJLA 2RGCA 2QQEA 4PAQA 3AM1A 3BH6A 3PG5A 4M9XA 1R5NA 3CBQA 1NNEA 3UXMA 3A4LA 2H92A 4NPHA 5ANRB 3WMFA 4F4IA 1U8AA 2JLXA 4PSAA 1XMSA 3K0CC 5JLJA 5E3HA 3SN6A 4EFMA 3FFAA 2ZRGA 1J70A 1CULC 1YE8A 1NG1A 4JL6A 1KIMA 4A0FA 2RGBA 2XB2A 1RIFA 2NO6A 1ZNYA 2X77A 4XJXA 4Q7KA 4X8HA 2IYZA 2BCJQ 1XX6A 2TMKA 1E1RD 3K70B 2WSMA 4GOKA 4XH9B 1E9AA 3FWYA 4TQUS 3CB4A 1YR9A 3DZDA 2QA5A 5JMTA 2AN9A 2QNRA 1ZYUA 4U00A 3PIRA 2B7CA 3BS4A 4YMUA 1SVIA 2YOHA 2CLSA 1ZJ6A 3SJBA 1SVWA 2Q6TA 4QRHA 1ZD9A 2QE7D 2KWIA 3QI2A 4OI1A 1M6NA 2NGRA 2VPPA 4NKRA 3CF2A 3K09A 3KKNA 1Z5ZA 4LUCA 4A2QA 4M9ZA 4OBEA 2HLDD 1D5CA 1PLLA 2QGNA 3PEWA 2WWYA 4P3YA 4RZUA 4S2EA 2YWEA 5J4LA 1PLKA 4W5WA 2OBLA 4QL3A 3IO3A 2I4IA 3SHWA 3BRWD 2FFHA 4AYWA 3DPUA 3RS2A 1NKTA 4NMMA 1DEKA 3KTAA 2ZS9A 5FPHA 4RD0A 4W5HA 2C95A 4TQ9A 5DE3A 1ZNWA 2C9CA 3LA6A 4C0JA 2IC5A 1P9NA 3EZ9A 5HPYB 1BYIA 4Q1DA 4EFLA 4DDTA 3B8HA 4RFSB 2QTVB 3GJ3A 4DKXA 4R7ZA 2VL7A 1Q3TA 4X8LA 4IOMA 3TUJC 2G83A 3EZFA 3DOEA 3NBXX 3MCAA 3U5ZB 1H8EA 5CB6A 1W46A 3SDZA 4HUQA 3QBVA 2GJSA 4URVR 3BH0A 4C3ZA 1W0KA 3NH6A 3C5CA 2H57A 1IN5A 1EFRA 4FIDA 2ZRAA 2O0HA 5EP4A 4QHTA 1KZ7B 1W0JD 4XWOA 3JZMA 4ILEA 2OCPA 3SR0A 1T3LA 5SZKB 3U3RA 2C98A 5CLLA 2OILA 2ZRPA 2QG6A 1TQ6A 4IDPA 2OAP1 2CVHA 1Z6AA 3V4FA 1T6NA 1J2JA 4NYIR 5CDFE 4W5JA 1QHIA 5FOTA 5DI3B 821PA 4C2UA 1QHXA 2RGDA 1GAJA 2QMEA 4Q7LA 4XTRA 1A2BA 3AF4A 3MWLA 4KFTA 2XOKD 4PSKA 1E0AA 3EARA 4CYMA 1XTIA 2A5DA 3RVBA 4X8OA 4LCBA 4TMXA 1IY1A 2BEJA 5F2EA 3RAPR 3P4XA 1OB5A 1JBKA 2YKGA 4Q48A 2FDCA 1H8HA 5EUMA 4IDNA 2HF9A 3FYHA 3AVXA 2O0JA 2QENA 3U7GA 1WA5A 3AF0A 1XFAA 4FI3C 3ZVNA 2IYYA 4QNRA 1G3RA 2OAQ1 2V3CC 4NZYA 2NQ2C 4J0QA 4W7SA 2GTPA 3PR1A 4RFVA 1E1QA 1MO4A 4A82A 4BECA 4LHYA 3FTQA 2GJAA 2JLWA 2OZEA 1Q0UA 4EPYA 1QHGA 2QP3A 4QBGB 4TLBA 2GDJA 2VP0A 2CJWB 5L3VA 4NCKA 2EQBA 4A8JA 3WYGA 5FR2A 1L4UA 4FCWA 2O8FA 2YWFA 1SXJA 3C15C 4XSGA 4IVPA 3BFKA 4QFMA 5E95A 2C04A 4C7OA 1OIVA 4HDQB 4M1MA 4HAZA 3FE2A 4RKFA 2G88A 5AUPB 2C99A 3QXCA 1OYWA 1S9HA 4YQFA 4LPSA 2C96A 3VR5A 1ZVQA 2X2FA 2FPMA 2GAAA 1SXJD 1YJ5A 4Q1EA 3DOFA 3LVRE 2KBEA 4P4TA 4KBFA 4LHXA 1J8YF 1DVRA 1IXRC 1BMFD 1IJEA 3MWJA 1U81A 2IBMA 3QF7A 4FMDF 1NP6A 5CYOA 1GP2A 4MRSA 2IEYA 3VU9A 4MYCA 1NLZA 3SI7A 1VHLA 4C0HA 3QKTA 1KNXA 3L0SA 1D2NA 5GJBA 4BFZA 4DIDA 4ZKEA 4YMVA 4Q7MB 4BWYA 3F3YA 2DHRA 1Z0FA 2A30A 4LBVA 2IS6A 3OIUA 3LDAA 2XGJA 2CHGA 3CNNA 1GFIA 5KOYA 4PC7A 4MRPA 1LB1B 4QGAA 3I1FA 4D4MA 2F3TA 4HB2A 4D0GA 3GD7A 5LD2B 4KCGA 3VMFA 4XVUA 1S3SA 1F2UA 4BZQA 3GJ6A 1YRAA 2EFCB 1B0UA 3P27A 1GVNB 2ZM5A 5TB5A 2W6ID 3OE7D 2ZRKA 3CH4B 1WP9A 4OK3A 4DLSA 2FSHA 4MDEA 2FZ4A 4GZMA 2ZREA 2IYSA 4ITRC 5FPKA 4XVQA 2HUPA 4L9WA 1P75A 2F1JA 4AWXA 5HZKA 4WA7A 4Q1BA 5C4GB 3GJXC 1OV4A 3A1TA 1IN7A 4QXAA 3ADDA 1M2OB 3GLHA 4BPBA 4ARZA 4D82A 4NCNA 4PAOA 2IS1A 4JBWA 1AA3A 5IK2D 3EA5A 2ZUCA 2CVFA 3CX7A 2JCSA 3BE4A 5FR1A 4A2WA 4CDGA 4YONB 4G5RA 1W48A 2B8WA 1CJUC 2GWHA 2EWVA 2OBNA 4CT5A 1UEJA 1Z0DA 2JEOA 5BYKA 3BIFA 3IHWA 1KAGA 1NMYA 4MGKR 1OKKA 1S4QA 721PA 1OXSC 3B78A 1NRJB 6Q21A 1G3UA 3R20A 3W5JA 4NP6A 2KE5A 4K46A 2YHSA 3GLGB 3LBIA 4KI0A 4I1VA 3IUYA 1E79D 4B74A 2GZAA 1XEXB
chains in the Genus database with same CATH superfamily
3GEEA 4XIYA 3M81A 1DOHA 4OL0A 4AKSA 1PYGA 1TZJA 1L4MA 4QU8A 4RXMA 2EX1A 4OLBA 4K8RB 4YQEA 3QH4A 1MUUA 1KZ6A 5DDIP 4KHPB 2FF5A 5MN5A 2Y66A 1N2GA 1GR0A 4MQ6A 1P1IA 4MW2A 4EFDA 4FM9A 5AVOA 2AZDA 1L1EA 2QGZA 1QYVA 4XCVA 1KJ8A 3BXPA 1KDZA 2HYDA 3T4UA 3KLMX 1V1MB 2JH8A 3F6PA 1P5ZB 2J6IA 1FRNA 3O26A 1FQKA 2O48X 3KVOA 1OUMA 2CUKA 4MR8B 4KV7A 3AETB 5KTKA 4LMAA 3AP2A 5EKSA 1FS6A 3C8ZA 4Q39A 3WGZA 3X1MA 4B3FX 1VBFA 2M6SA 4MVJI 1X74A 2C9ZA 3IE2A 5SZIA 2ATIA 3EXG2 3VU8A 1A98A 1MXHA 4PN7A 1J06A 3D81A 5HMLA 4MQEB 2H5JA 1SOMA 3DZIA 4QBTA 2X3UA 2ZAIA 5DYYA 2DWPA 3QBDA 4NE2A 1C8BA 3F6BX 2VDLB 3LXXA 4COKA 1XF1A 3QG1A 1I7QB 5DYNA 3M4YA 5JI3E 3GRPA 4TVSA 4FILA 3THXB 4DJ5X 1K6JA 1N5JA 4ZDJA 4EJSC 3GCGA 1P9RA 4FSHA 4U7TB 1ZP6A 1A5TA 5IEJA 4IOJA 4AMUA 5CBKA 1ADFA 1NM5C 3GNLA 3RYHB 5ADVA 2GJ9A 2PSJA 4DPKA 1KMHB 1KOFA 3DA8A 2V7PA 3V48A 2Y76A 1DJMA 1CQZA 5IJXA 1T9CA 1P2VA 1VJDA 1YBHA 2C1XA 2ZAOA 3LDFA 2QPOA 4G5YA 1GKYA 4BQIA 3ZD7A 1FTWA 1DADA 2EVWX 3TAUA 1M2JA 5DSZA 4B44A 1LI4A 4LYDA 5CAEA 1XFDA 1UUFA 2BONA 5DM4A 1A9TA 4WECA 2I6SA 4MQUA 2GZMA 2CJFA 1D8AA 4ZHQA 2E9SA 4WKGA 4HKTA 1Z4QA 3AFHA 4GC5A 3SF8A 4L51A 1KFKB 1TKAA 4C4OA 5JI2E 2PKQO 3FKSD 5J2UA 3LPMA 2DUMA 4EHJA 5IM4F 3QWAA 3ZD8A 2QT9A 1R9JA 1WR8A 2FN7A 4WBXC 4POOA 3LVFO 2N47A 3QG5A 4LKRA 3THYB 1VG0B 1Y3AA 4LAFA 4MZXA 4OP3A 4W9MC 4LJ9A 1FDTA 3ILHA 5D3ZA 4U6QA 2I3DA 2VUTA 3IB6A 1ECPA 4JLMA 4FTWA 3ML1A 2X6TA 3MUNA 3L1JA 4JLDA 4GBED 3HFGA 5AOBA 2BY4A 4OHWA 4ZZ2A 4I36A 3T3NA 3WKEA 3JWEA 4QBIA 3W9UA 2CLFB 3IA2A 3TM5A 1SIOA 3VJLA 1HR0B 2XVZA 1Y5LA 1UP6A 4ZIRB 3T1OA 2W83A 3PP8A 1RPAA 4FFVA 4NNOA 5CT8A 1PP4A 5JNWA 2CXRA 3WFIA 1Z7BA 1XAHA 4C5BA 2VBFA 3PJRA 3OOHA 4AN0A 3HY6A 2FR1A 2L82A 5EHQA 5GZ1A 1EVEA 4IGAA 1RLOA 4EYQA 1N8KA 1BWPA 1VG1A 3OTHA 4UMEA 3I83A 2ZM6B 3CNHA 4O2RA 2QVZX 2NSJA 4GMDA 4HOYA 3ZOKA 1JKMA 1N8NA 1RZVA 3GGCA 1C1DB 1E96A 1EUDA 4ANFA 3M3HA 4QNNA 4D4KA 3ROEA 4JI8B 1D03A 1OTHA 4EFNA 5C1BA 1KZ1A 2C7RA 5A05A 3LX6A 1DXYA 1T8SA 2F1OA 3IJPA 5JCOA 1KSGA 4PWYA 3ED1A 3HHPA 4YLYA 4MCAA 3IAXA 4Y9UA 1O6BA 1U9CA 2WJ3A 5ESRA 5BW8A 3OUUA 1F9EA 3ZU2A 4PHHA 4TL8A 5F7JA 1FDVA 5LXTA 2O5EA 1PS0A 1WZUA 2IEBA 1IB0A 2BCGY 1NFRA 3ITKA 3MOGA 4MRAA 2CZGA 2M2IA 1AGNA 4H7FA 2GA9A 1R1DA 5HEKA 2BF4A 4GKJB 1XAJA 2VBCA 1HE1C 4LBYA 5L8VA 1O6FA 4D4IA 4U2EA 1RYNA 1TM1E 1ZICA 3NG1A 3G2NA 2H4WA 4NATA 4PLPA 1ADBA 4TLEA 4P31A 2NNLD 4PC2A 1ESCA 4ZOLB 1QVZA 1I1HA 1FFXB 3QJGA 1V45E 3UY4A 4E32A 2NUTB 4WJLA 3DE1X 3WGYA 2QRZA 1X42A 3O3NB 5K01A 5K8VA 3JV7A 4X8MA 4RAQA 3MC1A 2ZIFA 3EVNA 4KH1A 4ND6A 5IWCA 4RTPA 2OUIA 2G7ZA 5FL3A 3VGJA 1E0DA 1EE9A 3C6YA 1F1JA 5IDYA 5JE8A 4FFNA 1D1QA 1XN1A 1YB5A 5D7NA 5F98A 4FOLA 1PF7E 4PGHA 3BDIA 3FHOA 2XUAA 4OYHA 2F1RA 2OMKA 1GNLA 1ZI6A 1ANKA 5ALXA 5JD4A 5DW0A 1Q84A 4US1R 1HT1E 3LLMA 4V0LA 3VO8A 4OHBA 3AEKB 4F9FA 4P38A 5J4VA 3LHKA 4ON9A 2Y92A 2RHCA 3VNRA 4ED9A 1VLHA 3VKUA 4XRGA 3DMTC 3L5KA 5DCWA 1HSZA 2W8BB 3IELA 2JJQA 3IIEA 4DLKA 1F6DA 3IMFA 5E7JA 3O3CA 2Y0DA 2DPGA 2Z2IA 2R84A 3IP6A 1KU6A 2FW7A 3SF0A 4E5UA 4REOA 3CH5A 3PXCX 1OTYA 3AUFA 2C0CA 5CFNA 4RD1A 5AM0A 1FMFA 1GUFA 4BNFA 1HEIA 2QD4A 2VG8A 1R5OA 1Y80A 3AUXA 3NVDA 1N3IA 3ZBTA 1EUZA 4UFPA 2HKIA 2XVXA 4DHEA 3CR8A 4UDOA 1SCJA 2PD4A 4W8GA 1N2XA 1BH2A 3PJFA 4F5DA 4CDRA 1P19A 4MVJP 1QIIA 3LK7A 4EA9A 3FUVA 3UYLA 4YXFA 3OJXA 3LO8A 1CZNA 2G1JA 1BIFA 2J46A 2YJTD 3W1VA 3FTEA 1HH4A 1TKRA 2BZSA 4NH4A 4MIYA 4C0BA 2W11A 5LOVF 4FE7A 3AYXB 4O4JA 3UNXA 1A5ZA 1C4OA 2IEGA 2REQA 3B1WA 1HDGO 3MAJA 4YBZA 2EHDA 5F2OA 3IQHX 3MINB 5H9WA 4BNTA 2X6QA 2A1UA 1WWKA 3EQ7A 4S1TA 4UASA 3RANA 5LP6A 5MN6A 1EFAA 2PUCA 2AD1A 4FGJA 1NZJA 4WK2B 1JG4A 2C8LA 3HN6A 1NATA 3L1VA 4PZEA 4BLWA 4H6XA 3C1UA 3FGNA 4DUGA 3KQWA 4FYXA 2QM8A 2EGUA 4CF5A 3I5MA 3IV9A 3NBUA 5TY0A 1ORDA 1G20B 1WU7A 3F5MA 2V5AA 4QHYA 4FS3A 4HLUA 2BLNA 2J0VA 4RPGA 5IAAA 1JIJA 4X93A 4DUGD 3KSBC 3E1GA 1DJOA 2A1TR 2Q2VA 4YXWA 4AMBA 5JXJA 2ILTA 2X13A 4DA4A 4TLMB 3VJRA 1B8OA 2J3DA 1TZKA 3MW8A 4BFYA 1C0IA 4Y2QA 5LR6A 5FX2A 3T4XA 4OLAA 4BGUA 4BNYA 4BO4A 4ZZIA 1XLWA 3SE0A 3SXUA 4HAVA 3EVCA 3T1VA 2ZUFA 2PAFA 3OO1A 2R6AA 3GIWA 4UNIA 2BFNA 2PLWA 2GPBA 3EHEA 2D0OB 2WV9A 3MTGA 1FU8A 2QN6A 1EXNA 3JXEA 1XK7A 2JFQA 1U0EA 1ESMA 2J9ZB 2K7ZA 3MT8A 4JOSA 1QONA 4MB2A 3ZDXB 1XLUA 1W73A 2GJ8A 3I9NA 4G6ZA 4WUTA 2C5BA 1XG5A 1ZNZA 2NU6A 3FPKA 1B41A 4ZYWA 3WIBA 4C2TA 4TS3A 1VL8A 1PQ4A 5JLAA 1I4WA 3GLHE 2BFAA 3L49A 5DF1A 1Z4KA 4ARBA 5KYYA 1AF4A 1JR6A 3CNQS 3O38A 2G9VA 3H8JA 1O0CA 1Z22A 2AUMA 2ZI7A 1RHJA 3TNFA 3AIIA 1T9BA 5EJGA 1U8ZA 3RYCB 1W88A 2R6JA 2QUIA 3UHOA 4C2AA 1BDIA 5I3CA 1SUSA 2ZYGA 4DARA 1XMQB 1V95A 1CUDA 2EG5A 3U0BA 1WKVA 5C3MA 3BA6A 3BULA 1KJJA 1VE6A 3GJ7A 2QYSA 1R6TA 3ILVA 4I8XA 5TQ2A 5IAKA 3B52X 4FKMA 3LUAA 3QK7A 3ZKWA 3ICOA 4C7OB 3FETA 3GMIA 2LIPA 3PC7A 1SXJC 2EV9A 4DNXA 1SKQA 1OFVA 1FFBA 2PANA 3HCDA 4E5SA 5CCEA 3I2JA 3UPDA 1HLDA 1I80A 3FPSA 3GNQA 1KY2A 3FPHA 3NKFA 4CIAA 5GIOE 4AF8A 3D6MA 5ILOA 3PC3A 1TF7A 4Q47A 4X91A 4GOOD 1IY2A 4LQLA 4MV0A 7YASA 3GUUA 4CXMA 2BBSA 2JGAA 1C29B 3NAGA 4EGJA 4H7IA 5ARDA 4HD8A 3VJMA 4R8RA 5DTEA 2P3SA 5ITSA 3ZCQA 2Y67A 2H6EA 5EIWA 3W6OA 2QZJA 3WBFA 3AHEA 4EGAA 4YMTA 1PGQA 3ZDCA 2ZB4A 1TNDA 3QA9A 3T54A 4C30A 1KXJA 4N0MA 4CHTA 1E3LA 4EF4A 2EJCA 4RJTA 4K1LA 2X7XA 1C0EA 1CD5A 1U4SA 1JPUA 1JVBA 2FCAA 2XWSA 1C4XA 3DJFA 3HNOA 4I4TF 4PYRA 1GFZA 4TTJA 3IIMA 1GGVA 2W00A 1AZWA 1QVRA 1YBMA 2VK2A 2Y4OA 2RBEA 3KR9A 4MIOA 5CX1A 4GPEA 1QE3A 2DQ4A 3VNAA 3PXXA 2G1UA 1MNQA 1QLJA 2H0RA 2WD7B 3R9IA 4C0AC 4EIWA 5KOHA 1F2TA 5HE9A 5JXWA 3O9MA 3ZS8A 3MUOA 4Y30A 4DNFA 2OKGA 1OXXK 1FDWA 4DR3B 2HRQA 1GLVA 1PG2A 1Y8QA 2EKBA 2HU7A 1NYLA 2RCYA 2W2OA 4WKBA 5C8YB 2FOIA 1T4GA 4RVHA 4IDFA 1FMTA 5HQ3B 3ZHXA 1TTTA 3WGNA 4LK2A 1FE8A 1XRQA 1I2BA 4U5XA 4OFBA 2FZVA 2E4YA 3R7AA 4QGSA 2F3QA 2JD0A 3X0DA 3C41J 1OXVA 1H94A 2OL4A 1JBEA 2IUFA 1RPNA 3CVOA 3GUYA 3PWKA 3KYDA 4HYTA 1ZFNA 1JDBB 3GJ4A 4K7JA 4BE9A 2Z83A 2RK4A 1N5OX 221PA 2VKTA 3EB9A 1UF9A 1X7ZB 3LC2O 3UHPA 2Q7OE 4C9BA 1B00A 3AF5A 1I2CA 1WDLA 3BD9A 1X1DA 3FXAA 3I32A 3KR1A 3VDMA 4AG6A 2IYVA 2AYZA 5DBIA 4D4JA 1PL6A 3FLAA 4FXPA 4MGIR 4X00A 5BW6B 1Q1ZA 3AHIA 4EG4A 4DM4A 3FD8A 4L50A 3Q3JB 5B2EA 5DNEA 1JKJB 5F9MA 5CFQA 5CLHA 4RIFA 5JWHA 5ITVA 4CLEA 2Q29A 1NJ8A 2BUAA 3K16A 3MWGA 4TMVA 2Q2OA 3NX4A 5SY9A 2HHJA 2HSJA 4Y18A 5EXPA 4BVJA 5AHRA 4H6PA 3BX1A 3PGA1 3AM4A 1JHYA 4Y9TA 1IM2A 1WETA 3CTPA 2RHGB 4O4IA 4JUAA 1YZ3A 2H8KA 5KUTA 2PSFA 1BE8A 1DKOA 3IODA 4GP6A 1MIOA 1XA4A 3ITNA 3CISA 4BJ6A 2I34A 4YGXB 5G53C 4BGIA 1E9EA 2E55A 1OXTA 2GM5A 4LDZA 1K8QA 2XE7A 3DYVA 4X6YA 2ZRCA 1GNPA 3KZNA 2VUUA 4GO1A 3V4PB 2UUCB 3OZTA 4BEJA 2FEWB 4RCZA 2X8JA 1PT8A 1TCAA 3RBAA 3RG8A 5K8LA 3KJQA 2OZVA 2FN4A 3PEFA 1YZTA 1CUBA 2HFJA 2XKJE 3AQIA 4YP1A 4KR6A 3OC6A 2ONCA 3OLVA 4GF5A 4Q3OA 4BMNA 3HO1A 2UYOA 1C5KA 2H1VA 1FNNA 2BTQB 2OP1A 3K0HA 3DE7X 1DKQA 1YUNA 3ZZTA 3GRRA 1P60A 2ZE8A 4Q6BA 2XMQA 5FPTA 1QQAA 1PV1A 1G8KA 4M87A 3DPSA 3UJAA 4Z3OA 1FTYA 4PRKA 1DELA 1N2CA 1VE9A 3DXYA 4BNUA 4HDKA 2O0LA 4RC9A 3ROXA 5JPDA 1TRHA 3G7UA 5JEDA 3RVPA 2V55B 1W36D 4B3TB 1MJHA 2AEFA 4EF5A 1PJ4A 3WB9A 2EFEB 2R5FA 2ZI4A 1C3JA 3G8DA 2WTNA 5AW2A 2QNBA 2CYCA 4K6CA 2J87A 2ZXEA 4J91A 4GKVA 3WXBA 4NZ9A 4QFBA 3OLCX 4OQDA 3WK4A 5JAZA 1QH1A 2QL7A 3BICA 1UP4A 3D59A 4ZARA 9MHTA 1NHWA 1V8ZA 2O0KA 4J29A 4UCWA 5HIIA 5EYPB 4FFRA 4JC0A 2XCSB 2R62A 1XCJA 1GRCA 1LRJA 5HS6A 1XZFA 1I0IA 1RKVA 3I05A 3MQ4A 1WUHS 3C45A 3O2JA 3WLTA 3HRIA 1YQGA 1UMKA 2Q5FA 4WCFC 4N47A 1QF9A 1JSCA 1Z5NA 3PIDA 4G4JA 4IIDA 4UEKA 2IPAB 3WHLA 1POXA 3FTDA 1BN6A 3GAMA 1QRTA 3GEHA 5CVUA 3B7PA 4M7WA 3OM1A 4US0R 3AOGA 2PGAA 5TF0A 3QFRA 1GL9B 2J9GA 2V9PA 4LKOA 1XHFA 4NU0A 5LFAA 5ADHA 4HVCA 2G1PA 1JHZA 4M1OA 4ZEVA 2O20A 2AIRA 1VRCA 1XRRA 3B1XA 3GMDA 2V8BA 5AVJA 3UOGA 1LBSA 2HY7A 4WLVA 3GLSA 4BV8A 4TZ6A 2FNAA 1BCSB 1CZRA 1OR8A 2X7JA 4YCSA 1N2OA 5DK6A 1Z37A 2WMNB 5DXFA 3BGIA 1WOMA 3P9RA 3MFYA 3DB2A 1HRDA 1HKHA 1ZGBA 3AGQA 2YFHA 2IXDA 4HMOA 4JXKA 1PW7A 1VZ3A 3FVRA 4LRYA 4JEMA 5DBFA 3VSDA 3AY0A 3O73A 2GR9A 4PHTA 2CNBA 1W25A 3NW9A 4FOTA 2WT8A 4Q82A 3U40A 4QX6A 3O4VA 2GEJA 1GCIA 5JAIA 5HQTA 2VI5A 3H9EO 1OXMA 1CUGA 2F3UA 1X1TA 1O96A 2BLLA 4X95A 2H2AA 1ODKA 2QAGA 1LLFA 2NLOA 2WVAA 1YJQA 4OSEA 4NU6A 4EI9A 2XXAB 2MR6A 1CVIA 3ELYA 3LQ2A 4UAGA 2REBA 3SYRA 3MT0A 3WHKA 2R60A 1J0XO 1E1QD 5CM8B 1CQWA 3OZAA 4DV5B 1QGUB 5J9FA 4REQB 4DSZA 1KNQA 3Q87B 4Q1AA 5DP1A 3VSCA 4OX9B 3FHJA 2ZRHA 3ZJYA 3UJNA 5JT1A 3QYPA 1PEAA 5DBGA 4B7XA 4PPNA 2WWXA 3PQ6A 3CFYA 5ECDA 1J56A 5AVUA 2RJ3A 5BYBA 2BGIA 2WJJA 4HFRA 5JCXA 1M72A 3AHDA 4PZZA 4M55A 2FP3A 3M6AA 4RV4A 5CJJA 3N07A 4F84A 1QB7A 4BX9A 4KU4A 2YUTA 4N8DA 3UATA 3GF4A 4M9UA 3RYFB 2GWRA 4KACA 1H1LA 4Q01A 5D84A 2XCTB 4TV9A 2J8ZA 2VATA 2OLEA 1IEXA 4IO0A 4PICA 3CLRC 4TS4A 3ASZA 4Z49A 1VOTA 5IYZA 1IH8A 2Q2QA 4CKBB 2VVTA 2O2DA 4LV5B 4WRRA 3KOXA 4P08A 1NVVR 3PU6A 1T1IA 3FDIA 4FC6A 1QKIA 2W22A 1LU9A 2MJLA 4X45A 3D3WB 2A5YB 4NZPA 2QD1A 1A3CA 1XRJA 4CQMB 1P4JA 1F0YA 1EUYA 2X0RA 2VEDA 1G8JA 2ZT5A 4LY0A 3RSOA 1AXGA 5G0UA 1ZHFA 2GCOA 4EZIA 1NOIA 3U7QA 4ZV4A 3A6GA 3G8BA 2BI8A 3VKWA 4BFWA 5KNBH 3P0JA 5KQMA 4HT3B 2OHIA 1O87A 3SS8A 2YWHA 1R18A 2PQ0A 4MA0A 4N3CA 3V42A 3GUHA 5LD2C 1V8DA 5T41A 5CFZA 2G09A 3CT4A 5JADA 3WYBA 1SHLA 1ZVKA 4FX2A 2VIIA 3JQ9C 2HI0A 2EBFX 2FX2A 2VHXA 3NU1A 1QTNA 4MPDA 2O3JA 3AR9A 4ACAA 2R8EA 1FNBA 2BGLA 3RUHA 2GLTA 1O94A 1YZQA 4UU0A 4ZQIA 2H59A 4MV3A 1IHPA 1U94A 1NRXA 5F5NA 2C82A 5IVIA 3DXZA 521PA 2PH7A 4UE3S 1D5WA 2WG0A 4MI9A 3MJVA 1SFRA 3H3XA 3T9DA 3GP3A 4IH4A 2BD0A 4YCAA 3VSAA 1JXQA 3C7KA 4RA6B 1XYYA 1M3SA 3JYNA 5EMJA 5JMPA 4G09A 3W7BA 3H86A 5KTRA 5L4SA 2BEUA 8LDHA 2FPUA 1I1QB 1UBMS 1Z9BA 4C0WA 4AROA 1JECA 1TECE 1IXSB 3FUXA 5BRJA 3VVLA 1N2EA 3UENA 5EE3A 2FEAA 1DE0A 4G2TA 3M6WA 1J0CA 3F90A 4EBFA 1RJDA 3QBJA 4DLZA 4F60A 3K0CA 2C00A 3D7MA 4UBOA 1FIUA 3BL8A 4EK9A 4HB3A 1VKNA 5ERYA 5F9HA 5TRTA 3NAMA 2LBPA 2B20A 1LA2A 1DTSA 3HFJA 4HC4A 4MYUA 3HP7A 1HOTA 4IH1A 1RRGA 5K3EA 4KNYA 3SQXA 4FEEA 4Z0NA 3K0KA 3HCOA 4KLAA 4KPUA 1A71A 4EYKA 1Y9JA 1AN0A 3RTDA 3B2NA 3GJTA 1V7ZA 3K0BA 3LY7A 4RJJA 4WZBA 1SUPA 5K2OA 3LXRA 4G0MA 1M6YA 1OTXA 2ABWA 2GN4A 3RLIA 2ZRNA 4CMCA 2GX6A 1HLGA 1EHCA 1K7CA 4ZVKA 1JSXA 3RD5A 2XBLA 4A0QA 2OOSA 3JQEA 5SYMA 4E3WA 1ZJ5A 4OHYA 2JI4A 1FMLA 2IHNA 1T5TA 2Z6AA 1USWA 1J9ZA 3HU1A 1DAGA 1JHXA 5ERGB 1XXHA 2JLSA 3V34A 1I5RA 4YJ2A 4TMWA 1PR1A 3KQUA 4YIHA 1FP4A 4TSFA 1Z25A 2QZ4A 1E9FA 1GRQA 4B3IA 1K7SN 1MJ5A 1M8JA 1PL0A 1GIAA 2V54A 1NGSA 3FVQA 4L22A 5B7QA 3K0SA 4N5NA 4RA9A 2XI4A 4FI3F 3ZXUB 5FOVA 1P4HA 5CFLA 1BA2A 3SZRA 4YUXA 5DNUA 1I14A 3P4YA 8ATCA 4DR5B 5BYJA 4Y1RA 5I45A 1RQRA 3L8MA 1R5JA 4URFA 1X7GA 2FU5C 4EA6A 4BVAA 2AN3A 1KI9A 2JAQA 3L0ZA 4HH4A 5B4UA 3HR8A 4KQGA 3VDQA 4ESHA 4XD2A 5H16A 1D6SA 1Y82A 4BVEA 2NM0A 1BDMA 5ICFA 3KHSA 2D5LA 1KAMA 2CDAA 2ETXA 2FUEA 5KNCA 2EXXA 3LUKA 1H6AA 1ZMBA 5DLQC 2PS0A 2OBXA 1R9NA 3M34A 2YKQA 1I7NA 4ZXFA 3H84A 1UMBB 3O31A 2ZPTX 4YP0A 3LO5A 4GUAA 1U7HA 3RFTA 3EULA 4PX3A 2B9VA 2Y1OA 4YMSA 2JLAA 2W0SA 1YL6A 2F17A 2YDYA 4RQBA 4CWAA 5ADUS 4C4TA 1OZGA 1LSOA 1R27A 1ETHA 4GQIA 3B5JA 3FRHA 3HVHA 4FKZA 4G23A 4NCXA 1U0HC 1JR3E 1NIPA 3P9PA 3I5XA 3SX0A 1G6HA 1HG0A 1Q7CA 1XTSA 5FBQB 4EO7A 1DMRA 1A50B 1Q2UA 3AR2A 1HK7A 2GFHA 3NOOA 4NRDA 4RETA 4WADA 5U4QA 4KOEC 4HTFA 4HH0A 2WSLA 5KTTA 3D3EA 4DM7A 5G4LA 1PZGA 2C7QA 1OIWA 1RXUA 3NH9A 4IDAA 1SY7A 4ZVRA 1UPCA 3IOCA 4WXPA 4RAOA 3HH8A 1NU8A 2PLNA 1B0PA 2IZ0A 3NHWA 2BJWA 3R7WB 3ZGXA 2VLIA 3BTVA 1QZZA 2KPOA 4QG7A 5AJWA 1JTFA 4BGDA 2QW8A 1EGAA 1MKYA 2HA4A 1YB7A 3KUXA 2PV7A 4LHWA 3UV3A 5A0VA 3HSKA 4MWTA 3II6X 3DT9A 5IRCD 2FK8A 4X44A 1A2KC 4OUDB 2XTNA 2NU7B 5HM8A 1KJYA 3FVVA 4DQUA 1JTVA 1PWEA 2OTCA 5ALQA 3NDIA 2IEAA 2F6RA 4GQAA 1PQYA 3AILA 4BNDB 2C1EA 3S1LA 1L5LA 5FOUA 4E3ZA 3H17A 2OXCA 2DC1A 2VBIA 2VXYA 3TNYA 2OV8A 3ZQUA 2AR7A 2EP5A 5BOSB 1DBRA 2OAGA 1G21E 1SUCA 2DQYA 2EYQA 2PRYA 1SIUA 2ID9A 2X6RA 3CYFA 3LSYA 2ZEJA 4N7MA 3T06B 3Q7PA 2PUGA 2RFLA 1DAHA 4A6DA 5MDHA 3TVYA 2IOYA 1D8TA 3CZ4A 3DAHA 5IS2A 1E2IA 3KVNA 4F1WA 3VXKA 2OBYA 1NTOA 3PENA 5IN5A 1MP0A 1JAIA 2KLBA 3JAWA 4ZD6A 1SRRA 3CF4A 1BGVA 4OMCA 3W77A 2MMCA 2SBTA 3QFHA 2L0XA 3RC3A 2I9KA 1NNSA 3IVMA 5LCXA 5CG1A 1QGED 2B82A 3QP9A 4MKXA 4BBPA 4B5KA 4KE6A 1YJ8A 2AZMA 1PFUA 3VM6A 1OHHA 2H54A 3NPMA 4ZAWA 3IOBA 4R2KA 4DQLA 1JFFB 1Z3CA 1K2VN 3DJYA 2AS0A 2X9VA 2P2SA 2ODNA 3ITEA 3L41A 1AQYA 4BC1A 1WB4A 4QATA 4AS3A 2C2GA 4EMUA 5J1TB 5AM3A 5KTOA 1E7SA 2YWBA 4J0FA 5LQMA 2A7XA 3H5NA 1MRNA 1G5PA 3NLLA 4F71A 3AHHA 4DVGA 1EWRA 2D7DA 2XT6A 4RQAA 1L5FA 2QJTA 4RD4A 4MV1A 4Q4AB 5IDVA 3K9WA 3ENKA 2WY2D 3STUA 1OAOA 2EU8A 3CUUA 4YB8A 2JDIA 1FCJA 3IUQA 4BHTA 5KS2A 4I66A 1U0SY 4FYMA 4L7VA 1J5PA 4J1TA 2GH1A 1A1SA 4XW2A 4EYOA 3TPFA 1C4KA 3H1FA 2HADA 4TKZA 1OBHA 3CN9A 2FEOA 1C30A 3I04A 1TUBB 4EEKA 4PQYA 2JDID 1GAEO 1ORRA 1WKBA 2FPPB 3Q1KA 1BKDR 1MAHA 1AXRA 5I48A 1QO0A 1R4AA 3I2KA 3IALA 3OPMA 3SE7A 2QLMA 3OKFA 3C70A 4I4TB 5KAMA 1L8QA 2FG6C 1UWKA 3ANSA 1JWLA 4RTQA 1PWXA 4JSYA 4A8PA 4JVSB 2BHLA 4IJQA 4TV8F 1KI2A 1P74A 4IHJA 2G9ZA 1Z6YA 3F7NA 4MS4B 1T9GR 3EIEA 1FMCA 4QECA 3TWOA 4DLTA 5KDOA 2ZR7A 2XF8A 4EA7A 2QRKA 3PVZA 1K8XB 1RXEA 4JJEA 4NPCA 5ALTA 2IS4A 1NV8A 1KPGA 1KFJB 3M33A 3L06A 3D1VA 4RUKA 3ZX5A 2W2LA 3WLIA 3HB4X 3JZDA 5T8KA 4NESA 4EHLA 1EFCA 2DWQA 5FKJA 1CEYA 4LCJA 5WRFA 1ECBA 3OOWA 4GSLA 4KVZA 1P7CA 1U1EA 3DBLA 3EXFA 5SY4A 3AESB 1OBOA 1GCAA 1PGNA 4G0YA 1M74A 1WHSB 1PD0A 2W6PA 1STOA 3RAEC 2HLHA 3L6UA 5EY5B 1XTVA 5MFPA 3T5PA 5E1DA 2D6FA 3B9BA 1B14A 1JU3A 4QOHA 4DRYA 1B2RA 5H5JA 2GZRA 2XZOA 4AN1A 3RBVA 1PNRA 3CZAA 3EVTA 5CA0A 4B35A 1U7XA 2AL7A 2FJ0A 1EJ2A 3QV2A 1MB4A 4JYCA 1LD3A 4HZUB 2QNIA 3L1KA 4LDAA 4LJAA 4PY2A 3DCNA 4WZAB 4PG7A 3SKXA 3WRYC 4P7JA 4Q34A 4WCVA 1NDUA 5D2CA 5FUYA 3WSWA 5LYJF 4HEA1 4JB0A 4JT2A 1I3KA 3OF3A 1WPXA 2G80A 3AHFA 3QTBA 4F85A 4HNHA 2CLHB 3TF5A 1SR8A 1OH8A 4AP9A 5K3CA 4D8UA 4YO8A 4X71A 1VSVA 3R44A 1R7RA 3OEED 4A91A 2F8SA 1PZHA 3KSDO 4UMVA 2PFGA 3D4NA 4JR1A 4RTSA 1PX0A 3COWA 5KYWB 4H3HB 1E9RA 4BGVA 4O08A 8OHMA 2OO7A 3QNUA 1EX7A 1EIWA 1XCOA 2V6JA 1KP3A 1V25A 4ND7A 5EE9A 2B94A 4C4XA 4YMLA 3QVVA 4A4DA 4PG8A 5DTJA 4QKQA 5BURA 2VAVA 3S27A 1TJYA 1L7PA 2TMGA 3NHAA 4EJFA 4DT1B 3B8EA 5IG2A 3EMKA 3OZ7A 2OGWA 1TYAE 1FEZA 2ZR9A 2H2GA 4KE8A 4MNTA 4OXKA 4IZOA 4D45A 2H11A 3P9IA 5EP2A 4X3CA 4WEQA 4PM4A 4PHGA 3I39X 3OZSA 3PHCA 1ZH0A 4ADSG 4XGIA 4Z4QA 2B6HA 3LV8A 2YJGA 3HJNA 2FW9A 4ALLA 1QGAA 2PGLA 2P6RA 5SYAA 1E1CA 4F5YA 3JVDA 3L7LA 1HE2A 2FRDC 3UH0A 5DT9A 4U0JA 1EU1A 5AXCA 4KYVA 4HAUA 3KE8A 4CLOB 3FAZA 1USVA 4A8JC 1TVEA 2BFBA 5ALZA 3BYZA 5A0FA 4G1UC 4JAVC 5KWIA 3P4UA 4L15A 2HO5A 4PC3A 3H2KA 4NEHB 1JEAA 4MPRA 5TVGA 4TWAA 2W6JA 3W6PA 3MA0A 1HQYE 1WVMA 3L07A 1KZYC 3HI6A 2IXTA 3GIDA 2AXEA 3DEZA 3AIOA 3HR4A 3LOPA 3QEJA 1C50A 4LJ6A 5DEIA 4E31A 4FUTA 5JZVA 2BMWA 4AL4A 4G5SA 2I6QA 3KWFA 2X22A 4B3XA 3MLBA 5EP1A 3P9KA 5KJEA 1IHOA 2UVPB 1S2GA 2SHKA 1RWNA 1G8HA 1ZQ9A 3QBTA 4OU5A 5I9BA 3T9EA 3NDRA 5CXUA 4U2CA 3ZLBA 2CDBA 2DKNA 2V9CA 5FYQA 2FPOA 3KALA 2ASEA 1E9DA 2KSQA 1NT4A 5BRNA 2F3RA 3RSFA 3GY0A 2QVBA 3JPWA 3CZ9A 1ESNA 3OU7A 3KLNA 1J09A 3MWEA 4F3CA 5BN3A 4XWKA 3R4CA 5FTLA 9ATCA 4DR2B 4I46A 3LC0A 3EVAA 1N0IA 1RVV1 1YC2A 2XXJA 3D6JA 2M1ZA 1NUUA 3HY3A 4ZI7F 5IF3A 1VMAA 4P83A 3B1KA 1U2GA 3M4JA 3V4VB 3M9WA 3USES 5FLXA 1Z34A 5A4DA 5IAGA 1XTKA 2NX2A 4M8IA 4OJNA 4Q3CA 4CCYA 4M0LA 2FLWA 5DGTA 3OQPA 1IUOA 4QT0A 4DMMA 4GWKA 2H4HA 1U63A 3P1JA 1LTHR 1JDUA 1ML4A 3VH3A 4X20A 2B3DA 2W8ZA 1PUIA 1E5LA 1QO7A 1OLUA 2P4SA 3I6MA 4KR3A 1NQWA 3CUVA 4Q00A 4M22A 4EGFA 3DKPA 3Q98A 2OV6A 4L9AA 4ZQHA 3LXUX 3MGKA 3H8SA 1PWZA 1X7HA 3RWBA 1OT3A 1Y1SA 4LY3A 4KEAA 2JIRA 4K9MA 3OQVA 3GLQA 3D02A 5AKEA 3HBFA 2PGXA 2RHWA 5DK4A 5K7SA 621PA 2XTAA 1E5DA 2MSKA 3QY0A 2B0JA 3ZQKA 4PQFA 1B1AA 1R64A 1UMDA 2JC3A 4OV6B 3O91A 1JG2A 5JDIA 1R0ZA 2CV1A 1UKZA 3RNOA 1XQXA 1SQ6A 2JAXA 5UKDA 4XWGA 4TLAA 3ZHVA 2IYWA 1MDFA 1P62B 1LDGA 4BLOA 3OTOB 5CXQA 2J5BA 2SKCA 1YBAA 2QM7A 3D6FA 3AEQA 3U44A 4B3DA 1O57A 1CLUA 1QOZA 5FHQA 2OYSA 3HJCA 4EQ6A 2ZQYA 2NO1A 2Y8EA 4R84A 1XPUA 3K2EA 3ZGOA 3F1LA 1N8TA 1KP9A 3GRVA 1OI7A 1PSWA 3P2YA 5K09A 4QYIB 4M4SA 1HDEA 2WILA 3MXTA 3U3OA 4IVRA 4G36A 3COZA 3TSZA 1JEYB 1ZEJA 3DMGA 4BKPA 1KVRA 3JQAA 2W2MA 4UQOA 4OHUA 3FPGA 3P2IA 2OCKA 4M9QA 1E1RA 1M1YB 1W47A 3EOZA 4GUDA 5IC4A 2CFCA 4JK3A 3IXQA 4JYBA 4KX5A 4XLZA 1SOAA 5AXDA 1GM5A 1CUAA 2XJ4A 3Q7TA 3SXJA 3B1YA 2RHDA 3DAPA 1EX6A 4JSRA 4CLXA 3CG4A 3RHFA 4YRIA 5C9ZA 3BSYA 4JUFA 1SUIA 3JQAD 5KCMA 1W6RA 4ZHSA 4AKEA 4BNKA 3OQBA 4YTEA 3W5CA 3MTAA 4FT2A 1QVAA 4QTYA 1UJMA 4AQDA 1ZBDA 2WA1A 3AL3A 3C3MA 3DDOA 5KWSA 3IEVA 4Q93A 4OVKA 2FZKA 3TMKA 1RT9A 4BOYA 1VBKA 2QOEA 2RCNA 3MIIA 5JCJD 4A7PA 3PHHA 1XTRA 2M32A 3BE6A 1L3BA 1ULZA 3MM4A 2Z8YM 3SFTA 1TU4A 4FHDA 3AERB 4ZVSA 3F8SA 2X76A 2JD2A 1X9IA 2OK7A 2PGOA 3I34X 4P3PA 4FDLA 3UAZA 3KQQA 2GNAA 3T7EA 3GYBA 1YVEI 4P3NA 2GB4A 3BB1A 5FNVB 2VJBA 3BSFA 1U2ZA 1UBLS 2QU7A 2ZUUA 3H11A 3Q6MA 3QX9A 4J1NA 3DP9A 2R6FA 2H5EA 2G76A 3O3OB 1TIPA 2V6GA 2G0TA 4WLOA 5CMLA 4F6CA 3O2SB 1NU6A 2DLNA 4LRSB 3RRZA 3ME5A 1CRZA 4WL0A 5KC8A 2IYLD 5ITZA 3GNTA 2X0KA 5AW9A 1Z0ZA 3OTQA 1NYRA 4I1UA 2CHVA 1YZKA 2J3LA 2F4VB 1R4MA 3DBOB 2XQGA 5KREA 1BSVA 3WFJA 1U7DA 5IMSA 2RBKA 2ZT7A 3KPWA 2JGKA 2O8EB 4EECA 4DPMA 3WQRA 4IM7A 4A23A 2WAAA 3ACCA 4G67A 2Q6IA 2JGNA 5HJ2A 3AV0B 1VHWA 3L8FA 4C6TB 3D8UA 2RAUA 2HMWA 2VPZA 4LMBA 1YR8A 3CC8A 3CXUA 4KMSA 3WNVA 1PNQA 1T29A 2DB3A 1EBUA 3CRVA 3PE6A 3CKYA 5CT6A 1OSNA 3E53A 4IMJB 3V1UA 4OP2A 4B3CA 3INGA 1Y98A 2WM8A 1OE0A 2VPTA 3WGTA 1MH1A 4C6TA 4R0NA 1C7FA 2I8LA 1KDVA 4YJDA 1LNZA 1OLXB 4PZAA 3WICA 3PDHA 2AEMA 3H1BA 4NVRA 4D97A 4ENRA 3D3KA 3A2KA 1GDDA 2QP4A 3NIFB 4DIEA 5JRJA 3NHZA 5CVJA 4DR1B 1DQSA 1DCKA 1YFLA 3BF8A 3GLRA 1QF7A 5DPMA 4ESOA 2IHVA 2BFPA 2P5UA 3L1UA 5IBRA 3WIDA 3G1TA 3RG2A 1NR7A 1SGWA 4URWR 3T5TA 2QPAA 2TS1A 3F7OA 2CNWD