2ZRRA

Crystal structure of an immunity protein that contributes to the self-protection of bacteriocin-producing enterococcus mundtii 15-1a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
83
structure length
83
Chain Sequence
b'GDDRRKKAEVIITELLDDLEIDLGNESLRKVLGSYLKKLKNEGTSVPLVLSRMNIEISNAIKKDGVSLNENQSKKLKELMSIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mundticin KS immunity protein
publication title Crystal structure and mutagenic analysis of a bacteriocin immunity protein, Mun-im
pubmed doi rcsb
source organism Enterococcus mundtii
molecule tags Antimicrobial protein
total genus 31
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2008-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08951 EntA_Immun Enterocin A Immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.140 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2zrrA00
2K19A 2IP6A 2ZRRA
chains in the Genus database with same CATH superfamily
2V6EA 4GXTA 3IAS1 2XTQA 4O1PA 3UITA 2QZGA 2ETDA 3L0IA 3B55A 2YFAA 4PL4A 4Q9VA 4O1OA 3KP9A 1TDPA 2A2CA 3DA3A 3FNBA 5LNK1 2KKMA 4OAUC 4HEA1 4DWLA 1W3SA 2F6MB 4YZ9A 2XMXA 3IAM1 2HGKA 5HGIA 4HFVA 2FU2A 2F66B 2RIOA 1SJ8A 2MJFB 2JAEA 3LJ2A 3Q8DA 2ZRRA 2L1LB 4PL5A 4Z7HA 3DA4A 3LJ0A 3F4MA 2JBWA 2CAZB 3FBVA 1JQOA 4YZCA 3FVVA 2RADA 4NV5A 4NV2A 2FUG1 4G75A 4Z7GA 2JB2A 4PL3A 2GSCA 2JB3A 3JSBA 2IP6A 3SDJA 3AJFA 3VA9A 2YFBA 2BL7A 4AS3A 2BL8A 1U5KA 2RLDA 4AS2A 2A2DA 4U6RA 1YO7A 4I1TA 4G76A 2JB1A 2XTRA 2ZW3A 3I9V1 4YZDA 2K19A 3P23A 4OAVB 3LJ1A 4JCVE 2FEFA 2QSBA 2E8GA 2QGMA 2P22B 2V1CC 3DO9A
chains in the Genus database with same CATH topology
2V6EA 4GXTA 3IAS1 2XTQA 4O1PA 3UITA 3L0IA 2YFAA 4PL4A 4Q9VA 4O1OA 3KP9A 2A2CA 3DA3A 5LNK1 2KKMA 4OAUC 4HEA1 4DWLA 1W3SA 2F6MB 4YZ9A 2XMXA 3IAM1 5HGIA 4HFVA 2F66B 2RIOA 1SJ8A 2MJFB 2JAEA 3LJ2A 3Q8DA 4Z7HA 4PL5A 2ZRRA 2L1LB 3DA4A 3LJ0A 3F4MA 2CAZB 3FBVA 4YZCA 4NV5A 4NV2A 2FUG1 4G75A 4Z7GA 2JB2A 4PL3A 2JB3A 3JSBA 2IP6A 3SDJA 3AJFA 3VA9A 2YFBA 4AS3A 1U5KA 4AS2A 2A2DA 4U6RA 1YO7A 4I1TA 4G76A 2JB1A 2XTRA 3I9V1 4YZDA 2K19A 3P23A 4OAVB 3LJ1A 4JCVE 2E8GA 2P22B 2V1CC 3DO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K19 A;  2IP6 A;  2ZRR A; 
#chains in the Genus database with same CATH topology
 2V6E A;  4GXT A;  3IAS 1;  2XTQ A;  4O1P A;  3UIT A;  2QZG A;  2ETD A;  3L0I A;  3B55 A;  2YFA A;  4PL4 A;  4Q9V A;  4O1O A;  3KP9 A;  1TDP A;  2A2C A;  3DA3 A;  3FNB A;  5LNK 1;  2KKM A;  4OAU C;  4HEA 1;  4DWL A;  1W3S A;  2F6M B;  4YZ9 A;  2XMX A;  3IAM 1;  2HGK A;  5HGI A;  4HFV A;  2FU2 A;  2F66 B;  2RIO A;  1SJ8 A;  2MJF B;  2JAE A;  3LJ2 A;  3Q8D A;  2ZRR A;  2L1L B;  4PL5 A;  4Z7H A;  3DA4 A;  3LJ0 A;  3F4M A;  2JBW A;  2CAZ B;  3FBV A;  1JQO A;  4YZC A;  3FVV A;  2RAD A;  4NV5 A;  4NV2 A;  2FUG 1;  4G75 A;  4Z7G A;  2JB2 A;  4PL3 A;  2GSC A;  2JB3 A;  3JSB A;  2IP6 A;  3SDJ A;  3AJF A;  3VA9 A;  2YFB A;  2BL7 A;  4AS3 A;  2BL8 A;  1U5K A;  2RLD A;  4AS2 A;  2A2D A;  4U6R A;  1YO7 A;  4I1T A;  4G76 A;  2JB1 A;  2XTR A;  2ZW3 A;  3I9V 1;  4YZD A;  2K19 A;  3P23 A;  4OAV B;  3LJ1 A;  4JCV E;  2FEF A;  2QSB A;  2E8G A;  2QGM A;  2P22 B;  2V1C C;  3DO9 A; 
#chains in the Genus database with same CATH homology
 2V6E A;  4GXT A;  3IAS 1;  2XTQ A;  4O1P A;  3UIT A;  3L0I A;  2YFA A;  4PL4 A;  4Q9V A;  4O1O A;  3KP9 A;  2A2C A;  3DA3 A;  5LNK 1;  2KKM A;  4OAU C;  4HEA 1;  4DWL A;  1W3S A;  2F6M B;  4YZ9 A;  2XMX A;  3IAM 1;  5HGI A;  4HFV A;  2F66 B;  2RIO A;  1SJ8 A;  2MJF B;  2JAE A;  3LJ2 A;  3Q8D A;  4Z7H A;  4PL5 A;  2ZRR A;  2L1L B;  3DA4 A;  3LJ0 A;  3F4M A;  2CAZ B;  3FBV A;  4YZC A;  4NV5 A;  4NV2 A;  2FUG 1;  4G75 A;  4Z7G A;  2JB2 A;  4PL3 A;  2JB3 A;  3JSB A;  2IP6 A;  3SDJ A;  3AJF A;  3VA9 A;  2YFB A;  4AS3 A;  1U5K A;  4AS2 A;  2A2D A;  4U6R A;  1YO7 A;  4I1T A;  4G76 A;  2JB1 A;  2XTR A;  3I9V 1;  4YZD A;  2K19 A;  3P23 A;  4OAV B;  3LJ1 A;  4JCV E;  2E8G A;  2P22 B;  2V1C C;  3DO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...