2ZSIA

Structural basis of gibberellin(ga4)-induced della recognition by the gibberellin receptor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
339
structure length
339
Chain Sequence
EVNLIESRTVVPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLIRDWQLAYAEGLKKAGQEVKLMHLEKATVGFYLLPNNNHFHNVMDEISAFVNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable gibberellin receptor GID1L1
publication title Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 119
structure length 339
sequence length 339
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zsiA00
2OPHA 2WTNA 5AKGA 1ZD5A 5JD5A 4KE9A 3WLAA 4EA6A 3E1GA 4QDOA 3ZWQA 3EBLA 1CUWA 1AMNA 4QLOA 4XX1A 4ZGBA 3IIIA 3ICWA 4UHHA 4WDRA 5KBYA 4WFIA 2UZ0A 4J0JA 4UBLA 4FNGA 3D59A 1CUJA 1VE7A 2XUFA 2WUGA 2XMZA 2CUTA 2PL5A 3SWWA 5CW2A 2WFZA 4LXGA 4W1RA 4XIIA 1YA8A 5DNVA 4C4ZA 2JEZA 2G4LA 4YPVA 2QRUA 4JH0A 5T4BA 3W9BA 4BZWA 3M3DA 3FWHA 1G4HA 3FYUB 2I78A 1R88A 3PF9A 4E11A 4Y2XA 5ALWA 2O2IA 3E3AA 3F9CA 2VJCA 3KXPA 4DMFA 4CIAA 3WIOA 2PPLA 4U2EA 3FVTA 1QFSA 5HK8A 3WMRA 1LPOA 3ESAA 5ALJA 2O7VA 5CT9A 4ITVA 3W05A 4ARAA 1HPLA 1H2WA 2R8BA 1GPLA 3V1NA 1P0PA 3C8DA 1HQDA 1THGA 4PO3X 3RM3A 3O4HA 4Y2SA 2DFPA 3UUFA 4PSDA 4DTCA 2LIPA 5K3BA 1CQWA 3D2BA 2QT9A 4UUQA 3C6ZA 3T52A 4W63A 1QE3A 1VZ2A 3AIOA 1W4LA 1EINA 5BWBA 4K6HA 2IIVA 2JGJA 4H7EA 3O4IA 3H2JA 2V9ZA 3R3XA 4G4IA 1UK8A 1F0NA 1E3QA 4L0CA 4W1SA 3STUA 5JAUA 1ODSA 4W9RA 2ZSIA 4BDSA 4GHWA 2WIGA 3EQ8A 4G4GA 5LYYA 5LZ7A 3I2HA 2VQ6A 2DSNA 4A5SA 2HIHA 4BBZA 2DR0A 4XWGA 3FOBA 3KDAA 4BB0A 4F60A 1QJ4A 4G9GA 5CTAA 5YASA 1HDEA 2O2HA 5HZGA 2RAUA 1K63A 3WL5A 3WWCA 4X92A 4GDMA 4AB1A 1TCBA 3GROA 4FMPA 5AP9A 2K2QB 1CUBA 3I2FA 1H2XA 1DINA 1DT5A 5E4TA 1B6GA 2XMCA 3V48A 2JEYA 4JYPA 2G63A 3BF7A 1CUVA 3PUHA 3C6YA 1R9NA 4OB7A 4YASA 3WKBA 4X6UA 3GELA 3W04A 4KYVA 3WK4A 5JATA 5AKLA 4M0FA 1XLUA 5AI8A 5ALTA 5T4EA 4QDXA 4DMHA 5I7UA 5FV4A 4LYDA 4Q3LA 4E14A 3CCCA 1W75A 2HU5A 3PI6A 5C7YA 1WB6A 7YASA 4B85A 3NOXA 4FKBA 1GXSA 1UZAA 1WPXA 1TCAA 1E8NA 4X6XA 1XZKA 3AZOA 2IITA 3BDVA 2FUKA 3FYUC 3G8YA 3DDUA 6YASA 4ZWNA 1BN6A 4OU5A 4UBIA 5F4ZA 2OCGA 1QIIA 3L1HA 2RGUA 4ZXFA 4PW0A 3V1MA 1Y37A 3C8HA 3G0IA 2BUBA 3FVRA 3ZV7A 4H35A 2I3DA 1XZAA 2OGZA 2QJWA 3K6KA 5HF9A 4J0DA 1YB6A 4GW3A 2XB6A 5BV7A 1Q0RA 5AKZA 3G9UA 2QTBA 1HBJA 4P92A 2C58A 2XDWA 2AJDA 4BCDA 4M0MA 3W2TA 1GPNA 4ZREA 4JUIA 4RE6A 4DYHA 1PFQA 1UKBA 1MNQA 5AM3A 3WJ1A 2VATA 4LYEA 3DNMA 4BCBA 1FSSA 1QIKA 2RHWA 1CUYA 1N5MA 3HXKA 4GBGA 1CUCA 1VJ5A 2HA2A 1G42A 3D0KA 2HL6A 1QTRA 3LLCA 1RWQA 2JGFA 3GBSA 4CFSA 2VJBA 2CZQA 5LIPA 3G9ZA 1ZI9A 1UT6A 3F96A 4UPDA 1GT6A 4CI9A 3OURA 5CH3A 1QO9A 4OCZA 3A70A 5HK9A 3WWDA 5FP0A 2VJDA 3AIMA 5ALIA 1SCIA 4J0IA 1P0QA 1ZD2P 4N8SA 1ZJ5A 2DCMA 2JF0A 5EIEA 1ZJ4A 1MO2A 1H23A 3BF8A 1WCYA 2VJAA 4C4XA 4BC0A 4KE8A 3PUIA 2OGSA 3AIKA 2DQZA 1MT3A 1T4MA 2ZJ7A 5LZ2A 3H2KA 4IHAA 4INZA 4Y2JA 1BS9A 3UMJA 2VT6A 5AKXA 3BDIA 4B9EA 4F5ZA 4BP8A 2JGEA 1FFEA 1FJ2A 1IZ7A 2XUQA 1AKNA 1F6WA 3R3WA 1QIEA 1CUXA 3DL7A 3IUQA 5ALNA 4KE6A 3JYHA 3SX4A 4ETWA 2H9YA 5D3KA 2XQFA 1I6WA 4CG1A 3R41A 5BOVA 3IULA 2HFJA 2PSEA 1RP1A 5EHXA 2WG2A 1A8QA 4C01A 4PSUA 3I1IA 3WL7A 2WFMA 4AN0A 1XRLA 1MX5A 4I3FA 1WPRA 2HA3A 2J4CA 4CCWA 4DLNA 3CCBA 4UBKA 1YS1X 1OXMA 2GYWA 4B81A 3PFBA 5CH5A 1A8SA 4LXHA 5FKJA 3DD5A 3ESBA 1PJAA 4G9EA 1QIGA 1IUNA 1XQXA 3IUNA 5JADA 1JI3A 1CUUA 4Q05A 3F67A 1O6FA 3F8SA 5C8ZA 2X76A 4FOLA 5ALUA 4Y2PA 4H7IA 4HZGA 1NU8A 2RHTA 4GXNA 1J2EA 2QJRA 5AM2A 2AJLI 2X5XA 1IMJA 5AM0A 3UUEA 1U2EA 5AHXA 5IKXA 4WFJA 5JZSA 5ALVA 5C8XA 5DYWA 1EDBA 4AMYA 2PU5A 2WIDA 4UHFA 1R50A 2WSLA 1GZ7A 2B20A 2XMDA 4FLMA 1DT3A 2ZSHA 2QKYA 5CRIA 2XQJA 2C0PA 1CUHA 4G5XA 5J3JA 4KAJA 1TIBA 4TPKA 5LP1A 3K2IA 1LGYA 3WK5A 3D7RA 1K4YA 1E8DA 5T4FA 4B9AA 2WIJA 3DKRA 4Y2UA 5AKIA 3BWXA 5AI6A 4DMKA 4X7BA 3PICA 3BE8A 1XFDA 3VISA 4EHBA 2Y1KA 5LZ9A 2XUIA 4HAIA 3WZLA 4W1QA 2VAXA 5HCUA 5A6VA 2WJ6A 2Y2UA 1L7QA 4F0JA 4MJ3A 1A8UA 1F0PA 2HA7A 5ALPA 2OCLA 3AUKA 5D7BA 1E66A 3RARA 1UXOA 1EB9A 5EIHA 2YASA 1JU4A 4BVKA 2DHDA 1XZGA 3QH4A 5AO9A 3G0GA 5SYNA 2DHCA 1XQYA 3ESCA 5DWDA 3QMVA 3ILSA 2VT7A 3STXA 2Z3ZA 2QM0A 5IVKA 3IA2A 5AKKA 5JANA 5CT4A 3DJYA 1AX9A 4UBNA 2GYUA 2I3ZA 1CUGA 1XLVA 1UKAA 2O2GA 4OSEA 5AIBA 2WLSA 3RLIA 3OOSA 4Y2VA 1CFJA 1USWA 2GZSA 1ZOIA 3ANTA 2OXEA 3P2MA 3GA7A 4UBJA 4A16A 1TK3A 4RE5A 5DYTA 4AN1A 5ESRA 4UFNA 2HA5A 1VA5A 2WIKA 3ZI7A 1AC5A 5AKJA 2IX9A 2XMRA 4EY8A 5ALLA 3HSSA 5CXUA 2PU7A 1O6GA 3KWFA 2B9VA 4K5QA 2OG1A 2BAGA 2WG0A 3WKCA 3GFFA 1THTA 4BE4A 2JIDA 4C4YA 5K3CA 1CUEA 1FFAA 3PFCA 3RKSA 3HEAA 5DJ5A 3G0CA 4U2FA 3WA6A 3WKEA 5FPQA 3G0DA 4UHBA 4BATA 1ZI8A 3I6MA 4QA9A 3V9AA 3TGLA 2PM8A 3WK8A 2RONA 2JGKA 4PSCA 1XZMA 3STVA 1EVQA 2XE4A 1DTEA 1QIMA 4ARBA 1YASA 3R40A 2OGTA 2ACKA 4G8DA 4H7KA 5ALZA 2FX5A 1BROA 2ZYHA 1H2ZA 3W9UA 1E89A 4HS9A 1VKHA 1EK1A 2AJBA 1QFMA 5JD6A 3I2IA 1MAAA 1CUDA 3I2KA 4GEGA 1UK6A 1XRQA 1D07A 1ISPA 3TJMA 4BTVA 3A2NA 4Y2TA 4MWTA 4PF1A 4BAUA 3CXUA 4LIPD 5JZBA 5JZ9A 5IVDA 4BE9A 3D2AA 5C81A 2H7YA 3I2GA 4B6GA 3HYSA 1QIFA 4BAGA 4E46A 4TVKA 2QVBA 2AXEA 1HL7A 2QR5A 4W1PA 2VTVA 3HJUA 4AXBA 4CCYA 2XQKA 3HZOA 3LIPA 1T2NA 3GUUA 5K3FA 4E15A 2OAEA 2XMBA 2JGMA 2ZYRA 3VJMA 5LZ8A 3DYVA 4NVRA 4H7DA 1MTZA 2QUBA 4I4CA 4P93A 4EZIA 1CUZA 4B80A 4X91A 1G5FA 4B7ZA 5DNUA 1JJBA 1R1DA 5AM5A 4ZV7A 1ACJA 2C7BA 4BC1A 4N8EA 3NUZA 3VXKA 3R3ZA 1N8SA 4B0PA 2P8SA 5AK6A 1LZLA 5AKHA 1BRTA 1EDDA 1XZLA 3HRHA 3D5EA 1OILA 3DQZA 2ROQA 1DQYA 4G8BA 2ZYIA 2WFLA 1LBSA 1AGYA 4G1FA 2XUKA 4RGYA 1BCSA 1UK9A 1YCDA 5CURA 4EY6A 1BE0A 2GYVA 5ALMA 3E4DA 5A2GA 1EVEA 5E2IA 5FPPA 1QGED 3VJKA 3WWEA 2PVSA 1ZI6A 4DMCA 4DNOA 1JKMA 5EGNA 4WY5A 1XZFA 3E0XA 1SC9A 5KWJA 4B84A 4DSZA 2R11A 4C87A 5AOCA 1TCCA 5ALQA 2BCEA 3QBJA 1H2YA 1ACLA 5HF8A 4IH9A 1XKTA 5FRDA 1EI9A 1UKCA 3Q0TA 2H7CA 1J06A 4C6HA 2GBGA 4CCYB 5DLPA 5DYYA 1S8OA 4XVCA 5ALXA 1WHTA 5K3FB 1B41A 5LLSA 4KAFA 5FDFA 4UHEA 1DWPA 1UFOA 3B5EA 1CV2A 2PSJA 1TQHA 4MXDA 4DGQA 2QOEA 4DIUA 2XLCA 4QDTA 4WCVA 4CG3A 1XQWA 4K6GA 5K5EA 2H7XA 3QYJA 2PSFA 3DL4A 1AZWA 2WFLB 1WHSA 1ZIYA 2BFNA 4X94A 3DOIA 2XUOA 1J07A 2CBGA 1Q84A 5IVHA 4WJLA 5JIBA 3M82A 2V96A 5FOQA 2I03A 5ALKA 2QS9A 4K6KA 1LNSA 5AM1A 3I6ZA 4Y2RA 1LBTA 3QM1A 2FJPA 5JAHA 1NX9A 4J7AA 1CLEA 2O7RA 5DTJA 2WHPA 1PV1A 4J03A 3G9XA 2HU8A 1JU3A 5SYMA 5CXXA 3STTA 1IZ8A 3QPCA 5JAPA 2GZRA 1UK7A 5HKBA 1ORWA 3KWJA 1K5PA 1CRLA 3CN7A 4B83A 4HXGA 3SC2A 5K3DA 3WL6A 1LPSA 3S8YA 2QMQA 4H18A 5AK3A 4OU4A 1EDEA 4FWBA 4QLAA 5DNWA 5CMLA 3DYIA 1EH5A 4Q82A 5AICA 2ZYSA 5CH8A 1F8UA 3H2IA 4PV7A 4AMZA 4BAZA 1A7UA 5FUMA 1YAJA 1ETHA 1JFRA 4RNCA 5EHZA 3CN9A 2W6CX 1CQZA 4IH1A 4FLEA 1IVYA 3O4JA 3EF3A 4Q1VA 1R4ZA 4G4JA 5IVIA 3U0VA 1CPYA 2WHRA 5ISMA 1Q83A 3FBWA 3KOOA 3R0VA 5EI5A 2HA0A 3VJLA 1QOZA 2WIFA 3O9VA 3G7NA 1KU6A 1W6RA 4Q34A 5JAOA 3HLKA 1YAHA 2VEOA 2W22A 2XUPA 5A71A 5LKRA 4TGLA 4OPMA 3BJMA 3L1IA 5ALFA 2WHPB 4DNFA 1MX1A 1Z68A 1K8QA 5HF5A 2QUAA 4JNCA 3IURA 4UHCA 1C7IA 4Z49A 4BDTA 5JASA 4AQDA 3DCNA 4BYMA 5JYCA 1CUIA 2JGLA 1X70A 1EHYA 4B0OA 1J1IA 1FFBA 2OQVA 2J3DA 4HRYA 1SCKA 2XUDA 4KACA 5KWIA 5H3HA 4BCCA 2D0DA 3KSRA 5AK5A 3O95A 4FBMA 3NWOA 4AZ0A 2HDWA 5HKAA 5HFAA 2ZJFA 3G02A 3B3QA 4GI1A 4H7JA 3LS2A 3ZLUA 1EXWA 3WJ2A 5AI5A 3OG9A 1VE6A 3WKAA 1XLWA 3STYA 3FLAA 4B82A 5A7HA 1XZCA 1W1IA 3BIWA 3FCYA 3G9TA 5BWCA 3I28A 5ALRA 2WUEA 5ALHA 4IH4A 2BUAA 4P9NA 5JARA 2XMGA 3LCRA 3O0DA 3VDXA 3WWPA 3PDCA 1P0MA 1JMYA 2ZVDA 3H04A 1WOMA 5EIAA 3QITA 4Q3OA 3X3HA 4OD0A 3AJAA 1EX9A 2WG1A 3Q8WA 4KJXA 4J0GA 1C4XA 3YASA 4X93A 4X85A 1IUPA 2C4HA 2OCKA 1XZIA 3KD2A 1A88A 1CUSA 4MYSA 1NU6A 3BL8A 1MU0A 1CVLA 5HQ3A 3ED1A 3AZQA 5EHQA 3ESDA 4C89A 4J0CA 5AI0A 1XQVA 3NGMA 1DWQA 1KEZA 3C5WP 2ECFA 4X71A 3A6ZA 3C43A 2XI4A 4UHDA 2FJ0A 3H0CA 2ACEA 2HA4A 3LP5A 2WM2A 1SOMA 1CR6A 4BRSA 3G0BA 1N5RA 4Y2QA 3HI4A 1EA5A 3OPMA 4DNQA 3V1KA 2Y2VA 2Y6VA 2OLEA 4QNNA 2HU7A 2Z8ZA 4S0XA 2WHQA 1G66A 1CIJA 2RIPA 1ODCA 2XUHA 3AFIA 4G8CA 4YX9A 3R3VA 2YH2A 1EB8A 2PX6A 2VAVA 4WFKA 2C0QA 1GGVA 3FCXA 2WQZA 1JT2A 1AUOA 3C6XA 2YXPX 3A2LA 3ICVA 4C88A 5T4HA 1U4NA 4CIBA 4MEAA 4N8DA 2VA9A 5AJHA 3IUJA 2J3QA 5IH7A 2Z5GA 3DEAA 1YSCA 1QIHA 3I6YA 2WJ3A 2OQIA 4FTWA 5CT5A 2WU4A 3WK9A 4OB6A 3WQHA 4JYMA 1DX4A 3GZJA 1BEEA 4H77A 3ANSA 4Q3KA 3VVLA 3FNBA 4XJVA 5ALOA 1X2BA 5ALSA 1VLQA 2OAGA 4WY8A 2AJCA 4X90A 1HLGA 2Z3WA 2ONCA 4L9AA 3N0TA 5A7GA 5HQ3B 1SCQA 3IDAA 3STWA 4OUKX 4EBBA 2ES4A 2XUGA 2DHEA 1VZ3A 4DM7A 4X6YA 1TKRA 4FDMA 4HXEB 4QZVA 4EY5A 5ALEA 1ZD4A 2VSQA 2CB9A 3D3NA 1XRRA 2WUDA 4OYLA 3H2HA 2X8BA 4MYDA 1R9MA 2CMFA 4O08A 3WYDA 4ZI5A 4UFOA 4YK7A 1P0IA 1VOTA 4MQLA 2PSDA 4AX4A 2XLBA 5K3EA 5AM4A 5AI9A 3HC7A 3V1LA 1E5TA 3C45A 1YS2X 2PUJA 4L3WA 2AJ8A 3R3YA 1EK2A 5AKYA 3IB3A 2NW6A 2HADA 3SK0A 5AIAA 4BRZA 3WK7A 1JMKC 1C7JA 1GKKA 4H0CA 4QEKA 3WZMA 2V97A 3T4UA 1XZEA 5JD4A 1WB5A 2QXUA 4RPCA 1AURA 4PNZA 2PSHA 5ALYA 3H19A 3C70A 4J0HA 3EIOA 4OYYA 1DU4A 4NZZA 1LZKA 3QVMA 3QMWA 4DNPA 2XQIA 4FFVA 4EUSA 1Q0ZA 4AZ3A 5CBKA 4H7FA 5I8PA 2EEPA 4V2IA 1BN7A 4HTAA 3ZPXA 3FSGD 4X00A 1CEXA 3I1YA 5D6OA 3VVMA 1XROA 2HHAA 2DQYA 2HRRA 5CT8A 4NMWA 3B12A 2GBFA 3AILA 3D2CA 4LKOA 1QIDA 3FLBA 3M81A 4LHEA 1W52X 3IBTA 3WYNA 4I19A 1MNAA 1XRNA 3ZLVA 5I9IA 1Y7HA 3HABA 1GQSA 2BGNA 4BP9A 1HKHA 2HA6A 5C8VA 2ZJ6A 2GBCA 2HFKA 2QXTA 3QZUA 3BJRA 3ZLTA 1OCEA 4CG2A 3I2JA 2OCIA 4IO0A 1E8MA 5DTIA 1YB7A 5AI4A 1H22A 2D5LA 2WU3A 1ZIXA 1BCRA 2B61A 5E4YA 4QDUA 3VKFA 1LPNA 4FFWA 4KAAA 2EDAA 2XQGA 4UFPA 5FLKA 2CEKA 3EQ7A 5LZ5A 1ORVA 2GBIA 4QWWA 1ZICA 1RYYA 4HXFB 1XRMA 2XUJA 3QPAA 4ZRDA 2PBLA 4N5HX 1VXOA 5HF6A 1FFDA 3WK6A 4FBLA 3DOHA 1QZ3A 3S2ZA 5LZ4A 3BIXA 5AH0A 5AOAA 1CUAA 3U1TA 1LPAB 1ZGCA 4LXIA 4KRYA 1R3DA 4FNMA 3WI7A 4QWMA 2WJ4A 4MEBA 4UBMA 4QDZA 3W06A 1VA4A 3PF8A 4KEAA 1MN6A 4Y7DA 3MUOA 1GPKA 2BKLA 3H1AA 3DS8A 2CKMA 2WUFA 4OB8A 4M0EA 2PKYX 3LIIA 3H2GA 3C6BA 4U2DA 3FSGA 4KE7A 1MJ5A 5EHNA 1IUOA 1XKLA 4FHZA 5AOBA 3PE6A 3RK4A 5EFZA 2Y6UA 2BGRA 1QTIA 3K9BA 5CT6A 2WTMA 4EY4A 1WM1A 4NS4A 5K3AA 3JW8A 1YA4A 1LPBB 1FFCA 2BJHA 1XZJA 2HM7A 4ROTA 2YYSA 1SFRA 1UOPA 3WA7A 4DSAA 4ZV9A 3OM8A 2XUAA 4K2AA 1UWCA 4WDQA 2C5FA 2J4FA 1WB4A 4AO6A 3R3UA 1M33A 3HACA 3MVEA 4J3JA 1KU0A 4JEIA 2H1IA 2PUHA 4QE3A 1QIJA 4EY7A 2G5TA 3AINA 3IUMA 3OC0A 4Y9SA 1VXRA 2C5GA 2QZPA 3A2MA 1JJIA 1ODTC 1YR2A 1K6EA 3D4LA 4F21A 1AQLA 1DX6A 3AZPA 1TRHA 1CUFA 1MAHA 1XZBA 3F97A 1XRPA 4EB0A 3C5VA 4L72A 2B4KA 5JALA 2Q0XA 4GLBA 1JJFA 3WL8A 1BEZA 4HRXA 1X2EA 3FAKA 4FLFA 3DKKA 3L1JA 5HFNA 1XZDA 2Z8XA 2G5PA 3EQ9A 4MQMA 2JGIA 1DQZA 4GWLA 1BU8A 3QMMA 1GQRA 1LPMA 4HVTA 5FXMA 4X95A 1QO7A 1U8EA 3M83A 4BVLA 1MPXA 4BZZA 1XZHA 4H7HA 1MX9A 4Y2YA 5E4JA 4X3CA 3O9MA 1U65A 3H17A 2VF2A 3QPDA 2RI6A 4KRXA 3JWEA 4BVJA 2HRQA 4J0KA 4UBOA 1N1MA 4KR0A 5AK4A 5KREA 4IQ4A 3O4GA 4X97A 1Y7IA 1ZD3A 1QLWA 2BUCA 3TEJA 5ALGA 3H1BA 1DWOA 2XMSA 4GECA 4U2CA 4BTLA 4MWSA 2XT0A 3MUNA 4U2GA 3DLTA 2E3JA 3WIBA 3OTQA 3FYTA 4D9JA 1ZGBA 4AO7A 2WILA 3F98A 4AO8A 5ALDA 5A62A 4P08A 2ORYA 5LKAA 1TAHA 3IVMA 5D3ZA 2WKWA 3BXPA 4PQEA 1W76A 5AKEA 4A23A 3FYUA 1LLFA 1L7AA 2CJPA 3FLEA 3TRDA 1UOOA 3C87A 1L7RA 2EDCA 3H18A 3MGAA 1GKLA 5A7FA 1LPPA 2JBWA 2V98A 3N2ZB 2XMQA 3WKDA 4U2BA 1UOQA 4N5IX 3WWOA 1QONA
chains in the Genus database with same CATH superfamily
5LQSA 1XJWA 3O82A 4RS3A 2H08A 2WZCA 3VZRA 3OIWA 3GLTA 3B2NA 4JOBA 1V6CA 5DHTA 1H2RS 1Z17A 521PA 5K2MA 3VO8A 1GSAA 3H5AA 4GF5A 5EMKA 2JH3A 1RI5A 1SXQA 4EB6B 3ZH2A 2EKPA 4HH4A 3LQYA 4OQYA 3FYCA 4EA6A 4MUKA 2PT6A 3T12A 4EWLA 1NDQA 1PDVA 2R4QA 1NP7A 1JA1A 1SU8A 2N42A 3A1TA 3CX8A 3N76A 4QDOA 4NEQA 4R8SA 5TMDA 4C0HA 2C29D 2ZIZA 4IF4A 3UN1A 3ZUGA 2R1UA 3JQDA 4E2ZA 3AKZA 1PGQA 4KXFB 5ECGC 2GYYA 1Z88A 1OLUB 3SG0A 3A6DA 4U6SA 2C9ZA 3RC8A 3U16A 4INOA 1OREA 3MFQA 4G26A 2QZZA 1KFCB 1U1GA 3AG6A 5K20A 3HWWA 1EGVB 3HVHA 3PRJA 3Q11A 4UHHA 3M5CA 1TDJA 1GEEA 2BI4A 1FVHA 1T1RA 1GR1A 1U28A 4L8WB 5F33A 2CJXA 2UZ0A 1JHXA 1H8HD 5GGYA 2RD2A 4F4HA 4UBLA 4IDOA 4XXHA 1R6UA 2D13A 3IGFA 3PJEA 5FWYA 4GP7A 3W5HA 4G5FA 4L16A 3GLFE 3M9LA 1D2CA 3BSSA 4AWXA 2NMVA 3ONWA 1U2GC 2XUFA 1ZU4A 2XMZA 1MOPA 3EJWA 3OP4A 1IY2A 5KO2A 1CR0A 2F8LA 2BFDA 1C5KA 3H42B 1KS9A 4S1WA 1LQTA 4TV8A 2VDQB 5GONA 5E38A 2EATA 2Y1DA 1FXWF 4A36A 3FMPB 5L3ZA 4GE3A 4Z99A 3V32A 4FNAA 2WFZA 3N2GA 4LXGA 2NVBA 4MUYA 4UUOA 1C3VA 4EDHA 3WLQA 3BERA 5A4MS 1ZC3A 4KJZA 4AMGA 1SOVA 1ZCAA 1FX0A 3LCCA 3CLSD 3MAAC 3LV8A 4KQ6A 2JEZA 2NU9B 3GK3A 4YPVA 2ZRJA 4N76A 3W9BA 3PHGA 1LX6A 4IEFB 1XMVA 1KZ6A 2FXVA 2AIRA 2IPMA 2OHVA 1XEWY 1NJ5A 1G4HA 3PHJA 4FGLA 4PFJA 4QQ8A 1H6DA 5KTMA 4EL5A 1KRXA 3GFRA 1Z47A 2I78A 3EGEA 1R88A 2YCLA 1RPNA 1YBVA 1DJOA 4FCVA 4E11A 4Y2XA 3B85A 2PWYA 2JIPA 4MQFB 4MI6A 5REQA 1DIOB 4IXNA 4BO1A 5AW8A 3REQA 3CA8A 2ZTVA 4DKXA 3LX6A 1GZ5A 4W5QA 3F9CA 2VJCA 1QCYA 4DMFA 3GHHA 3R0IA 2Q3FA 3NOVA 1WZCA 3PKIA 4G1EB 4R69A 3B9PA 1WXIA 4V0KA 2HN9A 3RS7A 4LUCA 1QZZA 1TYEB 2KLHA 3RSCA 2R5WA 2PUCA 2AFHA 2YHUA 3LM8A 3WIOA 2CLIB 2PVCA 4HWKA 1LLQA 2R60A 3CV3A 1GTSA 3Q8MA 5K0FA 1HE5A 1T10A 4MAFA 4OJQA 4PGAA 1SBTA 3RVPA 2LKDA 4BJ1A 2EFHB 3FWNA 4DG8A 4F56A 2DFDA 1P2GA 3EGXA 3PCXA 1KA9H 3UQZA 1ORTA 4A8JC 1JPUA 2VSFA 4ITVA 2WVHA 1MR3F 3BWEA 3C15C 4IRMA 2BR3A 3B20A 3KTAA 3PXAA 4DANA 3W7AA 4Q4JA 1GPLA 2A3NA 2GGSA 3GFQA 1CZLA 4EG1A 3CHYA 1DFGA 3LW7A 1YFKA 4EG5A 3IBFA 4AW9A 2NIPA 5LWHA 3RM3A 4Q4CA 4RWZA 4TXJA 5G1OA 4YFVA 4D9NA 1P2TA 2VCYA 1ZNXA 2NYRA 5THXA 4DDHA 1N2SA 2OCBA 2I2XB 1HNWB 2W6IA 3GLVA 4Q9HA 3WGHA 5EVJA 4C6TB 1P7YA 3GLUA 3HY4A 1R5OA 1UZUA 1ESEA 4MQEB 2AUNA 4I1OA 1IEXA 4RLSA 3LPCA 5K3BA 3D2BA 4ILEA 3U37A 4HGRA 3OZCA 1FQJA 1N9GB 2IJGX 2OL4A 2X7HA 5LB2A 1NWHA 5FQOA 2AN1A 2XJ9A 3NVAA 1J56A 3HXOA 4GSYA 1YQ9A 4UUQA 1ECPA 5JRJA 4RCZA 4ZYLA 2ZB2A 2ZSAA 3CZ9A 3DHEA 2JK1A 3OFKA 4HLDA 3AIOA 2PRJA 4EX6A 2XCTB 1QNFA 1RT9A 4S3MA 4JUDX 1IFXA 4JP3A 3ZZ0A 2UV8A 2OORC 4ND2A 4CKXA 3IOCA 3V1TC 2XA9A 1K7FB 1V41E 2YW2A 5IC4A 2A0WA 2LRHA 3QYPA 4IZOA 5I9NA 3GLGA 2P11A 1QANA 1YL7A 4WA8A 3B6MA 5LBUA 4RPLA 4C07A 1OF1A 3I01M 4IIEA 5B58C 1G8FA 3HUEA 4LXXA 4OIMA 3C3CA 3F5FA 4E2WA 2KWIA 2L19A 4RK0A 4DXDA 3AR5A 3L77A 2P5TB 4GRAA 1U0FA 2YYAA 2P9BA 4OFZA 1EDOA 2WICA 4I4TF 1JHRA 1NAHA 4KYIB 3OZUA 5TQ2B 2C7GA 2SECE 2AYZA 3AVQA 3GRAA 3H83A 1NOIA 4W1SA 4AIRA 1NVBA 2ZBPA 3PD0A 2HBQA 1XF1A 4I46A 1FP2A 1A71A 2Q1WA 1N8KA 4OLFA 4YS6A 3WLSA 1IJBA 1R12A 1TJ5A 3DUFA 4OREX 5EZYA 1EHIA 4LOAA 4XIGS 1E6KA 3KJIA 3T06B 5AVRA 1X1QA 3GGGA 3OO1A 5KVVA 3QEOA 5DGIA 4J6EA 1EESA 2ZSIA 3KKZA 3UV6A 1DJNA 3DMPA 4QPPA 4RLFA 4BWFB 4NMLA 4BDSA 4GHWA 4KW7A 4G4GA 2C5LA 3ME5A 2DSNA 4R8VA 5JMOA 4HUQB 4ZZ3A 2DR0A 4P4GA 4YQYA 4XWGA 3ZGOA 3C3JA 2R6HA 3QNUA 1A0OA 3LT1A 5J2UF 2AOXA 4O1MA 3PUZA 1B7GO 5EIWA 1TAUA 3PNKA 4NHEA 1G8YA 4RZSA 3KDAA 2IXEA 1SOUA 3IO5A 2HDOA 2JVIA 1J8FA 1ATZA 4JASB 2DSTA 1T1JA 4C22A 1RPJA 2X41A 4KN5A 5CTAA 5B6JA 1HDEA 4YT4A 3OT4A 4CM9D 4NZNA 1K6XA 4PAGA 1GILA 2RAUA 1KYXA 3KJHA 4LWPA 3F8TA 1YK0A 4IXMA 3ZIDA 4E33A 4DIKA 1ECJA 5EXXA 4GXTA 3PHBE 3Q7RA 3WL5A 2FW0A 1BHJA 1SWVA 3ELDA 4BE7B 1QU3A 1T1SA 4AZTA 1FE8A 1NVXQ 2JNWA 3U7HB 1HT1E 5EIOA 1UMBB 1YR6A 2Q9BA 1GRNA 2K2QB 3I2FA 2OV2A 5DI9A 4X7RA 1KEPA 3RVMA 1U3TA 3S2GA 1JVNA 1R15A 2JD1A 1BE6A 1JKFA 1N6IA 3R0QA 2FOXA 1UJMA 1Z0SA 2PH5A 1LDBA 3E23A 4WTOA 4FJ0A 4C1NA 4Z4CA 2G63A 4FEAA 3RVKA 3NUGA 2QN8A 4G23A 2A57A 1ZFNA 3AEUA 3RBXA 1CNMA 4B3BA 3WKBA 2FPIB 2W83A 1W87A 2EJBA 3HR4A 3MTDA 5SV2A 1NQ5A 4HDMB 3I9NA 4HAYA 5F1KA 2RJNA 1CIVA 2X40A 3GJ3A 1BDHA 3EK2A 3NTRA 1V7QA 2YWDA 4YDRA 4F1JA 1UAAA 3KYJB 4XQEA 1YMVA 4MYRA 4AG3A 1M2GA 3NUQA 1KH1A 3VH3A 3CUKA 3JZFA 3A8TA 5BN4A 1V2GA 1Y3HA 1Q14A 3QF7A 2PL9A 1NE7A 4HWTA 4ALMA 5KWSA 1QRDA 4RJLA 1QZXA 5T4EA 3CJTA 3O21A 4H0FA 1PR6A 4EM6A 3BB4A 1GVHA 1ZK0A 2B36A 3H9BA 4C7BA 3HY3A 4Q3LA 1VYHA 4CLEA 1L6RA 3SDSA 3VRHA 4E22A 5IM4A 1D2AA 3R3HA 2XIJA 1ISJA 1L8QA 3PI6A 3CRVA 3MXOA 1IBLB 4B6JA 1NVUQ 1SQGA 2E4WA 2Q2VA 1NATA 2QSYA 1EVKA 7YASA 4TYNA 2ZE5A 5U4XA 2V45A 5F4BA 1GXSA 3AEQA 1UZAA 3L7NA 4HQLA 3ZK7A 3EULA 3JQBA 4GI5A 5A3VA 1XYYA 1HWYA 1WPXA 2Q8PA 2XPCA 4I50F 4O4LB 2EL7A 2XNJA 3W3AA 2ZUTA 5K0NA 3VSBA 1TCAA 1HEIA 3FUVA 3NBKA 5FOUA 3UPUA 3EGIA 4ND1A 2C04A 3V55A 1VMAA 4PZ0A 2J32A 3HXQA 2J46A 3H87A 3NNSA 1TF2A 1W0KD 3FYUC 4DA0A 5EUMA 1ZW6A 3KKOA 2H5LA 4HY3A 3N8DA 3ENKA 4N3BA 2Z9CA 1NVVQ 1GEGA 1T4GA 5IUJC 3LBIA 2G4VA 4LWQA 4UBIA 2O7QA 2XSZD 4YRTA 4DIBA 4OXNA 3OOWA 5F4ZA 1O5IA 5C4IA 4KWCA 1Z0KA 2RBKA 2W00A 4L02A 4AMVA 2L69A 1NOJA 2RGUA 1XXLA 3L1HA 5P21A 4CKBB 4DQXA 2JLVA 1ESNA 2WUWE 3L7YA 1Y37A 2Y66A 3PDIB 4KZKA 2DUJA 4UD6A 2IHBA 5EN4A 1XIVA 1KMIY 5HUJA 2BUBA 1EUCA 2B3DA 2QD2A 4LPKA 3V2IA 1NRJB 1S3FA 3KZNA 4MB6A 2PWZA 4OJKA 5TGDA 4A91A 1ZVMA 2ACVA 3BH6A 1AV6A 1FU8A 1KMNA 4U6NA 4MYCA 1J8YF 1UCFA 2OGZA 3BK7A 3K6KA 4II7A 5TGZA 3UWPA 5IFKA 2GM5A 4NYJR 1RKBA 3H5IA 3K32A 4JBIA 2O3JA 4WV3A 4P83A 4Y1EA 1Z56C 2W4IA 4MZDA 5AKZA 1FDOA 5FI1B 1G5RA 1C9JA 2ZUUA 1CR4A 2VUSA 2YJGA 4IJVA 2EQ5A 5FPYA 3JCZA 2ZXEA 2P0AA 2ZDGA 3R7NA 4O2AB 4GPBA 2BGIA 1BOFA 3K73O 5FCDA 4Z9YA 4M0MA 2FUG1 4K9QA 5WRFA 2ECKA 3BGSA 1W6UA 4DJTA 2UKDA 1EFCA 3FY4A 1XD2B 3GXOA 3MTIA 3G5MA 3QVJA 4FCCA 3HNPA 4J9UE 4RZHA 5CX1A 4AU1A 2GAJA 1VJ1A 3UB4A 5AM3A 2NZYA 1E79A 4Q12A 2B1RA 4LYEA 1CW2B 1XVIA 3DNMA 3KU4A 4QTTB 1C9DB 1MC5A 3PUWA 5K8TA 1Q0SA 5IS2A 2CCKA 4RVHA 5JT1A 4XB1A 1G6Q1 1ZPDA 2QGNA 3KIPA 1N5MA 3K30A 2WWXA 1TC1A 2XX3A 4IUYA 2Q4BA 3FA2A 4GBGA 4HNAA 4I0WB 4RX1A 2E4YA 3UCFA 3X2SA 1QHEA 4EGQA 5DNYB 5JVDA 4IWXA 1KJ8A 4JGIA 4ZOCA 1Z0UA 2KPOA 4GKBA 2ZUEA 3UB3A 1VYUA 4D8YA 1M3SA 1ZONA 1H2BA 4K9OA 4FWTA 1SK9A 2WAYA 1YDHA 2EOAA 2H1VA 2QV7A 3AR7A 3QW2A 4MKFA 2JGFA 2Y67A 3O8DA 3GBSA 4HQ0A 4NE2A 3KB8A 3ZQ6A 1JVSA 3R3JA 5KYNA 2HK7A 4YA6A 3SYNA 3FMOB 4GD3Q 2VJBA 1VL6A 2F43A 5B2ZA 4LYFA 5LIPA 1BDBA 2FR8C 3G9ZA 3M1YA 4GO1A 5E7JA 1Z63A 3DBIA 5DT9A 3MCTA 1BMTA 3FYHA 2BFBB 3PGJA 1C0LA 1UT6A 1WCXA 4ZU6X 3RW9A 2HJ9A 4AC9A 5KNBH 2ZRPA 5ELXA 1KH2A 4YRQA 3FUUA 4HGQA 3ZGNA 3ABIA 1KEEB 3GC6A 5EJ2A 4Y6GB 2QRMA 3QP9A 1M6EX 1F60A 3PC8C 3LNCA 3OE7A 4DWWA 1MENA 1WA5A 3ZJ4A 4KIFA 3EWAA 5DBOA 3V8PA 4C78A 3KOYA 3ZXSA 1GUDA 4DGSA 1X15A 3OUZA 4UMDA 4IDPA 3CIFA 4ZDKA 4MROA 2NVWA 3SE0A 4U7TB 3L8DA 4ZK6A 1TA4A 3MS4A 1BH6A 5MN4A 1RI4A 4Y1RB 3AVYA 2OHIA 3IDOA 1ZJ5A 5CFOA 3LA8A 1RJWA 1BWSA 1FMTA 2DUUA 2Y05A 4Q9DA 3M70A 1OLSA 2JF0A 1WHTB 2JLCA 1TUBA 3H13A 4ZAYA 1T6ZA 2WYHA 1H23A 2AQKA 3BF8A 4UNSA 4X20B 5BQXA 4FMBB 2WF7A 2B4QA 3BMOA 4BQSA 3ANXA 5EJ9A 2VJAA 2C2GA 2O0MA 3KJXA 3CUTA 3DMFA 2O8DA 2Y1OA 3ZNOA 4LRYA 4B6OA 3HU1A 1ENPA 2OGSA 3ZHXA 2NTVA 1JIJA 1OXXK 1OT3A 2O6HA 3ENVA 3S5UA 4DFDA 3N28A 2IPXA 2XKBA 5AD1A 5JSHA 1T4MA 4WWHA 3DZFA 3LSTA 1UKYA 3VQTA 1E1RA 1G4UR 1KQPA 4ZALA 3FZNA 2AC7A 2GS9A 3EN0A 1PG0A 2BRUC 4LA4A 2HGZA 1I24A 3MCWA 4PYIA 1BKDR 3TM5A 3UMJA 1EP9A 2UVPB 4RVGA 4L78A 4EMBA 1EFAA 2VPPA 2VT6A 3BDIA 2C7VA 3MN1A 1Q95A 4OY3A 2ASVA 2AZMA 3Q7IA 3K1TA 3UK2A 4RFLA 3AOEC 1FTWA 2A88A 2IXDA 4OQDA 1FFEA 4KK4A 4R83A 4Y6RA 2H07A 5JSZA 4FSXA 1IZ7A 4OQQA 3KZXA 1NULA 2NZUG 1N3BA 3OZ7A 4PLHA 2AWOA 3AUJB 3ZGVA 3R3WA 2I71A 3R76A 3DC7A 3RUDA 3SHOA 1NQUA 3PGVA 5LNK6 2O8FA 3AH8A 4L6AA 2IH2A 4KRFA 1U0RA 1VHLA 2JIBA 2XVZA 3WQBA 1E61A 1W85B 1JDBC 1JDNA 1YS4A 2ZTLA 5AXCA 1V7PC 2GPBA 3TLMA 2H9YA 3I12A 3NKLA 1P31A 3OZFA 1O6CA 2ORIA 3KXLA 4TV9B 3L8MA 4KOEC 4DRXB 2Y0CA 3O8RA 4AUNA 1JLLB 1Y1QA 2A7QA 3MNFA 1O97D 5DCWA 4DMGA 3DD1A 3DWIA 4ZHSA 5EHXA 1MO4A 5LPNA 2R1VA 5HXAA 2BISA 2J7PA 2QWXA 2FP3A 4DSUA 5BUQA 1ZZEA 3ZI4A 2WG2A 4BV8A 5HYVA 4ZOLB 3TMAA 3PE4A 4JI0B 1SGWA 1RLJA 4HFNA 1SVWA 2Q4TA 4XCQA 3WL7A 1QRSA 3BRQA 2E9SA 3T8YA 4RGBA 2PGOA 2GTIA 3C97A 4L4UA 3FJ1A 1DBVO 3HR7A 5C80A 5IUNC 2NUPA 3CKLA 3LZCA 2GKGA 4I3FA 5A3RA 2D7JA 4A26A 1WPRA 4PYRA 4IG9A 2ZWOA 1C50A 2BZ0A 2OVFA 2YVAA 2HA3A 4OKSA 3R7WA 1DARA 2XB8A 1K2VN 2J4CA 3OZVA 4KQ9A 1NQWA 3L18A 2IYAA 4WLOA 3FWKA 1N0UA 1OXMA 2VPYA 3HI6A 5KWEA 3ZJUA 5TQVA 1C1DA 2BR4A 4UCWA 4B81A 2GFQA 2CNKA 1Z0DA 2R84A 1A8SA 2JFHA 4GKAA 3E22A 3BDAA 3P9IA 5C5CA 4YGXB 1KOLA 3DA8A 5HWSA 2XBMA 1P1RA 2WYWA 3KB1A 1Y8RA 2QTRA 5GAJA 1JFTA 4JIGA 3K05A 1D9ZA 3ESBA 3OHPA 4EO9A 1XXHB 3LBHA 1IUNA 1O1YA 1B76A 6REQB 3D6HA 5EPOA 3S8EA 4JV5B 2D4AA 1XHLA 1ZH4A 3S99A 2G36A 2JFPA 3KSMA 3S2EA 4ZJYA 3CR7A 1U2QA 4K88A 4BVAA 3PC7A 1BJTA 1JI3A 2WP8J 1EK6A 4PHTA 4XX0A 1QCCA 1VGQA 2FSVC 2YTZA 4WQMA 4UU0A 1YZTA 1J22A 3WZ2A 1L6IA 4ND6A 2EQBA 1FJHA 3LH5A 3O8LA 4B3FX 3HUUA 5J47A 5C8ZA 3B5JA 2X76A 5ALUA 1TJ4A 5JJBA 1U4OA 1JQ3A 1CQIB 1TKCA 4BVEA 3KOZA 4Q37A 3NB0A 5E0KB 2FGJA 5CCDA 4LYYA 2P35A 8OHMA 4L0MA 1XTPA 3P0EA 2HWYA 2XVMA 3ID6C 3MAJA 2RHTA 4PVCA 4PFKA 1UP6A 4PZDA 2Q5IA 4FMDB 2Z3VA 3RU2A 4Z7OB 2ZG6A 5K0SA 2O2JA 2E5WA 5C8YB 4CMAA 2V5VA 3P9YA 5AHXA 2ZWMA 3GP5A 5EWJB 4NG5A 1WKCA 1RCTE 5H82A 1D2GA 2HSZA 2YWCA 5FX2A 3DL0A 4DE5A 5ALVA 1RYBA 3JQ7B 1P0FA 3OQIA 1PWXA 5DYWA 2A9PA 2HHCA 3GDWA 3ZVLA 1OTYA 1VHTA 1KQFA 1PTJC 2E5FA 4O4IB 2PU5A 2WIDA 3TSOA 1QHFA 3QEMA 4HB2A 4HGYA 4V0LA 3PBKA 1YQXA 4WE3A 1ZM7A 4AP9A 1GZ7A 1WXDA 2F6RA 1UPTA 3D4BA 2BELA 3FSRA 4LX0A 1SG6A 1SAYA 3TOSA 4YJ2F 2I1QA 3U44B 5AVYA 3B1XA 5FPTA 5FB3A 2ZE6A 1R5BA 3NEAA 3ADPA 3V4LA 1MJGM 2QKYA 1XI2A 3PHIA 4MKZA 1SCUA 3L46A 3Q8XB 5EWLB 1IZ0A 1OKKD 3ZTYA 4AFNA 1YHYA 2XQJA 2WJVA 3L7KA 1DAIA 1U3GA 1AM4D 3DAGA 4I5GA 4KAJA 1TIBA 4YUZA 4TPKA 5H7XA 1T34A 1CEQA 4YGYA 1HE1C 1N0VC 2J30A 5HTKA 2QBYA 1RYZA 3P2IA 5F7OA 3M1AA 2Y4NA 3IPCA 3QV2A 1CJMA 1G7TA 5T5QA 4X1IB 3JQ9A 4B32A 4WNIA 2GLXA 1Q44A 4UVEA 1KDTA 4XWWA 4AKSA 3QUTA 3KOXA 1MFZA 4Y2UA 1B14A 1U5CA 2JJYA 3ZQUA 3O3NB 1NVGA 3F7NA 1N5OX 4J9VA 4MW5A 3E5HA 2WJYA 3MW8A 2QEQA 3SGLA 3K0FA 5BV0A 1NFFA 1XFDA 2BEVA 4RPGA 5ENDA 3VISA 4C0LA 4EHBA 1LX7A 2GCIA 2Y1KA 2D2IA 5LZ9A 4LDPA 3PQFA 1AQJA 4Z9FA 1FYFA 2CXXA 4JSRA 2VPWA 3E48A 2FG6C 1TO6A 3P2YA 1NIPA 4EP1A 5IAJA 4QJ3A 4KTTE 2JKYA 1LSOA 3WC4A 3ICEA 4JHXA 3VR4H 4LCJA 3FG9A 1W4AA 1F0PA 4QYMA 4W7IA 1M2FA 3SC3A 5B1SA 3T54A 3VDNB 4LE0A 2JAUA 3PPIA 1OZHA 1B16A 2VNIA 3NS7A 1E66A 4HO1X 4K28A 4UAVA 3RS8A 5BRNA 5JNSA 1UXOA 1EB9A 2QVLA 5HBRA 3GBVA 3SFVA 3IXMA 1L5QA 2IU4A 4MVJH 4XUEA 4EUKA 2YJ4A 4ZI7A 2XZLA 3PD1A 4ZKEA 3UJPA 4F72A 2W2NA 3QH4A 2CL0X 3OBBA 3ZWKA 1W44A 2DMRA 2V3VA 3G0GA 1MG5A 1RIIA 2OWDA 5FAXA 5LXTF 4DVJA 3AHIA 3QMVA 4EUEA 4OHPA 1E64A 1U1IA 1KOJA 1T43A 3ILSA 3P9KA 3R9KA 3Q3GE 2VT7A 1JHOA 2FUNB 2QM0A 2XAUA 5AKKA 5JANA 3D1JA 4DDTA 1STOA 4R2XA 1ZN8A 1SC3A 1V96A 3WB1A 4IF6A 4PLCA 1DSSG 4H27A 1L5VA 2H9AA 2CXUA 4B73A 1C7FA 1X1TA 3OIDA 4UBNA 4WESB 3L84A 4MA4A 3ASYA 4CMEA 3WGIA 2HIMA 1WJGA 2OO7A 4MWZA 3EUAA 2Y71A 4I4LA 1G64A 2GEJA 3UK0A 1PBTA 2ZSDA 4NCNA 5DTQA 1RZUA 1CBUA 3HJAA 1QBGA 4MQBA 3K2QA 2O2DA 3KCQA 3RLIA 4JCCA 1DBQA 1GNPA 1YKSA 3EA5A 3D8RA 3MB8A 3ZDZB 1CRZA 4X1OA 1USWA 2A5GA 2BEJA 3RT7A 3VC1A 5C7LO 5ICEA 3ZQKA 5KNBA 4L8GA 1DMRA 4P3KA 3U7RA 1GQQA 2H17A 1AU9A 2GETA 3GA7A 3A36A 3B1VA 4TS4A 5DYTA 1XKQA 3F1LA 4C7MA 1L8AA 4DZZA 3A1SA 5I7VA 3TUZC 1GKIA 1NONA 1M8JA 3GZ4A 1K0FA 4PYOA 4RZXA 5DBEX 2IDKA 3PIIA 4MS3B 1KH3A 3RJZA 1RPZA 3RYFB 4ARCA 1CB0A 2OC4A 4YDQA 1FMCA 4NOMA 2TMGA 4HDKA 4QD3A 4D74A 5KDOA 2A1TR 5JQWA 1FXWA 1EIZA 4YUWA 2BKXA 5D3MB 1GAXA 1XYVA 1GPDG 4OSOA 3W1EA 5LQKA 3QXSA 4DCGA 2ZRQA 3CLHA 2R47A 3ZX4A 3R23A 4YMUA 4GZLA 1JHZA 4B3CA 1CR1A 1P4HA 1B26A 5F12A 3ZKWA 1KFBB 4C4YA 1CUEA 1HDOA 3KVNA 2Z30A 5DNDA 1PLLA 4GMHA 3IKLA 2JCYA 2NO5A 2YVUA 1Q50A 4Y6QA 1JIVA 3NEJA 1UEIA 3IP7A 1DKNA 1FFAA 5HIMA 3V42A 4G2TA 3GNTA 4GQIA 1EA7A 4AJJA 3E6AA 1G2PA 1TMYA 2YWXA 3UT5B 5FF9A 1C9YA 4D57A 4CMGA 3CVXA 3V3TA 1EVLA 4IR7A 3S2YA 2JZNA 2QVCA 3BSWA 4BATA 1M0SA 5IANA 3UAYA 3I6MA 1T13A 3BC1A 1U2DC 1E2HA 5TXGA 1DOZA 5JSFA 1UFVA 5A9SA 4WZAB 3TGLA 5GJBA 2JS7A 2E48A 1K8XB 4P38A 1ISMA 1BW9A 1RRPA 3PHCA 4RYDA 1U0SY 2Q4RA 2PV0A 1EVQA 3W2IA 4W6QA 4B8WA 1XV5A 1FF9A 4F04A 1DV1A 4L4ZA 2NPOA 3D7NA 4ARBA 1YASA 1MJGA 2X5NA 1UFQA 1SKMA 2BE7A 3VR6H 3RIMA 4MVJM 1T4CA 4H7KA 4JJ8A 5ALZA 4RSGA 1BYUA 3I61A 5FOTA 1SR8A 4X3OA 3DV0A 2UUOA 1BROA 3LF2A 2RSLA 2MSLA 4Q5IA 1G20B 4CTKA 3KP1A 1ZCFA 3EF1A 1WDWB 1T8YA 3T1NA 1I4TD 5BOSA 1M34E 1AMOA 1VKHA 4MIEA 1ZEMA 4OXRA 4EIWA 4WCFB 5JQGB 3EYAA 3AVPA 5IHPA 2COKA 4LSWA 2PJDA 1E2UA 3C98A 4DQLA 3DXZA 1RRVA 2V7QA 5JD6A 1MAAA 3CTMA 4Q4DA 4DSOA 1SBYA 4PR3A 1NW9B 3BHJA 3UOWA 4NPHA 1MLDA 4AXXA 2RB5A 2FZKA 3OX2A 1RLMA 4JN6B 1GL7A 1YCHA 1R0YA 5I5GA 4KGVA 1RMQA 3ZG6A 4AIIA 1RZRD 5L7TA 5CIQA 2WYVA 1EVYA 4KLNA 2W2KA 4Y2TA 1YQWA 1PL0A 2OHXA 2X9VA 2Z8YM 4MWTA 4AF8A 4R9SA 4YUAA 4P0PB 1WCWA 3H5RA 5AXDA 4EEKA 2Q2OA 4JB2A 5CPFA 4WXYB 2O19A 1UDXA 4LSGA 3JVUA 1Q19A 2PIAA 3UYKA 3ZW8A 5JZ9A 3H5TA 2H5EA 4HZIA 4C3ZA 4FNOA 5C81A 1M74A 4EPYA 4LI0A 4MRVA 1EXNA 2XHEA 5JR3A 2WSMA 3TD9A 4I4TA 3N86A 4NF2A 4QFCA 4S1PA 2ZS7A 1OXVA 2AR7A 2JLYA 1M5UA 3D43A 1EVZA 2X77A 1KPHA 1ISFA 4MMXB 4RIHA 1XDGA 2ZVPX 2E82A 4QTUB 2P3OA 1PQWA 1U80A 3KS9A 3Q12A 4US1R 2WIBA 4OUDB 4D46A 1G98A 3H4MA 1FFYA 2F1RA 1ZU5A 1QQTA 3TCNA 4US0R 1XCBA 4BBAA 4BO6A 1G7CA 1G21B 2J0EA 2OVBA 3H8WA 3NX4A 4EMSA 4JXXA 1QOPB 4WEQA 3K35A 3GUUA 1Z4QA 2DLNA 3B1ZA 1NVFA 4HR7A 4Z3OA 2JGMA 1EQ2A 2G7MC 4GLOA 4MRMB 4CV3A 5B6PA 5J2UA 3LY7A 1X8LA 2F3PA 2VN8A 3GEPA 4JLSA 4NVRA 5H8WA 4H7DA 2GN4A 1FTQA 3DR3A 4M7PA 5I9BA 3ZE1B 2IH4A 3GEGA 3L7MA 2I2WA 1YHNA 3IAXA 4A2WA 2PRSA 3NRBA 4P6VF 5DNUA 3CZQA 5B37A 3Q98A 3TK1A 1TW2A 1DI0A 4EGCB 3FX2A 2G71A 2V4UA 2OUKA 2I6FA 3NNNA 4NBNA 2PCLA 4RMIA 1E0DA 1COZA 4BASA 1G18A 1R8SA 3TQQA 2XOXA 1X7XA 1N8SA 2V7EA 1P4JA 3WDLA 3ODGA 1UEXC 4MOWA 3DP9A 4YTEA 2W90A 5AK6A 5AKHA 2PYDA 1EDDA 2P2ZA 3KLOA 3N5CA 4PVDA 3ZWVA 1NJ1A 4TKVA 1XZLA 3HRHA 5TQ0B 4CDMA 3OE7D 1DV2A 2Y3IA 1P5JA 2ROQA 1ZC4A 3LP8A 1KVQA 4JD5A 4TQAA 4G8BA 4WZAE 1U7PA 1DVRA 3CRQA 1AS3A 4DF3A 3FI0A 1LBSA 1Q0PA 2IYXA 2Q1TA 3D7SA 3ODPA 1GQOA 1LI4A 5EG5A 5L3QA 3B2EA 2VWPA 5ETJA 1ADFA 2HJGA 3EDQA 1ECFA 3U62A 1YNSA 3OOHA 5JC1A 5FA8A 4AURA 3HL0A 3VPHA 3HV0A 4FE3A 4OQZA 4P2BA 5ALMA 3T7KA 2MMCA 3E4DA 1R4MA 4M87A 2O5RA 4DBZA 1P3DA 4PNHA 5JJIA 1G20E 5K51A 3VJKA 3WWEA 4CM1A 1XU4A 3BTVA 1UZNA 4HLNA 5CFRA 4R1SA 1ZI6A 2BMAA 2GA8A 3PQ4A 3E58A 2I1WA 2G3YA 1IXYA 3FHJA 1N7IA 1T1IA 2YZMA 4E2FA 1M8KA 2CDRA 1YDGA 1JKMA 1Q1GA 3GY0A 3ONVA 3DVSX 4NYIR 1T25A 1ZH8A 3L6DA 2BV3A 1IBMB 1E1RD 1O9GA 2NACA 2Q6LA 3NO4A 5KWJA 4B84A 5BQOA 2A8YA 3ISTA 2R11A 1L5WA 4C87A 3EFEA 4Z2YA 5CM2Z 4CLHA 1NP3A 3GT3A 5JNVA 4W4TA 4JI2B 4XB2A 5AYVA 3USES 3F6CA 5D5PA 3UY4A 2YXBA 2G88A 2VEDA 1JSRA 3R5TA 4DHWA 5IZCC 3ZU4A 4MYHA 4LKRA 1G5PA 5TARA 3T94A 3THYA 1XKTA 1OAKA 3PKJA 4TQUS 3ZWPA 2M32A 1EI9A 3KETA 1UKCA 1EE9A 1GOTA 1OVGA 4CM7A 4H2DA 5HQJA 5BSKA 5F76A 2H7CA 3C3YA 1E9RA 4I50A 2GBGA 2JD2A 4DLXA 4GM4A 4FYWA 3TX2A 3TFOA 2X0DA 4IDAA 4YJGA 4FOPA 1RM5A 3U80A 4DPLA 1QAOA 2UYHA 3LT5A 3GLHA 3PRKE 1B41A 4EFKA 4KAFA 2YY6A 3IRVA 4COOA 2FZVA 4CLRB 2B6NA 5LP6B 3SSAA 4LY0A 5C5DA 1SUBA 3ILVA 3O1IC 4C03A 5B4VA 1XNGA 2QN1A 2PZ8A 3HCEA 3B5EA 1H8ED 1CV2A 1NFQA 1WE2A 3EXFB 3C3BA 4LZOA 3S2FA 4H3VA 3LW8A 4MR9B 5GGXA 3VNAA 5BPHA 5I9LA 3HB4X 5BY2A 1GRCA 4QLBA 1JG2A 4BPRA 1G21E 2CHVA 1A5TA 1KDOA 4IIUA 3JZIA 5CITA 2HXYA 1UBEA 2Q1XA 1E2FA 3PJFA 2Z8YA 4JJFA 1O97C 5HIIA 3C3WA 4LBWA 1WSWA 2XLCA 4LC0A 4GX2A 4L57A 3JD4A 1Z5VA 2VTKA 3D6FA 4B75A 3I6QA 1ZAYA 4P4LA 3Q3CA 4EL0A 1W5SA 2XKAA 4QU9A 3V3KA 4Z4FA 1JR3A 2PBFA 3U9TA 4ZODA 2VCEA 2ZB8A 4KN8A 4WXEA 5SZHB 5JS6A 2HWUA 3MCUA 4HWGA 2VZ9A 1XVLA 1NBME 2BF7A 4X63A 4I6EA 3ZVNA 5ADWA 3ZZTA 3PC6A 2XF2A 3E35A 1KIFA 4CG0A 3U4QA 1T5HX 3ZWBA 4DM4A 3SVLA 1EFTA 4RF3A 2J6HA 4HDOB 3BMCA 3ZDYB 1J07A 2GHQA 1JQBA 2CBGA 4F4JA 2C54A 1Q84A 2AMFA 3VR2A 4F9TA 2C7QA 1DRKA 3M82A 5ITVA 1P9NA 3PQCA 4NPAA 1JKIA 4H15A 3T4EA 4IXDA 5IW8A 4LRUA 4JUCA 4FEYA 4EPTA 4CKCB 5AM1A 1H9BA 3CBQA 1ZIDA 2FVXA 4QBFA 2XNSA 5LNK1 1X0XA 2HCFA 1JE1A 4HGOA 3VDRA 4Q9IA 3M4ZA 2WB4A 1YZFA 4YP0A 3BJEA 1MUUA 4MVCA 4MWOA 2NSDA 3LFHA 3WHLA 1QV9A 2HHJA 2MSNA 4Y8VA 5EP2A 1JQJC 1TK9A 2CD9A 1VP9A 3DMRA 4GFDA 4O4JF 2B7CA 5EMNA 5SZIA 5LJIA 1H3NA 1UJ5A 4ID3A 1EAYA 4QARA 5DTJA 2WHPA 4DQUA 3D64A 3I9JA 1PV1A 3WAJA 3PGMA 3H9UA 1AHHA 2PGXA 2YXNA 3CJRA 1MDFA 1VCNA 4GRIA 2IWHA 3CG4A 3JQ8A 4C2BA 4OATA 4P7BA 1JU3A 5JH7B 2I6QA 4NARA 3W5VA 1S2NA 1FQOA 1XVVA 2YV3A 3GOHA 4GT1A 3F49S 1RXEA 2CNBA 3ORQA 1T3TA 1T3ZA 2D5CA 1IZ8A 1CS0A 1UK7A 3O31A 4A03A 3ZWWA 3AKEA 3CF4G 3KAPA 2ZW9A 3KWJA 1AD2A 1MIOB 1W93A 4U7HA 5C51B 4GOKA 1HDXA 4BFYA 4NOLA 1T9KA 3VR6A 3RRFA 2KYRA 1LY1A 2RIRA 1RXYA 2X4IA 1AF4A 1RHUA 3ANLA 3SC2A 3T7JA 2FQXA 4YRLA 4LX8A 1XU7A 3UGTA 5C35A 1J9EA 2FX3A 3TJRA 2HGSA 2QMQA 5AK3A 4DDUA 4ONEA 2PUAA 3OESA 2I5PO 1LS1A 1FP1D 5EYPB 2O48X 3A6KA 3QLUC 1QP7A 4QGBA 4QLAA 1XEAA 3QSGA 3PRYA 4AS1A 5G0VA 2VZLA 5AICA 3G2IA 2LZ0A 3H2IA 4HSEA 4JSTA 4PO8A 3ZNPA 4QXMA 4F5YA 3CRMA 3RRMA 3EPLA 2APJA 2F17A 1EUZA 1VSVA 3TH5A 4NNOA 4AMZA 4BAZA 3PNOA 2F7SA 4E07A 1M54A 3SYRA 1AH2A 3NRCA 3UK6A 3QPWA 3C14C 1JFRA 1KFJB 1L8LA 1UQTA 2PGJA 3JQGA 3PKZA 1ZNWA 4RK5A 1M6VB 1TGVA 3HVUA 4OI0A 4Q7JB 3UK1A 2Y77A 2VUTA 2W6MA 1OVMA 1DC4A 4KDRA 4QELA 2IHKA 3ZHUA 1JYEA 2IUFA 1UJBA 2C5SA 1DQPA 1IVYA 3O4JA 1K86A 4Q1VA 1FS6A 4FFLA 1JKJA 5J1TB 4RM2A 2FDCA 3FFTA 2TYSB 1WHSB 3HDVA 4W8OA 1IIBA 4ZT6A 1ESCA 4BFLA 1E9VA 1FDUA 3CO5A 3NV7A 1P3JA 4D4JA 5CVJA 1KEKA 1GU1A 2OK8A 3NM5A 5DM70 1P17A 3WADA 1AKQA 3G0HA 3M6MD 4HDRB 3CMCO 4CW7A 2VDUE 2E2WA 2RHLA 5GOZA 3D4IA 5GQSA 5LMUB 2F1OA 3K53A 2KM1A 2J0SA 3GDOA 4DA8A 1RC0A 4P4TA 2ZQZA 4YJ3F 4LV5B 4AQYB 2Q2WA 1KSFX 2FZ5A 4MMZB 1WIWA 3AT1A 3OHSX 4HDNB 3G7SA 4TS3A 1DCFA 3O75A 3FR7A 3GR6A 4XB6B 4MVWA 5FTNA 5H68A 3HLKA 1USGA 1NAIA 5BMVF 2FEKA 4B8YA 2A67A 4J1NA 1QB7A 4KUGA 2ANCA 1XZPA 4DWOA 2OBMA 5KHOC 3MLEA 1W88B 5AHRA 3BJMA 1JTFA 3WGOA 1PUXA 1Q7TA 1PNQA 3GL9A 5ALFA 3N8GA 1MX1A 2XZPA 2EJVA 1K8QA 2AZTA 3JWIA 3IURA 3UG7A 2QMUA 1ZOPA 4EO7A 2VDVE 1V6AA 2DP4E 3G2OA 4OQMA 1AO3A 2B3TA 4PG5A 4BFWA 2FW9A 1IY1A 4GX0A 1E20A 1N92A 2EEZA 2BCGY 3CF2A 1DO2A 1RTTA 3H2YA 4YUXA 2I0FA 2LVBA 1VRCA 5JYCA 5K6TA 1CUIA 3AFMA 3NGLA 1L7DA 3OT1A 4DJ5X 1H69A 3RU3A 2X8WA 4ERNA 1FQWA 3U2QA 6ABPA 4D8VA 1YZ3A 4OH1A 4B0OA 3GV0A 3EDCA 3JASB 2PMWB 3D6TB 3EA4A 1MC1A 1TIPA 4Z8XA 3GB9A 2Q3MA 3NP7A 1B2LA 1WF3A 2Z9BA 4LNAA 3WICA 1Y1LA 4MQ5A 3SZGA 4ACAA 3F46A 4KACA 1DDOA 2Z1MA 3ZQ4A 4R0MA 2GTPA 4M0PA 2BDTA 5KWIA 1P62B 1R3UA 3DW1X 4B3MB 2D0DA 3SC4A 2AOUB 1D6NA 2ID9A 3EXG2 1QDUA 1GGFA 3IL2A 3NWOA 4PLTA 4ZO4A 1CY6A 3GQBA 3BJZA 3WOHA 2HDWA 5HKAA 1WSBA 2IKSA 4ERXA 1UP4A 4C14A 5J4YA 2Y1EA 5BV8A 1Z7BA 4RFSB 1YKGA 2PO7A 2R2AA 4Q21A 3KEMA 2I6UA 3PLNA 4RAQA 3T7EA 1GLNA 3AX6A 3S7ZA 1VBNA 3W5IA 3HG7A 5FR2A 3UXYA 3KYDB 4NCHA 5F78A 4MHSA 4F3KA 2R7MA 8ATCA 1EXWA 4M46A 4O4HB 1Z5PA 3HFJA 3I9LA 3QBEA 3A37A 2R7KA 2C5EA 3OG9A 2R3SA 3NKFA 4LNUB 3RFUA 4CQNA 3BKWA 3O8BA 1SZCA 3WKAA 3MINB 3FLAA 2P41A 1NGSA 1FRNA 3PPWA 2WF6A 3KSDO 3N59A 1H5NA 1W1IA 2IUYA 1SPXA 3QA3E 3L4JA 1FQKA 4QUKA 3WYEA 2FX2A 2KBFA 4MVXA 3B3JA 3GN1A 5ALRA 3HU5A 4S0ZA 5AJVB 3UXHA 1GFZA 2J4DA 1B3BA 2SKEA 3IMEA 3JYLA 3M9XA 5BMOA 2XTAA 3W5AA 2ZI3A 1Z2EA 2FWRA 2HX1A 3HUTA 1HYHA 3PDUA 3E05A 3JD1A 1FU4A 4LVOA 3LCRA 4UREA 4BNJA 1RE1A 2Z2JA 1FXSA 2E6UX 4GZ6A 4PAMA 4U39A 2CWWA 1Q2XA 1AS0A 1GCGA 1YOVB 3AF2A 3N07A 1RHQA 1E4VA 2NSHA 2X23A 2YS7A 4F3RA 4UTPA 3ETGA 5L4LA 5M29A 4YJ2A 1RXWA 1RWOA 4LJLA 1RWVA 5DM1A 1B6RA 3I9MA 2ID7A 4G0MA 4XWOA 4YPOA 2I1LA 5LWQA 1XA3A 3EXHC 3NHKA 3MM4A 4BV3A 5IN5A 3X1ZA 5L6LB 1YRYE 3DZHA 1DIBA 1F9EA 5G2OA 2JA1A 2X0JA 1LU9A 1GITA 1TT5B 4J0GA 2KX7A 4L76A 1JG1A 4PXYA 1KY2A 4BWGA 3LFTA 4ENWA 3E27A 4NENB 1TF7A 1I5OA 3YASA 4IGEA 3LBFA 5KNCH 1Z16A 4OA5A 4FEEA 1GFIA 4ALJA 4FFSA 5KTOA 3UXMA 4HV4A 5G1PA 2H1FA 2V6MA 1KWKA 1ESMA 1RWPA 1QGOA 1G8JA 2D1TA 4JBGA 1ZCBA 3A6LA 3HDTA 4P5DA 4A6DA 4IVRA 2E37A 4LTNA 5DXFA 5AW3A 4L9SA 3KQPA 1AHIA 1W8IA 5K8CA 1I1HA 4Q7QA 1MIHA 3ZUPA 1HX7A 1SVNA 2MMGA 2VYNA 2R6JA 3UJ8A 2GO1A 3I3SR 4OI2A 5AJWA 5ER9A 4EEZA 1KKUA 3K9CA 3RBAA 1PK8A 3AZQA 3ESDA 5EHQA 4WMLA 1BC5A 1Z5GA 1O6BA 4BO0A 1BXGB 4ND8A 1J2YA 5FR1A 3B9QA 3I83A 5JROA 2ZR0A 2P69A 2FVYA 3AL2A 5AI0A 3W8FA 4BRWA 4BFSA 1CT9A 4DLYA 5BSMA 3Q5DA 4HN2A 4OYHA 2ZCVA 3QELB 2Q3BA 2ENUA 1G5IA 2BFCB 2GK7A 3CPJB 3HVJA 4UM5A 4G9BA 4RNDB 4NX2A 1QB8A 5LXTA 3IV7A 3R6DA 4GDFA 2XI4A 1A2OA 1F48A 1BJRE 3LYLA 4MW2A 4UE2A 2ACEA 5EA2A 2NO9A 2YXDA 1ISHA 2HA4A 3F71A 5B36A 2BEWB 3IQZA 1QP4A 2W2TA 5EKTA 3IEVA 1EJBA 1V7ZA 2JL1A 3MCAA 3G0BA 3R74A 5ERGB 3OPMA 2HMTA 4L4SA 2QX6A 2K4MA 4OHYA 3R7FA 3EEYA 2OOKA 3FVQA 5KYYA 2OLEA 2I67A 3NBAA 1I4WA 3QBVA 3OFSA 2Z8ZA 3IPYA 1QE0A 3MRSA 4L6IA 4G85A 3L7JA 4E08A 4G0QA 3LTNC 1A2KC 4U7GA 2IU3A 1UODA 2ZSJA 1KHTA 2ERYA 4RPKA 2RIPA 1CIJA 4G8CA 2XUHA 2Z4TA 3CISA 4YX9A 2YH2A 3G1UA 2OM6A 1SUAA 5SY6A 3RFCA 2PX6A 4KO2S 3KJNA 3QU9A 4U9UA 3QKUA 3WO1A 3LWNA 1ZY2A 1JA0A 1PGPA 1HLFA 1GGVA 2XGSA 3FCXA 4MV5A 4RHYA 4D25A 4ZDJA 1Z6ZA 2OMKA 2V8OA 1NLZA 4FINA 1HE2A 2WIAA 4L22A 2C3YA 1GCUA 3OECA 2WWVD 3ZD6A 4S0XA 2WHXA 3INRA 4OAOA 4QGSA 4C88A 2OTCA 3WDSA 3PX3A 1WCIB 1WABA 2XHZA 2X8JA 2GJSA 4N49A 5DLYA 4CQMB 5KU7A 5KYGA 2G76A 2QVYX 1QKJA 5IF9A 2R1ZA 3QE0A 1YJ8A 3IUJA 2OT3B 2QW8A 3EXEB 4G1BA 4NDNE 1Q11A 3DEAA 2LE0A 3JAKA 1PV4A 1NSTA 4RJTA 2VVTA 1L7PA 2QJTA 3TQHA 3N05A 2QD5A 3I6YA 1REQA 3A27A 1HSZA 2XYGA 3WBBA 1I5EA 1PHRA 3KDSE 4DQ0A 3SJAA 2VF8A 4ZAVA 2G9RA 3PXXA 3FZEA 4OB6A 1MV8A 2SNIE 1V1MA 3G85A 1J21A 3HB9A 4NDAA 3RDPA 5LQRA 5G4KB 3U9SA 1DX4A 1MH1A 1BEEA 2CK3D 1EFVB 2ISCA 2D74A 3U5TA 4NXNB 3N0WA 1XJ5A 3ANSA 1UBKS 2ZKIA 3BQNB 2RI1A 3FNBA 4XJVA 5ALOA 5E1OA 4PC2A 3EY9A 4WOJA 4P5PA 2OAGA 1V4BA 2AJCA 3JZMA 1HYBA 2OHFA 4X90A 1HLGA 1XP8A 1ZBDA 3CEAA 1KAOA 4KV7A 3WMGA 5KU1A 4RLQA 2FMXA 1K3TA 3EODA 5A7GA 1SCQA 1ZGHA 2A4MA 2QRGA 1VHQA 1J0BA 4M54A 3TTUA 2NPFA 3STWA 2ZJ2A 4OUKX 4BLRA 1JIKA 5MHTA 2J9XB 2ES4A 3VR4D 2XUGA 1MRZA 5JYEA 1C3OB 1XTRA 3T5CA 2J9FB 4UE6A 2DHEA 3KSZO 1X87A 4ARZA 4H1HA 4F3YA 1IPEA 3LKBA 1P9OA 3DOCA 3K5HA 3KTOA 3Q6IA 1TKRA 3G6WA 3H9CA 3VU9B 3UMFA 4CDRA 1K8YB 1SG9A 2OY0A 1M2OA 1UBFA 3AUXA 1II8A 3T9BA 4GBED 1BA3A 4MVJD 3DBRB 2IK8A 1PQ4A 5C9ZA 1IN1A 2R6AA 5A05A 2VQEB 3K6RA 3OJCA 1OPRA 4PZYA 3OP1A 2AX3A 2WR8A 1HDZA 3GHYA 3KKLA 3AGPA 4OYLA 4Q03A 3V2HA 5JZVA 2WQ7A 1M2NA 3H2HA 1XMPA 4MYDA 4Y0VA 2WMNB 4L6CA 3B7PA 4UFOA 3M5DA 4YK7A 4CV1A 1LF5A 3I09A 4LRSB 1RC8A 1L8OA 2EBFX 3A7DA 3DOJA 4RMNA 5UKDA 4ECEA 2PSDA 3QGMA 2AEEA 2C5BA 2FZEA 3COJA 4C0SA 4QJBA 3N39C 4HAWA 3H7AA 3S1AB 5BVGA 2G1PA 1TUEA 2B78A 4TZTA 5BW5A 5K3EA 3VNRA 4M6WB 1E9DA 1TW3A 3KPWA 1E5TA 3D7MA 4MWGA 4RORA 2FSIA 4TLLB 4FOOA 1ODIA 2QY6A 3BTSA 3SZUA 3UAVA 2AJ8A 3ZDCA 3PX7A 4I55B 4Y98A 2VC2B 1EK2A 1JDPA 1OZFA 2KS6A 4XH9B 5FWYB 1O77A 5I9MA 3U7EB 3MHTA 4FJ2A 1E9CA 3VKVA 3TFWA 1DADA 1U8XX 1RNLA 1UUFA 3H8JA 2OZLA 1NXQA 1XL1A 1G1MA 1JR3D 4CTJA 2NXNA 4O4LF 1QF9A 1P91A 2YUTA 3HXPA 2FZLA 2FE4A 1YI1A 4FFNA 4OYRA 2VJQA 4R1TA 1F8GA 5DRYA 4RIFA 2PD4A 5FA6A 4AY2A 4XZ3A 1QPZA 1JQEA 1DAMA 3GJ6A 5L4NA 4LQDA 4DYHA 1D7AA 4E31A 1B0ZA 1POXA 1Z4IA 4QJ5A 5HMMA 7REQB 5JD4A 4C43A 1CY4A 3Q15C 3BZBA 3IP8A 4RD3A 1WB5A 2QXUA 4FT2A 4RPCA 3UWKA 2ZT6A 4D9HA 1QQ7A 1PVVA 1F12A 1X7GA 3DR5A 3U6KA 2QPTA 3QFTA 1CEYA 1FB5A 2Q1UA 1RRMA 4LMRA 4US2R 4OMUA 2LP4Y 5ALYA 3EAQA 3H19A 5HJ5A 2UZ3A 2N0SA 3BMQA 1LVGA 2IYWA 3TZ6A 3A4YA 3V4FA 4REMA 2ZM5A 3A3PA 3AF6A 1DU4A 1S9HA 4NZZA 3Q9NA 4PZCA 4DB4A 3IHLA 1PQYA 1HYQA 3P9RA 2GARA 4QOFA 3UAGA 3V00A 2VDKB 4LGVA 2G9NA 3QMWA 4IVNA 6AT1A 5F77A 4X8LA 3U7FB 1SUIA 1TO1E 2I34A 3LC0A 3OEHA 3W1VA 2ZIEA 1Q0ZA 2M6KA 1N2JA 4F9GA 1RZ3A 2J09A 4H7FA 3FPKA 1M67A 2EEPA 2PL1A 2HQ1A 1OJ7A 1U0NA 2CNWD 2XB4A 2ZJAA 1QGAA 3AKCA 3JTEA 3L7BA 1ITZA 4JC8A 1NMEA 4DLVA 3HBNA 4E70A 4OHWA 5KQRA 3MSCA 4O2AF 5FOSA 2FXIA 2ZVQX 5EWMB 4NK5A 4B2LA 3KQNA 1ZRSA 2W4QA 3I1YA 3JAWA 4HL6A 1V8DA 2XDYA 4N3NA 3TUJC 2O0HA 2C1XA 1LA2A 4G5GA 3T5MA 3GVHA 3VVMA 3RANA 4ZK2A 1Z82A 4HB0A 1BX1A 1PJ8A 2DQYA 5CT8A 1OI7A 3VR6D 3WVNA 1VJCA 1AVTA 1TL7C 3FJOA 2ZIWB 4LMAA 3A6PC 3HCCA 4BMVA 1NNLA 5KSPA 3JYQA 1EUDB 5TB5A 1NVMB 2ZCJA 4EYGA 2ZAMA 3LY5A 5D84A 1ML3A 1VG1A 4GOXA 1ZXLA 1SVLA 2JFVA 2Q2NA 2IF0A 2C2WA 2XQVA 3N75A 4I4IA 1CB7A 1RCFA 1QIDA 3AHGA 4ZCPA 4CLOB 1JTEA 3FGZA 3IBTA 4I19A 1RWBA 4QYIA 3ZBPA 1Y63A 2IOFA 4JUFA 1N78A 5KNCA 3U60B 2J6IA 1XRNA 5F3WB 1AO0A 1AGRA 1J8VA 4CE6A 1QP0A 4AT1A 4KR6A 1ZUIA 4UUAA 5KYVA 4BLQA 3TKLA 4EF4A 2J45A 3DEKA 4CFZA 1AB6A 4EVQA 3SI7A 4XM2A 4WL0A 3WYAA 4WXRA 1Z4KA 3GIDA 3UA3A 4ZGWA 1TADA 3COWA 4LF9B 3G82C 4ACBA 2BGNA 1V8ZA 2NTJA 5A0VA 1HKHA 1R8QA 4LXUA 3PJRA 3C5HA 1HG0A 2FLWA 2KQUA 4H17A 1A95A 2NO0A 2YOGA 3MTGA 4MARA 4TYMA 5I8ZA 1UMDB 4BNFA 1EXMA 3LYHA 1L1EA 1XDUA 2L0XA 1UPFA 2HFKA 3ND9A 1GT91 3QZUA 4BMPB 1RCUA 3P7MA 3ANMA 3E7DA 3QW4B 1F38A 5EXTA 4JR2A 4YRZA 2ZAYA 4OHMA 1Y3CE 4CG2A 3LQFA 4R9UC 1MKYA 4TM8A 4KGZA 2OCIA 2ONKA 4TKMA 2VI5A 3T3IA 3M3PA 4IO0A 3P2EA 3OLWA 2AH5A 5C3MA 3DSRA 1RJ9B 3MA0A 3U81A 1ENOA 4CETA 2FMFA 2WU3A 1ZAKA 1KMHA 2QPAA 3ZX5A 3K94A 1BCRA 2B61A 1A1SA 1Y82A 3GP3A 5E4YA 4ZZ2A 3L6CA 1YV9A 1C1XA 1IWPB 1KORA 4GM0A 4XAQA 3D02A 3LYAA 5CDSA 2FZWA 3KNZA 2W93A 4MULA 4Q9JA 3U17A 3CPEA 4UDOA 2YKGA 2EDAA 4ED9A 4UFPA 2W6JA 3FPCA 1NMSA 4YRDA 2PTHA 4LDNA 4R8RA 5FLKA 4FZJA 2BGGA 1Q92A 1AUXA 2GBIA 4QWWA 2RHHA 4E4TA 2V6GA 4Q19A 4AZ3B 3ER9A 5CEJA 3Q7TA 3CNLA 3WGYA 2OECA 1VI6A 1XRMA 2E21A 3CPSA 3GNLA 3GZNA 5A3JA 4G36A 3OCCA 3QIVA 2WTUA 4GMGA 2XUJA 4ZRDA 3AEKA 5T8KC 3F7MA 2O2EA 2W2LA 2YJZA 3KELA 4N5HX 4ZQHA 3WGZA 4BRUA 3RVDA 1M10A 1TJYA 1PDOA 1P5FA 1UWKA 4YIKA 4KAXA 5K9ZA 4RMGA 1AF7A 3T4XA 3K1JA 3WK6A 5FPKA 2REOA 3GJZA 3IQDB 4GAEA 2VTBB 4O2RA 2V3CC 4Y0AA 3PQ5A 4YRBA 4GMKA 4MUIA 1ZWKA 1QZ3A 2R44A 4E2XA 4YP6A 1NUSA 1I0ZA 1L8XA 2FWPA 3S2ZA 3AIIA 4D3XA 3BIXA 4FQ5A 1DIRA 3UWSA 4C0AC 3G23A 3AEUB 3SZOA 4Q1DA 3LBYA 1V3QE 3PGKA 1ZGCA 3NJ8A 4WT7A 5EZSA 4EJSB 3R5HA 2YDYA 2NV6A 3WGJA 3CRW1 4NZMA 5L7YA 2HPVA 4FNMA 3HXMA 4BNZA 3WI7A 3DYBA 2WJ4A 2CFOA 1ZH0A 4S1OA 4TV9F 3PA6A 5IJXA 4W5TA 4QDZA 1WSDA 2W0SA 2UYGA 1DHRA 2VR1A 2A7XA 3AWIA 4B4VA 2PWPA 3KEOA 3IESA 3MUOA 3VKHA 3EVAA 1I3LA 3K4PA 1VE3A 2FR0A 1NMXA 1YZLA 4WI1A 4ZOLF 5M7EA 3JQFC 1MA0A 4QVIA 3GLSA 3IP9A 4P33A 5EXDA 2H5IA 1TC2A 3DEIA 4C08A 1GKUB 2JI9A 4RY0A 1ZVJA 5JFOA 4C0BA 3LIIA 4O4JA 3GJ8A 1UJ2A 4JY7A 4LOKA 2FWMX 3I9V6 1MJ5A 4E32A 3W2FA 4HRVA 1ORDA 1IUOA 3HB1A 3B53X 3WGLA 3BUSA 5EKSA 1XAGA 2UU9B 2QX8A 2Y1LA 3PE6A 2X2EA 5KOJA 4RYLA 3BJIC 1QV6A 4YRGA 3IXQA 4PLGA 1A3CA 3T3DA 4LF4B 5EP4A 3GA0A 1U7XA 4BFUA 1N5DA 1U31A 4JR0A 5CT6A 1NW3A 1XCMA 2I54A 1VB5A 4JFAA 4URXR 4OIFA 1FSPA 2YIMA 3D8HA 2GEFA 3ZCRA 3A6GA 4EF5A 4ZT2A 2K87A 1CHDA 2I80A 5AHKA 3ZDDA 3W90A 4HNSA 1ZK3A 4HRAA 1C30A 2YYSA 2HQBA 1SFRA 3GRVA 3HLTA 4IIYA 2IX3A 3REGA 4R2HA 2NPIA 2XH8A 4TWIA 1XNJA 2GZAA 4RBNA 3U49A 3LWBA 1LRKA 5K09A 3WMWA 4RZQA 4DAOA 5HOQA 4UM9D 2XV1A 2OSVA 4E1BA 3EXAA 4F11A 4FMDF 4WDQA 1Z0FA 4PXAA 2VLBA 2J4FA 1NVTA 4QHTA 1WB4A 2J67A 4IJQA 4L2IA 1GRRA 1M0WA 2I33A 5C8YF 1NXWA 3JQCA 1E2MA 1M33A 2NT4A 4UEQA 4IKEA 1DX9A 1RAGA 4DADA 4CTNA 1E1CB 2MSWA 1GV1A 4J3JA 2X1HA 1I51A 3GLFA 4WH0A 2DY1A 3QXCA 2QNBA 1K0UA 2XOKA 2WWTA 4WSOA 2ZT7A 2ZWAA 2BY4A 2OR3A 4JEIA 1XD9A 2H65A 1VRVA 2VOEA 4O4IF 2RGNA 3K09C 4N47A 1ESZA 4CUKA 3DV9A 2X1MA 2ZRGA 1WW2A 3N2NA 2BBTA 1FSZA 1H2FA 5IARA 3LL7A 3AINA 3RUHA 3WYGA 2IHUA 1N6LA 1E2JA 2VYND 4AG6A 4FHDA 1E7MA 5FUXA 3PEUA 5DP1A 2FQWA 3G2JA 4QQKA 5H83A 3AVXA 1UBUS 2C1EA 3G2MA 3OSZA 2FMHA 2Q5FA 2X15A 1KI6B 5GZ6A 2I7VA 1GGMA 1Z4OA 4LDQA 2FFHA 2NP6A 4QX6A 5F35A 3QOXA 1DX6A 2NZXA 3P94A 5FI0B 1MAHA 3ADOA 2CUZA 3ASVA 2X22A 4JB3A 4YJ3A 2JHGA 4J76A 3I0NA 4RSRA 4HNAB 1P7WA 1FY2A 2P9TA 3G49A 4OBWA 2C9MA 1FDSA 2WE8A 5IEJA 4PQGA 5KKCA 3QKRA 2B4KA 1JUDA 3Q2OA 5BMVA 1US8B 2Q0XA 1JJFA 4RXUA 1BEZA 3OWOA 4GP9A 2B92A 3FAKA 3RQIA 1JG3A 1QYXA 1V45E 2GI4A 2PZEA 3OY2A 4Q66C 1HT3A 5LOVB 2X0EA 4XPIA 2IIBA 1YVEI 1IQUA 4YMIA 4M9ZA 4ZJUA 2J9ZB 3WLTA 2ORWA 3Q3JB 3L1JA 1J6UA 3MD0A 5HFNA 2FKAA 2G77B 4YC7A 1I3CA 3A9VA 4DXHA 1VBMA 1XZDA 2AB0A 4PZAA 3PNLA 2BCJQ 2G5PA 4HF7A 1ONSA 3S3TA 1FUEA 3HZRA 1KAEA 2JGIA 2JAWA 2JFWA 2XRYA 3M1LA 4OJMX 4WLEA 3RAGA 2HSDA 4A27A 4GR9A 5JS1A 1JDJA 3FCSB 1WBJB 3OLZA 1BU8A 1ZOLA 2Y1FA 4RY8A 4GX5A 1GQRA 3AFNA 3AI1A 3H5NA 3LCJA 4URFA 3TFQA 3B3GA 4XFDA 5FXMA 2QX4A 5G02A 4ZI3A 4X95A 5C4GB 3TW6A 4GKKB 1U0EA 3D4PA 4KXXA 1NC1A 3RTAA 4BVLA 3W5SA 2OCYC 3U4IA 3GJQA 5AW7A 3SDBA 1IQ0A 1P1KA 1JJAA 4A8JB 4KUEA 1JLHA 4ND3A 2IZ5A 5C31A 3TEFA 4M8LA 1JG4A 5C53B 1F2DA 3VDMA 3MD9A 2GK4A 1KO4A 5IDWA 4CKYA 4S2UA 1C8KA 2J3EA 1NI4A 2C42A 2Z56A 3A10A 3MAGA 4M83A 1QH1A 4RAOA 4Y2YA 3O9MA 3FUCA 3R5KA 4PCVA 1I0IA 5AR1A 3WHKA 1FW6A 3I3OA 4WHMA 3QPDA 3GVCA 2RI6A 3NBQA 5K3SA 4K9MA 1YL6A 1UOEA 1AV7A 2JK0A 3FCOA 3LHSA 4NNJA 2HRQA 3GT4A 1I9GA 4J0KA 3WWYA 3WJ7A 1BKSB 3QVWA 4LCEA 3Q9LA 1KAHA 2QD3A 1A98A 2UVDA 4B48A 3CH5A 3AV3A 5DEIA 1N1MA 3NGXA 1CERA 1SCAA 2NTEA 2DWUA 3IEUA 4I36A 4EB6A 2D1YA 5EQDA 3ITDA 3HCFA 1O94A 5EINA 3BTUA 3SIPA 4E5PA 5KREA 2UZAA 2D2FA 1Y7IA 1ICIA 2BUCA 1HYEA 3EC1A 1XJCA 3HCOA 2OO5C 2X6RA 3HCWA 4J49A 3JARB 4PAOA 3FNHA 1QYVA 1NSFA 4WKBA 3TNDA 1PJTA 2M1XA 1DUVG 1ZGZA 1OLUA 2QYTA 4M53A 1DEOA 3BRWD 5ALGA 4M1SA 5ES3A 4EAQA 4Z4GA 2I99A 2X2OA 1DWOA 2HF2A 3F7OA 3M5WA 2A9QA 3EGVA 4QGHA 4X61A 4UHKA 3K0BA 3HU3A 3KJFA 3PEVA