2ZRPA

Msreca datp form ii'
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
326
structure length
308
Chain Sequence
PDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functionally important movements in RecA molecules and filaments: studies involving mutation and environmental changes
pubmed doi rcsb
source organism Mycobacterium smegmatis str. mc2 155
molecule tags Hydrolase
molecule keywords Protein recA
total genus 80
structure length 308
sequence length 326
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2008-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 2zrpA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zrpA01
1MKYA 1CR1A 3ZVNA 2CEAA 1XTQA 2AKYA 2WWIA 1PLKA 1F60A 2A5FA 3F3YA 3ND8A 4TT3D 5JI2E 1X1RA 1BIFA 1XDBA 4XH9B 3EWAA 3WY9A 4IVPA 2MMGA 1Y3AA 2NGRA 2WJIA 3K0AA 1WF3A 2AXPA 2NZJA 3NWJA 3ZGXA 1Z0DA 2JJ2A 4JBXA 5KPJA 2X2EA 3FHOA 3GD7A 1IQPA 2J1LA 2NO1A 4N0DA 5FUXA 2A5YB 4NKRA 4QJ5A 4S35A 3T61A 1XEXA 3ASYA 4MRPA 4XTRA 1G21E 4PXAA 3VNVA 5HZHA 3TH5A 1ZD1A 1OXSC 5A4JA 4A2WA 2VTKA 5JLJA 4TL7A 3FMPB 1ZD9A 3I62A 2ZRGA 4MYCA 2BHRA 3EIHA 4JYCA 2QORA 1KJZA 2W6JD 3OE7A 4LC1A 4HAVA 2FSIA 3K0EA 3SJCA 3FFBA 2HYIC 4FCVA 5AK0A 3P4XA 1IAQA 1N6HA 4L15A 2ONJA 2Z4SA 3EPLA 2NPFA 4Q4JA 3R9XA 2GF0A 2DPXA 2W2TA 1G17A 3GJXC 4V03A 2A5DA 1KDOA 1UEJA 4TTPA 2PZGA 4LV5B 1OV4A 4IDHA 1DG1G 1UADA 3TSWA 1E2EA 4PANA 4ZKDA 4CT5A 5J40A 3U61B 1M34E 2ZJZA 1JR3E 1KI1A 4PC7A 2J7PA 1KI2A 1T8TA 3LBHA 3U2QA 5K8LA 1D2NA 3U44B 1G8FA 2O52A 4EJSB 4KITB 2HV8A 3UMRA 4DDUA 721PA 2HCJB 4H1UA 1Z22A 4HZUB 3I4LA 4KSCA 2AWOA 2KBEA 2WPDD 3SU8A 4OHYA 1ZU5A 1P62B 2JJ2D 2IYWA 2ODBA 4LPSA 5EXSA 4A2PA 2ZRFA 1E4VA 3ZLJA 3SYLA 5DI9A 4JKIA 1FQKA 3K09A 1Q1BA 4TTQA 4AG5A 4TN1A 3VTKA 4TYWA 1Q1QA 3PEUA 3DKVA 4HDCA 1LF0A 2OM2A 1A7JA 2O8CA 4JYBA 2BBWA 2R44A 1ZCAA 2C78A 4ZDWA 1CJVC 5JHHB 4A0HA 2A5JA 2J0VA 2WMNB 2YV5A 4XD7A 1E1QD 2YWHA 3L8ZA 3ICEA 4B44A 4XIGS 5KHOC 1P60A 2QAGC 1KI7A 2BEJA 2I1VB 3U3OA 4A0GA 1VDZA 1CU1A 3B2EA 5D3MB 3FVQA 4AI6A 1CP2A 3KFVA 1DG3A 3IGFA 3QBVA 5BWMA 1R0YA 1QF9A 4XVRA 1NN5A 3X1YA 1WMSA 3RWOA 5IK2A 4M22A 4UNPA 4V0LA 4XSHA 1MO5A 3TVTA 4BLOA 4OQFA 3LQQA 3A6PC 3TAHA 4BFWA 2OXCA 3OIYA 1ESMA 3W90A 5DYGA 1HA3A 1W47A 4NCKA 1B0UA 1HE1C 4JLJA 4URZR 1PJRA 3E1SA 2CJWA 4RSGA 4HLDA 1JJVA 1LS6A 3NXSA 4KLNA 2QP4A 4M1KA 4LX0A 5C1BA 2P3SA 2Z0MA 3O8BA 4BZPA 3CUEF 3KXIA 5C18A 2HLDD 1JAHA 2VL7A 2J0QA 2AL7A 1T5IA 4Q1AA 1OYYA 4HUQA 4KFSA 1VG1A 1OHHD 4F4CA 5IRCD 4UXJA 4HB4A 1AIPA 1AM4D 2OO7A 5AJXA 1G8PA 1SVOA 3EIQA 2O0JA 2QE7D 1MR3F 2N42A 3K9GA 1VCOA 1NVUQ 1Z6YA 2C99A 3CR7A 3I5XA 2MSEB 3LY5A 4A0RA 3CPJB 4XWAA 4GP6A 5HCNA 2XEXA 1G20E 1NN1A 4OQMA 1NL3A 4TWZA 1R5NA 1OT3A 3B82A 2JDID 3B1ZA 3QPUA 1GRNA 4MITA 2ZS9A 2ZETA 5DYIA 4ZDJA 1F2TB 1NLFA 2IXFA 2J0UB 4HLUA 1OFIA 1JXOA 4N1AA 2WWHA 4AG6A 1RRCA 1COWD 2ZS7A 4KVGA 1GL6A 4LBVA 1RW4A 4A92A 1S1CA 3PUZA 2XZOA 2CK3A 4AURA 221PA 2VRWA 2JLRA 2J59A 3I61A 2DY1A 3K0FB 1T6NA 1N0UA 4LJ8A 1SKYE 2E87A 4P31A 4B3FX 4DLXA 4BE7B 5CJ2A 1A5TA 4AKGA 2OBMA 1IY0A 3GLIB 1EXMA 2VHQA 4MQBA 4URUR 3AP3A 4GNKA 4BWYA 1DO0A 5JRJA 1LY1A 4C7OB 1NN3A 5CM8B 1AN0A 1IHUA 1ZP6A 3WYGA 1G7CA 4NHOA 4G3XA 5SZHB 2VP6A 5CDFE 1S96A 2QBYB 3GLFA 2QPTA 3LNCA 3IIKA 3O8RA 1JI0A 1Y63A 2IF2A 3L43A 1ZM9A 3UK6A 3W8NA 3A8TA 3R8CA 4Q1FA 3SI7A 2ZJ8A 3NG1A 3WHLA 3ZZTA 5LBIA 1E0AA 1KK3A 1P7CA 4NBSA 2FV8A 2QT0A 2CCGA 3ASZA 3UPUA 2O8DA 2VHJA 2JDIA 2V54A 3QEOA 5CIQA 3AF2A 4AK9A 3T06B 2G9NA 1UJ2A 1G41A 4OL0A 4KBFA 1EFHA 1WRBA 5CM9C 1GG2A 1X8JA 4O2RA 5FPHA 1IN5A 1KSFX 3WRYC 1SKQA 1AK2A 2QE7A 1FOEB 3H84A 5FUVA 1ZUNB 1AZSC 2OUKA 1Q57A 1P2UA 4IFBA 3A4MA 4KODA 1NKSA 4LBYA 4CT4B 4PHGA 3BGWA 2H18A 4JL8A 1E79A 2XAUA 1IBRA 1S9DA 1XCMA 5KNBA 3K0SA 1OW3B 3KKMA 2CXXA 4QJ3A 1S8FA 1HURA 2HXYA 1XMJA 3CLVA 1SXJE 2JJ1D 1NY6A 5FL7D 4Q7KA 3NEJA 1OIXA 1E9DA 1HYQA 1SXJC 1G3UA 2A7QA 4OI0A 4KCGA 3MAAC 4Q02A 3AP1A 4ABYA 1R7RA 4Q9HA 5TDHA 3H86A 2CE2X 4M9ZA 4NYIR 4QNMA 1HQCA 4MRVA 4P4UA 3TKLA 4URVR 1EX6A 5CYPA 4DCUA 1UDWA 3CZQA 1OIWA 4Q7LA 1LF5A 2CCJA 1DVRA 2KWIA 2AD1A 2V6IA 2WJVA 2RKOA 1O3YA 2BJVA 1YVDA 5KSOA 2V7QA 3O8CA 1Q20A 3SDZA 1E9CA 4HB0A 1OFUX 5BQ5A 3BK7A 1WQ1R 1G7RA 2UKDA 4EPWA 4IVRA 1W0KD 2W2VA 1R10A 2HT6A 4DLUA 1HTWA 1W44A 3BAFA 2H7VA 2R6DA 3Q5EA 2PL3A 3M4YA 4MYTA 5TVKA 3S1AA 3PEYA 5JCPA 3ZIAA 4MDFA 1QZXA 1AGPA 4K46A 2BBSA 4MYHA 4ZDKA 2RB4A 1R0WA 5B2ZA 1SHKA 2VSXA 3QPWA 1CJTC 421PA 4D0GA 1AQUA 2ZYUX 4LYHA 4TZ0A 5H70A 1G9XA 4UKDA 2F1RA 2C9YA 5FBQB 4JT4A 2JLXA 2OFXA 2VP5A 4G5SA 1KO4A 1J2JA 1XP8A 1KO5A 2D2FA 4GOJA 3CNLA 2IA5A 1LS1A 4EFNA 3OIVA 1E2KA 3LLUA 3CNNA 2BJWA 1DAGA 2QP9X 4RD0A 4Q9JA 1U99A 2IYYA 3G82C 4BEBA 5TB5A 1BYIA 4OJKA 4CW7A 2GCOA 2IC5A 1W0JD 4ZI3A 2ORWA 2FGJA 2ZJ5A 4HDQB 5CJPA 4GOXA 4F93B 3OIUA 5BN4A 1L8QA 4OK6A 3R9IA 5KO2A 3REFA 5FBVB 5AUNB 1X8KA 1AQYA 3S1AB 2FEOA 4OBEA 3NKVA 4FIDA 5DNYB 4FMCF 1E2IA 3KTAB 5FFMA 1K8RA 3NHBA 1Z6GA 1XTRA 2ZJAA 1CIPA 2IEYA 3W34A 3KZ1E 1EESA 1XTIA 1AGRA 4BPBA 4DZZA 2GAOA 5FTMA 4F4IA 4M1SA 1U8YA 5FPYA 1JEEA 3CF2A 4ZCIA 1P4SA 4BFVA 3DKPA 3U7GA 3SJAA 1S2MA 5TARA 2O5VA 4AYTA 1JQJC 1XRJA 3QG5A 1W4BA 3M0EA 1YE8A 2ZXUA 4TQ9A 4HAUA 1Z0AA 3BFVA 3B1VA 4CVNA 3EC2A 3EWSA 5SZIA 2FSGA 1WBDA 5EE5B 4JIMA 3PV0A 3ZJYA 1F2UA 5HKKA 1W4AA 5FL3A 4IJMA 3AVVA 4DEYA 3RRNA 3SQXA 1CBUA 4P33A 2OSBA 2CLSA 1SXJD 4US2R 3AVQA 1I2DA 2HXSA 2W6ID 3KJHA 4D81A 3B1WA 3OEED 1XXHB 3TQCA 1AA3A 2ZRMA 1ZD8A 4OQNA 5TXGA 3EPHA 1P6XA 2PX3A 4TYYA 1QHGA 3AKCA 4D25A 1M7GA 2BMDA 3P32A 3PUYA 3F0TA 4C0KA 4EJSA 1ANKA 1G5PA 1N6LA 1Z29A 4B3DA 3AP2A 4LRWA 1M8PA 1NP6A 2GJ8A 2ZRBA 5EE1A 1OB2A 2FSHA 2NO6A 4D4LA 4B47A 3HWSA 2Q0HA 3MWKA 3SHWA 2ZI7A 1Z0KA 3IIJA 5DHFA 2GJAA 2B7CA 2ZI9A 4CEHA 3RS7A 2C8VA 1RYHA 5DE3A 2GJSA 2B21A 4AKIA 1G3QA 4DXAA 2RGCA 3C5HA 4DSNA 4TZ6A 3QF4B 4FCTA 4IOJA 1N5JA 2BEKA 2AX4A 1KIMA 3RVBA 3GLIE 1QHIA 2NQ2C 4JJZA 2GRJA 4LHXA 4TLCA 5IF9A 4DB4A 1EFCA 2CLCX 2V8OA 4CYMA 4BGDA 2ZRKA 1ODFA 1HV8A 4PZLA 2CCKA 4YQFA 3ADDA 3KUDA 2WOOA 1Z6AA 5FTLA 1XF9A 1T0JB 5TY0A 4TLDA 1R8SA 2QENA 1XEXB 1T4GA 4B2LA 4DHEA 4YMUA 2GXSA 2X19A 2OG2A 1P5ZB 1RYFA 1W46A 1FX0A 5H68A 1N2CE 3X2SA 1TU3A 3OZXA 4RZXA 2EFDB 3QKUA 3X1WA 2XXAB 121PA 3LRPA 1NJGA 4RFSB 2P2LA 3GEIA 3E2IA 4EFMA 4O2LA 1MOZA 3VR1A 4CEJA 4GBMA 2ZSEA 1Z2CA 2OESA 5A5GA 1NMZA 1G1MA 3K70D 3IIMA 3T35A 3QJYA 5G40A 5E7MA 3RS3A 3SFVA 1NVXQ 4OYHA 3UWOA 4QBHA 1KSGA 3UXMA 1OB5A 1QHNA 4Q9IA 4Z51A 2HDNB 2WHXA 3QKTA 3TW4A 5JWOA 4ACAA 2X2FA 3OESA 3QKSA 5C2JB 4GFDA 3GJ4A 1L7VC 1XWIA 1Z06A 4JMPA 3UKDA 4D2IA 4TQAA 4M9QA 3ZS9A 1W49A 3DPUA 4US0R 1RKBA 4UNRA 2V1UA 2R62A 5SZKB 1G5TA 2RGBA 4JLOA 1U90A 4PPGA 4M1TA 3Q72A 2PCLA 4B6EA 1IN7A 2A3RA 2GCNA 3NEYA 3U6BA 1BOFA 2A9KA 4JLNA 1CR0A 3LVQE 1U81A 1FW6A 1ZIPA 2QUZA 4QHTA 1TQDA 2AK2A 4LY6A 4FCWA 1DAFA 1GNRA 1ZNXA 1J99A 2G1KA 3CPHA 2BMJA 2LKDA 2ZUCA 4YXWD 1LVGA 1WB9A 1YR6A 5HPYB 2IF0A 2WJJA 5FOWA 2O8EB 4C30A 2ZRNA 3AQ4A 4DBLC 3UMSA 3CZPA 5L3SB 1N6IA 3BWDD 2RH5A 3QPVA 3THXB 2H57A 4OHVA 5E95A 2W58A 1C1YA 4PPNA 3QKRA 2YKGA 5IT5A 4L8GA 3LV8A 4D4KA 5F3WB 1N6RA 4M1MA 3BBPA 2C04A 1MABB 2P65A 4UNNA 5DH9A 4L4UA 5FPSA 3OEHD 5TV2A 2ZRDA 2R65A 3OF5A 2AD5A 1H8ED 4NPHA 2Q3HA 4NYMQ 3VKWA 2BIFA 1T91A 1IJEA 2GK7A 3D3QA 4QL3A 2JLWA 2IYXA 1CR4A 4UXHA 2IS4A 3FOZA 1YQTA 1JQLB 1P2SA 4II7A 5KNCA 1U0LA 2Z4RA 5CK5A 5LB2A 1Z5ZA 3I32A 2R6FA 2ZIAA 3NBZC 1E32A 2F43A 3VR5A 4G01B 3MJRA 1VCMA 2WJGA 3BOSA 5FOVA 3I72A 3N2IA 4PHHA 4Q1DA 5BYJA 4V02A 4C2TA 1ZRHA 3A4LA 1RRPA 4LV8B 1N5LA 3P26A 5KDOA 4LCBA 1XCPA 4BECA 2JLUA 1SKYB 4PHFA 4DVGA 1VECA 1TF7A 3CNOA 4A0FA 3MFYA 1IJFA 2D06A 1VCIA 3SE0A 3JZAA 1E9RA 1BKDR 4YDHB 2G3YA 2EYQA 2JLVA 5HKKD 1KJWA 2OBNA 2ZAOA 2DR3A 2QM7A 4FMBB 5ELXA 3NDBB 4POAA 4IVQA 4Q7MB 1DAKA 1NVVR 2P6NA 2TMKA 5DHAA 1KY3A 3UATA 1US8A 2GVZC 4X8LA 2XNDD 3QKRB 4G5OA 4XTCS 4D4JA 4C0JA 4QOSA 4ZV4A 4R9UC 4NCHA 3U60B 3BORA 3TBKA 4KSBA 5JS7A 2P6UA 4WIAA 2IXGA 4H9GA 4ITRC 3QNUA 3A58B 2V9PA 1SXJB 3JVVA 2ZR9A 3KJEA 5EXPA 1NG9A 2JLQA 4NZYA 5K8TA 2CBZA 4HZUA 2J7PD 2QSYA 2H17A 1XEFA 3NDPA 1G3IA 2QG6A 1E2GA 3LXRA 4Q21A 2ZROA 1E2PA 4OI4A 3WNBA 3EA5A 2DFTA 4W5WA 1R6BX 3SEAA 3SBEA 5B58C 4HEJA 4LDJA 2XNSA 3W3AA 4JVNA 4N0EA 2YJTD 4TYQA 5KDLA 1W0JA 2EVWX 1BMFD 1R5OA 1YZQA 2CJWB 4PTLA 1RFLA 3I8SA 3W6OA 3QG1A 1WA5A 1NVVQ 5JHGB 521PA 1EFUA 1CRQA 2ZRHA 2VHUA 2QBYA 1CEEA 4YLGA 3TR0A 3ZS8A 1HEIA 1RE0A 3CBQA 1U2RA 4FMDF 2B6HA 2HEIA 2BKEA 4QGFA 5BN3A 4JKYA 2HCBA 2BCGY 4TL8A 2I3BA 5G41A 3C14C 2F9MA 3RSLA 3ZIAD 3EC1A 1HY3A 4GRAA 4LJ5A 1W36C 3R9WA 1ZM2A 1U8AA 2WVJA 1G4UR 2HYDA 2IK8A 4OQLA 3BE4A 4MRNA 2P0EA 3PIRA 4BFZA 2D74A 1OXVA 4OHWA 2QTHA 1OHHA 4Q4AB 4KFUA 4MDEA 4IW3B 5EP4A 4DCVA 1SVMA 3BB1A 3KL4A 4ARZA 3CWQA 4OHXA 2FOLA 3UANA 2XNDA 1OJLA 2HLDA 3FMFA 3SJBA 3RC3A 1KSJA 1W0KA 3MG9A 3BIFA 3K9NA 4D82A 4W5JA 5AUQA 3MCAA 4WZBE 2HT1A 1MV5A 3QIAA 5CLQA 2P5SA 3ETLA 4Z1MD 3DVLA 2F1IA 1DAHA 4NP6A 3QE0A 4QGGA 3AM1A 2H16A 4RD6A 4HUTA 1TQ6A 4JLBA 4TQUS 3NC0C 4M9XA 4GT1A 3VX4A 1MO3A 1XMSA 3WMGA 2RMKA 2QU8A 5EP1A 4EPVA 2GK6A 5J4KA 4LSGA 2OFOA 1D2MA 2FE4A 1GKUB 4HB2A 4TLAA 2FPLA 1EWRA 5FBWB 4U7DA 2QRZA 4UXIA 1TF2A 4LK2A 2RGNC 2VF7A 5F9FA 1XD2A 3WMFA 1RJ9A 4HDOB 4QXAA 1FTSA 4C0AC 3QKSB 4I1OA 2D3WA 3D8BA 3ZD7A 2FX3A 3FHTA 2IUSA 2GHIA 3WYAA 5ANRB 1UBGA 3VFDA 621PA 5JJLA 4FINA 3ZYCA 2ZI5A 3GQBA 3W8RA 4JZKA 3KKPA 2KB0A 1YJ5A 3HYRA 4H1VA 4HAZA 5J5CA 1OH6A 5GJVC 1JEDA 4JLKA 1NIJA 3LX5A 5KSZA 3GJ3A 1E96A 2ZEJA 4HAYA 3UG7A 1TADA 4MGIR 3HU2A 2ZR7A 2VP0A 4LYJA 2CHVA 4DUGD 4B3GA 4JT2A 1KK2A 2FFHA 2P5TB 3A1SA 4HLUC 4MKIA 2GNOA 1Z0FA 2K5UA 1S4QA 4Q4AA 4MGKR 3LFUA 4PQRA 2WIBA 2YNMA 1GFIA 4NE2A 1YZTA 4R2IA 4ZPXA 5GVRA 2ZJYA 4FMDB 1XCGB 4JLDA 3WP0A 4Z8XA 3AGQA 2WKQA 2QAGA 3NC1C 4XVUA 1UM8A 1IXRC 5DN6D 2KBFA 1E9SA 1VHTA 5F98A 2J0SA 3WXMA 4DLSA 2WOJA 1YHNA 4P32A 4LGMA 3QUSA 3HR8A 1G7TA 5CB6A 3FKQA 1SVSA 2X8AA 5KSYA 2O8FB 1HE8B 2WKPA 1BO6A 5JCZA 3L0PA 4I4LA 2MSCB 2ASEA 3NBXX 3GJ5A 1U94A 3EPJA 3BRWD 2FSFA 4B43A 1JBKA 3AF4A 3HPRA 2W6JA 1Z6TA 3CM0A 1YRBA 3DL0A 1GRRA 2GCOB 5JSZB 1CJUC 4RJLA 1OSNA 1P75A 2PLRA 2BC9A 3SC3A 3TVDA 1KZGB 2YHSA 2ZANA 1PUIA 3BJIC 5BW8A 4JL6A 4CEIA 2WSMA 4KJZA 3IQWA 5L8VA 5FH9A 1OIVA 2H5EA 2WBLC 3VR4A 3OHMA 3QVVA 1ZNWA 2AFHE 2BV3A 4F91B 4CF7A 2I1QA 5JEDA 2PT5A 2QSZA 4A15A 2NIPA 2CK3D 3VHLB 4DDVA 4V0OA 1P9WA 2ZRPA 1FUUA 1X3SA 3NVAA 2L0XA 4GSYA 1JECA 4D6PA 5JSZA 4EAQA 3G0HA 3MSXA 4TMVA 1JR6A 3DM5A 1GTVA 1K6MA 3BFXA 3N5CA 1KOFA 1YU9A 3GJ6A 3L0IB 3P4YA 1KKMA 4JJKA 4TT3A 3U7FB 1XMVA 3LW8A 1N5KA 1XFAA 3RABA 1TNDA 3VAAA 4IRUB 5DN6A 8OHMA 1R8QA 2BMFA 4B3XA 4OI1A 1IXZA 4HI0E 2LKCA 4DJTA 5H8WA 2YWGA 3FPAA 4IDNA 2FG5A 2Z5FA 4MRSA 4XSGA 4D80A 4N3NA 3GJ7A 1M2OB 2ZI6A 5JFGA 3Q8XB 1DO2A 2J5XA 1E2NA 1TF5A 3WNCA 1UEIA 4IFEA 3C8UA 5EE0A 1Z3IX 4OK3A 3CRVA 1XJ0A 2NZ8A 2FJUA 2H8KA 4TSFD 2IYUA 5KNDA 1GILA 2IT1A 2QZ4A 4G5RA 4A82A 1B23P 3RS4A 5LB4A 2ERXA 5FBRB 3F5FA 3LD9A 3KX2A 4RCZA 5FI1B 3ECCA 2ZE5A 2ZYWX 1ZIOA 4IEIA 2WKRA 2BVNA 4M4SA 1T8UA 5G53C 1YRAA 2W6IA 2RGGA 3CB4A 1YR7A 4OI2A 2XITA 1Z0IA 4RZ2A 1DOAA 1D9ZA 1JB1A 4B71A 2AK3A 2ZAMA 3IKJA 2JA1A 1LTQA 3AF3A 5AR1A 2ATXA 1F5NA 2ZSDA 1KI4A 2UVQA 4GP7A 5LD2C 2CL6X 3AVYA 4B33A 1S3SA 5JWRA 2GZDA 1W2HA 4RVCA 3P27A 2IW3A 4KFRA 4V0KA 3GP8A 4C3ZA 4PZYA 4D26A 2OCBA 3IBYA 3GFTA 1T3LA 2GETA 2WPDA 4ZO4A 1V5WA 4B35A 1Z83A 2PMDA 2BM1A 1F3OA 1MRSA 2YC2C 5BXQC 1R2QA 1JPJA 4F38A 4FMCB 2WAYA 2XJ9A 4BFYA 4TLEA 1M7HA 2FMXA 5IHPA 3RANA 4ZCLA 2ZJBA 2VP9A 1G3RA 5P21A 5HCIA 4MKHA 2CHQA 2REOA 1JR3A 2LCFA 1N6OA 2OE2A 1G3MA 4QKQA 3FHCB 2Z83A 2NO0A 2GEVA 1E2JA 3T12A 3ONWA 3OIWA 4M1OA 3NBFA 4LJ9A 1R0ZA 4KU4A 5UKDA 4V0ME 4BFUA 3CX8A 1Q44A 3I73A 2QP3A 1GNPA 3TUJC 3BS4A 1KMHB 2ONKA 1DPFA 1F2UB 4OQXA 4ZIRA 3ZVRA 2F3RA 3LDAA 2AHOA 3BH7A 4B3CA 2HUPA 4IOMA 1C9KA 4J0QA 3RRMA 2R8RA 3U4QA 4PO9A 2R2AA 2ZJ2A 2QPOA 2ZSFA 2FZ4A 3A37A 3OE7D 1RRGA 3AUXA 5HTKA 3AF1A 4JLAA 4JVMA 3ADCA 2IS6A 5JJKA 2VYFA 5G3ZA 1YZLA 3CIOA 2X1VA 2CL7X 1JJ7A 2VIIA 2GZAA 1TTTA 3K1JA 3LH5A 3SBDA 4FXPA 4URWR 2PMKA 2XOKD 1S0UA 3GLFE 5FI0B 2FPMA 1GKYA 4A4DA 5JMTA 1U9IC 3MWJA 4GOKA 2D7CA 4GMDA 4MGZR 1KSHA 4ZCMA 3EZ6A 4KXFB 1OYWA 1LB1B 3EARA 2CVHA 2DWQA 1XPOA 4A8JA 1P3JA 1KJYA 2SHKA 3QXHA 2IWRA 2OLJA 3CKLA 3MUFA 3GPLA 3W3ZB 2C5LA 1J8YF 2XB2A 2QL6A 5HE9A 4CZ2A 2ZRJA 2GJKA 1A1VA 1IN6A 1GWNA 3X1XA 1IN8A 4F92B 5HE8A 4ILEA 2JGNA 1KK1A 3UMFA 3IEVA 2V7QD 3TE6A 1AJEA 4AIIA 3QI2A 5EUQB 3R7WB 2EW1A 4Q48A 2VP4A 1UDXA 1ZW6A 2CNWD 3NBYC 3U5ZB 1ZC4A 1FPMA 5J4LA 2GILA 5KYKA 3IBGA 4Q4HB 2IEZA 4MH0R 5L3RA 2JJ8A 4LC0A 2E1RA 4LOAA 1Z2AA 4MUBA 4HAWA 1X6VA 2B8WA 3CH4B 1I4DD 1XXHE 4G5QA 1ESNA 4QGAA 4I81A 3AVPA 2FH5B 1J70A 4LBWA 5EUMA 2D2EA 3DHWC 3GLFB 1FMLA 4CDGA 3VKGA 2EFCB 2RHMA 4RY2A 3DOFA 4FN5A 1W36D 2A78A 3E70C 5B64A 2Q21A 2PEZA 2VF8A 4QNRA 3T1QA 2WJHA 2AR7A 3CX7A 3KFXA 2HJVA 1II0A 1HH4A 4QGHA 1II8A 1U0JA 2WSSA 1UKEA 3RC8A 4PPFA 4WW0A 3Q5DA 4BUJA 3C15C 4NL4H 4L9WA 1QHXA 2NG1A 1T3SA 4CRWB 2D62A 2JLSA 2IWHA 2J41A 2AXNA 3CX6A 4BLRA 3DMDA 2VBCA 3U3JA 1W1WA 4UNSA 4TYNA 2NPIA 2D4HA 4KLZA 5EZ5A 3TSOA 2AWNA 2NOAA 3A36A 2R9VA 1NLZA 2G0NA 3U3RA 3GMTA 4WAUA 1PV4A 2C2HA 3KJGA 2ERYA 1FX0B 3SR0A 3R8FA 1Q1EA 2KI5A 1V43A 4GZMA 1M74A 2PCJA 5TMPA 2XB4A 4QJ4A 1NBMA 5JBQA 1TL7C 3QY0A 4M8NE 1KY2A 1GIAA 2EFEB 4DT1B 3LX8A 3VHXA 4E22A 1XEWX 2Q3MA 4Z8YA 3PQCA 4KAXA 4R7ZA 5DIFA 3LWNA 3BFKA 3HU1A 5GJCA 1OXTA 4TMZA 4XVQA 4JLVA 1DTSA 3EG5A 5FTJA 2O8EA 3SNHA 2GVDC 3OAAD 2O8BB 5K8UA 2GAAA 5AJWA 1WCV1 2JATA 4PR0A 1TX4B 4WOPA 3AVTA 1CF4A 3BB4A 3BD9A 2H92A 4BZQA 1GUAA 2B92A 1XTKA 2FF7A 2F6RA 3GLHB 4KO8A 4L9SA 4Q1BA 4NH0A 1BS1A 2HF9A 4M53A 3LO5A 4WXPA 4C0BA 1N25A 1RRFA 5DO9A 4URYR 2XZLA 2RGDA 2XTNA 4A8JB 3GLGB 1YKSA 1D5CA 2OXRA 5C4MA 2IUUA 2C9CA 2GXUA 2PBRA 1E0KA 2V1XA 3B6EA 1XXHA 1FMJA 1Z47A 3LXXA 4U5XA 2RGXA 3RLFA 5CYOA 3EIEA 3FTQA 3A4NA 4IKEA 2CDNA 2VH5R 2JEOA 4Q66C 3QENA 4IHQA 2IBMA 2HJGA 1WE2A 1SVKA 1GDDA 3B9PA 3JZMA 2Q9CA 3ZQ6A 1XX6A 2DHRA 3VMFA 3T15A 4LWZA 3HU3A 3VNUA 3CF0A 4LUCA 3GEHA 3A1VA 1I4TD 4DRZA 3PEWA 2W2XA 1Q21A 4UQOA 1ZNYA 3O8DA 1KNXA 3QXSA 4JL5A 4F4JA 5EE9A 3Q3JB 1FL9A 2YYZA 3WMEA 4PO8A 2AN9A 3LAWA 2EFHB 5BN5A 1IN4A 5DI3B 4C0LA 3K0AB 4DWJA 3K70B 3AB3A 3I1FA 3W9YA 2RAPA 3RDPA 1D6JA 1FUKA 4C0QC 3RWMB 3CPEA 3AVXA 3TUIC 2YINC 4KVAA 4QG7A 1VG0B 4Q4JB 5AJVB 3WHKA 4CIDA 1E99A 2CNWA 1RJ9B 2R6GA 1MRNA 5CIWA 1QVRA 1YZNA 4MYUA 4BASA 2CLDX 2CHGA 4QRHA 4HLQB 1UFQA 3EA0A 4L5BA 3TSZA 5LPNA 5F9HA 1ZMXA 2WWGA 2A5GA 3EW9A 5CLLA 1PVOA 1G4AE 4UNQA 1DAIA 2BMEA 2VQSA 4EQ6B 1VCNA 3FMOB 3MLEA 4WVFA 3VQTA 4LYAA 4X8HA 1F2TA 2J0UA 5FOTA 2J87A 4B76A 4C2UA 2RCNA 1CRPA 1NI3A 3DM9B 4EPRA 2ZE8A 2YOFA 4V0MA 3X1ZA 3EXAA 2QNRA 4JSYA 2ZS8A 4Q47A 3U3MA 5AUOB 1E4YA 3BH6A 4K8OA 2BDTA 1ZCBA 3OFND 3KQLA 1CXZA 1VPLA 3CO5A 5JRZA 4A2QA 2GBLA 4YDSA 2EU8A 3HP1A 4E5UA 2PT7A 3KDSE 2ZSAA 1T0HB 4WZAE 4B74A 3SS8A 4PC2A 3N2EA 2QGZA 2WWYA 5DLQC 3GJ0A 5K8IA 1H8HD 1P72A 3B8HA 3MD0A 5J4YA 4WXRA 4IXNA 4AD8A 3T1TA 3CRW1 5JWHA 2OT3B 4P4SB 4Q1CA 2O0HA 3IILA 2DYKA 1GRQA 3EZFA 4C7OA 3GLGA 3EZ2A 4RKFA 1DS6A 3UIEA 1NF3A 2ZRAA 2N46A 2Q6TA 3PUWA 3IHLA 3A1WA 4TYPA 3B60A 2IYTA 3F8TA 2BWJA 3WBJA 1E0SA 4NYMR 1M7BA 3W6NA 4ARZB 1Q3HA 1X8LA 1ZINA 2F1HA 3DO6A 3K9LA 3KJIA 4Q5IA 1AS0A 1ZAKA 3H0KA 4HYYA 1VYTA 1E94E 1T5LA 1UKZA 4PAOA 1JXMA 3AVWA 3THWB 4U02A 1KGDA 2EQBA 3V4RA 5HR5A 3GCGA 1XTJA 2VHTA 4A9AA 1BMFA 1W48A 1N0VC 2PLFA 1P61B 2CL0X 4AC9A 3KB1A 3LLMA 2QQEA 1NJFA 1MABA 1EX7A 3K0CC 4XOIA 4ESHA 1IM2A 2HF8A 3PR1A 1LW7A 4JVSB 3ZH9B 4KYIB 3U7HB 4DCSA 4DLVA 4NCNA 3L2OB 3QEJA 4MUAA 4YMWA 4B34A 2VSFA 5SZJA 4AYWA 4C0HA 2Q9AA 3DMNA 3RS2A 1VYUA 4G0NA 3U44A 4JS0A 4B75A 3MWYW 3RS5A 1LFDB 2BKUA 5E7JA 2IXEA 3RS0A 4S2EA 5AJYA 2R6CA 4DEXA 3ADBA 4DIEA 4PX9A 4B3BA 3L82B 1H65A 3SYNA 1UBFA 2QQ0A 3I5YA 4I1UA 2N1BA 4DLTA 1NSFA 2WAXA 5GVSA 4BRWA 1ZVQA 2A2ZA 1A4RA 1EWQA 4GL2A 3C16C 3THYB 1KI8A 1YZKA 4NCIA 5DISB 3DZ8A 3IDQA 3VU9B 3VR6A 3EZ9A 2QMUA 4PHTA 2J7KA 2IHYA 2PZEA 2ZQ5A 3B7GA 2OAP1 3B85A 3B1XA 3K53A 1XJQA 2OFWA 4IXMA 2DFLA 1G5RA 2WM9B 4RCYA 1HUQA 3GJ8A 5JECA 3ND9A 2RGNA 1OXUA 4DKXA 3BB3A 2OILA 3AEZA 3BXZA 3PUXA 1W36B 4LJ7A 4E03A 5FOUA 2F9LA 4KI0A 4Q9KA 1G8YA 2O8FA 1TUIA 3AV0B 1EK0A 4IDPA 1GAJA 4URXR 3T1VA 1GZSA 2W83A 3B78A 2J3EA 1KZ7B 4C9BA 2BM0A 1UPTA 4BLSA 1Z07A 1H8EA 1Z6XA 2JJ1A 5C4GB 5KU1A 3VR2A 1KO1A 2IHBA 3H2YA 4NDZA 3GLHA 5DSZA 1QVAA 4R2HA 1UBCA 2D7DA 1SQ5A 1GSIA 3U7EB 1FTNA 3BERA 1PUJA 4R71A 4OHZA 1X86B 5FUWA 4DDTA 4DCTA 2WWFA 4I1SA 1CJMA 2QEQA 1QDEA 1SXJA 2C95A 2G83A 2REXB 3BH0A 2JIZA 3KKNA 5CB8A 5M04A 3K9HA 5EQTA 5KTYA 1YR9A 3PG5A 1U98A 1A2BA 1AKEA 3CH5A 3GLGE 1W4RA 2GF9A 2Y8EA 1YZUA 2YWEA 4NYIQ 4TMXA 4YC7A 1KMQA 1SVWA 4MGYR 3SOPA 5G3YA 2C77A 1E9BA 4E09A 2F55A 2QY9A 1E6CA 1XBTA 4GDFA 4CEHB 1HT2E 2IYQA 4PC3A 4PAQA 1CLUA 4IDOA 1ZM7A 3R20A 1TAGA 1YR8A 2NO9A 2OCPA 3IHWA 2IYLD 1OFTA 3DOEA 4IOLA 3RSOA 2ZYVX 1RC8A 1XZPA 4BLQA 2ZRCA 4FWIB 1PLJA 1RIFA 3TIFA 1QHYA 4GI7A 2YZ2A 3RRZA 3IQXA 2WIAA 1WBBA 1CKEA 2FFAA 2X77A 4P4TA 5FBLB 2QROA 1G19A 3Q7PA 2MSDB 2WWWA 1DE0A 2UZIR 2EFGA 3MRSA 2ODEA 4O3MA 3A1TA 1SGWA 2QRNA 2ZR0A 3GLIA 2XSZD 2FNAA 1ZBDA 3QXXA 2F3TA 2WWXA 4RZ3A 1E2LA 2B7BA 3U4QB 2IL1A 3MMPA 4Q01A 1GP2A 1DEKA 2ZJOA 2VEDA 4GPTA 4ASUD 1KO7A 1R4AA 3M1IA 4L16A 1Q1ZA 3I8XA 4B2PA 3THOA 3B5JA 4WBSA 4IDQA 5D3MA 1G6HA 4EJSC 1NLYA 1TQ4A 1JR3D 4EFLA 1ZUIA 2QMOA 1SULA 3X1DA 3UG6A 3EX7C 1KI6A 4Q18A 4QBIA 4BFXA 5KPDA 3FDIA 1QHHB 2CE7A 2CVFA 4NMMA 2ZI3A 4ESVA 4A8JC 3AUYA 3N70A 2QA5A 3THYA 3HDTA 2GXQA 3QSYA 3Q85A 3MJHA 1IY2A 1VTKA 3KQNA 3UWKA 4EQ6A 2QMHA 3EAQA 2EWWA 3V9PA 5FPKA 3C5CA 3CRQA 3AKEA 1GVNB 3KQHA 1FP6A 2YOGA 1FQJA 3WP1B 1E2QA 3C7KA 2IYVA 3PCRB 4DSOA 3O47A 1GITA 1KO8A 4DSTA 4R98A 4PQFA 2PX0A 2G0TA 5EP3A 4D0LB 4EPYA 4FW9A 1WP9A 1FNMA 1IONA 1Q22A 2VHCA 2OCYC 4MKFA 4RD1A 4D0NA 4PO1A 1NSTA 2WMOB 4E07A 1IXSB 2WV9A 2DWOA 4ZKEA 1DBSA 2REBA 1XEWY 5L3SA 2F7SA 2GJ9A 1GL9B 4B6FA 4C0SA 1TEXA 5E4FA 3LVRE 4BQSA 4BZXA 3WRXC 2O0KA 3KKQA 2QT1A 5DGXA 1C4OA 4I1VA 4PQYA 2V3CC 3CF6R 2XJ4A 4RD4A 1AS3A 3QQ5A 4M9SA 4PAMA 2WTUA 4DSUA 3PFIA 3KXLA 2XX3A 1UAAA 3WBKA 5JZVA 2QMEA 2WICA 1P9RA 5KSPA 4XD7D 2MMCA 2NMVA 1UKYA 4OKSA 4PC6A 3KQKA 4YMSA 3FB4A 3FFAA 1CJKC 2ZITA 3GLHE 3BC1A 1GNQA 4TSFA 3ZDQA 2QTVB 3NIBA 4XWOA 1PZNA 2G88A 4RFSA 5AJZA 5DI3A 1M6NA 1TU4A 4LJAA 3Q7QA 2RGEA 3VX3A 1AKYA 1NN0A 5CDFA 3THWA 2FDCA 1PLLA 3M6AA 2ANBA 1G7SA 2NO7A 1J90A 4AKEA 5JI3E 1SZPA 1D9XA 2O8BA 2FPKA 1NBME 2YWFA 4B73A 3ZVMA 3L0SA 3GFOA 2ZU0C 1E0JA 4DLRA 1GOTA 2EYUA 3KUCA 3NHAA 1KDRA 4Q9LA 1EFRD 3L8YA 2C98A 4P0TA 3EPKA 4FD2A 3DDCA 4YXWA 2J45A 3T1OA 4BLPA 1ZM3A 3HPQA 4EUNA 2I4IA 1OKKA 1IY1A 2QAJA 1Z0JA 1E1RD 1F48A 3HJNA 5EJEA 3ADKA 3NH9A 3I92A 2JLYA 1ZJ6A 4LZZA 4Q4HA 1P73A 4DLWA 5LD2B 2JASA 2WJYA 3TK1A 1VYVA 2E9SA 4M0LA 4W9MC 1CTQA 5A0FA 2ZRLA 2BBOA 1EGAA 1Q12A 1Q0UA 2ZU6A 3D7MA 2ECKA 2FFBA 4JLMA 4B2IA 5B57C 3THXA 5D3QA 3GEEA 2VPPA 2VLIA 4KFTA 1NBMD 1E3MA 1SVLA 2W0MA 4DC9A 1XD9A 4HLCA 2JLZA 3REGA 3B13B 2ZE7A 2OZEA 4KV9A 4RD2A 2OBLA 5L3QA 1VG9B 1RZ3A 1J7KA 2AFIE 2GBLC 1OE0A 1TMKA 4NYJR 4PSVA 3U3KA 2ATVA 1E98A 2GTPA 4Q1EA 2P67A 1VIAA 1CULC 1A82A 2GKSA 2XZPA 4A36A 2QAGB 3FGNA 3NTUA 4AY2A 4WA7A 4NONA 1FNNA 3ZQJA 2QPAA 4QHSA 1KAGA 2WSSD 3HR7A 4ZIRB 3AGPA 1OH5A 2JIZD 3LQRA 3QVUA 4Q4LA 1BYUA 2FN4A 5L3QB 3J81k 2F43B 4ZI2A 3RRYA 3TUZC 4DB2A 1ZYUA 1OH7A 2C96A 3H1TA 4Q19A 1MH1A 2RHDA 4AWXA 4M1WA 3EZ7A 3JVUA 1K5GA 1P9NA 4W5HA 3C4JA 4EPXA 1S3GA 4ON9A 1Q3TA 1XTSA 2FEMA 3ZZ0A 2PZFA 2V4ZA 3TMKA 2QGNA 3K0FA 1N5IA 4CEJB 1SVIA 2DB3A 2JAQA 3W5JA 2IYZA 4MKGA 4EIWA 3C41J 1LNZA 4JSTA 4M1YA 3R7WA 3AH8A 1E79D 3G5UA 2C9OA 5FL7A 3D31A 5JEEA 4QHYA 1P2TA 4PC1A 5C46F 2OLKA 4PSAA 1NRJB 3OEHA 1XZQA 2ZREA 3V00A 2ANCA 2J9RA 2FA9A 1DAEA 3P1JA 4Q03A 3CR8A 1G8GA 4CEIB 3CONA 5J4HA 4QBGB 1D2EA 2BBTA 4FWTA 2GWHA 4LJ4A 1XD2B 3OEEA 3AF0A 1UF9A 3Q9LA 5FUYA 2Z6VA 2DWPA 4HZIA 4QC2A 1XB2A 4QFMA 5KUTA 3SQWA 2ORVA 3FKSD 1E1QA 1KI3A 2OCAA 1NKTA 4Z1MA 2IUTA 4DLYA 3AKYA 2PH1A 1NIPA 2DCUA 1O87A 1N3BA 1QHHA 4BFSA 4LYFA 1SHZA 4A6XA 4P3YA 1KI6B 3RAPR 4HAXA 3MWLA 1N6KA 3DEFA 4MRRA 1KTVA 2W00A 1E2HA 1LV7A 1QG2A 4DT1A 3B1YA 4HSEA 5AUPB 1G8HA 3TRFA 3ZVLA 4DIDA 4JBWA 2XOKA 3PUVA 3WNDA 2G77B 2ZE6A 1AS2A 2ZM5A 2ZTSA 3CRMA 3IPYA 1KMHA 4TL9A 5J4VA 3K70C 2LWIA 3W5IA 4UJ5A 3CWZA 1KYIA 2GXAA 1VMAA 4B48A 1NY5A 5FR1A 4KHZA 4RD3A 1MO4A 4TTRA 1FP7A 5E7IA 4W7SA 4A1FA 2P6RA 1D8TA 2W0SA 4Q00A 2GESA 1GKIA 3K0CA 3MGCA 1VIYA 4PPQA 1G291 4TLBA 2Z43A 2VP2A 1E1RA 4UJ3A 4Y0VA 4G1UC 1RVDA 1WXQA 1EFRA 1Z63A 2QN6A 1G18A 2ZRIA 1ZM4A 2YC4C 1OLOA 3IO5A 3KKOA 4Q7JB 1KDPA 1OKKD 5FPTA 4YMTA 2ORIA 1U9IA 1F6BA 4F7WA 1QHSA 1COWA 3TJZA 1H8HA 5CK4A 4TMKA 3T5GA 4XJXA 5E3HA 5KDDA 2VSOA 1E9EA 4LHYA 4LPKA 4PFSA 4X8MA 1W7AA 1TEVA 1VHLA 2ZUBA 1KNQA 5EXXA 1TUEA 1TPZA 1ZNZA 4TMWA 2OAQ1 1ZUHA 3E5HA 1DARA 1G64A 3KQUA 3RYTC 3SZRA 5L3VA 1NMXA 4XWKA 3PJRA 1OH8A 2ZVQX 4ACBA 1TQ2A 1OXXK 2O8DB 1KKLA 5GJWC 3P20A 1XU4A 2C03A 2XTMA 1ETUA 3FWYA 2GDJA 2RGAA 3QF4A 3OFNA 4FI3C 1NG1A 3AVUA 3D6TB 2H1LA 2OHFA 2IS2A 1E69A 4JBYA 5EXTA 4BRUA 1OF1A 3TNFA 2ZUDA 4BLTA 3ZD6A 3LW7A 4HUQB 3VKHA 2KE5A 5CITA 2EWVA 3PENA 1W4CA 3FYHA 4Y0AA 1II9A 1G16A 2Q9BA 5EP2A 3LBIA 4DDWA 4G5GA 5IK2D 1W2GA 3SN6A 1FZQA 3W6PA 6Q21A 1DELA 1W5SA 5EE3A 3T34A 3FE2A 1U0HC 1XPUA 4NYJQ 2VA8A 3QOFA 3B9QA 2VO1A 3V4FA 1CS4C 4RZUA 2OEPA 4BFTA 3ZZUA 3VR3A 2ZYTX 1EFTA 4LJYA 2KJQA 3T5DA 2GEUA 1Z8FA 1GL7A 1T9HA 1E9AA 3QXJA 3TW8B 2BOVA 5FTNA 4B32A 1NVWQ 5GADl 4CGZA 1ZC3A 2PJZA 2GCPA 1UBEA 3AVOA 5B30A 1Z08A 2FWRA 3KTAA 3SYKA 5LDDC 1QRAA 3GFPA 4JVLA 2FGKA 3EASA 2FFQA 2G6BA 4M2LA 4US1R 1KAOA 1X1SA 1A2KC 1Z28A 3CW2A 2G1JA 2ZSBA 3TGPA 3TR5A 1KDTA 3SJZA 2GEDA 5IDVA 2KSQA 2ZI4A 4IOKA 1MO6A 1JAIA 2ZPTX 2FU5C 4ASUA 1YZGA 5AWFC 1XD8A 1FFHA 3DZDA 3HYTA 2XSZA 2DFNA 1W5TA 3LBNA 4K81B 4AYXA 1N0WA 2JCSA 4V0NA 5F2EA 2ODWA 2FZLA 1BH2A 1EG7A 4WZ6A 4EKDA 5EZ6B 4YMVA 5GJBA 4AKHA 1UKVY 4KYUA 1E9FA 2A30A 2J46A 5FOSA 3RNLA 1N6NA 1S1MA 1OFHA 5FOXA 2IX3A 1GM5A 4D4MA 3PXGA 3OAAA 4KBGA 4DCNA 3PVSA 3ICQB 2ODNA 1M1YE 3QF7A 2ZVPX 4IEEA 1R0XA 1P2VA 3IO3A 3TQFA 2IS1A 1AA9A 1XPRA 3KXKA 1DADA 3FMIA 3IPXA 5KOYA 4OJQA 4LHVA 4PSKA 3IEUA 4QM7A 1RPZA 4NCJA 1G6OA 1QG4A 1I2MA 2IYRA 2R6AA 4GZLA 1HT1E 3AKDA 1KK0A 1ELOA 4LI0A 2Q3FA 2YVUA 3IUYA 4NU0A 3QBTA 1JALA 2WZQA 4A6PA 2XXAA 1E2MA 4QBFA 1NMYA 1II8B 1N6PA 1VKJA 1L2TA 3A1UA 2O8CB 1IOZA 4OK5A 4LBZA 1AZTA 4PZZA 1T3HA 2GZHA 4X8OA 1KHTA 4TMTA 1ONBA 2AKAB 1K5DA 4LJ6A 4YONB 5J47A 1WDTA 4O0MA 2QTFA 3H4MA 4ZDIA 2CMKA 3LA6A 2V6JA 3FKSA 3U6KA 4RFVA 5FTKA 821PA 1QBKC 4TL6A 1L4UA 4LHWA 2XTZA 1OPXA 3VU9A 1E2DA 4EDHA 3L0OA 1VG8A 1NNEA 1I4LD 5JJIA 4I99A 1L4YA 1ZU4A 2B8TA 3QXCA 3NH6A 1S9HA 4LHZA 4M21A 4LV6A 4Z54A 4MA4A 1JPNA 4DUGA 3TLXA 4DLZA 2IYSA 1XNJA 2GA8A 2PEYA 1XMIA 2QI9C 2UZ3A 1XJCA 2F1JA 1U8ZA 4JLPA 4EPTA 4QM6A 2YOHA 3PEVA 3KB2A 5JS8A 1CR2A 3SHFA 1E2FA 4HB3A 3CRRA 3K8YA 5FR2A 4NTZA 3RHFA 1HQYE 4RKEA 1KI9A 2DBYA 4O25A 4HATA 4BEJA 1US8B 3WYFA 2OV2A 2QM8A 1R5BA 5HZKA 2NTYC 1DAMA 1J8MF 2V55B 4U00A 5BYKA 2PJRA 4GMXA 3TAUA 4C4PA 1JNYA 3I3SR 2DFKB 3K09C 3PITA 4ERNA 5H1YA 1MT0A 2BCJQ 3SFZA 4P4SA 2XGJA
chains in the Genus database with same CATH superfamily
1NUUA 2JZNA 5A4AA 2CV2A 1CR1A 4WKCA 2GR9A 1MX5A 1EUDB 3AEUA 3D5TA 3GF4A 1XTQA 2WWIA 2ISSD 3GW8A 1L4HA 2ZDQA 3HJUA 3F3YA 3MLAA 1R8YA 2B9EA 4B2YA 1SHLA 3TNLA 4MULA 3R0XA 3DZIA 4ZVSA 3H8SA 4KFCA 1F8FA 1KY4A 4ZO8A 4ZVTA 1K2WA 3EWAA 3ZWBA 4H77A 4IVPA 1K6IA 1YQGA 3HCOA 3ZDYB 4AZ0B 4ZEOA 1E5VA 3F6YA 3TGLA 2Q5QA 1F0PA 2R4QA 3L9WA 3UJDA 2ZTHA 5KPJA 3FHOA 2C1XA 2TRSB 1IQPA 3GD7A 4KQMA 4N0DA 3DFIA 5EWMA 5FUXA 4E51A 4JYAB 3TXYA 5CBPB 1NXVA 1XKLA 4S35A 1IEQA 4GYJA 3ASYA 4CMEC 4O4JF 3VNVA 3GP3A 3KT8A 3TH5A 1ZD1A 1GFSA 1OXSC 4I50F 4JXXA 1BX3A 2HSGA 2VTKA 3VO9A 3FMPB 5JPIA 3MS2A 3TXXA 2D2VA 5KKCA 3SSNA 2ZBVA 1BRTA 4C78A 1U7XA 4MYCA 4BP1A 4JYCA 4QQRA 3S44A 2QORA 2WIKA 3HCBA 3OZIA 3OE7A 5SYMA 1OWOA 3ICVA 3SJCA 4NENB 4Z6KA 4CDNA 3GUUA 3HB4X 5JPCA 3UJNA 4GPZA 2WEKA 3OSZA 1HZZA 1NATA 1PFQA 2ONJA 4YA6A 3T6KA 3EPLA 2W2TA 2DPXA 3GJXC 2V7EA 1ZDMA 3UC9A 2AJ8A 3MTDA 1RXSA 1KDOA 1RAIA 3EFBA 1WHSB 5IZ4A 2RD2A 1KRXA 1FYVA 1N32B 4DABA 3P5SA 2D5BA 3TQOA 1DG1G 3E0QA 4YRZA 1RIIA 3QUCA 3W7AA 3BJMA 3OO0A 3JQ8B 3EDYA 3RM3A 4PC7A 3W8RA 1KI2A 3VR0A 3AIOA 3U2QA 2WD9A 1EVLA 3JQCA 4DBVO 1MAHA 3NHYA 2V9CA 4KITB 721PA 2MR6A 1MJNA 1DIHA 2JAPA 2Z09A 3BMQB 1Y8AA 3L7OA 1JG7A 4B3TB 5EXSA 3Q3IA 2ODBA 2IYWA 2Z3VA 1ZIDA 5DOZA 1AC5A 2ZRFA 3WSVA 1UT8A 1GZDA 2C84A 3WWEA 5CLFA 2IY8A 1GCIA 1RE1A 3FKJA 4NBNA 3ZLTA 2C7GA 1JS1X 2E55A 3OOJA 3ELWA 4TN1A 5L3ZA 1QGZA 3WV4A 4BB6A 4TYWA 5F7ZA 2OD9A 4KOAA 2V3VA 4HMQA 3GGSA 2FPWA 1A7JA 5DNCA 4JYBA 1ZGHA 2R44A 1ZCAA 4C06A 2JBAB 4KO2S 1GUZA 1YAJA 3QEBZ 4W8OA 4XD7A 1RXYA 2YV5A 5DHTA 1GGVA 3RJZA 1ZRMA 2JGEA 1WXFA 3E1KA 3WDLA 5FPPA 4TS9A 3D54D 5KHOC 3WL8A 5K3EA 1J39A 3AIMA 5B2FA 4ZU3A 3EA4A 4A0GA 2DRIA 3DF9A 1VDZA 4IJ6A 5D3MB 3ROFA 2J3HA 4AI6A 2X9NA 4N54A 1CQPA 2HHCA 1DG3A 1LPNA 2J48A 3IGFA 2HMTA 4DIFA 1KYTA 1UIRA 3UN1A 5AI6A 4RACA 3UF0A 3C74A 4QU0A 4UTOA 1KVQA 3G5AA 4HH4A 3BPSA 1MO5A 4CV3A 4BLOA 4OQFA 5MGNA 1AQNA 2RBKA 4JCCA 5IC6A 4BNXA 4DARA 2DUJA 1HDEA 5KB3A 3LUAA 3NCHA 3UUWA 3W90A 3LPCA 5DYGA 3VISA 4NOKA 4OHMA 2LP4Y 4K9PA 2INGX 3SC6A 3BDVA 4LYGA 5G1NA 1TM5E 4LI3X 4RSGA 3VVBA 4HLDA 4JQOA 1MOQA 4LQ4A 1LS6A 3FLEA 4QPZA 5DPMA 4M1KA 4CI0B 1J0CA 1O0BA 2P3SA 3O8BA 4BZPA 5AQEA 2J9FB 2DUMA 5J1TB 1Q1NA 1K75A 5C18A 4DV1B 2J5KA 3OZEA 2POQX 4MCAA 3ZY5A 2C83A 5DDIP 4HUQA 1JPUA 1ZD3A 4PAGA 1ENPA 2Y77A 1IHYA 4C20A 1VKNA 5ADWA 1SVOA 2BEUB 1MR3F 4RWEA 3K9GA 1V1JA 1TYAE 3IOCA 3GJQA 5H16A 3VV2A 2VDLB 4U3JA 4ZAVA 2BAGA 1FDRA 4IO1A 2JA2A 1RP7A 2K2WA 1LBTA 4EI2A 1WZUA 2WHPA 4RTMA 2QM3A 4OQMA 1NL3A 4GR9A 1UT5A 1N2JA 1J0BA 2CXPA 3OIDA 4RF2A 4YACA 1U1DA 2ZS9A 3RROA 4ZDJA 1OWLA 2O20A 1NLFA 2IXFA 2WG1A 4HLUA 3BKXA 5EWJB 1OFIA 2QM0A 2AC4A 4AFNA 4V3CA 1R27A 1Z26A 4CDRA 4AG6A 4EG7A 1COWD 2V7BA 4JA2A 2BGMA 2CJYA 2GTIA 4KVGA 5CR9A 1CVLA 1I3LA 2AG1A 4LBVA 2Q62A 1OAKA 3DR3A 1HLFA 3EFHA 4XCVA 2CY0A 2EKLA 4A92A 3ANSA 3H18A 3PUZA 5KAPA 4AURA 3FNQA 3TVYA 221PA 4YT5A 2VRWA 2FYTA 2JLRA 2WUWE 3KSMA 4X54A 3GUHA 3D4IA 1UT6A 3EBLA 3K0FB 3I61A 2QV0A 4CM9A 4D8VA 3QVGA 1D2AA 1P17A 4LJ8A 2RAFA 2UYOA 1RQGA 4V0SA 1IBCA 1SKYE 2JGAA 4MQUA 4P31A 5THXA 1VMIA 3D5EA 3U7RA 3W4KA 4EJ6A 4CMCA 3ASUA 5C51B 2VNKA 4WOKA 5CJ2A 1EUCB 1YCDA 5IVKA 4URUR 3AP3A 4GNKA 2JGJA 2Z2XA 1LY1A 3DE6X 4JEUA 2I6TA 4DCPA 4H0CA 2JGFA 4M46A 2VP6A 1HE2A 1U4OA 5DEIA 2G9QA 4LE0A 3JSXA 2QBYB 3IMGA 2IHZA 3MMSA 3N7AA 3LNCA 4KX3A 3VPAA 4RY0A 5BMVA 5FUMA 1JI0A 2C3PA 1GQFA 1Y63A 1RJGA 1WD7A 1VL6A 1AE1A 2O23A 3D2CA 3W8NA 5HKLA 1R6UA 3R8CA 1YRQA 3IP9A 1LBIA 3D02A 4GUAA 4QAJA 3WHLA 3ZZTA 6ADHA 2HI0A 2NSJA 5HILA 2ECPA 4YROA 5JRZA 1J7JA 1EJ0A 2FV8A 2H63A 5K99A 4EVRA 1DINA 2QT0A 1M2HA 3IEXA 1OJ7A 1BX1A 3F71A 4I1YA 1YCGA 1YD7A 3C7TA 1YQEA 3PPIA 2GN2A 4MGHA 2YVLA 1ZUWA 1UFVA 3R9KA 3DFZA 4D9IA 2HLPA 1TW2A 1LW6E 3SPXA 2VATA 4ITUA 2ZTUA 3G2IA 4DR1B 4QRDA 1RHJA 1OCEA 1WRBA 1U0BB 3BIWA 2QGFA 3FBWA 1SKQA 3WYBA 1FOEB 1W9MA 4OP1A 5EKXA 3TBFA 4GBED 4PG6A 1P2UA 3A4MA 3AYZB 1NKSA 3GRCA 1J2EA 4KZKA 1L6RA 3BGWA 3DW1X 4YRRA 2V8BA 1OOEA 1E79A 1S6YA 4XJVA 5SY6A 2YV1A 2VTDA 1UH5A 1DKOA 3RS9A 1RWOA 2CXXA 5KBYA 3GZ4A 3UWSA 1OWMA 2QAIA 2GZMA 1HURA 4DDUA 2EAUA 2XKKA 4KLAA 1Q14A 3LCMA 5ENZA 5AKJA 5DP2A 1NY6A 1GGNA 5EJIA 4OM7A 3ZXUB 1F8UA 2FXVA 4Q7KA 2ICAA 3JQBA 1I6WA 5FL7D 3SDSA 3JAMA 1TM1E 4MJLA 5B3AA 2IX9A 3UT6A 4NFSA 1G3UA 2NXNA 1FSPA 4MV3A 4HNQA 3F6EX 1GFZA 4EHLA 3FLMA 3ENQA 1KZYC 1W96A 1ZESA 3R5JA 4KAJA 5TDHA 3R7DA 1K6JA 2AOTB 4YV7A 1NVDA 4QNMA 3QWBA 3OURA 3BX1A 4H4EA 4R2WA 2Z6QA 1IUKA 2H0AA 1CUHA 2PGJA 3AM5A 4IIDA 5EZYB 2IOFK 4NMHA 4DMFA 1Y1SA 4PN7A 4QWMA 3GPDG 1KQOA 1NOKA 5CYPA 1OIWA 1W4LA 3BMNA 4Q7LA 1URPA 4GL4A 5H9WA 5LZ4A 1MGPA 1DVRA 3OECA 3BTSA 1JDZA 5A9RA 3OT1B 4WOCA 3STXA 2BJVA 2IIBA 4RMJA 3O8CA 3SC4A 5CGZA 3V33A 3TINA 6LDHA 3SDZA 1SIUA 1YULA 3ZKWB 2R8BA 4U5QA 4R1SA 4B85A 3QMVA 3L5OA 3NHLA 3E7FA 1MT3A 3UZUA 3SMVA 2HHAA 4EPWA 1N2XA 2F67A 1MJGA 1W44A 1YGPA 3FD8A 1GPYA 3OTGA 4OHUA 1LPMA 1XRNA 4PLCA 4XX1A 2R6DA 5TVKA 2PL3A 3K4HA 5HZMA 2YKPA 2C94A 1EBBA 2RHHA 1IBSA 3GT4A 4UCXA 5JCPA 2CXSA 2PGNA 4RX1A 4BTEA 1QZXA 4K46A 1T1RA 4ZDKA 4OLBA 4G09A 5D6NA 4FU0A 5B2ZA 1SHKA 2XE4A 4QTYA 1GNTA 5AKKA 4DJDC 1Q84A 1CJTC 421PA 1J1UA 1AQUA 4LYHA 5HNKA 4TZ0A 4I46A 1NYTA 2BZ0A 5H70A 1THMA 1TYDE 2C9YA 5FBQB 5A04A 1IK4A 1LBEA 1UMBA 2MYNA 2OFXA 2PSFA 3W04A 1TK3A 1J2JA 4E6EA 3UAGA 2D2FA 2WYOA 1MA0A 4GOJA 4MHTA 3VI4B 4EFNA 1OY1A 1P81A 1OPRA 3SVLA 4WSOA 4RA9B 2BJWA 2DSNA 1DAGA 4N6OA 1U0GA 2GD2A 2GN1A 3C5VA 2M98A 2ZUVA 3H5OA 4LE1A 1FC0A 3GEGA 2PRZA 2O8VA 3DMRA 3HN2A 3ZV5A 4BX3A 3LUHA 2AIRA 2GCOA 3CCBA 4IINA 4CW7A 3I42A 4DL9A 2E48A 3FFXA 2ZJ5A 3EGXB 4IQGA 3PFWO 4L4YA 3U7IA 4U0JA 4K9MA 5PGMA 1SBNE 3G8DA 2IE8A 3RRBA 5BN4A 2NYVA 3NBKA 2OXEA 4N01A 3PE6A 1X8KA 1AQYA 1SBIA 1CJSA 3QVOA 4EY8A 4R2JA 4BS9A 2PPLA 3QTLA 4DANA 4ZI7A 3PA8A 3L7LA 1N33B 5HVNA 3RV4A 4Q6WA 3L6CA 4RYDA 3QXGA 3V48A 1Z6GA 3ABOB 3K16A 1RYBA 5AW2A 2Y0DA 3BCHA 2JHGA 3E9MA 1TZ2A 2OCGA 5FHRA 3DP7A 1GGEA 3R3YA 4ZHQF 1QGUB 1L5WA 3V5NA 1GTRA 4K9RA 4L5IA 2GAOA 3I0NA 3FPSA 1ZOIA 4MS3B 4PSCA 2IJGX 1MENA 1XRRA 3IKLA 4PVDA 5IN5A 4FGZA 1QH8B 2A0KA 4XDHA 3SJAA 4H7FA 1XRJA 1SOWA 3KE9A 3M0EA 1FU7A 3BXGA 3ESCA 4TQ9A 4TKVA 3CH6A 2TECE 2NYUA 3E05A 3EC2A 2P4HX 4IYRA 2A7XA 3V4VB 1DP4A 1WBDA 2WW8A 4QUHA 3C3AA 4PCAA 5JH7A 5JQGB 4EA9A 1W4AA 4H60A 4DEYA 3PI6A 1CBUA 1Z16A 4WK2B 4EG0A 1UXKA 5U1PA 4JLUA 1Z4JA 1SXJD 3QSGA 4RULA 1ZMOA 3PD7A 1RLMA 3KJHA 3NS7A 5JD4A 5T4HA 5K0GA 2YS7A 2BGIA 1ZD8A 5HA5A 5TXGA 7AT1A 4XM1A 3EPHA 2CVZA 4DLKA 3AKCA 3WLJA 2ILVA 1E2UA 2GAIA 1QIFA 3D0RA 2BMDA 2PV7A 5FNVF 4D25A 2I54A 5E1DA 5LQSA 5LQJA 1F9AA 4KXVA 4R2XA 3VR5D 4UTZA 2E18A 4OVKA 3U09A 1BE1A 1XG5A 3QUTA 4Z2AA 1Z29A 4LRWA 1YQQA 3OD5A 3PGLA 4HOYA 4OGLA 2X22A 3ES9A 3IPLA 1OB2A 3HKBB 2NO6A 4J7XA 2HDOA 2XADA 1CNEA 1GQ2A 2C29D 2DG2A 3REQA 3KWMA 1F51E 3CUUA 2ZI7A 4XDGA 5DHFA 2B7CA 2H4ZA 2ZI9A 4CEHA 3FAKA 4RE6A 4REMA 5IMSA 3R5FA 1T10A 2WU3A 2I91A 2B21A 3FWKA 3GIDA 4K5QA 1G3QA 4N0MA 5IM4A 1MAWA 2VJLA 2P30A 1SXPA 1ZGBA 4TZ6A 4FCTA 3AJ9A 3C5EA 4IOJA 1CDDA 1LQUA 2Y0CA 5CHEA 4LF6B 1QHIA 2P9FA 4JJZA 1IEWA 3OH8A 4LZWA 5GZ3A 2CLCX 2V8OA 2H5IA 3P71T 1MAUA 2PMEA 2ZRKA 1U8XX 2CCKA 3R2JA 2Y2VA 4PZLA 1OA1A 1LNSA 5FI3A 3O92A 4BLWA 3ADDA 5GGXA 5CMLA 2TSYB 1B74A 5EHXA 2Z30A 1TKAA 1DBPA 1XF9A 1T0JB 3G49A 5FTLA 4TLDA 1GTSA 5EPUA 5CH3A 5EVJA 2AZ4A 1T1SA 4B2LA 4BKRA 4DHEA 1E3JA 4O08A 3AOEC 5H68A 3S68A 5DM1A 4ZI5A 2PQ2A 1E6WA 4UDYX 4CXMA 3LRPA 3L7CA 2HMWA 2WYUA 2VYND 5CT9A 2P2LA 4DC1A 3E2IA 4RL6A 3KXPA 2Y1CA 4N0PA 5K4AA 3P2KA 3I64A 1PGOA 3R76A 3RAJA 1TIKA 3VYRB 1G1MA 3K70D 2GM4A 3G0BA 4ZQCB 3L4SO 2NU7B 2O2GA 3RS3A 2FRDC 3UWOA 1XV5A 4GVXA 4L8VA 2GF2A 1GGKA 1QHNA 3TD9A 4M1ZA 4YP0A 4EYSA 4D8TA 2FWIA 2WHXA 4PY2A 4Z51A 5JWOA 1Y7TA 1C3OB 2ENWA 1D6SA 2GCIA 2R1TA 2WA2A 2X2FA 2QN1A 3QKSA 4L6CA 2ATIA 3N28A 5C2JB 1L7VC 3K30A 1OZHA 1SUBA 1F2DA 5FI5A 3COSA 3RUHA 3T3GA 4M9QA 5ESRA 1XVLA 5EZYF 3ZS9A 2WI8A 3PA6A 3AFNA 5JFOA 1N9GA 4J1TC 5SZKB 1EA5A 3K15A 2QUJA 2RGBA 3UGKA 4JLOA 1DI0A 1RLOA 4PPGA 1U8FO 3PR2B 1ORIA 3WGMA 3UUFA 5BYBA 2XCTB 3FCYA 1KHHA 2C0PA 1QJCA 2GCNA 3NEYA 1IBKB 2C2KA 2R1VB 3LVQE 1ECPA 4JLNA 1OI2A 3EZNA 1ZIPA 3H5WA 8ATCA 1E8MA 1H2ZA 4X60A 3UFXA 4DYDA 3GEBA 4FCWA 1NF2A 2PSJA 1A9YA 1GNRA 2DPLA 3R5TA 4OBBA 4WBNF 3I12A 3PUIA 5B3LA 1I7DA 1WB9A 2ZUCA 3CNBA 4I4CA 3ZK9A 2IF0A 5HPYB 3V8NA 5FOWA 3VMMA 2CFSA 4M3NA 3MWFA 4DBLC 3GCZA 4B4DA 1HOXA 1QKIA 1N6IA 4N8DA 5CP8A 3SIWA 4M7RA 3X0DA 1WMFA 2AXEA 1WOYA 4OHVA 2W58A 4QUJA 4PPNA 5EG5A 1I94B 3P9NA 4XB6B 1U7WA 3LV8A 5BSEA 2V5VA 1ISJA 4G4JA 4D4KA 3R77A 2YYYA 2GPJA 3K6SA 1Y42X 3UW1A 1PEKE 3OCWA 3VKFA 2P65A 2VRCD 3TLJA 3W79A 3WDMA 2D00A 1V41E 4DCMA 4ZYYA 4OY3A 3LYUA 4L4UA 1I4WA 4K28A 4M0EA 2A14A 1LJ8A 2CGEA 2VJDA 3OF5A 4QO7A 3PICA 3IUBA 4GWKA 3VKWA 4LG1A 1R4MB 4FQ5A 4LWPA 2JLWA 1NVTA 2OHVA 3WGGA 1WPXA 4ROTA 2IYXA 2G72A 4U1RA 4UXHA 2DFDA 1SQSA 1L7BA 1P2SA 3A3PA 4L27A 1BCSB 5KNCA 3REOA 5LB2A 1E1CB 3GFGA 3V6LA 1GTG1 4IX9A 2YKQA 1JHYA 2L69A 3NBZC 4C2AA 3ESRA 4FVTA 4JBNA 4KR9A 4G01B 4KQEA 5TPZA 1MQ9A 5C80A 5I7SA 5FDFA 4P7FA 3BOSA 4R4JA 4AZTA 1WXGA 2JFYA 4JCOA 4JI7B 1XTZA 3Q3CA 4ZRMA 2GZRA 1QFZA 1JLLB 5ALUA 4U63A 1F5SA 3IVAA 3A4LA 1JHVA 5DBFA 5EZQA 1SR8A 4M83A 4QEDA 5TS2A 4CM4A 4O2BF 1KPIA 3B3JA 3CPSA 3QMPA 3BICA 3ZXXA 1QRUA 1XZEA 1SRQA 2G36A 2HMUA 1NOJA 3DUWA 3NT4A 1SKYB 1WXDA 4PHFA 4DVGA 1JKJA 3ZJVA 4GG1A 1TF7A 4A0FA 5TX7A 2R751 2GBFA 1MNQA 1YS4A 4WI1A 2QW8A 1L5HA 3DBLB 4XEHA 4Q7QA 3FSJX 1I10A 1X7GA 1E9RA 2XYHA 3B8EA 3LWBA 1I2CA 1BKDR 1VE1A 2ETXA 2JLVA 1MZVA 1L3IA 2NXEA 1KJWA 3IUQA 3JVDA 3R7NA 3SICE 4BMSA 5KWIA 1IMJA 2DR3A 1P1JA 1SFRA 1Z8DA 3P94A 3E1GA 1NVVR 2Z08A 5CT4A 4AUKA 5U4XA 3T1NA 2TMKA 1LX6A 1W19A 2ZWPA 3K2BA 1OBVA 1US8A 3LQ1A 4UHFA 1TDJA 4XX0B 1E6EA 1L3CA 4PW0A 1EHCA 5A6SB 5A9SA 4MVJH 1M6VA 3H97A 1V11B 5JMPA 6REQB 2J33A 5FFFA 4EHKA 3TBKA 5ICSA 1REQB 4LJLA 4KSBA 2PUEA 1UC9A 3PIIA 4BP9A 1K63A 4N6NA 1NBAA 2VRBA 4XE5A 1RI5A 4Z4CA 1WW3A 1YCHA 2NTNA 5FNVB 2QRMA 4KQCA 3W7BA 4ARAA 4J9VA 4CMGA 4EG4A 4FGJA 2XBMA 2UVPB 2CBZA 2FETA 3QJ5A 4HZUA 4IIVA 4L8LA 4XX0A 5EYPB 2H17A 4UUMA 2VT2A 4M60A 2HK7A 1KAHA 4Q21A 5ERYA 3LPAA 3EA5A 2DFTA 3QVJA 1W2WB 3FCOA 4W5WA 3WS7A 3UJ8A 3EW7A 2XNSA 1AKWA 4C89A 2EVWX 3Q4GA 1YZQA 4WGFA 3CU5A 4ENRA 4ZFNA 4QUKA 4OGWA 2J4CA 3WICA 3LGAA 1CRLA 3EFOB 1SQ0A 521PA 5JHGB 2FPOA 2ZRHA 2QN8A 1QANA 2I7VA 3EIWA 3FNFA 4RTPA 4YLGA 3TR0A 2K6GA 1RE0A 3JTMA 3VOBA 3T54A 1ZGZA 1U2RA 3FNRA 3KYJB 3ZE9A 4DBZA 2BKEA 4QGFA 4UM5A 4FBGA 4YVFA 1CHNA 2G1AA 2XA1A 4IQ4A 5BN3A 2I3BA 4G85A 5FYDA 5G41A 3C14C 4YCBA 2IP1A 3RSLA 3QYFA 5JR3A 3ZIAD 3T3NA 2Z8XA 3VKVA 1W1IA 4KPUB 5ESWA 5IASA 1W36C 2R8EA 4DQVA 3R9WA 1L1QA 1ZM2A 4UCQA 2WVJA 5KKAA 5A0VA 1YIAA 2HYDA 1SZCA 2H2DA 1O5OA 5LQUA 2JH3A 4GX0A 1Y8RB 5CG1A 1OXVA 2HREA 3J80A 4U2BA 2IHJA 1VE5A 2R97A 3R3XA 1X80B 4YRGA 1RCTE 5KNCH 1NVMB 4DCVA 1SVMA 4ARZA 5BMOA 2FSUA 4YI3A 1LLDA 3O82A 1AGYA 1WDKA 2GO1A 2AYXA 2HLDA 3SJBA 4PZCA 1KSJA 1KKUA 4GE0A 3K9NA 1YRHA 4H6WA 4D82A 3FYUC 4RSMA 4WNCA 1HNWB 4HPJB 4IICA 4P80A 5EJ2A 3G0CA 3QE0A 3WVNA 4BNNA 3AM1A 2LV8A 3FI0A 1T43A 3FRHA 3L4EA 1TQ6A 4G24A 1I0ZA 3TMYA 3BGSA 3ZW8A 3VZBA 3UXYA 3EDOA 4GC5A 5JE8A 3VX4A 1MO3A 1N9ZA 2Y71A 4JOCA 1BVRA 2OC9A 4UHJA 5K0BA 2QU8A 5EP1A 4EJ2A 1PJ3A 2GK6A 4I2NA 2C2OA 3GGCA 4HWGA 3H9GA 1Z2OX 1RI2A 2FE4A 1HLPA 1V1MA 3JAKB 2FPLA 1EWRA 3K6KA 3K8OE 3QLTA 4HB2A 5J23A 2QXUA 1NW7A 2QRZA 5D87A 1TF2A 2RGNC 2OO3A 4EM6A 1A9SA 2YVKA 3VUFA 4PPYA 1XD2A 2ZYRA 1WQ3A 4LK3A 3V2IA 5I7EA 1RJ9A 1EAYA 1GZHB 3DDSA 2IH2A 2QLJA 5A9SB 4TKUA 1PRYA 4I1OA 1EUZA 1X80A 2FX3A 5GGYA 5HX7A 3WYAA 4C7KA 2EKZA 2XB9A 1UBGA 1PJTA 2IW1A 4MLCA 2VTEA 1SCAA 2A86A 2ZI5A 4FE4A 2BFFA 2Z2JA 3AR8A 3HYRA 3N76A 4H1VA 1T2DA 4P5DA 4RVOA 3RARA 5HSGA 1OH6A 2FRXA 3BHJA 4JLKA 4LYYA 5KSZA 3GJ3A 2ZEJA 4HAYA 5ESXA 4HJXA 2J9ZB 2CFIA 1B8OA 1T9CA 5FA6A 2HO5A 3NO4A 2QN7A 1U9CA 3QFSA 4MKIA 4HLUC 3BMOB 3VPXA 1Z7WA 1S2LA 1XA4A 4JI2B 3HZRA 3DDOA 4Y2SA 1DUSA 2JG3A 2ZSUA 2UUAB 1VLQA 2LVBA 4JC4A 4NHEA 4O6VA 4R2IA 1WETA 1WW8A 2ACEA 2PGDA 3C98A 1WW2A 2H31A 4FMDB 4JLDA 3WP0A 5JW6A 1FBNA 5F5NA 1CY4A 3INRA 3OCCA 4MEJA 5IULC 4XVUA 3OZRA 1UM8A 5DN6D 2KBFA 1PTJC 5BV2P 3F3KA 3PYXA 1QAQA 3HI6A 2B83A 1S3IA 5B6PA 5KQSA 2WTXA 1M6EX 4H7DA 1KJJA 2WOJA 4P32A 4EL5A 4JQZA 2PYDA 2WM3A 1G7TA 3PF8A 5CB6A 2X8AA 3TRKA 1WXEA 1BO6A 2QHXA 2WKPA 5DHUA 7REQB 4OU4A 3L0PA 3L0YA 1U04A 4I4LA 4XDYA 3W0LB 1PG0A 2ID7A 2XMSA 3AESA 1O5IA 3NYQA 5CBKA 2FSFA 1O97D 1JBKA 3AF4A 3HPRA 4AF7A 4AROA 4GLJA 3QU7A 3OOEA 5K0CA 3FYDA 3DL0A 1H3NA 4MS1B 2E5LB 1I3OA 1OSNA 3SC3A 3ZD9A 1F0NA 1MX1A 2YHSA 4F96A 1WQ4A 1PUIA 4K2AA 1DJNA 2BHSA 1FUYB 4KDCA 4KDFA 1V8PA 4ZT2A 5AYVA 4KJZA 1I4EB 3UJ7A 3AKZA 1E3TA 5FH9A 1T4DA 1XCLA 1OIVA 3VR4A 2J09A 5G4KB 1E1DA 5CCDA 3OHMA 1DIGA 1K8QA 3QIVA 1ZNWA 2AFHE 2BV3A 2PSEA 4DFDA 2PK3A 1CV2A 3K2IA 4J49A 4LN1A 4EHDA 3VZDA 4F91B 5JEDA 5AK4A 5C8XA 4CFSA 3VHLB 3G2MA 3LP5A 1Y8QB 1CZHA 2ZRPA 1V5FA 4FK8A 4ZOEA 1A9PA 4OV6B 1RMQA 2RJNA 3RJ9A 2D1YA 5JSZA 2WC1A 3Q3VA 1GTVA 3WG9A 3V6MA 1ZD2P 4KLCA 3BFXA 3N5CA 1KOFA 1KZ9A 2WTBA 3GJ6A 3K1YA 3L0IB 3LRXA 3OPQA 4FFWA 1KKMA 4H7JA 1JFVA 3FM9A 4JJKA 4WKBA 3WYCA 4BB5A 1XMVA 3U7FB 3NIDB 4UE2A 3A05A 1TNDA 5HDBB 1SN7A 3WMXA 1WM1A 3LGSA 5CEJA 1VCHA 2QDXA 3DYVA 2JFXA 4C01A 3TOCA 4B17A 1O1YA 3IP7A 1E3WA 2PXAA 2JPDA 1IXZA 3EDCA 3WZLA 3ROEA 1C7ZA 4DJTA 5H8WA 4IDNA 5DM70 1K4KA 3OCZA 4WOJA 3JWPA 3GJ7A 2QZZA 5EMLA 3SHVA 1A8IA 4AKSA 3Q8XB 2VPWA 4NMLA 2GBPA 1BVUA 2HXGA 1TF5A 4GYWA 2GI4A 3MXOA 3QX9A 1TYEB 3C8UA 3A4IA 4LXGA 5IG2A 2RJ3A 1FJXA 3HCPA 2XI4A 3OU7A 4CL0A 2D5LA 1Z33A 3TZLA 1VKZA 1X8XA 1ECGA 3AEQB 5ETJA 4HPWA 4D9NA 2QE6A 4MYRA 3G0GA 5HRCA 3BA1A 4YPFA 4DWWA 4IPTA 3TEFA 3PD1A 2PQ0A 4A82A 2YIMA 4JX9A 1C8LA 1GCGA 3MMZA 3MT0A 4NXNB 3T3PB 5BN1A 2ERXA 3AM4A 2QV7A 3Q12A 4D57A 4B80A 3LD9A 1IMOA 1MJHA 4FFNA 2NSHA 4PYRA 1HBJA 5GONF 4FDUA 2C2YA 3ECCA 4FYHA 4AXBA 1ZIOA 2AQHA 3GJZA 3EODA 1T8UA 1SXHA 3QKWA 5BV1A 3EVGA 2FLWA 2XPCA 1AV7A 1Y3BE 3BF8A 3LTEA 4MW5A 4U2CA 1R18A 2R68A 5IXYA 2KW5A 1GT6A 4I6GA 4J0JA 2JA1A 1I1OA 1Q7RA 1CUGA 2PZ8A 2RI1A 5AR1A 1NVGA 1VLLA 4IAOA 2C0QA 3UT0A 2UVQA 1TC1A 2ZT6A 4IIFA 3KOWA 4CG1A 5IUNC 3DMTC 4QSHA 2NO4A 4KFRA 2NU9B 3INNA 4RGYA 4WBXC 4Q9DA 3VTAA 4C3ZA 5AM3A 3SWWA 4D26A 1WUHS 1PK8A 2NTEA 3A9WA 3AMVA 2R79A 3GFTA 4JBGA 1MEJA 1T3LA 1SVUA 2R5FA 5HXAA 5JO9A 4IBOA 2JAOA 4IILA 1MRSA 1KEPA 3OC6A 4DQ0A 1JPJA 4F38A 4P6VF 4FMCB 4IXWA 4MV6A 4BFYA 3FETA 2WHQA 1R9MA 3GT7A 1RQNA 4I1PA 1DIOB 3COZA 5LQAA 3ODGA 4JJ7A 4F1KA 5J2TA 2IEAA 3AR7A 9LDBA 1F8YA 3DOJA 2F8MA 3RVLA 2REOA 5NLLA 1JR3A 2LCFA 4DIKA 1OBHA 3ML1A 1WXWA 4QKQA 3FHCB 3TLMA 3CX4A 4U7JA 4I9NA 1E2JA 5MN6A 1U7OA 4G23A 3FSEA 4RPIA 4AJKA 3FYUA 2ZJ1A 3P9IA 3PFKA 4LJ9A 1LPPA 2ZIUB 4JU9A 2XVYA 5AW1A 5E2BA 1EU1A 4RBNA 3JRNA 3I73A 2J3MA 1V7CA 4BGUA 1GNPA 4NJEB 3RBAA 4ZAGA 1ZN7A 3TUJC 3MGGA 4H3HB 4MUNA 2ONKA 4XSVA 2HZBA 3JASB 3NATA 1NR1A 4HDAA 2F3RA 2X41A 3LDAA 1FYEA 2AHOA 4UM8B 1G8JA 2YQ4A 4A7PA 3RAEC 3IERA 3JWIA 1WTAA 4B3CA 4JK3A 3QNMA 5CVVA 1C9KA 1YIOA 3RRMA 4GIBA 4PO9A 3RB8A 1HEUA 3K31A 2ZJ2A 2QPOA 4DTCA 2ZSFA 2FZ4A 3FBTA 3IIIA 4KK3A 1RM4A 3WNQA 3A37A 2XYGA 2OZVA 3AF1A 5L4NA 2WTNA 2WUFA 3EVEA 2X1VA 5LYJF 1HX7A 2CHFA 2JARA 3L8HA 3TOXA 3RVQA 2BE7A 2JGDA 3BRWA 2A33A 5CDSA 1S0UA 2UYQA 3GLFE 1UODA 3QZUA 4QT4A 4J07A 5JMTA 1KJNA 3MWJA 4GOKA 2XNJA 2XVXA 4GMDA 4IIJB 4F3NA 3EZ6A 4A03A 1DRUA 3T7SA 2A3NA 1GV0A 2BGKA 5C5IA 5JSQA 2RGUA 3NU1A 3ONFA 1NRXA 3DAYA 4N5LA 4IDGA 4X97A 3WWOA 1KJYA 2OCLA 2I4TA 2OLJA 3A6HA 3GPLA 2HW8A 1WU8A 1LBHA 2EIHA 2C5LA 1J8YF 4FGSA 1PR4A 3GN2A 3MPUA 4X6XA 3OZTA 5EHNA 4C6HA 5C0OE 3WX0A 1GFWA 4K88A 5HKAA 4XJSA 2ID9A 2GJKA 2RSLA 4LMRA 4ZVLA 2P78A 1A1VA 4HDMB 3ZDXB 4RGVA 2VCYA 1XR3A 2NZVG 5AHOA 3E18A 3UMFA 4GS5A 4QWWA 1V39A 2IIPA 1AJEA 3UPDA 5JAUA 1ACMA 4LNUB 3R7WB 1RXWA 1HXHA 4BVEA 2VP4A 2ZM6B 1LXCA 4TV9B 1ZW6A 2CNWD 3W77A 1VMDA 3U5ZB 4Z9BA 4B4KA 2GILA 2AUMA 4EHHA 5KYKA 2GPAA 3EGOA 1NNSA 4NJMA 4QYSA 2O5CA 5JRDS 5AVJA 3D4LA 4IHKA 1TA4A 3D8HA 2GASA 3NOQA 4MH0R 4LC0A 3D3EA 4LOAA 5IS2A 1SA0A 1PDOA 1Z2AA 2QRHA 5A4DA 5KVVA 3HUFA 2ZKLA 2EZ4A 5MDHA 1AHIA 1X6VA 2FUG6 2V5UA 3NVMB 3CH4B 2SBTA 1V0JA 1JFFA 1JI3A 3P0HA 4QXPA 1F2VA 1LSUA 4RK0A 4RK1A 5KJ6A 4MWOA 2IE0A 3KELA 3ZI0A 4B6RA 4W5QA 1ZSVA 1YB6A 5BMVF 1X42A 1UK9A 2EFCB 1QYVA 2O1XA 3DOFA 1H6DA 3E70C 2XUPA 3DS8A 3PHLA 1PJCA 3PCXA 1TO2E 1PGJA 2PKRA 3UK7A 5TEWA 3GBPA 4BQFA 4CHTA 1RZRD 3O95A 3RC8A 1Y82A 5B12A 2VYVA 1G63A 3K5HA 2FPPB 1KAQA 5IW8A 3C15C 3AR5A 4R1PA 3T7AA 4GR4A 3ACDA 1PGPA 1H4TA 3DW3X 3IPRA 5CVDA 1R4NA 2L42A 4TXJA 3WGYA 3IJPA 2JLSA 1CCWA 3HDVA 4GE3A 1UPXA 4PG7A 4IMRA 3LPDA 3NTQA 1W1WA 4XGKA 1GTL1 1UFRA 2NPIA 2D4HA 1WV1A 5K8TA 2NOAA 2R9VA 1NLZA 2J67A 4YV2A 4GZ5A 4ND5A 3ZPXA 2W6CX 4PN3A 3KPYA 1O9HA 4CCYA 2GEJA 1RQPA 3ANYB 4HDRB 4BZWA 3R8FA 2O6HA 1V43A 4BKMA 4BV2A 1BFUA 2ZIFA 5ER6A 4YRPA 4ARVA 4QUIA 1DCTA 1TTQB 5F7XA 4DT1B 2HGSA 2EFEB 3LX8A 1OYVA 5F21A 4FGKA 4TGLA 5B1IA 2FKAA 1K8YB 2HMVA 4AY3A 1WDLA 1Q7BA 2WF6A 2O3RA 4KAXA 4Z8YA 5DIFA 4BTVA 4DOMA 2X5XA 3BFKA 3C3WA 4P5PA 1KYVA 4ZT5A 4TMZA 1YXMA 2Z56A 4IGKA 4XVQA 4WNIA 1DTSA 2CDBA 1Q0LA 3IQDB 4IJVA 1DKMA 1B0ZA 3AR4A 3I2KA 1TCUA 2XKAA 1PL0A 2GD0A 5EMJA 5I5GA 3OPXA 1SZJG 3SNHA 2GVDC 2R8PA 3OAAD 3V4SA 2O8BB 1LBSA 3RGGA 2PO7A 5F4ZA 4OLAA 4PR0A 1TX4B 4B7XA 1KU0A 2H92A 4MAMA 4BZQA 1Y1LA 4L9SA 1VP3A 1X19A 4KO8A 3OT5A 2ZPAA 2GK4A 2FTKE 1DO8A 2E4WA 1U1GA 1OLXB 4M53A 2NQ8A 4C0BA 3DWFA 5IXSA 4AMZA 1R0BA 2ABWA 2HA4A 2XDQA 4URYR 2FSVA 2XTNA 4G1MB 4GC9A 1J07A 1QKKA 1U2GC 1YKSA 2PKWA 1U0FA 1CSEE 4UHDA 5C4MA 2OUIA 3OO1A 1MN6A 4FFVA 2G82A 1AMNA 2OO5C 2ID4A 2X3UA 4ZP1A 3KPWA 1XXHA 2F3SA 1FMJA 2RHGB 2V96A 3GLSA 3UJ6A 4ER6A 1FRZA 1X7YB 2OAGA 3DL2A 3PX3A 2DOKA 5CYOA 3EIEA 2CUZA 1I8TA 1T4BA 3AI2A 1L5KA 4Q66C 3U9LA 2G17A 2JIDA 3QENA 3OCVA 3MBOA 4YUVA 3HDGA 1SVKA 3JZMA 2FW8A