2ZRRA

Crystal structure of an immunity protein that contributes to the self-protection of bacteriocin-producing enterococcus mundtii 15-1a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
83
structure length
83
Chain Sequence
GDDRRKKAEVIITELLDDLEIDLGNESLRKVLGSYLKKLKNEGTSVPLVLSRMNIEISNAIKKDGVSLNENQSKKLKELMSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mutagenic analysis of a bacteriocin immunity protein, Mun-im
pubmed doi rcsb
source organism Enterococcus mundtii
molecule tags Antimicrobial protein
molecule keywords Mundticin KS immunity protein
total genus 31
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2008-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08951 EntA_Immun Enterocin A Immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.140 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2zrrA00
2IP6A 2K19A 2ZRRA
chains in the Genus database with same CATH superfamily
2RADA 3DA3A 1W3SA 3UITA 3B55A 1SJ8A 3L0IA 3FVVA 3JSBA 4YZCA 2E8GA 4Q9VA 2L1LB 1U5KA 2FUG1 2FEFA 2JB1A 2YFAA 3I9V1 3KP9A 4PL5A 2F66B 2ZRRA 2XTQA 3AJFA 2JB2A 2QGMA 2KKMA 4Z7HA 4PL3A 4GXTA 3LJ1A 2IP6A 3IAS1 4NV2A 4Z7GA 2JBWA 4YZ9A 3LJ0A 3P23A 2ETDA 2FU2A 3FBVA 2RLDA 1JQOA 2CAZB 1TDPA 2QZGA 2V6EA 2MJFB 3DO9A 2A2CA 3Q8DA 4HEA1 4NV5A 3F4MA 2GSCA 2ZW3A 2YFBA 4JCVE 2XTRA 4I1TA 2QSBA 4PL4A 2JB3A 2K19A 4G75A 3LJ2A 2BL8A 5LNK1 4OAUC 4AS3A 1YO7A 2A2DA 3SDJA 4U6RA 4OAVB 4HFVA 3FNBA 4O1PA 4AS2A 3IAM1 2HGKA 4YZDA 5HGIA 3VA9A 2F6MB 4G76A 2V1CC 4DWLA 3DA4A 2XMXA 2RIOA 2P22B 2BL7A 2JAEA 4O1OA
chains in the Genus database with same CATH topology
4OAUC 4AS3A 3DA3A 1W3SA 1YO7A 2KKMA 2A2DA 4G75A 4U6RA 3SDJA 4OAVB 3UITA 4HFVA 4Z7HA 4O1PA 2V6EA 2MJFB 3DO9A 4PL3A 4AS2A 3IAM1 1SJ8A 3L0IA 4GXTA 3JSBA 3LJ1A 4YZCA 2A2CA 3Q8DA 2E8GA 4Q9VA 4YZDA 4HEA1 4NV5A 2IP6A 3F4MA 5HGIA 3VA9A 3IAS1 4NV2A 4Z7GA 2F6MB 1U5KA 2FUG1 2L1LB 2V1CC 2JB1A 2YFAA 3I9V1 3KP9A 2YFBA 4G76A 4JCVE 4DWLA 4PL5A 2F66B 2ZRRA 4YZ9A 2XTRA 4I1TA 3DA4A 3LJ0A 3P23A 2XTQA 2XMXA 4PL4A 2JB3A 2RIOA 2P22B 2K19A 3AJFA 2JB2A 3FBVA 2JAEA 3LJ2A 4O1OA 5LNK1 2CAZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IP6 A;  2K19 A;  2ZRR A; 
#chains in the Genus database with same CATH topology
 2RAD A;  3DA3 A;  1W3S A;  3UIT A;  3B55 A;  1SJ8 A;  3L0I A;  3FVV A;  3JSB A;  4YZC A;  2E8G A;  4Q9V A;  2L1L B;  1U5K A;  2FUG 1;  2FEF A;  2JB1 A;  2YFA A;  3I9V 1;  3KP9 A;  4PL5 A;  2F66 B;  2ZRR A;  2XTQ A;  3AJF A;  2JB2 A;  2QGM A;  2KKM A;  4Z7H A;  4PL3 A;  4GXT A;  3LJ1 A;  2IP6 A;  3IAS 1;  4NV2 A;  4Z7G A;  2JBW A;  4YZ9 A;  3LJ0 A;  3P23 A;  2ETD A;  2FU2 A;  3FBV A;  2RLD A;  1JQO A;  2CAZ B;  1TDP A;  2QZG A;  2V6E A;  2MJF B;  3DO9 A;  2A2C A;  3Q8D A;  4HEA 1;  4NV5 A;  3F4M A;  2GSC A;  2ZW3 A;  2YFB A;  4JCV E;  2XTR A;  4I1T A;  2QSB A;  4PL4 A;  2JB3 A;  2K19 A;  4G75 A;  3LJ2 A;  2BL8 A;  5LNK 1;  4OAU C;  4AS3 A;  1YO7 A;  2A2D A;  3SDJ A;  4U6R A;  4OAV B;  4HFV A;  3FNB A;  4O1P A;  4AS2 A;  3IAM 1;  2HGK A;  4YZD A;  5HGI A;  3VA9 A;  2F6M B;  4G76 A;  2V1C C;  4DWL A;  3DA4 A;  2XMX A;  2RIO A;  2P22 B;  2BL7 A;  2JAE A;  4O1O A; 
#chains in the Genus database with same CATH homology
 4OAU C;  4AS3 A;  3DA3 A;  1W3S A;  1YO7 A;  2KKM A;  2A2D A;  4G75 A;  4U6R A;  3SDJ A;  4OAV B;  3UIT A;  4HFV A;  4Z7H A;  4O1P A;  2V6E A;  2MJF B;  3DO9 A;  4PL3 A;  4AS2 A;  3IAM 1;  1SJ8 A;  3L0I A;  4GXT A;  3JSB A;  3LJ1 A;  4YZC A;  2A2C A;  3Q8D A;  2E8G A;  4Q9V A;  4YZD A;  4HEA 1;  4NV5 A;  2IP6 A;  3F4M A;  5HGI A;  3VA9 A;  3IAS 1;  4NV2 A;  4Z7G A;  2F6M B;  1U5K A;  2FUG 1;  2L1L B;  2V1C C;  2JB1 A;  2YFA A;  3I9V 1;  3KP9 A;  2YFB A;  4G76 A;  4JCV E;  4DWL A;  4PL5 A;  2F66 B;  2ZRR A;  4YZ9 A;  2XTR A;  4I1T A;  3DA4 A;  3LJ0 A;  3P23 A;  2XTQ A;  2XMX A;  4PL4 A;  2JB3 A;  2RIO A;  2P22 B;  2K19 A;  3AJF A;  2JB2 A;  3FBV A;  2JAE A;  3LJ2 A;  4O1O A;  5LNK 1;  2CAZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...