2ZSIB

Structural basis of gibberellin(ga4)-induced della recognition by the gibberellin receptor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
60
Chain Sequence
GMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVLATETVHYNPAELYTWLDSMLTDLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable gibberellin receptor GID1L1
publication title Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 20
structure length 60
sequence length 67
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12041 DELLA Transcriptional regulator DELLA protein N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1290 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zsiB00
2ZSHB 2ZSIB
chains in the Genus database with same CATH superfamily
4DIQA 4PCQA 1Y1WJ 1TWFJ 1YITI 3ROUA 2W82A 3LQRA 2D45A 1R9TJ 1YS7A 4ZTFA 2CS3A 2F2EA 3HHGA 1K6YA 1WKMA 4X0GA 3RI4A 3DPTA 2VKVA 3TQNA 4Q4ZF 1FBUA 2VT3A 4OIPF 5LHHA 2ZFUA 2VE8A 5CVUA 2MABA 2RKHA 2VJIA 2MC3A 2DO7A 2E36A 2M8EA 3GTLJ 3RPQA 1U78A 3CESA 3HRUA 2XDVA 3KE2A 4M3EA 4MO7A 2UWMA 4MEXF 3MZ8A 3I9V2 2DMTA 2HFHA 4OOIA 1X3UA 1IZ1A 2F5CA 1H9TA 3E3VA 5H6QA 4A0YA 2WAFA 1KQ9A 1EF4A 3TDZC 2RQPA 3HM5A 3OS0A 1S6LA 2DQRA 5IP6A 4Y13A 5CPRB 3OYEA 4LK0F 3GMEA 5GP9A 4RAYA 1R36A 4DYQA 2CQ7A 2LKSA 4BEHA 1FMWA 3AL0C 2HPIA 1W36C 2AO9A 3GTJJ 3HIFA 5E1XA 5CKTA 3J7ZI 2KP6A 4ANJA 3DF8A 1ETYA 2FOKA 3ZP5A 1R1VA 3BP8A 3OIOA 4RBOA 3ZR8X 3MEXA 1JJ8C 4YEJA 4PFPA 2IS2A 2JQ7A 3B02A 1XSDA 2BE5F 4A3FJ 1QRYA 2W24A 1HXDA 4CCOA 3B6AA 3EUHA 2IGMA 3DBRB 1DP3A 4RAFA 3CCMI 2ESHA 4JYKA 4Y4RA 2ZJPF 2WBMA 3QU3A 5CVVA 1PUEE 3GF2A 4NC7A 4OAYA 5L3FA 2Y9YA 4QPOA 3JRDA 3K1NA 5FRNA 3MN2A 2C6YA 1XSXA 4BXUA 5B1AH 3CQZJ 2KHMA 2RC4A 3HPGA 3A0BC 5AIPA 1AKHA 1AU7A 2CU7A 3QOEA 2ZNZA 1SD7A 3OYBA 3WGGA 2DDAA 3RDIA 1SMYF 3WTVC 2JSPA 3FMSA 5D5WB 2KJCA 1T6SA 2VIXA 3K1MA 5F08A 3HZJA 3NWTA 3RIRA 3G71I 2STWA 2DMNA 3COAC 3I64A 1D5VA 1G3TA 4MGRA 5BS6A 5D8KB 1T38A 3F6OA 4RM2A 4AU7A 2JUCA 1T0FC 2A6EF 2UUZA 2W84A 3KYCB 4JX5A 5JHFA 1T39A 1MDMA 4OU0A 2E5ZA 3E0JB 2V9PA 2HYFA 2XAHA 5KCMA 1FTZA 2RGVA 4Y3OA 4ENNA 3AG3H 1WRJA 1OLTA 2DFIA 3F3XA 4QSHA 4RB2C 3J80Z 1O3QA 2PMHA 1K78A 1X2NA 3ESWB 3M07A 1BI3A 1NH3A 3Q9VA 3QP5A 1W36D 1J0RA 1KONA 1IN7A 3LAJA 1BIBA 2R4GA 4D7MA 2KLOA 1W5TA 2F48A 2CW8A 3KX2A 1LEBA 2BY2A 3LA3A 1XG1A 2GIVA 1BOAA 3HUGA 3M8FA 1E0EA 5L3CA 4HZFA 3BR0A 3M8EA 2ACJA 1WGXA 1MKMA 1ZTRA 3CCUI 2Z33A 2LYCA 1IC8A 5E8GA 3GEZA 3L2UA 2L7FP 4BBSJ 5D8LB 2AXLA 3CMMA 4IOCF 5K5RA 2Y30A 2O8XA 4FE4A 4II2A 5DM6F 3JRBA 1XMXA 5CQEA 3BLYA 3PFIA 2EFPA 4MTEA 2M5WA 1D8KA 3BR5A 3FMQA 3HOUJ 4G12A 1LE8A 2B63J 2DK8A 3DXJF 1XDSA 1E3HA 5FKMA 3CJTB 4HV6A 1K61A 2VODA 2FRHA 1G3WA 1RKWA 3LSHA 4IJAA 4XSXF 3ZMDA 3WTWC 3P9KA 2ZXJA 1YW9A 3LSIA 3DBHB 3SXYA 1WI3A 1O4XA 4M3DA 3ZMZA 3BPVA 2DFFA 4FISA 5ICCA 3HOZJ 1LJ9A 1IRZA 1ONVA 4LIUA 4CCJA 1IF1A 1NTCA 2FBHA 4CHUA 2EWNA 1XCBA 4IHWA 4PK4A 2E2JJ 4I02A 3OWTA 3JRGA 4UB6C 4CYCA 1QZEA 3HG9A 3QU6A 3KP2A 4AD9A 1MBEA 3CLQA 1W5CC 2R3SA 1DU6A 2EZKA 2ZJ2A 1B6AA 2VL8A 1R5HA 4HPQA 2IXSA 4IQJA 3VDXA 3KP3A 2P5VA 2BXZA 3DLAA 1STZA 5EEAA 4I76A 4XRMA 1ETVA 2LF7A 5HNFA 4ZTJA 2GAUA 1BBYA 1FPQA 3KFWX 2V9VA 3OYLA 4N4OB 4L0YB 1P7JA 2DT5A 2FU4A 4L18B 1MBFA 2X1CA 1GVDA 3C7JA 3WU0A 2CSOA 2KRHA 1MIJA 2AXTC 1ZRDA 2XIGA 5EDNA 4HF2A 3P5JA 5IT3A 4M73A 5BNGA 1G3YA 4K2EA 4EM1A 2JJ7A 4IX7A 2EA4A 4F91B 4BKXA 3CCSI 1WJAA 2Q2EA 3MCZA 2QSHX 2IEKA 5GTHC 4AVPA 4AWXB 2EPFA 2QBYA 1YJ9I 2L5QA 3TW7A 3S32A 1TL8A 3L1PA 1T2KA 4DBRA 3VYUB 2ZO4A 4MIMA 3Q0UA 4NDLA 4RGXA 2P4WA 3JAMZ 2YX7A 4IHSA 4XOTA 1E3PA 2CW7A 2YR2A 3FXUA 2Y0SN 3ECOA 4YIFA 1WZ2A 1TC3C 1VQPI 2W4SA 3LA7A 2ZC2A 3D0SA 3HRSA 2VKDA 1V4RA 1V55H 1TW2A 5A2QK 1GDTA 2XF5A 4G6TB 2OUMA 3RZOJ 4KMFA 3RTRA 5M3FJ 3H1CA 3CP2A 1J5YA 3P7NA 1JGSA 2LVSA 2ZFWA 3V8KA 4ZH4F 5BQTA 3LSRA 2DCEA 3ECHA 4BBRJ 3K10A 3LWFA 2BYVE 2D2WA 3RKWA 5E3NA 3JRIA 3Q0WA 4L9TA 2X6XA 2R7FA 2VXZA 4P96A 4BEHB 1BW5A 1FLIA 2O9LA 4EQQA 1X1AA 1RZ4A 4EMSA 5HLHA 1Z7LA 5J1UA 2DTRA 1G3SA 1UHWA 2XRLA 5J4VA 3EPZA 1E17A 4UVBA 4HSRA 3K4BA 2GA1A 1BR2A 3WODF 1DPUA 2OA4A 2WAEA 4RGRA 3IWFA 3LNQA 4MFEA 4HRIA 3V7RA 1T08B 5DS9A 1HKQA 3C2GA 2JA6J 2HGCA 1Z67A 1CGPA 4XORA 2STTA 2DTZA 3DU6A 1R49A 2H09A 2QQBA 2JK3A 1QHHD 5E20A 2EFWA 4BXXJ 2QQAA 2DOAA 2OCCH 3SEZA 4B09A 5LBQA 2H1KA 4HX8A 4UV8A 1QPMA 4ESFA 1ZYRF 2W00A 1IRXA 3VB2A 4A3MJ 1T98A 2PX9A 1JUPA 1Y0NA 2JA2A 1FBQA 2CQKA 1RRJA 4BGDA 1Y1VJ 1Z1DA 2XAJA 4YG2F 1WCMJ 3KZZA 1AKHB 3MWMA 1IW7F 3HOXJ 2E19A 2V26A 2VJ5A 4P9FA 4HQEA 2L2OA 1HOMA 2XF7A 1W7PA 2UZKA 2X6YA 1B8IA 1WJDA 1D1AA 3BCAA 3GXOA 3TKYA 4LB5A 3QPTA 2BHZA 2CRGA 3I55I 3H0GJ 4FASD 4YELA 2IT0A 2NXNB 2WAQA 2XKPA 4IRGA 1ZGAA 1YX3A 2GZWA 4C30A 1K6OA 1VQNI 2M34A 5CVIA 1BC8C 1UMQA 3F23A 1ZGWA 3GFJA 2DW4A 1MDMB 1LFPA 1PVEA 4EJUA 2NVYJ 4G7ZF 2R7OA 4A3CJ 1TTYA 2XPVA 2EZLA 1B4AA 3ZQHA 2CQXA 3LAPA 1CF7A 3MD2A 1O7LA 3QYBA 1K4TA 5CVRA 1X3WB 1RUNA 3I53A 1JHHA 1BC7C 4B44A 2MH9A 4XSZF 3IC7A 3OYFA 1LDKB 3R4KA 4BUPA 3DKYA 1PP7U 1PYVA 2ZJQF 1KU3A 4BYYA 2ESNA 2TCTA 2ME6A 2Z1DA 3H3UA 3B73A 2X51A 4LLNA 2HKXA 5E17F 4QTRA 2VOOA 2EV6A 2WB1N 1YHQI 5E18F 1V54H 2LKXA 5IP7J 2EZIA 1EKEA 2XSJC 2OZUA 4PSWA 1Z77A 4XICA 3D1NI 3FM3A 2ID6A 2P6TA 2ELKA 4H0EA 1SFOJ 1QZZA 4N4NB 2FQ3A 1JT6A 2K5CA 2W1OA 1U8RA 5F6FA 4AYBA 3CC7I 1A5JA 1P6RA 2VE9A 3TDUC 3F72A 5J40A 4BE1A 1SC7A 2JMWA 1TWGJ 1ZARA 2KQRA 3K7AJ 3LFUA 2KRFA 4M6YA 3RYPA 1OYWA 1AHDP 3T8RA 3DKXA 2W57A 2MD5A 3S1QJ 4ZYGA 4HW0A 5IOYA 4JOMA 1NG7A 4NB5A 4IHXA 2O3FA 2P0WA 4WXCA 3V8LA 1F4KA 4CYCB 1J09A 3U2RA 5E3OA 1RESA 2PN6A 1P92A 2X1EA 2P8TA 2NOGA 2NVTJ 1R5GA 2IS4A 1NG6A 4UUTA 4W1UA 4CA0A 4WCGA 1S7OA 3FWEA 1MGTA 1ZG5A 2ADUA 2E1MC 3HB9A 1B72A 4RB1A 5KAIC 3O3KA 4BY7J 1JUMA 2JRMA 4D7NA 1IN8A 2DA2A 3QAHA 1VQMI 3S15J 4UB8C 2XSDC 3I4MJ 2M7BA 5C4XJ 3CDLA 1UHSA 2BVMA 4G6QA 1YIOA 1MMDA 1EH6A 1ETXA 1IRGA 2IA0A 4XKBA 1ETKA 1GV5A 4MNUA 2FEZA 2Q0OA 3J7AY 2MD0A 1SVLA 2OTLI 2Q2EB 2WY8Q 3G6EI 4U87A 4HF1A 1JKOC 1BN5A 2XAQA 1B9MA 1WJFA 4ENJA 2QBYB 3F0CA 3SZGA 1IRFA 2ICWG 4KIFA 4RS8A 3TP0A 2MC4A 5FKOA 5D6EA 3TP3A 4II3A 1AOYA 1FOXA 1JT0A 2M45A 1VF9A 1WH5A 2QYOA 4V2FA 2LNBA 2M0MA 2NS0A 4ASNA 3GLLA 4ETSA 2Y31A 2R5ZA 2YUSA 3K4JA 4O6JA 4Z6YA 3BDDA 1TT0A 2L0KA 1B59A 2R0QC 3H5NA 4KICA 3TBIA 2VOPA 3LL7A 3HC7A 2E60A 2FX0A 2GBYA 4L9JA 2IRFG 4XN3A 3E97A 1WJ5A 3S3OA 5FLXZ 2EBIA 2DDBA 3D5SC 3OYCA 1DUXC 3L00A 2VI6A 4XKCA 4L5JA 1BOBA 5ILSA 2VC0A 1EA3A 4RAZA 2LTPA 1MMGA 5ICGA 1YI2I 3OYIA 4AUXA 3H9QA 5FLVA 2DA6A 5BOXA 2K7LA 4XLCA 2M4KA 3ISPA 3J81K 2MW8A 3JSOA 4D1QA 4OAZA 4B4CA 4CCNA 1W4MA 1OYIA 1XCVA 3CCLI 1JXSA 1SD6A 4A3IJ 2QZ8A 1A31A 5HLIA 3CTAA 1V5GA 3HRTA 1VQ5I 1MBGA 3C2BA 5IT9Z 2K27A 4BS9A 5E79C 3OYAA 2VQGA 2OBPA 3LOCA 1WH7A 5ILUA 4ZJZA 1HQCA 1MBKA 4KDPA 1OPCA 2H8WA 4R8HA 3K4KA 2ZSHB 1B1BA 2IGNA 1W5SA 3JRHA 2KZGA 1F9NA 1Q1HA 4UY8I 3KYDB 2O5RA 1TBXA 2CV0A 5DM7F 1W7PB 1KQ8A 1B8IB 3PNTA 2E34A 3FXJA 3LA2A 4FE7A 2KDZA 1XMAA 3RZDJ 1F1ZA 4HDUA 3T0YA 3QPSA 4A3LJ 1YJWI 1XPXA 1SFUA 1K7AA 2CH0A 1HBXG 5D5XB 1Z21A 1OYYA 4ZC3A 1S72I 2IJLA 4HA8A 4UUSA 1Z6RA 3RYRA 5GTIC 3GZNB 1J59A 3BQYA 2FQ4A 4A3JJ 5IYBJ 1OJLA 1IXCA 2AS5F 1KGSA 2MSYA 3JTHA 1CF7B 2FA5A 2YU9J 4HX4A 2EFOA 4OINF 3CC2I 4PDKA 4ZYDA 4CSWA 1BW6A 3HOWJ 1ACIA 3DTEA 1HKSA 2K4BA 3KIOA 3W6VA 3A0HC 2XGDA 2XPUA 3QODA 1JKPC 1HKTA 3A03A 2XKOA 2XGEA 5LGTA 3S1NJ 4AIDA 4UXNA 4S04A 2QKLB 1ZHFA 4Y7NJ 3PNYA 5HS7A 2KIFA 2Y75A 3PSFA 4XLHA 5JLXA 3HL2A 2WTEA 3DFGA 5EZHA 4ON0A 4DQ2A 5LD2C 3A01B 4AIHA 3CC4I 1LUJB 2EIJH 2K85A 3R0JA 1S9HA 3L2QA 1X1DA 5C4JJ 1W1WE 2AQEA 4XRFA 3WHCA 3K70C 4YFKF 1H9GA 2QSFX 1OR7C 3OYHA 5F0HA 2YSRA 2RNJA 1G59A 3CO6C 3IWZA 3ZCOA 1FJLA 3E1SA 3SHFA 2CWEA 1LVKA 3O2PE 4XBFA 3WU1B 4J19A 5E3LA 3NWSA 4G8XA 1ULYA 1YLFA 1MNDA 2XB5A 4BE0A 5B5EC 3ELKA 4AIKA 2W25A 1NHAA 1IN5A 1X4PA 4LG3A 4JQFA 3E6DA 1Y8RB 2XAGA 3MMYB 4L5IA 4M6XA 3H0DA 1ZKGA 4OIQF 2L01A 4NC6A 2MA3A 2MLKA 1WPKA 1QVUA 3F21A 2HZDA 4WXDA 3RPUD 2QA4I 1BIAA 1UZCA 4MFDA 2B7EA 1Y0UA 2R92J 4M74A 1QO0D 2FMLA 1E2XA 1ZR2A 4CUGA 2AQFA 3ZMVA 2MG4A 2DA7A 4WX9A 3S3NA 1ZREA 1VNDA 1POGA 4U7BA 4ZDPA 1P7IA 3JCUC 4L0ZB 2IPQX 5EEGA 4NQWB 2ZSIB 4C2UA 5FKKA 3W2VA 3IHUA 1B72B 5H20A 2LKPA 1SAXA 1TNTA 3OR2C 2IVMA 2XGCA 3OIPA 2ZCWA 2IS1A 3PIOF 3R60A 2PMZN 3L2WA 1OCPA 2JUGA 2QVOA 1TW3A 3PUBA 3HXLA 3R0AA 2H8RA 3DEWA 4OIOF 4A3EJ 3ZQQA 2B9SA 1ZGJA 1ZLJA 4QIWN 3VYSB 2N8GA 3FXQA 4GYIA 5HDGA 3WG7H 2EIMH 3ZMUA 1YOVB 2HOEA 3CJNA 4PGHA 3K70D 2CMPA 3C1DA 2JN6A 1U8BA 2JPBA 3FHNA 1T95A 5DUKA 3AL0B 2K9NA 2BY0A 2L9VA 5FKNA 4BJ6C 4EJVA 2V9KA 4OMZA 3LSJA 3JRFA 2VT2A 4GXOA 3OYGA 4O3MA 2HTJA 2V6CA 3BTIA 3G1LA 4MQVA 2NRAC 2R5ZB 2A6HF 2ZBKA 3E7LA 4MQ9F 2EV5A 5HS8A 1YX5A 2VPRA 1FIAA 2RNGA 4E7ZA 3F6VA 2FE3A 1UHMA 3K69A 5LFAA 1EH8A 4A5MA 5FD6A 1XDUA 1ZRCA 4H4KC 4XLFA 3ZMSA 2XROA 3CUQC 4BDZA 2QCOA 1VQ6I 2R93J 1IV6A 1FC3A 3WTXC 2M30A 3VYRB 5M5WJ 2E35A 1JKRC 1SD4A 2CV2A 3ZMTA 2BV6A 3ABKH 5D5VB 4XLPF 5J47A 3OYNA 3BJAA 3K4MA 5FJ8J 4IF4A 1LEAA 1ZRFA 2L9RA 3G2BA 2R7RA 1I3QJ 3IH2A 4LOCA 3E5UA 1TWHJ 2HDWA 1D0ZA 3ULQB 3OY9A 4HDVA 3TEDA 4IQ4A 3PSIA 3AFHA 3BR3A 1IDZA 1BJZA 3P9IA 3LFKA 1APLC 2CG4A 3VYTB 3J7YJ 3GTGJ 1FIPA 3EETA 5D6FA 3K1PA 1EV7A 2F5EA 3GBGA 3T5XA 4NC8A 3JREA 1A6IA 4KA4A 1U5TC 1V5FA 1WFXA 1Z05A 2WAQN 3TOAA 2R7QA 1U2WA 4NBQA 3EDPA 2UV1A 3BT9A 4IHVA 3CCQI 1R5ID 4JX6A 5KAFC 1Q1VA 4E7SA 3KP5A 3S93A 3ZPLA 4EJWA 3KP7A 3GTOJ 3E6MA 5DDGA 2WADA 1FOKA 2KZVA 4HOBA 2GXAA 3PFYA 3FMRA 1EH7A 2L9NA 1QQIA 2A68F 2EILH 2FOWA 5J1YA 4UUSB 2V1UA 3CJQB 5F64A 3BTCA 5JLWA 3A1YA 1NK2P 2EQRA 3N4MA 4NHJA 3ABMH 5F0CA 4ZZDA 1ITYA 2CJJA 2V7FA 3BZCA 5EZGA 5HLGA 4EJOA 1WJCA 2OPTA 2Q8KA 4XONA 2GIZA 1D0YA 4CDGA 1LNWA 2ME0A 4PSXA 1D0XA 1TQMA 1P2FA 1USTA 5DCFA 1X4OA 2OTJI 1H8AC 3DP7A 2QGUA 3CP8A 1ON2A 1BM9A 2LD5A 5K7ZA 1YRNA 5B1BH 5E1ZB 3T8TA 5CYVA 5IY5H 4PUSA 4RDUA 5KVRA 5IYDJ 3OYJA 2QWWA 5BMZA 4E7KA 1A36A 1MBHA 2BGCA 4AYBN 4LLLA 3QP6A 2X1DA 2F4MB 3M1EA 2WA0A 4KJZA 4EGZA 4XKVA 2J5PA 5KK1A 2IW5A 3KYLA 2V4JC 4IRIA 2DJNA 4N0BA 3M7GA 1KA8A 2X6WA 3PO2J 1WSUA 1LFUP 1OQYA 1TWAJ 1Z3YA 4A0ZA 3S3MA 3S16J 3B6CA 2O61A 3BWGA 2LLKA 2DFHA 3BROA 3EYYA 1TQPA 4LFUA 2EV0A 2YX4A 4ESBA 2M87A 2PJRA 3BC8A 1VQ7I 2M3AA 2JSCA 5A2QZ 1D3YA 3K6GA 3F9KA 3AG4H 2Z2SB 3ZN0A 4BNCA 3HKZN 1Z9CA 1LQ1A 2HDDA 4IOAF 3BTLA 2OC6A 3IRRA 2H6CA 3BR2A 5TRDA 3I58A 4XMYA 3TMOA 4C3HJ 4FX4A 2BEOA 2CW0F 3SFIA 5FO5A 3LSGA 4YRVA 2BOLA 2VBXA 2DK5A 4J00A 1VQ8I 1T56A 4XN0A 1HLVA 3ONQA 1P4XA 4RGUA 1ZN2A 1DP7P 3DU5A 2JRTA 2V1NA 4KFCA 3G1MA 1HDDC 1X58A 2KL4A 3DKWA 1X1BA 4U0WA 5EGOB 4FTHA 3G1OA 5GADJ 4E4HA 4CCKA 2F4OB 3HDDA 3RQ4A 3I5UA 3NQOA 2L02A 1XD7A 4KMUX 3ZQIA 3G4SI 2K40A 5C44J 2K4JA 2ZKZA 4A5NA 2HVSA 4DJAA 3K2ZA 3S14J 5C3EJ 3SQNA 2H6BA 3BY6A 4L9NA 4CZCA 4KISA 3BG6A 3FBNB 2FSWA 1FSHA 4RMNA 4PGGA 1HA8A 3BR6A 1VTNC 1OMIA 3FX3A 3NEUA 3ZQ7A 1W0TA 5F1RA 5IOZA 2KJBA 3D5RC 1G8XA 3DBLB 5FLMJ 5TISC 4WXHA 3EUAA 4YIIA 2G9WA 2BW3A 2R5YA 3FK7A 5B66C 2GWRA 3LSMA 4IVNA 5CQGA 2CUJA 1UB9A 4IEJA 1WWXA 5M3MJ 4CICA 2E2HJ 4BAYA 5L3BA 1RR7A 1G6NA 2Z3YA 4LIVA 5M5XJ 1ORKA 1H88C 1S7AA 4UVAA 2PFBA 2Y69H 3V7SA 3CMYA 1SFEA 1IUFA 4UNOA 2ETHA 3LSPA 1XGMA 1D5YA 3DEUA 4Q48A 3F8MA 3OOPA 3A01A 4QLCU 5EG0B 5ICEA 4R1HA 3WTZA 1XGSA 2PEXA 2HXOA 3JW4A 4DBQA 4S05A 1S3JA 3S8PA 2WC2A 1OCCH 4XLNF 1CQTA 1SAUA 1TT5B 3O8GA 2XV4S 1X3ZB 2F5VA 4KT6A 5J4YA 3H9GA 2F5DA 2LY2A 3KP6A 4PJMA 4GGGA 3W2WA 2W7NA 5GPCA 3BG9A 1ZK8A 5D4RA 1O3SA 2GM4A 1PDNC 2BBYA 4HV5A 1R22A 1MJ9A 1ZQ3P 2KIUA 2HPMA 1I5ZA 1VQ9I 3ZRGA 3QOPA 3N97A 2JZYA 2LY1A 3KEQA 2DPDA 3VWBA 2YS9A 3JSPA 2Y0SA 2YPRA 2F5FA 1REPC 3F8FA 3OL4A 3FF5A 2KRCA 5E3MA 2TRTA 2Z16A 1VFCA 2VLAA 4CGZA 4A12A 2KT0A 1J2XA 3BQZA 5IPAA 5J8CA 2IS6A 4BY1J 3G3ZA 4L5EA 5LGNA 4HQMA 4XQFA 1GVJA 2ZXIA 5DEQA 1BR4A 3H3VK 2VONA 2V1XA 1I3AA 1WVRA 4IKFA 1I6XA 3REOA 1Z91A 1Z6TA 2ZMEC 1D1CA 4BQNA 4KUMA 1JHFA 1GXQA 4NQWA 4PJNA 4C2TA 3T1BA 2LF8A 4CXFA 1USSA 2DYRH 4U7DA 3OYMA 4EV0A 3OYDA 4I2OA 4B8XA 2OV7A 3GTPJ 3SDBA 2GOXB 3QPLA 3PO3J 4I99C 1ON1A 4MHGA 4C3JJ 2XAFA 2LREA 3FXLA 1Y6IA 3IH3A 3U1DA 4A3BJ 4ZYAA 1YTYA 2QENA 1O3TA 2E1NA 1OR7A 4OWRB 5GAEJ 4E7IA 4G7HF 4GRIA 3ABTA 3MQ0A 4O5VA 1QHGA 4N9IA 4XKWA 4B47A 3WGHA 5H2FC 4KYWA 1ERDA 1QA6A 2OZ6A 3MKLA 1I6HJ 3CMAI 5IYCJ 2MH2A 2DA3A 1Z0XA 1YRNB 1FX7A 1GUUA 5FB2A 1XGNA 4ZZLA 2KMUA 2DBBA 3HHHA 1BR1A 2CV1A 3K0LA 3SZTA 2ECBA 4M9SA 2CQNA 1QVTA 3JRCA 1FYMA 3BJOA 3FM5A 2ZXWH 1U0JA 2QQ9A 3DPLC 3V42A 3KZIC 2L9SA 2UXNA 2HWVA 2MFZA 4IZZA 4RB0A 4XIDA 4HYEA 1MH3A 5K5OA 1OKRA 2XGXA 2E1MB 4F55A 1PP8F 1N78A 3M1CA 3C18A 2VJ4A 3L7WA 1R71A 4BU2A 1FEXA 5DCMA 4I09A 2JT1A 4A0XA 2RV8A 4DYRA 1N25A 2I5UA 1BA5A 4ZDOA 4UUVA 4FCYA 4HAMA 1FMVA 1MNEA 2PJRB 4A93J 4UV9A 4BXFA 5DTDA 1LDDA 5LLQA 2L4MA 3V7CA 3GTMJ 3S2WA 4CH7A 1QGPA 1MBJA 2HU9A 4HF0A 3KEYA 5LGUA 1VQLI 2EA2A 4M3FA 2OU2A 1M1EB 3QWLA 3BZ6A 2K9QA 1T0FA 1JJ6C 3MAJA 3LSKA 4LITA 1YJNI 1R4MB 3K2AA 2P5LC 3IL2A 3GW2A 5KNLA 2WWYA 1SEUA 1SANA 1RI7A 3VEPA 3CCJI 4Q5SF 3KZYA 4N9HA 1AWCA 4A6EA 2B0LA 3SYTA 2NOJB 2FBKA 1S29A 1FYKA 2ELJA 2G7HA 4BJTA 3H3ZA 5JI6A 2IGKA 4MEYF 3LQQA 2EH3A 3OSGA 3J81Z 4BL0B 2D1HA 4LD5A 2VASA 2DU9A 4A6DA 4LK1F 2H94A 2K9MA 4DYCA 2Z9OA 3H5AA 3CDHA 2LSOA 5B3SH 2HI3A 4E6KG 1R1UA 2HXIA 4PJJA 2PG4A 3CMEI 3H35A 2CYYA 3AAFA 2D5VA 4V19K 4RA2A 3I56I 2Q1ZB 5M5YJ 3CUQA 2BVLA 3CCRI 1N77A 1XC5A 1UG0A 5ICFA 1R00A 3ASNH 1LDJA 2VBZA 1U9NA 3ASOH 2Y9ZA 3DEEA 2R7XA 2NS8A 1FBSA 2M7AA 3KLNA 4A2UA 1ZH5A 5ED4A 4I98B 3HSEA 1J75A 2P81A 2VQCA 2DMQA 1Y8QB 2HR3A 2MYSA 1X19A 1IV8A 3IAM2 3WTUC 1DQUA 4E7JA 3RKQA 2BW3B 2A61A 2R5YB 2HVRA 2QM3A 2E2IJ 3RSNA 1X2MA 2ID3A 1IGNA 3NARA 4ENMA 2DA4A 2EINH 3HOYJ 4OIRF 1RC9A 1DPRA 1XSVA 2BY1A 2AHQA 3ERED 3ML6A 3M8JA 2PQ8A 4HNUA 3ERMA 1Z7UA 4CO8A 2O8KA 1V3FA 1ZG3A 4B43A 3ZQCA 5LRRA 3VOEA 4BJ5C 3U1KA 5J1RA 2DA1A 1U5TA 2VKHA 5EF6A 5AIQA 2KIQA 2GLOA 4HLYA 1WHUA 2HKOA 2PLYA 5JHUA 3F8CA 3BZKA 2R7VA 3A02A 4EM2A 1ZAOA 1UELB 3PQKA 1BL0A 5EEHA 5DYMA 1AA7A 1WJEA 3R61A 1IO2A 1YE9A 4RLFA 3E5XA 3HSRA 1IDYA 2IA2A 4MLOA 5JVTA 4U0YA 1OCOH 2DFEA 3F8BA 5CJ9A 4IO9F 1FYLA 5HDKA 3UR3C 2M9HA 3L2CA 2NNYA 1BI1A 2HOAA 3TO7A 6PAXA 3GCMA 2ELHA 3MFKA 1U3EM 2V6EA 4GO1A 4B48A 1I1GA 3L2VA 3FZVA 3PM1A 2FF4A 4BH9A 3CCEI 2PJPA 1F43A 5CLSA 1D1BA 3FISA 2EIKH 4P55A 5JFRA 2LBFA 3K4CA 1LFBA 5IP9J 1K79A 2BZTA 3H9JA 2X9DA 4G7OF 3AG2H 2R7DA 1W0UA 1Y56A 1MJAA 2OAZA 4XRSG 3BJ6A 5DUIA 4ZYEA 4F7ZA 5BPIA 3GFMA 2HDCA 2CO5A 3L2RA 4M71A 4KITB 2LK2A 1JKQC 2DAOA 2DYSH 1MZBA 1YQAA 3QPHA 4F3QA 2A5YB 2DN0A 4A3GJ 4HG2A 1I50J 1VI0A 2GOMA 2ZXHA 3GLXA 3VSKA 4F93B 2E5NA 1R6RA 3OSFA 2OQGA 3H36A 1MW7A 2HQAA 1RKTA 3DTIA 4FHTA 3TO9A 2VN2A 5L3DA 3BOQA 3DPUA 2Y2ZA 4XOPA 4EATA 2QUFA 3S2HJ 1HF0A 5EGOA 3ZN1A 2E7XA 2F6CA 1YO5C 1PJRA 2HNHA 5F1JA 4EVIA 2XB0X 4Y17A 4KIBA 4XL9A 1GV2A 2NYXA 1F36A 1R7JA 3I59A 1QPIA 3L9FA 5FFXA 1FP1D 4ZDLA 2GXBA 3PJRA 1R58A 2XPWA 1OFCX 1XN7A 1O7FA 2E7WA 4I01A 1RIOH 2EZHA 2P7VB 2M1BA 1TNSA 2P7CB 3M9AA 3J80K 2A07F 3NRVA 4GFBA 3J7AO 2HZTA 2XUBA 2NVXJ 1FTTA 2IA1A 1FNNA 2V1DA 3O6BB 3RJPA 5EJCA 2QQ8A 3L09A 3AKZA 3OYKA 4IRHA 1PUFA 2VXDA 2FXAA 1R23A 3CCVI 4IL6C 2QKMB 5EYRA 2LH9A 1VQOI 3CF5F 1FT9A 1Y39A 1S5LC 1XB4A 5BPDA 2X6OA 2DMUA 1MMAA 1YYVA 4C2MJ 5FRMA 5LRSA 5J6XA 4BHPA 4EEFG 2M2EA 2KFDA 3OS2A 4I0BA 2GA2A 4F92B 3TOBA 1UFMA 1IAWA 4LLGF 1IN6A 1HDPA 5EG0A 4YIRX 2FUG2 5JVGF 4XLAA 5DCMB 3FIWA 3PNVA 3TO6A 3EQLF 2QSGX 3IUOA 3PUFA 1JI8A 1HSJA 3ABUA 4C9YA 1FP2A 2K86A 4BQAA 3MVPA 5H6RA 2OQRA 5HVQC 2CFOA 3E5QA 1ENHA 1IXRC 1I1SA 4M3GA 3WU2C 3O8HA 4IHYA 2P6SA 2K02A 1JGGA 2LRDA 2IAIA 1U9OA 4EJTA 2CGPA 2RQQA 2FBIA 4NNJA 1OCRH 5DV5A 2EFNA 3Q0VA 4XR6A 1QBJA 2I8DA 1XTAA 3I3LA 1K4SA 3WTTC 3KLOA 3IKVA 4RM3A 5F04A 2VQLA 2YU3A 1ZELA 1S7EA 3WE3A 3F22A 5HODA 4IXAA 2XHKA 4A69C 2RN7A 3A4CA 4KT5C 3GFLA 2ZJRF 3BCBA 4JP0A 2LP0A 4D0PA 3N05A 2JTVA 3S1RJ 3H5RA 3GZ6A 5FD5A 1OCTC 2JPCA 4AM3A 3OR1C 3I71A 2L7KA 2WV1A 1K83J 4G6DA 4E7HA 4DZPA 5K1YA 1KU7A 3BG3A 3CUQB 4JX4A 4M6VA 4FETA 3W3CA 3CCYA 3M4OJ 4PZJA 5J8FA 1X1PA 4JBAA 3IRQA 3K9TA 2HQRA 2E1CA 3MKWB 2EK5A 2ZNYA 3HOVJ 3EUKL 1FSEA 2J5OA 4V2GA 1MMSA 2Z5UA 5KHDA 2M0CA 2HEOA 1Z3XA 1OISA 3DTKA 4ITVA 4I6ZA 1G4DA 5HNHA 5E1WA 3CUOA 3KEOA 4WWCA 3SFZA 2XAUA 2I10A 2GQQA 3CZ6A 5D4SA 2FD5A 2WV0A 3JAMK 1E3OC 4CYDA 3U21A 2RVCA 1BJAA 1UAAA 4XK4A 4M9XA 2A5WA 2L7ZA 3V4GA 2H27A 4YFNF 3FXRA 4OMYA 2DQLA 3I0TA 4HEA2 4QWQA 1P4AA 1UG2A 3W6JB 2QLZA 4XNFA 1U5TB 3BG7A 3EUHC 2QF7A 2CQQA 2PMZA 3OOUA 4X1EA 4J01A 3P9CA 2R7TA 2HYJA 3S17J 1ETOA 2VJJA 1XX5A 2CUZA 2TDXA 2HQNA 4P1WA 1HW1A 2Y48A 1MSFC 4Z2YA 4LB6B 2L7MP 1NK3P 3HGYA 2MLGA 2ZMEA 3VPRA 4HBLA 3OS1A 2DOEA 2K9SA 4BHBA 2OF7A 2R7WA 4CZZA 1FY7A 1XGOA 3WTYC 3CO7C 1ZLKA 2WY7Q 3HOTA 2BXYA 3H92A 4I7HA 2X0LA 1H89C 4KN4X 1MNMC 5FKLA 2HS5A 4P9UA 3MKYB 2DXIA 4Y52J 1LPQA 1SFXA 3ZXSA 1L3LA 1MSEC 5FFZA 4LG0A 1VQKI 3HOSA 2LBFB 3KCCA 1TWCJ 3E6CC 2DA5A 3HSFA 3OL3A 1ZR4A 3RCOA 1HW2A 2BY3A 1GT0C 4ESJA 1JUSA 3HBLA 4DNCA 2DMPA 4WK8F 1JTYA 2XRNA 1YS6A 5DD8A 2E1OA 2VB6A 4F52A 3QYFA 5HS9A 1P9QC 1J9IA 2HOSA 5GAHJ 4KNYA 4AVZA 3R6SA 3MKZA 5HDNA 3GTKJ 1ODDA 1UCRA 2GXGA 3IP4B 3SDGA 3WE2A 1TLHB 3FXKA 3HRMA 2KKOA 4EGYA 3FKIJ 1DGRM 3G73A 1DU0A 4FT8A 1BI2A 5TJJA 1A04A 3DWLE 4R79A 2LMDA 4HSTA 1MH4A 3UNGC 3Q5FA 4Y15A 4TV7A 2W48A 3CD6I 2LFBA 4W97A 1IN4A 3S1MJ 3GWZA 1HSTA 4KN7X 2LR8A 3I59B 1X1CA 5K7HA 2VBYA 1P4WA 3Q9SA 1LB2A 2KDOA 4AIJA 2JVHA 2FNPA 4G9YA 5D5UB 1JTXA 1FWZA 2ISYA 1KZHA 2NS7A 2Y0MA 4RLQA 4FX0A 3HTUA 5ILVA 3DCFA 2JA5J 1WJBA 4GDFA 2NNNA 1H0MA 5ERIA 1FZPB 4RAGA 1BI0A 1T8IA 3GYHX 2D1VA 2W85A 1SD5A 1SVOA 4Y33A 5LEJA 5F0FA 4UVCA 1PUFB 2JA8J 1RR8C 1QU3A 4WF2A 2RAEA 5F27A 1L0OC 1MMNA 1WQ2A 3HYIA 3ZQGA 3WTSC 3FBIB 1G2HA 2FMYA 1XS9A 4BACA 2VKEA 3X2QH 3EYIA 1K78B 2A3SA 3PIPF 2VUMJ 5LHIA 4M3BA 4Q47A 1R1TA 1KYWA 3QYEA 9ANTA 1MJBA 1OCZH 3M3YJ 1TQIA 2CFXA 4E70A 5L3EA 4RB3C 4M72A 3AG1H 3HGGA 2VQHA 2JA7J 3CJRB 1QNTA 3HUGB 3ABLH 3GZ5A 1QZYA 2G7UA 4BHCA 3UKGA 3Q3SA 2EFQA 3SJMA 3KP4A 3A2KA 3JTGA 1N75A 1RPWA 3FXMA 2FJ1A 4S0HB 3RKYA 2PMUA 1YW8A 2XASA 3ZGKA 3HPHA 4LGWA 3OMYA 2K9LA 1F5TA 2RREA 3ZOBA 4YFXF 1YW7A 3DQVC 2M4GA 3RPUA 2KPMA 4DGWB 1LE8B 3BPXA 3D5LA 2DI3A 3CF2A 4KIGA 2COBA 4L9VA 2XF6A 4FQGA 5K5QA 2L4AA 3GFIA 1IJWC 2FNAA 2Z99A 3BG5A 1O57A 2LOOA 3I54A 4QPQA 2OD5A 2R7ZJ 1YFHA 1DGWY 5DD4A 2VBWA 5K7FA 4PFOA 1RETA 1UJ8A 3C3WA 5GAGJ 3GUDA 2L54A 3PL8A 4RGSA 2DPUA 1U6GA 3I4NJ 3CLOA 3KPHA 1D8JA 4PJLA 4ENKA 5TGTA 2JWTA 2CUFA 4XM3A 2DOFA 3WHBA 4C3IJ 1EJ9A 4B3AA 1HW5A 1GXPA 3IH4A 4PJ0C 3ZQLA 2EB7A 4DZJA 1VZ0A 3MZYA 2R7UA 3RQIA 3I4PA 3LSTA 5J3LA 5L3GA 4JK1X 3SEQA 2HVQA 1RUOA 1LVAA 1R4NB 3HKZA 3OV8A 3QRFF 1TP4A 3BR1A 3GTQJ 3HEFA 4BDYA 3IAS2 4IPAA 3TL4X 2PBIA 2R7SA 1I27A 3GX4X 4D9JA 2NAZA 1A6QA 2UXXA 3VSLA 2O6GE 4ABZA 3FKJA 4D5FA 1FOWA 5HOOA 3TW6A 3TGNA 3U9GA 1HCRA 2DT6A 4CCLA 3HTSB 4MTDA 3ZQFA 2HTSA 2HQ5A 3OIQA 2VPLA 1LKXA 1S8NA 3MZHA 5JR3A 1I39A 2COMA 2LG4A 2DT7B 2X4HA 1ZG1A 3VFZA 3PQJA 5FLXK 2EJRA 2O0YA 4HLXA 3WGIA 2F4IA 2JVGA 4ZYHA 2ZMEB 3K4NA 4A3DJ 1XMKA 1GHCA 3RKXA 3JRAA 1T33A 1WI9A 4G94A 3SZPA 3GVAA 5HLTA 3KETA 2V79A 4D5CA 2XC7A 4GCVA 2XVCA 2NVUB 1MD0A 1IXSB 2VC1A 2K3PA 3C2HA 2P5KA 3BTJA 2DJIA 4BQOA 3W2AA 2X85A 4GYGA 5FGMA 4CCMA 3E6BA 5GPAA 4LG0B 2K3FA 4BE2A 1V5EA 3F8NA 2RDPA 2LDUA 2X48A 4NUBA 2MGQA 3V8JA 1KU9A 2O7OA 1JE8A 2QEXI 3GO5A 4HX7A 3K4LA 4P5OA 5IT9K 1VQ4I 3FDYA 2PI0A 1GLNA 1B9NA 4XRSA 1KQ0A 1SMTA 1FOYA 2DLLA 4EM0B 4E7LA 4U0VA 3S2DJ 1O3RA 2ZB9A 2WB1A 3W6KB 2E71A 2O03A 3FXOA 3DLLF 2ECCA 1TZLA 2LY9A 2H1LA 2DODA 3IKTA 4A3KJ 2IGOA 4HNTA 2L3DA 2A69F 2IBDA 2OCEA 4BQQA 1YIJI 3FHZA 4U88A 2KIMA 2NVQJ 2M8GX 1ETWA 3DV8A 4DW6A 1SVMA 3HJEA 4LMYA 4M9ZA 1KYZA 4LJZF 3JR9A 3FK6A 3CDIA 4XLEA 1HC8A 1YG2A 5CVJA 1J7KA 1ETQA 1SFKA 2BHYA 2KISA 5FROA 4UHTA 4IHTA 4X6AJ 5LHGA 2HYGD 1C0WA 1DDNA 2OJED 4HNVA 4B3XA 4I0AA 3LMMA 5E8IA 1IG7A 1IUYA 3IV5A 1W7PD 2IP2A 2A05A 4AC0A 1RNLA 3WG9A 5AONA 5LEKA 2HOTA 3VODA 3NAUA 1A35A 2ISZA 2G0EA 1KU2A 3QQAA 4B1RA 2CUEA 2LC2A 2A6TA 4DOZA 2MBFA
chains in the Genus database with same CATH topology
4DIQA 3LSGA 4YRVA 2W82A 2BOLA 4J00A 5HVQC 2CFOA 4XN0A 3ONQA 4ZTFA 2CS3A 2M7BA 1K6YA 2BVMA 4X0GA 3DU5A 1MMDA 3DPTA 2LRDA 2V1NA 4XKBA 2RQQA 4NNJA 4XR6A 3J7AY 2I8DA 2MD0A 3I3LA 2ZFUA 2Q2EB 2WY8Q 2KL4A 4U87A 2MABA 2VJIA 1X1BA 4RM3A 2VQLA 1WJFA 1ZELA 4E4HA 3SZGA 4CCKA 3CESA 2XDVA 3RQ4A 2MC4A 2UWMA 3A4CA 3I9V2 4II3A 2HVSA 4DJAA 3BCBA 4CZCA 3N05A 2M0MA 4KISA 3BG6A 3H5RA 3FBNB 2WAFA 3K4JA 4RMNA 1TT0A 1HA8A 3OS0A 3OR1C 2L7KA 3H5NA 3TBIA 3LL7A 5CPRB 3HC7A 3OYEA 2E60A 3D5RC 1G8XA 4E7HA 4BEHA 1FMWA 3AL0C 2HPIA 4XN3A 1W36C 4FETA 3W3CA 3EUAA 1WJ5A 2BW3A 3S3OA 5CKTA 3LSMA 5CQGA 2CUJA 3D5SC 2KP6A 4ANJA 3OYCA 3MKWB 3EUKL 4LIVA 3ZR8X 4XKCA 1BOBA 4YEJA 4PFPA 5KHDA 2IS2A 1EA3A 1MMGA 1Z3XA 3DTKA 4ITVA 4CCOA 2IGMA 3OYIA 1DP3A 5HNHA 3H9QA 2XAUA 3CZ6A 4XLCA 4Y4RA 2WBMA 2M4KA 4D1QA 4OAZA 4CCNA 4NC7A 4OAYA 3U21A 4QPOA 1UAAA 4DBQA 5FRNA 2A5WA 3S8PA 2KHMA 4HEA2 3HPGA 1SAUA 1V5GA 4XNFA 3QOEA 4BS9A 3OYAA 2VQGA 3BG7A 3EUHC 2F5VA 2PMZA 4KT6A 3OOUA 3OYBA 3H9GA 4ZJZA 4J01A 2LY2A 2JSPA 4PJMA 2R7TA 3W2WA 2W7NA 2VJJA 3K4KA 2CUZA 2ZSHB 2VIXA 4P1WA 2IGNA 3NWTA 3OS1A 4RM2A 2HPMA 4AU7A 2R7WA 1T0FC 2O5RA 2UUZA 3ZRGA 2LY1A 2CV0A 3VWBA 2WY7Q 2Y0SA 5JHFA 3HOTA 3OL4A 3PNTA 2E5ZA 3E0JB 2KRCA 5KCMA 2Z16A 4Y3OA 2VLAA 1OLTA 3MKYB 2DXIA 2IS6A 2CH0A 4XQFA 2ZXIA 1BR4A 1Z21A 4ZC3A 3ZXSA 1W36D 3HOSA 4IKFA 1KONA 2LBFB 2R4GA 1D1CA 2KLOA 4BQNA 2CW8A 3KX2A 3OL3A 4PJNA 3RCOA 4C2TA 1E0EA 3OYMA 3OYDA 2OV7A 2VB6A 3SDBA 4F52A 3QYFA 2GOXB 1P9QC 2LYCA 3L2UA 4AVZA 3MKZA 2LREA 3IP4B 4CSWA 3CMMA 1Y6IA 4ZYAA 3DTEA 4OWRB 4E7IA 4II2A 1DGRM 4GRIA 5CQEA 3BLYA 3QODA 1QHGA 3DWLE 4R79A 4HSTA 2QKLB 4XKWA 3PNYA 3UNGC 4B47A 3PSFA 4XLHA 3HL2A 5LD2C 1ERDA 3LSHA 1S9HA 3LSIA 3L2QA 1X1DA 1X1CA 2AQEA 2KMUA 3K70C 2CV1A 1BR1A 1OR7C 2KDOA 2JVHA 3OYHA 1G59A 3ZCOA 3E1SA 4LIUA 4CCJA 1LVKA 4RLQA 1U0JA 3DPLC 3NWSA 4PK4A 3V42A 3OWTA 1MNDA 1WJBA 2L9SA 4BE0A 2MFZA 3HG9A 4IZZA 1X4PA 4LG3A 4JQFA 4Y33A 2VL8A 2E1MB 3MMYB 4F55A 1N78A 3H0DA 4HPQA 3M1CA 1QU3A 2IXSA 2VJ4A 4IQJA 3VDXA 4BU2A 1MMNA 3DLAA 3FBIB 2HZDA 5HNFA 4ZTJA 4ZDOA 3RPUD 4BACA 1FMVA 1MNEA 4N4OB 3OYLA 2PJRB 4BXFA 4CUGA 2AQFA 4CH7A 2X1CA 2HU9A 3S3NA 3KEYA 3QYEA 4U7BA 2KRHA 4ZDPA 4NQWB 2ZSIB 4C2UA 3LSKA 4LITA 2VQHA 3W2VA 3CJRB 3HUGB 3OR2C 4IX7A 5KNLA 3OIPA 4F91B 3A2KA 2IS1A 1N75A 1WJAA 3SYTA 2NOJB 3L2WA 3ZGKA 2L5QA 2ELJA 2JUGA 3HPHA 3OMYA 3PUBA 3S32A 3HXLA 4BJTA 2K9LA 2IGKA 2RREA 3ZQQA 4DBRA 3VYUB 3DQVC 2M4GA 4BL0B 3VYSB 2VASA 2K9MA 4XOTA 2KPMA 2CW7A 3H5AA 4DGWB 3D5LA 3K70D 2CMPA 3FHNA 1T95A 3AL0B 3CF2A 2W4SA 4E6KG 2VKDA 4BJ6C 2XF6A 2V9KA 4PJJA 3H35A 2XF5A 4G6TB 2OUMA 2Q1ZB 3OYGA 2BVLA 2LOOA 1N77A 1UG0A 3RTRA 4QPQA 3CP2A 1DGWY 3DEEA 2DCEA 4PFOA 2R7XA 2M7AA 3K10A 1YX5A 2VQCA 3PL8A 2MYSA 3IAM2 1X19A 2RNGA 2VXZA 2X6XA 4BEHB 4E7ZA 4PJLA 1DQUA 5TGTA 4E7JA 1X1AA 4XM3A 5LFAA 1Z7LA 2BW3B 2HVRA 3EPZA 3RSNA 4H4KC 1VZ0A 4XLFA 2R7UA 4HSRA 3K4BA 4BDZA 1BR2A 3SEQA 2WAEA 2HVQA 4HRIA 3HKZA 3M8JA 3VYRB 3C2GA 4HNUA 2CV2A 4XORA 4BDYA 3DU6A 3IAS2 3TL4X 4B43A 2R7SA 3OYNA 1QHHD 4BJ5C 4D9JA 3K4MA 3VSLA 2DOAA 3SEZA 2VKHA 3FKJA 3G2BA 2R7RA 5HOOA 2W00A 1IRXA 2HDWA 2R7VA 1D0ZA 2DT6A 4CCLA 3OY9A 1UELB 4IQ4A 2JA2A 3PSIA 3AFHA 1AA7A 1WJEA 4BGDA 3OIQA 2VPLA 1LKXA 1YE9A 4RLFA 3VYTB 2LG4A 2DT7B 2V26A 2VJ5A 4MLOA 2L2OA 2XF7A 2X6YA 1WJDA 1D1AA 3BCAA 3UR3C 3GBGA 4NC8A 4FASD 2F4IA 2JVGA 1V5FA 1WFXA 4YELA 2R7QA 2V6EA 2WAQA 4B48A 3L2VA 2UV1A 1YX3A 4C30A 3K4NA 1D1BA 4E7SA 3S93A 2LBFA 5HLTA 3K4CA 2XC7A 1LFPA 3H9JA 2R7OA 2K3PA 1Y56A 3C2HA 2WADA 2DJIA 4BQOA 3W2AA 2X85A 2KZVA 3PFYA 3MD2A 4CCMA 3L2RA 3QYBA 4KITB 2L9NA 4BE2A 1V5EA 4F3QA 3CJQB 4NUBA 4B44A 4HG2A 3A1YA 2ZXHA 2GOMA 1LDKB 3VSKA 4BUPA 3OYFA 3DKYA 3K4LA 2V7FA 1PYVA 4P5OA 2E5NA 1R6RA 4F93B 1WJCA 1MW7A 2HQAA 3FDYA 3DTIA 4XONA 1GLNA 3DPUA 4EATA 4XOPA 2Z1DA 1D0YA 4PSXA 4E7LA 1D0XA 2X51A 2F6CA 1PJRA 2HNHA 1X4OA 2WB1A 3CP8A 4XL9A 2XSJC 4PSWA 4ZDLA 1TZLA 3PJRA 4PUSA 2IGOA 4HNTA 3OYJA 4E7KA 4BQQA 4N4NB 2K5CA 2W1OA 4AYBA 4XLEA 2X1DA 4BE1A 2KQRA 2WA0A 3LFUA 4KJZA 4XKVA 3AKZA 3OYKA 1SFKA 3KYLA 2V4JC 5FROA 3DKXA 2VXDA 2X6WA 2QKMB 1Z3YA 2LH9A 4JOMA 1NG7A 3S3MA 2P0WA 1MMAA 1J09A 4B3XA 5FRMA 3LMMA 2PJRA 3BC8A 2M3AA 3OS2A 2X1EA 4F92B 3K6GA 2IS4A 3F9KA 1NG6A 2Z2SB 2FUG2 4CA0A 4XLAA 3PNVA 2OC6A 2E1MC 3IUOA 4XMYA 3TMOA 1JI8A 2LC2A 4C9YA 2A6TA 4DOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSH B;  2ZSI B; 
#chains in the Genus database with same CATH topology
 4DIQ A;  4PCQ A;  1Y1W J;  1TWF J;  1YIT I;  3ROU A;  2W82 A;  3LQR A;  2D45 A;  1R9T J;  1YS7 A;  4ZTF A;  2CS3 A;  2F2E A;  3HHG A;  1K6Y A;  1WKM A;  4X0G A;  3RI4 A;  3DPT A;  2VKV A;  3TQN A;  4Q4Z F;  1FBU A;  2VT3 A;  4OIP F;  5LHH A;  2ZFU A;  2VE8 A;  5CVU A;  2MAB A;  2RKH A;  2VJI A;  2MC3 A;  2DO7 A;  2E36 A;  2M8E A;  3GTL J;  3RPQ A;  1U78 A;  3CES A;  3HRU A;  2XDV A;  3KE2 A;  4M3E A;  4MO7 A;  2UWM A;  4MEX F;  3MZ8 A;  3I9V 2;  2DMT A;  2HFH A;  4OOI A;  1X3U A;  1IZ1 A;  2F5C A;  1H9T A;  3E3V A;  5H6Q A;  4A0Y A;  2WAF A;  1KQ9 A;  1EF4 A;  3TDZ C;  2RQP A;  3HM5 A;  3OS0 A;  1S6L A;  2DQR A;  5IP6 A;  4Y13 A;  5CPR B;  3OYE A;  4LK0 F;  3GME A;  5GP9 A;  4RAY A;  1R36 A;  4DYQ A;  2CQ7 A;  2LKS A;  4BEH A;  1FMW A;  3AL0 C;  2HPI A;  1W36 C;  2AO9 A;  3GTJ J;  3HIF A;  5E1X A;  5CKT A;  3J7Z I;  2KP6 A;  4ANJ A;  3DF8 A;  1ETY A;  2FOK A;  3ZP5 A;  1R1V A;  3BP8 A;  3OIO A;  4RBO A;  3ZR8 X;  3MEX A;  1JJ8 C;  4YEJ A;  4PFP A;  2IS2 A;  2JQ7 A;  3B02 A;  1XSD A;  2BE5 F;  4A3F J;  1QRY A;  2W24 A;  1HXD A;  4CCO A;  3B6A A;  3EUH A;  2IGM A;  3DBR B;  1DP3 A;  4RAF A;  3CCM I;  2ESH A;  4JYK A;  4Y4R A;  2ZJP F;  2WBM A;  3QU3 A;  5CVV A;  1PUE E;  3GF2 A;  4NC7 A;  4OAY A;  5L3F A;  2Y9Y A;  4QPO A;  3JRD A;  3K1N A;  5FRN A;  3MN2 A;  2C6Y A;  1XSX A;  4BXU A;  5B1A H;  3CQZ J;  2KHM A;  2RC4 A;  3HPG A;  3A0B C;  5AIP A;  1AKH A;  1AU7 A;  2CU7 A;  3QOE A;  2ZNZ A;  1SD7 A;  3OYB A;  3WGG A;  2DDA A;  3RDI A;  1SMY F;  3WTV C;  2JSP A;  3FMS A;  5D5W B;  2KJC A;  1T6S A;  2VIX A;  3K1M A;  5F08 A;  3HZJ A;  3NWT A;  3RIR A;  3G71 I;  2STW A;  2DMN A;  3COA C;  3I64 A;  1D5V A;  1G3T A;  4MGR A;  5BS6 A;  5D8K B;  1T38 A;  3F6O A;  4RM2 A;  4AU7 A;  2JUC A;  1T0F C;  2A6E F;  2UUZ A;  2W84 A;  3KYC B;  4JX5 A;  5JHF A;  1T39 A;  1MDM A;  4OU0 A;  2E5Z A;  3E0J B;  2V9P A;  2HYF A;  2XAH A;  5KCM A;  1FTZ A;  2RGV A;  4Y3O A;  4ENN A;  3AG3 H;  1WRJ A;  1OLT A;  2DFI A;  3F3X A;  4QSH A;  4RB2 C;  3J80 Z;  1O3Q A;  2PMH A;  1K78 A;  1X2N A;  3ESW B;  3M07 A;  1BI3 A;  1NH3 A;  3Q9V A;  3QP5 A;  1W36 D;  1J0R A;  1KON A;  1IN7 A;  3LAJ A;  1BIB A;  2R4G A;  4D7M A;  2KLO A;  1W5T A;  2F48 A;  2CW8 A;  3KX2 A;  1LEB A;  2BY2 A;  3LA3 A;  1XG1 A;  2GIV A;  1BOA A;  3HUG A;  3M8F A;  1E0E A;  5L3C A;  4HZF A;  3BR0 A;  3M8E A;  2ACJ A;  1WGX A;  1MKM A;  1ZTR A;  3CCU I;  2Z33 A;  2LYC A;  1IC8 A;  5E8G A;  3GEZ A;  3L2U A;  2L7F P;  4BBS J;  5D8L B;  2AXL A;  3CMM A;  4IOC F;  5K5R A;  2Y30 A;  2O8X A;  4FE4 A;  4II2 A;  5DM6 F;  3JRB A;  1XMX A;  5CQE A;  3BLY A;  3PFI A;  2EFP A;  4MTE A;  2M5W A;  1D8K A;  3BR5 A;  3FMQ A;  3HOU J;  4G12 A;  1LE8 A;  2B63 J;  2DK8 A;  3DXJ F;  1XDS A;  1E3H A;  5FKM A;  3CJT B;  4HV6 A;  1K61 A;  2VOD A;  2FRH A;  1G3W A;  1RKW A;  3LSH A;  4IJA A;  4XSX F;  3ZMD A;  3WTW C;  3P9K A;  2ZXJ A;  1YW9 A;  3LSI A;  3DBH B;  3SXY A;  1WI3 A;  1O4X A;  4M3D A;  3ZMZ A;  3BPV A;  2DFF A;  4FIS A;  5ICC A;  3HOZ J;  1LJ9 A;  1IRZ A;  1ONV A;  4LIU A;  4CCJ A;  1IF1 A;  1NTC A;  2FBH A;  4CHU A;  2EWN A;  1XCB A;  4IHW A;  4PK4 A;  2E2J J;  4I02 A;  3OWT A;  3JRG A;  4UB6 C;  4CYC A;  1QZE A;  3HG9 A;  3QU6 A;  3KP2 A;  4AD9 A;  1MBE A;  3CLQ A;  1W5C C;  2R3S A;  1DU6 A;  2EZK A;  2ZJ2 A;  1B6A A;  2VL8 A;  1R5H A;  4HPQ A;  2IXS A;  4IQJ A;  3VDX A;  3KP3 A;  2P5V A;  2BXZ A;  3DLA A;  1STZ A;  5EEA A;  4I76 A;  4XRM A;  1ETV A;  2LF7 A;  5HNF A;  4ZTJ A;  2GAU A;  1BBY A;  1FPQ A;  3KFW X;  2V9V A;  3OYL A;  4N4O B;  4L0Y B;  1P7J A;  2DT5 A;  2FU4 A;  4L18 B;  1MBF A;  2X1C A;  1GVD A;  3C7J A;  3WU0 A;  2CSO A;  2KRH A;  1MIJ A;  2AXT C;  1ZRD A;  2XIG A;  5EDN A;  4HF2 A;  3P5J A;  5IT3 A;  4M73 A;  5BNG A;  1G3Y A;  4K2E A;  4EM1 A;  2JJ7 A;  4IX7 A;  2EA4 A;  4F91 B;  4BKX A;  3CCS I;  1WJA A;  2Q2E A;  3MCZ A;  2QSH X;  2IEK A;  5GTH C;  4AVP A;  4AWX B;  2EPF A;  2QBY A;  1YJ9 I;  2L5Q A;  3TW7 A;  3S32 A;  1TL8 A;  3L1P A;  1T2K A;  4DBR A;  3VYU B;  2ZO4 A;  4MIM A;  3Q0U A;  4NDL A;  4RGX A;  2P4W A;  3JAM Z;  2YX7 A;  4IHS A;  4XOT A;  1E3P A;  2CW7 A;  2YR2 A;  3FXU A;  2Y0S N;  3ECO A;  4YIF A;  1WZ2 A;  1TC3 C;  1VQP I;  2W4S A;  3LA7 A;  2ZC2 A;  3D0S A;  3HRS A;  2VKD A;  1V4R A;  1V55 H;  1TW2 A;  5A2Q K;  1GDT A;  2XF5 A;  4G6T B;  2OUM A;  3RZO J;  4KMF A;  3RTR A;  5M3F J;  3H1C A;  3CP2 A;  1J5Y A;  3P7N A;  1JGS A;  2LVS A;  2ZFW A;  3V8K A;  4ZH4 F;  5BQT A;  3LSR A;  2DCE A;  3ECH A;  4BBR J;  3K10 A;  3LWF A;  2BYV E;  2D2W A;  3RKW A;  5E3N A;  3JRI A;  3Q0W A;  4L9T A;  2X6X A;  2R7F A;  2VXZ A;  4P96 A;  4BEH B;  1BW5 A;  1FLI A;  2O9L A;  4EQQ A;  1X1A A;  1RZ4 A;  4EMS A;  5HLH A;  1Z7L A;  5J1U A;  2DTR A;  1G3S A;  1UHW A;  2XRL A;  5J4V A;  3EPZ A;  1E17 A;  4UVB A;  4HSR A;  3K4B A;  2GA1 A;  1BR2 A;  3WOD F;  1DPU A;  2OA4 A;  2WAE A;  4RGR A;  3IWF A;  3LNQ A;  4MFE A;  4HRI A;  3V7R A;  1T08 B;  5DS9 A;  1HKQ A;  3C2G A;  2JA6 J;  2HGC A;  1Z67 A;  1CGP A;  4XOR A;  2STT A;  2DTZ A;  3DU6 A;  1R49 A;  2H09 A;  2QQB A;  2JK3 A;  1QHH D;  5E20 A;  2EFW A;  4BXX J;  2QQA A;  2DOA A;  2OCC H;  3SEZ A;  4B09 A;  5LBQ A;  2H1K A;  4HX8 A;  4UV8 A;  1QPM A;  4ESF A;  1ZYR F;  2W00 A;  1IRX A;  3VB2 A;  4A3M J;  1T98 A;  2PX9 A;  1JUP A;  1Y0N A;  2JA2 A;  1FBQ A;  2CQK A;  1RRJ A;  4BGD A;  1Y1V J;  1Z1D A;  2XAJ A;  4YG2 F;  1WCM J;  3KZZ A;  1AKH B;  3MWM A;  1IW7 F;  3HOX J;  2E19 A;  2V26 A;  2VJ5 A;  4P9F A;  4HQE A;  2L2O A;  1HOM A;  2XF7 A;  1W7P A;  2UZK A;  2X6Y A;  1B8I A;  1WJD A;  1D1A A;  3BCA A;  3GXO A;  3TKY A;  4LB5 A;  3QPT A;  2BHZ A;  2CRG A;  3I55 I;  3H0G J;  4FAS D;  4YEL A;  2IT0 A;  2NXN B;  2WAQ A;  2XKP A;  4IRG A;  1ZGA A;  1YX3 A;  2GZW A;  4C30 A;  1K6O A;  1VQN I;  2M34 A;  5CVI A;  1BC8 C;  1UMQ A;  3F23 A;  1ZGW A;  3GFJ A;  2DW4 A;  1MDM B;  1LFP A;  1PVE A;  4EJU A;  2NVY J;  4G7Z F;  2R7O A;  4A3C J;  1TTY A;  2XPV A;  2EZL A;  1B4A A;  3ZQH A;  2CQX A;  3LAP A;  1CF7 A;  3MD2 A;  1O7L A;  3QYB A;  1K4T A;  5CVR A;  1X3W B;  1RUN A;  3I53 A;  1JHH A;  1BC7 C;  4B44 A;  2MH9 A;  4XSZ F;  3IC7 A;  3OYF A;  1LDK B;  3R4K A;  4BUP A;  3DKY A;  1PP7 U;  1PYV A;  2ZJQ F;  1KU3 A;  4BYY A;  2ESN A;  2TCT A;  2ME6 A;  2Z1D A;  3H3U A;  3B73 A;  2X51 A;  4LLN A;  2HKX A;  5E17 F;  4QTR A;  2VOO A;  2EV6 A;  2WB1 N;  1YHQ I;  5E18 F;  1V54 H;  2LKX A;  5IP7 J;  2EZI A;  1EKE A;  2XSJ C;  2OZU A;  4PSW A;  1Z77 A;  4XIC A;  3D1N I;  3FM3 A;  2ID6 A;  2P6T A;  2ELK A;  4H0E A;  1SFO J;  1QZZ A;  4N4N B;  2FQ3 A;  1JT6 A;  2K5C A;  2W1O A;  1U8R A;  5F6F A;  4AYB A;  3CC7 I;  1A5J A;  1P6R A;  2VE9 A;  3TDU C;  3F72 A;  5J40 A;  4BE1 A;  1SC7 A;  2JMW A;  1TWG J;  1ZAR A;  2KQR A;  3K7A J;  3LFU A;  2KRF A;  4M6Y A;  3RYP A;  1OYW A;  1AHD P;  3T8R A;  3DKX A;  2W57 A;  2MD5 A;  3S1Q J;  4ZYG A;  4HW0 A;  5IOY A;  4JOM A;  1NG7 A;  4NB5 A;  4IHX A;  2O3F A;  2P0W A;  4WXC A;  3V8L A;  1F4K A;  4CYC B;  1J09 A;  3U2R A;  5E3O A;  1RES A;  2PN6 A;  1P92 A;  2X1E A;  2P8T A;  2NOG A;  2NVT J;  1R5G A;  2IS4 A;  1NG6 A;  4UUT A;  4W1U A;  4CA0 A;  4WCG A;  1S7O A;  3FWE A;  1MGT A;  1ZG5 A;  2ADU A;  2E1M C;  3HB9 A;  1B72 A;  4RB1 A;  5KAI C;  3O3K A;  4BY7 J;  1JUM A;  2JRM A;  4D7N A;  1IN8 A;  2DA2 A;  3QAH A;  1VQM I;  3S15 J;  4UB8 C;  2XSD C;  3I4M J;  2M7B A;  5C4X J;  3CDL A;  1UHS A;  2BVM A;  4G6Q A;  1YIO A;  1MMD A;  1EH6 A;  1ETX A;  1IRG A;  2IA0 A;  4XKB A;  1ETK A;  1GV5 A;  4MNU A;  2FEZ A;  2Q0O A;  3J7A Y;  2MD0 A;  1SVL A;  2OTL I;  2Q2E B;  2WY8 Q;  3G6E I;  4U87 A;  4HF1 A;  1JKO C;  1BN5 A;  2XAQ A;  1B9M A;  1WJF A;  4ENJ A;  2QBY B;  3F0C A;  3SZG A;  1IRF A;  2ICW G;  4KIF A;  4RS8 A;  3TP0 A;  2MC4 A;  5FKO A;  5D6E A;  3TP3 A;  4II3 A;  1AOY A;  1FOX A;  1JT0 A;  2M45 A;  1VF9 A;  1WH5 A;  2QYO A;  4V2F A;  2LNB A;  2M0M A;  2NS0 A;  4ASN A;  3GLL A;  4ETS A;  2Y31 A;  2R5Z A;  2YUS A;  3K4J A;  4O6J A;  4Z6Y A;  3BDD A;  1TT0 A;  2L0K A;  1B59 A;  2R0Q C;  3H5N A;  4KIC A;  3TBI A;  2VOP A;  3LL7 A;  3HC7 A;  2E60 A;  2FX0 A;  2GBY A;  4L9J A;  2IRF G;  4XN3 A;  3E97 A;  1WJ5 A;  3S3O A;  5FLX Z;  2EBI A;  2DDB A;  3D5S C;  3OYC A;  1DUX C;  3L00 A;  2VI6 A;  4XKC A;  4L5J A;  1BOB A;  5ILS A;  2VC0 A;  1EA3 A;  4RAZ A;  2LTP A;  1MMG A;  5ICG A;  1YI2 I;  3OYI A;  4AUX A;  3H9Q A;  5FLV A;  2DA6 A;  5BOX A;  2K7L A;  4XLC A;  2M4K A;  3ISP A;  3J81 K;  2MW8 A;  3JSO A;  4D1Q A;  4OAZ A;  4B4C A;  4CCN A;  1W4M A;  1OYI A;  1XCV A;  3CCL I;  1JXS A;  1SD6 A;  4A3I J;  2QZ8 A;  1A31 A;  5HLI A;  3CTA A;  1V5G A;  3HRT A;  1VQ5 I;  1MBG A;  3C2B A;  5IT9 Z;  2K27 A;  4BS9 A;  5E79 C;  3OYA A;  2VQG A;  2OBP A;  3LOC A;  1WH7 A;  5ILU A;  4ZJZ A;  1HQC A;  1MBK A;  4KDP A;  1OPC A;  2H8W A;  4R8H A;  3K4K A;  2ZSH B;  1B1B A;  2IGN A;  1W5S A;  3JRH A;  2KZG A;  1F9N A;  1Q1H A;  4UY8 I;  3KYD B;  2O5R A;  1TBX A;  2CV0 A;  5DM7 F;  1W7P B;  1KQ8 A;  1B8I B;  3PNT A;  2E34 A;  3FXJ A;  3LA2 A;  4FE7 A;  2KDZ A;  1XMA A;  3RZD J;  1F1Z A;  4HDU A;  3T0Y A;  3QPS A;  4A3L J;  1YJW I;  1XPX A;  1SFU A;  1K7A A;  2CH0 A;  1HBX G;  5D5X B;  1Z21 A;  1OYY A;  4ZC3 A;  1S72 I;  2IJL A;  4HA8 A;  4UUS A;  1Z6R A;  3RYR A;  5GTI C;  3GZN B;  1J59 A;  3BQY A;  2FQ4 A;  4A3J J;  5IYB J;  1OJL A;  1IXC A;  2AS5 F;  1KGS A;  2MSY A;  3JTH A;  1CF7 B;  2FA5 A;  2YU9 J;  4HX4 A;  2EFO A;  4OIN F;  3CC2 I;  4PDK A;  4ZYD A;  4CSW A;  1BW6 A;  3HOW J;  1ACI A;  3DTE A;  1HKS A;  2K4B A;  3KIO A;  3W6V A;  3A0H C;  2XGD A;  2XPU A;  3QOD A;  1JKP C;  1HKT A;  3A03 A;  2XKO A;  2XGE A;  5LGT A;  3S1N J;  4AID A;  4UXN A;  4S04 A;  2QKL B;  1ZHF A;  4Y7N J;  3PNY A;  5HS7 A;  2KIF A;  2Y75 A;  3PSF A;  4XLH A;  5JLX A;  3HL2 A;  2WTE A;  3DFG A;  5EZH A;  4ON0 A;  4DQ2 A;  5LD2 C;  3A01 B;  4AIH A;  3CC4 I;  1LUJ B;  2EIJ H;  2K85 A;  3R0J A;  1S9H A;  3L2Q A;  1X1D A;  5C4J J;  1W1W E;  2AQE A;  4XRF A;  3WHC A;  3K70 C;  4YFK F;  1H9G A;  2QSF X;  1OR7 C;  3OYH A;  5F0H A;  2YSR A;  2RNJ A;  1G59 A;  3CO6 C;  3IWZ A;  3ZCO A;  1FJL A;  3E1S A;  3SHF A;  2CWE A;  1LVK A;  3O2P E;  4XBF A;  3WU1 B;  4J19 A;  5E3L A;  3NWS A;  4G8X A;  1ULY A;  1YLF A;  1MND A;  2XB5 A;  4BE0 A;  5B5E C;  3ELK A;  4AIK A;  2W25 A;  1NHA A;  1IN5 A;  1X4P A;  4LG3 A;  4JQF A;  3E6D A;  1Y8R B;  2XAG A;  3MMY B;  4L5I A;  4M6X A;  3H0D A;  1ZKG A;  4OIQ F;  2L01 A;  4NC6 A;  2MA3 A;  2MLK A;  1WPK A;  1QVU A;  3F21 A;  2HZD A;  4WXD A;  3RPU D;  2QA4 I;  1BIA A;  1UZC A;  4MFD A;  2B7E A;  1Y0U A;  2R92 J;  4M74 A;  1QO0 D;  2FML A;  1E2X A;  1ZR2 A;  4CUG A;  2AQF A;  3ZMV A;  2MG4 A;  2DA7 A;  4WX9 A;  3S3N A;  1ZRE A;  1VND A;  1POG A;  4U7B A;  4ZDP A;  1P7I A;  3JCU C;  4L0Z B;  2IPQ X;  5EEG A;  4NQW B;  2ZSI B;  4C2U A;  5FKK A;  3W2V A;  3IHU A;  1B72 B;  5H20 A;  2LKP A;  1SAX A;  1TNT A;  3OR2 C;  2IVM A;  2XGC A;  3OIP A;  2ZCW A;  2IS1 A;  3PIO F;  3R60 A;  2PMZ N;  3L2W A;  1OCP A;  2JUG A;  2QVO A;  1TW3 A;  3PUB A;  3HXL A;  3R0A A;  2H8R A;  3DEW A;  4OIO F;  4A3E J;  3ZQQ A;  2B9S A;  1ZGJ A;  1ZLJ A;  4QIW N;  3VYS B;  2N8G A;  3FXQ A;  4GYI A;  5HDG A;  3WG7 H;  2EIM H;  3ZMU A;  1YOV B;  2HOE A;  3CJN A;  4PGH A;  3K70 D;  2CMP A;  3C1D A;  2JN6 A;  1U8B A;  2JPB A;  3FHN A;  1T95 A;  5DUK A;  3AL0 B;  2K9N A;  2BY0 A;  2L9V A;  5FKN A;  4BJ6 C;  4EJV A;  2V9K A;  4OMZ A;  3LSJ A;  3JRF A;  2VT2 A;  4GXO A;  3OYG A;  4O3M A;  2HTJ A;  2V6C A;  3BTI A;  3G1L A;  4MQV A;  2NRA C;  2R5Z B;  2A6H F;  2ZBK A;  3E7L A;  4MQ9 F;  2EV5 A;  5HS8 A;  1YX5 A;  2VPR A;  1FIA A;  2RNG A;  4E7Z A;  3F6V A;  2FE3 A;  1UHM A;  3K69 A;  5LFA A;  1EH8 A;  4A5M A;  5FD6 A;  1XDU A;  1ZRC A;  4H4K C;  4XLF A;  3ZMS A;  2XRO A;  3CUQ C;  4BDZ A;  2QCO A;  1VQ6 I;  2R93 J;  1IV6 A;  1FC3 A;  3WTX C;  2M30 A;  3VYR B;  5M5W J;  2E35 A;  1JKR C;  1SD4 A;  2CV2 A;  3ZMT A;  2BV6 A;  3ABK H;  5D5V B;  4XLP F;  5J47 A;  3OYN A;  3BJA A;  3K4M A;  5FJ8 J;  4IF4 A;  1LEA A;  1ZRF A;  2L9R A;  3G2B A;  2R7R A;  1I3Q J;  3IH2 A;  4LOC A;  3E5U A;  1TWH J;  2HDW A;  1D0Z A;  3ULQ B;  3OY9 A;  4HDV A;  3TED A;  4IQ4 A;  3PSI A;  3AFH A;  3BR3 A;  1IDZ A;  1BJZ A;  3P9I A;  3LFK A;  1APL C;  2CG4 A;  3VYT B;  3J7Y J;  3GTG J;  1FIP A;  3EET A;  5D6F A;  3K1P A;  1EV7 A;  2F5E A;  3GBG A;  3T5X A;  4NC8 A;  3JRE A;  1A6I A;  4KA4 A;  1U5T C;  1V5F A;  1WFX A;  1Z05 A;  2WAQ N;  3TOA A;  2R7Q A;  1U2W A;  4NBQ A;  3EDP A;  2UV1 A;  3BT9 A;  4IHV A;  3CCQ I;  1R5I D;  4JX6 A;  5KAF C;  1Q1V A;  4E7S A;  3KP5 A;  3S93 A;  3ZPL A;  4EJW A;  3KP7 A;  3GTO J;  3E6M A;  5DDG A;  2WAD A;  1FOK A;  2KZV A;  4HOB A;  2GXA A;  3PFY A;  3FMR A;  1EH7 A;  2L9N A;  1QQI A;  2A68 F;  2EIL H;  2FOW A;  5J1Y A;  4UUS B;  2V1U A;  3CJQ B;  5F64 A;  3BTC A;  5JLW A;  3A1Y A;  1NK2 P;  2EQR A;  3N4M A;  4NHJ A;  3ABM H;  5F0C A;  4ZZD A;  1ITY A;  2CJJ A;  2V7F A;  3BZC A;  5EZG A;  5HLG A;  4EJO A;  1WJC A;  2OPT A;  2Q8K A;  4XON A;  2GIZ A;  1D0Y A;  4CDG A;  1LNW A;  2ME0 A;  4PSX A;  1D0X A;  1TQM A;  1P2F A;  1UST A;  5DCF A;  1X4O A;  2OTJ I;  1H8A C;  3DP7 A;  2QGU A;  3CP8 A;  1ON2 A;  1BM9 A;  2LD5 A;  5K7Z A;  1YRN A;  5B1B H;  5E1Z B;  3T8T A;  5CYV A;  5IY5 H;  4PUS A;  4RDU A;  5KVR A;  5IYD J;  3OYJ A;  2QWW A;  5BMZ A;  4E7K A;  1A36 A;  1MBH A;  2BGC A;  4AYB N;  4LLL A;  3QP6 A;  2X1D A;  2F4M B;  3M1E A;  2WA0 A;  4KJZ A;  4EGZ A;  4XKV A;  2J5P A;  5KK1 A;  2IW5 A;  3KYL A;  2V4J C;  4IRI A;  2DJN A;  4N0B A;  3M7G A;  1KA8 A;  2X6W A;  3PO2 J;  1WSU A;  1LFU P;  1OQY A;  1TWA J;  1Z3Y A;  4A0Z A;  3S3M A;  3S16 J;  3B6C A;  2O61 A;  3BWG A;  2LLK A;  2DFH A;  3BRO A;  3EYY A;  1TQP A;  4LFU A;  2EV0 A;  2YX4 A;  4ESB A;  2M87 A;  2PJR A;  3BC8 A;  1VQ7 I;  2M3A A;  2JSC A;  5A2Q Z;  1D3Y A;  3K6G A;  3F9K A;  3AG4 H;  2Z2S B;  3ZN0 A;  4BNC A;  3HKZ N;  1Z9C A;  1LQ1 A;  2HDD A;  4IOA F;  3BTL A;  2OC6 A;  3IRR A;  2H6C A;  3BR2 A;  5TRD A;  3I58 A;  4XMY A;  3TMO A;  4C3H J;  4FX4 A;  2BEO A;  2CW0 F;  3SFI A;  5FO5 A;  3LSG A;  4YRV A;  2BOL A;  2VBX A;  2DK5 A;  4J00 A;  1VQ8 I;  1T56 A;  4XN0 A;  1HLV A;  3ONQ A;  1P4X A;  4RGU A;  1ZN2 A;  1DP7 P;  3DU5 A;  2JRT A;  2V1N A;  4KFC A;  3G1M A;  1HDD C;  1X58 A;  2KL4 A;  3DKW A;  1X1B A;  4U0W A;  5EGO B;  4FTH A;  3G1O A;  5GAD J;  4E4H A;  4CCK A;  2F4O B;  3HDD A;  3RQ4 A;  3I5U A;  3NQO A;  2L02 A;  1XD7 A;  4KMU X;  3ZQI A;  3G4S I;  2K40 A;  5C44 J;  2K4J A;  2ZKZ A;  4A5N A;  2HVS A;  4DJA A;  3K2Z A;  3S14 J;  5C3E J;  3SQN A;  2H6B A;  3BY6 A;  4L9N A;  4CZC A;  4KIS A;  3BG6 A;  3FBN B;  2FSW A;  1FSH A;  4RMN A;  4PGG A;  1HA8 A;  3BR6 A;  1VTN C;  1OMI A;  3FX3 A;  3NEU A;  3ZQ7 A;  1W0T A;  5F1R A;  5IOZ A;  2KJB A;  3D5R C;  1G8X A;  3DBL B;  5FLM J;  5TIS C;  4WXH A;  3EUA A;  4YII A;  2G9W A;  2BW3 A;  2R5Y A;  3FK7 A;  5B66 C;  2GWR A;  3LSM A;  4IVN A;  5CQG A;  2CUJ A;  1UB9 A;  4IEJ A;  1WWX A;  5M3M J;  4CIC A;  2E2H J;  4BAY A;  5L3B A;  1RR7 A;  1G6N A;  2Z3Y A;  4LIV A;  5M5X J;  1ORK A;  1H88 C;  1S7A A;  4UVA A;  2PFB A;  2Y69 H;  3V7S A;  3CMY A;  1SFE A;  1IUF A;  4UNO A;  2ETH A;  3LSP A;  1XGM A;  1D5Y A;  3DEU A;  4Q48 A;  3F8M A;  3OOP A;  3A01 A;  4QLC U;  5EG0 B;  5ICE A;  4R1H A;  3WTZ A;  1XGS A;  2PEX A;  2HXO A;  3JW4 A;  4DBQ A;  4S05 A;  1S3J A;  3S8P A;  2WC2 A;  1OCC H;  4XLN F;  1CQT A;  1SAU A;  1TT5 B;  3O8G A;  2XV4 S;  1X3Z B;  2F5V A;  4KT6 A;  5J4Y A;  3H9G A;  2F5D A;  2LY2 A;  3KP6 A;  4PJM A;  4GGG A;  3W2W A;  2W7N A;  5GPC A;  3BG9 A;  1ZK8 A;  5D4R A;  1O3S A;  2GM4 A;  1PDN C;  2BBY A;  4HV5 A;  1R22 A;  1MJ9 A;  1ZQ3 P;  2KIU A;  2HPM A;  1I5Z A;  1VQ9 I;  3ZRG A;  3QOP A;  3N97 A;  2JZY A;  2LY1 A;  3KEQ A;  2DPD A;  3VWB A;  2YS9 A;  3JSP A;  2Y0S A;  2YPR A;  2F5F A;  1REP C;  3F8F A;  3OL4 A;  3FF5 A;  2KRC A;  5E3M A;  2TRT A;  2Z16 A;  1VFC A;  2VLA A;  4CGZ A;  4A12 A;  2KT0 A;  1J2X A;  3BQZ A;  5IPA A;  5J8C A;  2IS6 A;  4BY1 J;  3G3Z A;  4L5E A;  5LGN A;  4HQM A;  4XQF A;  1GVJ A;  2ZXI A;  5DEQ A;  1BR4 A;  3H3V K;  2VON A;  2V1X A;  1I3A A;  1WVR A;  4IKF A;  1I6X A;  3REO A;  1Z91 A;  1Z6T A;  2ZME C;  1D1C A;  4BQN A;  4KUM A;  1JHF A;  1GXQ A;  4NQW A;  4PJN A;  4C2T A;  3T1B A;  2LF8 A;  4CXF A;  1USS A;  2DYR H;  4U7D A;  3OYM A;  4EV0 A;  3OYD A;  4I2O A;  4B8X A;  2OV7 A;  3GTP J;  3SDB A;  2GOX B;  3QPL A;  3PO3 J;  4I99 C;  1ON1 A;  4MHG A;  4C3J J;  2XAF A;  2LRE A;  3FXL A;  1Y6I A;  3IH3 A;  3U1D A;  4A3B J;  4ZYA A;  1YTY A;  2QEN A;  1O3T A;  2E1N A;  1OR7 A;  4OWR B;  5GAE J;  4E7I A;  4G7H F;  4GRI A;  3ABT A;  3MQ0 A;  4O5V A;  1QHG A;  4N9I A;  4XKW A;  4B47 A;  3WGH A;  5H2F C;  4KYW A;  1ERD A;  1QA6 A;  2OZ6 A;  3MKL A;  1I6H J;  3CMA I;  5IYC J;  2MH2 A;  2DA3 A;  1Z0X A;  1YRN B;  1FX7 A;  1GUU A;  5FB2 A;  1XGN A;  4ZZL A;  2KMU A;  2DBB A;  3HHH A;  1BR1 A;  2CV1 A;  3K0L A;  3SZT A;  2ECB A;  4M9S A;  2CQN A;  1QVT A;  3JRC A;  1FYM A;  3BJO A;  3FM5 A;  2ZXW H;  1U0J A;  2QQ9 A;  3DPL C;  3V42 A;  3KZI C;  2L9S A;  2UXN A;  2HWV A;  2MFZ A;  4IZZ A;  4RB0 A;  4XID A;  4HYE A;  1MH3 A;  5K5O A;  1OKR A;  2XGX A;  2E1M B;  4F55 A;  1PP8 F;  1N78 A;  3M1C A;  3C18 A;  2VJ4 A;  3L7W A;  1R71 A;  4BU2 A;  1FEX A;  5DCM A;  4I09 A;  2JT1 A;  4A0X A;  2RV8 A;  4DYR A;  1N25 A;  2I5U A;  1BA5 A;  4ZDO A;  4UUV A;  4FCY A;  4HAM A;  1FMV A;  1MNE A;  2PJR B;  4A93 J;  4UV9 A;  4BXF A;  5DTD A;  1LDD A;  5LLQ A;  2L4M A;  3V7C A;  3GTM J;  3S2W A;  4CH7 A;  1QGP A;  1MBJ A;  2HU9 A;  4HF0 A;  3KEY A;  5LGU A;  1VQL I;  2EA2 A;  4M3F A;  2OU2 A;  1M1E B;  3QWL A;  3BZ6 A;  2K9Q A;  1T0F A;  1JJ6 C;  3MAJ A;  3LSK A;  4LIT A;  1YJN I;  1R4M B;  3K2A A;  2P5L C;  3IL2 A;  3GW2 A;  5KNL A;  2WWY A;  1SEU A;  1SAN A;  1RI7 A;  3VEP A;  3CCJ I;  4Q5S F;  3KZY A;  4N9H A;  1AWC A;  4A6E A;  2B0L A;  3SYT A;  2NOJ B;  2FBK A;  1S29 A;  1FYK A;  2ELJ A;  2G7H A;  4BJT A;  3H3Z A;  5JI6 A;  2IGK A;  4MEY F;  3LQQ A;  2EH3 A;  3OSG A;  3J81 Z;  4BL0 B;  2D1H A;  4LD5 A;  2VAS A;  2DU9 A;  4A6D A;  4LK1 F;  2H94 A;  2K9M A;  4DYC A;  2Z9O A;  3H5A A;  3CDH A;  2LSO A;  5B3S H;  2HI3 A;  4E6K G;  1R1U A;  2HXI A;  4PJJ A;  2PG4 A;  3CME I;  3H35 A;  2CYY A;  3AAF A;  2D5V A;  4V19 K;  4RA2 A;  3I56 I;  2Q1Z B;  5M5Y J;  3CUQ A;  2BVL A;  3CCR I;  1N77 A;  1XC5 A;  1UG0 A;  5ICF A;  1R00 A;  3ASN H;  1LDJ A;  2VBZ A;  1U9N A;  3ASO H;  2Y9Z A;  3DEE A;  2R7X A;  2NS8 A;  1FBS A;  2M7A A;  3KLN A;  4A2U A;  1ZH5 A;  5ED4 A;  4I98 B;  3HSE A;  1J75 A;  2P81 A;  2VQC A;  2DMQ A;  1Y8Q B;  2HR3 A;  2MYS A;  1X19 A;  1IV8 A;  3IAM 2;  3WTU C;  1DQU A;  4E7J A;  3RKQ A;  2BW3 B;  2A61 A;  2R5Y B;  2HVR A;  2QM3 A;  2E2I J;  3RSN A;  1X2M A;  2ID3 A;  1IGN A;  3NAR A;  4ENM A;  2DA4 A;  2EIN H;  3HOY J;  4OIR F;  1RC9 A;  1DPR A;  1XSV A;  2BY1 A;  2AHQ A;  3ERE D;  3ML6 A;  3M8J A;  2PQ8 A;  4HNU A;  3ERM A;  1Z7U A;  4CO8 A;  2O8K A;  1V3F A;  1ZG3 A;  4B43 A;  3ZQC A;  5LRR A;  3VOE A;  4BJ5 C;  3U1K A;  5J1R A;  2DA1 A;  1U5T A;  2VKH A;  5EF6 A;  5AIQ A;  2KIQ A;  2GLO A;  4HLY A;  1WHU A;  2HKO A;  2PLY A;  5JHU A;  3F8C A;  3BZK A;  2R7V A;  3A02 A;  4EM2 A;  1ZAO A;  1UEL B;  3PQK A;  1BL0 A;  5EEH A;  5DYM A;  1AA7 A;  1WJE A;  3R61 A;  1IO2 A;  1YE9 A;  4RLF A;  3E5X A;  3HSR A;  1IDY A;  2IA2 A;  4MLO A;  5JVT A;  4U0Y A;  1OCO H;  2DFE A;  3F8B A;  5CJ9 A;  4IO9 F;  1FYL A;  5HDK A;  3UR3 C;  2M9H A;  3L2C A;  2NNY A;  1BI1 A;  2HOA A;  3TO7 A;  6PAX A;  3GCM A;  2ELH A;  3MFK A;  1U3E M;  2V6E A;  4GO1 A;  4B48 A;  1I1G A;  3L2V A;  3FZV A;  3PM1 A;  2FF4 A;  4BH9 A;  3CCE I;  2PJP A;  1F43 A;  5CLS A;  1D1B A;  3FIS A;  2EIK H;  4P55 A;  5JFR A;  2LBF A;  3K4C A;  1LFB A;  5IP9 J;  1K79 A;  2BZT A;  3H9J A;  2X9D A;  4G7O F;  3AG2 H;  2R7D A;  1W0U A;  1Y56 A;  1MJA A;  2OAZ A;  4XRS G;  3BJ6 A;  5DUI A;  4ZYE A;  4F7Z A;  5BPI A;  3GFM A;  2HDC A;  2CO5 A;  3L2R A;  4M71 A;  4KIT B;  2LK2 A;  1JKQ C;  2DAO A;  2DYS H;  1MZB A;  1YQA A;  3QPH A;  4F3Q A;  2A5Y B;  2DN0 A;  4A3G J;  4HG2 A;  1I50 J;  1VI0 A;  2GOM A;  2ZXH A;  3GLX A;  3VSK A;  4F93 B;  2E5N A;  1R6R A;  3OSF A;  2OQG A;  3H36 A;  1MW7 A;  2HQA A;  1RKT A;  3DTI A;  4FHT A;  3TO9 A;  2VN2 A;  5L3D A;  3BOQ A;  3DPU A;  2Y2Z A;  4XOP A;  4EAT A;  2QUF A;  3S2H J;  1HF0 A;  5EGO A;  3ZN1 A;  2E7X A;  2F6C A;  1YO5 C;  1PJR A;  2HNH A;  5F1J A;  4EVI A;  2XB0 X;  4Y17 A;  4KIB A;  4XL9 A;  1GV2 A;  2NYX A;  1F36 A;  1R7J A;  3I59 A;  1QPI A;  3L9F A;  5FFX A;  1FP1 D;  4ZDL A;  2GXB A;  3PJR A;  1R58 A;  2XPW A;  1OFC X;  1XN7 A;  1O7F A;  2E7W A;  4I01 A;  1RIO H;  2EZH A;  2P7V B;  2M1B A;  1TNS A;  2P7C B;  3M9A A;  3J80 K;  2A07 F;  3NRV A;  4GFB A;  3J7A O;  2HZT A;  2XUB A;  2NVX J;  1FTT A;  2IA1 A;  1FNN A;  2V1D A;  3O6B B;  3RJP A;  5EJC A;  2QQ8 A;  3L09 A;  3AKZ A;  3OYK A;  4IRH A;  1PUF A;  2VXD A;  2FXA A;  1R23 A;  3CCV I;  4IL6 C;  2QKM B;  5EYR A;  2LH9 A;  1VQO I;  3CF5 F;  1FT9 A;  1Y39 A;  1S5L C;  1XB4 A;  5BPD A;  2X6O A;  2DMU A;  1MMA A;  1YYV A;  4C2M J;  5FRM A;  5LRS A;  5J6X A;  4BHP A;  4EEF G;  2M2E A;  2KFD A;  3OS2 A;  4I0B A;  2GA2 A;  4F92 B;  3TOB A;  1UFM A;  1IAW A;  4LLG F;  1IN6 A;  1HDP A;  5EG0 A;  4YIR X;  2FUG 2;  5JVG F;  4XLA A;  5DCM B;  3FIW A;  3PNV A;  3TO6 A;  3EQL F;  2QSG X;  3IUO A;  3PUF A;  1JI8 A;  1HSJ A;  3ABU A;  4C9Y A;  1FP2 A;  2K86 A;  4BQA A;  3MVP A;  5H6R A;  2OQR A;  5HVQ C;  2CFO A;  3E5Q A;  1ENH A;  1IXR C;  1I1S A;  4M3G A;  3WU2 C;  3O8H A;  4IHY A;  2P6S A;  2K02 A;  1JGG A;  2LRD A;  2IAI A;  1U9O A;  4EJT A;  2CGP A;  2RQQ A;  2FBI A;  4NNJ A;  1OCR H;  5DV5 A;  2EFN A;  3Q0V A;  4XR6 A;  1QBJ A;  2I8D A;  1XTA A;  3I3L A;  1K4S A;  3WTT C;  3KLO A;  3IKV A;  4RM3 A;  5F04 A;  2VQL A;  2YU3 A;  1ZEL A;  1S7E A;  3WE3 A;  3F22 A;  5HOD A;  4IXA A;  2XHK A;  4A69 C;  2RN7 A;  3A4C A;  4KT5 C;  3GFL A;  2ZJR F;  3BCB A;  4JP0 A;  2LP0 A;  4D0P A;  3N05 A;  2JTV A;  3S1R J;  3H5R A;  3GZ6 A;  5FD5 A;  1OCT C;  2JPC A;  4AM3 A;  3OR1 C;  3I71 A;  2L7K A;  2WV1 A;  1K83 J;  4G6D A;  4E7H A;  4DZP A;  5K1Y A;  1KU7 A;  3BG3 A;  3CUQ B;  4JX4 A;  4M6V A;  4FET A;  3W3C A;  3CCY A;  3M4O J;  4PZJ A;  5J8F A;  1X1P A;  4JBA A;  3IRQ A;  3K9T A;  2HQR A;  2E1C A;  3MKW B;  2EK5 A;  2ZNY A;  3HOV J;  3EUK L;  1FSE A;  2J5O A;  4V2G A;  1MMS A;  2Z5U A;  5KHD A;  2M0C A;  2HEO A;  1Z3X A;  1OIS A;  3DTK A;  4ITV A;  4I6Z A;  1G4D A;  5HNH A;  5E1W A;  3CUO A;  3KEO A;  4WWC A;  3SFZ A;  2XAU A;  2I10 A;  2GQQ A;  3CZ6 A;  5D4S A;  2FD5 A;  2WV0 A;  3JAM K;  1E3O C;  4CYD A;  3U21 A;  2RVC A;  1BJA A;  1UAA A;  4XK4 A;  4M9X A;  2A5W A;  2L7Z A;  3V4G A;  2H27 A;  4YFN F;  3FXR A;  4OMY A;  2DQL A;  3I0T A;  4HEA 2;  4QWQ A;  1P4A A;  1UG2 A;  3W6J B;  2QLZ A;  4XNF A;  1U5T B;  3BG7 A;  3EUH C;  2QF7 A;  2CQQ A;  2PMZ A;  3OOU A;  4X1E A;  4J01 A;  3P9C A;  2R7T A;  2HYJ A;  3S17 J;  1ETO A;  2VJJ A;  1XX5 A;  2CUZ A;  2TDX A;  2HQN A;  4P1W A;  1HW1 A;  2Y48 A;  1MSF C;  4Z2Y A;  4LB6 B;  2L7M P;  1NK3 P;  3HGY A;  2MLG A;  2ZME A;  3VPR A;  4HBL A;  3OS1 A;  2DOE A;  2K9S A;  4BHB A;  2OF7 A;  2R7W A;  4CZZ A;  1FY7 A;  1XGO A;  3WTY C;  3CO7 C;  1ZLK A;  2WY7 Q;  3HOT A;  2BXY A;  3H92 A;  4I7H A;  2X0L A;  1H89 C;  4KN4 X;  1MNM C;  5FKL A;  2HS5 A;  4P9U A;  3MKY B;  2DXI A;  4Y52 J;  1LPQ A;  1SFX A;  3ZXS A;  1L3L A;  1MSE C;  5FFZ A;  4LG0 A;  1VQK I;  3HOS A;  2LBF B;  3KCC A;  1TWC J;  3E6C C;  2DA5 A;  3HSF A;  3OL3 A;  1ZR4 A;  3RCO A;  1HW2 A;  2BY3 A;  1GT0 C;  4ESJ A;  1JUS A;  3HBL A;  4DNC A;  2DMP A;  4WK8 F;  1JTY A;  2XRN A;  1YS6 A;  5DD8 A;  2E1O A;  2VB6 A;  4F52 A;  3QYF A;  5HS9 A;  1P9Q C;  1J9I A;  2HOS A;  5GAH J;  4KNY A;  4AVZ A;  3R6S A;  3MKZ A;  5HDN A;  3GTK J;  1ODD A;  1UCR A;  2GXG A;  3IP4 B;  3SDG A;  3WE2 A;  1TLH B;  3FXK A;  3HRM A;  2KKO A;  4EGY A;  3FKI J;  1DGR M;  3G73 A;  1DU0 A;  4FT8 A;  1BI2 A;  5TJJ A;  1A04 A;  3DWL E;  4R79 A;  2LMD A;  4HST A;  1MH4 A;  3UNG C;  3Q5F A;  4Y15 A;  4TV7 A;  2W48 A;  3CD6 I;  2LFB A;  4W97 A;  1IN4 A;  3S1M J;  3GWZ A;  1HST A;  4KN7 X;  2LR8 A;  3I59 B;  1X1C A;  5K7H A;  2VBY A;  1P4W A;  3Q9S A;  1LB2 A;  2KDO A;  4AIJ A;  2JVH A;  2FNP A;  4G9Y A;  5D5U B;  1JTX A;  1FWZ A;  2ISY A;  1KZH A;  2NS7 A;  2Y0M A;  4RLQ A;  4FX0 A;  3HTU A;  5ILV A;  3DCF A;  2JA5 J;  1WJB A;  4GDF A;  2NNN A;  1H0M A;  5ERI A;  1FZP B;  4RAG A;  1BI0 A;  1T8I A;  3GYH X;  2D1V A;  2W85 A;  1SD5 A;  1SVO A;  4Y33 A;  5LEJ A;  5F0F A;  4UVC A;  1PUF B;  2JA8 J;  1RR8 C;  1QU3 A;  4WF2 A;  2RAE A;  5F27 A;  1L0O C;  1MMN A;  1WQ2 A;  3HYI A;  3ZQG A;  3WTS C;  3FBI B;  1G2H A;  2FMY A;  1XS9 A;  4BAC A;  2VKE A;  3X2Q H;  3EYI A;  1K78 B;  2A3S A;  3PIP F;  2VUM J;  5LHI A;  4M3B A;  4Q47 A;  1R1T A;  1KYW A;  3QYE A;  9ANT A;  1MJB A;  1OCZ H;  3M3Y J;  1TQI A;  2CFX A;  4E70 A;  5L3E A;  4RB3 C;  4M72 A;  3AG1 H;  3HGG A;  2VQH A;  2JA7 J;  3CJR B;  1QNT A;  3HUG B;  3ABL H;  3GZ5 A;  1QZY A;  2G7U A;  4BHC A;  3UKG A;  3Q3S A;  2EFQ A;  3SJM A;  3KP4 A;  3A2K A;  3JTG A;  1N75 A;  1RPW A;  3FXM A;  2FJ1 A;  4S0H B;  3RKY A;  2PMU A;  1YW8 A;  2XAS A;  3ZGK A;  3HPH A;  4LGW A;  3OMY A;  2K9L A;  1F5T A;  2RRE A;  3ZOB A;  4YFX F;  1YW7 A;  3DQV C;  2M4G A;  3RPU A;  2KPM A;  4DGW B;  1LE8 B;  3BPX A;  3D5L A;  2DI3 A;  3CF2 A;  4KIG A;  2COB A;  4L9V A;  2XF6 A;  4FQG A;  5K5Q A;  2L4A A;  3GFI A;  1IJW C;  2FNA A;  2Z99 A;  3BG5 A;  1O57 A;  2LOO A;  3I54 A;  4QPQ A;  2OD5 A;  2R7Z J;  1YFH A;  1DGW Y;  5DD4 A;  2VBW A;  5K7F A;  4PFO A;  1RET A;  1UJ8 A;  3C3W A;  5GAG J;  3GUD A;  2L54 A;  3PL8 A;  4RGS A;  2DPU A;  1U6G A;  3I4N J;  3CLO A;  3KPH A;  1D8J A;  4PJL A;  4ENK A;  5TGT A;  2JWT A;  2CUF A;  4XM3 A;  2DOF A;  3WHB A;  4C3I J;  1EJ9 A;  4B3A A;  1HW5 A;  1GXP A;  3IH4 A;  4PJ0 C;  3ZQL A;  2EB7 A;  4DZJ A;  1VZ0 A;  3MZY A;  2R7U A;  3RQI A;  3I4P A;  3LST A;  5J3L A;  5L3G A;  4JK1 X;  3SEQ A;  2HVQ A;  1RUO A;  1LVA A;  1R4N B;  3HKZ A;  3OV8 A;  3QRF F;  1TP4 A;  3BR1 A;  3GTQ J;  3HEF A;  4BDY A;  3IAS 2;  4IPA A;  3TL4 X;  2PBI A;  2R7S A;  1I27 A;  3GX4 X;  4D9J A;  2NAZ A;  1A6Q A;  2UXX A;  3VSL A;  2O6G E;  4ABZ A;  3FKJ A;  4D5F A;  1FOW A;  5HOO A;  3TW6 A;  3TGN A;  3U9G A;  1HCR A;  2DT6 A;  4CCL A;  3HTS B;  4MTD A;  3ZQF A;  2HTS A;  2HQ5 A;  3OIQ A;  2VPL A;  1LKX A;  1S8N A;  3MZH A;  5JR3 A;  1I39 A;  2COM A;  2LG4 A;  2DT7 B;  2X4H A;  1ZG1 A;  3VFZ A;  3PQJ A;  5FLX K;  2EJR A;  2O0Y A;  4HLX A;  3WGI A;  2F4I A;  2JVG A;  4ZYH A;  2ZME B;  3K4N A;  4A3D J;  1XMK A;  1GHC A;  3RKX A;  3JRA A;  1T33 A;  1WI9 A;  4G94 A;  3SZP A;  3GVA A;  5HLT A;  3KET A;  2V79 A;  4D5C A;  2XC7 A;  4GCV A;  2XVC A;  2NVU B;  1MD0 A;  1IXS B;  2VC1 A;  2K3P A;  3C2H A;  2P5K A;  3BTJ A;  2DJI A;  4BQO A;  3W2A A;  2X85 A;  4GYG A;  5FGM A;  4CCM A;  3E6B A;  5GPA A;  4LG0 B;  2K3F A;  4BE2 A;  1V5E A;  3F8N A;  2RDP A;  2LDU A;  2X48 A;  4NUB A;  2MGQ A;  3V8J A;  1KU9 A;  2O7O A;  1JE8 A;  2QEX I;  3GO5 A;  4HX7 A;  3K4L A;  4P5O A;  5IT9 K;  1VQ4 I;  3FDY A;  2PI0 A;  1GLN A;  1B9N A;  4XRS A;  1KQ0 A;  1SMT A;  1FOY A;  2DLL A;  4EM0 B;  4E7L A;  4U0V A;  3S2D J;  1O3R A;  2ZB9 A;  2WB1 A;  3W6K B;  2E71 A;  2O03 A;  3FXO A;  3DLL F;  2ECC A;  1TZL A;  2LY9 A;  2H1L A;  2DOD A;  3IKT A;  4A3K J;  2IGO A;  4HNT A;  2L3D A;  2A69 F;  2IBD A;  2OCE A;  4BQQ A;  1YIJ I;  3FHZ A;  4U88 A;  2KIM A;  2NVQ J;  2M8G X;  1ETW A;  3DV8 A;  4DW6 A;  1SVM A;  3HJE A;  4LMY A;  4M9Z A;  1KYZ A;  4LJZ F;  3JR9 A;  3FK6 A;  3CDI A;  4XLE A;  1HC8 A;  1YG2 A;  5CVJ A;  1J7K A;  1ETQ A;  1SFK A;  2BHY A;  2KIS A;  5FRO A;  4UHT A;  4IHT A;  4X6A J;  5LHG A;  2HYG D;  1C0W A;  1DDN A;  2OJE D;  4HNV A;  4B3X A;  4I0A A;  3LMM A;  5E8I A;  1IG7 A;  1IUY A;  3IV5 A;  1W7P D;  2IP2 A;  2A05 A;  4AC0 A;  1RNL A;  3WG9 A;  5AON A;  5LEK A;  2HOT A;  3VOD A;  3NAU A;  1A35 A;  2ISZ A;  2G0E A;  1KU2 A;  3QQA A;  4B1R A;  2CUE A;  2LC2 A;  2A6T A;  4DOZ A;  2MBF A; 
#chains in the Genus database with same CATH homology
 4DIQ A;  3LSG A;  4YRV A;  2W82 A;  2BOL A;  4J00 A;  5HVQ C;  2CFO A;  4XN0 A;  3ONQ A;  4ZTF A;  2CS3 A;  2M7B A;  1K6Y A;  2BVM A;  4X0G A;  3DU5 A;  1MMD A;  3DPT A;  2LRD A;  2V1N A;  4XKB A;  2RQQ A;  4NNJ A;  4XR6 A;  3J7A Y;  2I8D A;  2MD0 A;  3I3L A;  2ZFU A;  2Q2E B;  2WY8 Q;  2KL4 A;  4U87 A;  2MAB A;  2VJI A;  1X1B A;  4RM3 A;  2VQL A;  1WJF A;  1ZEL A;  4E4H A;  3SZG A;  4CCK A;  3CES A;  2XDV A;  3RQ4 A;  2MC4 A;  2UWM A;  3A4C A;  3I9V 2;  4II3 A;  2HVS A;  4DJA A;  3BCB A;  4CZC A;  3N05 A;  2M0M A;  4KIS A;  3BG6 A;  3H5R A;  3FBN B;  2WAF A;  3K4J A;  4RMN A;  1TT0 A;  1HA8 A;  3OS0 A;  3OR1 C;  2L7K A;  3H5N A;  3TBI A;  3LL7 A;  5CPR B;  3HC7 A;  3OYE A;  2E60 A;  3D5R C;  1G8X A;  4E7H A;  4BEH A;  1FMW A;  3AL0 C;  2HPI A;  4XN3 A;  1W36 C;  4FET A;  3W3C A;  3EUA A;  1WJ5 A;  2BW3 A;  3S3O A;  5CKT A;  3LSM A;  5CQG A;  2CUJ A;  3D5S C;  2KP6 A;  4ANJ A;  3OYC A;  3MKW B;  3EUK L;  4LIV A;  3ZR8 X;  4XKC A;  1BOB A;  4YEJ A;  4PFP A;  5KHD A;  2IS2 A;  1EA3 A;  1MMG A;  1Z3X A;  3DTK A;  4ITV A;  4CCO A;  2IGM A;  3OYI A;  1DP3 A;  5HNH A;  3H9Q A;  2XAU A;  3CZ6 A;  4XLC A;  4Y4R A;  2WBM A;  2M4K A;  4D1Q A;  4OAZ A;  4CCN A;  4NC7 A;  4OAY A;  3U21 A;  4QPO A;  1UAA A;  4DBQ A;  5FRN A;  2A5W A;  3S8P A;  2KHM A;  4HEA 2;  3HPG A;  1SAU A;  1V5G A;  4XNF A;  3QOE A;  4BS9 A;  3OYA A;  2VQG A;  3BG7 A;  3EUH C;  2F5V A;  2PMZ A;  4KT6 A;  3OOU A;  3OYB A;  3H9G A;  4ZJZ A;  4J01 A;  2LY2 A;  2JSP A;  4PJM A;  2R7T A;  3W2W A;  2W7N A;  2VJJ A;  3K4K A;  2CUZ A;  2ZSH B;  2VIX A;  4P1W A;  2IGN A;  3NWT A;  3OS1 A;  4RM2 A;  2HPM A;  4AU7 A;  2R7W A;  1T0F C;  2O5R A;  2UUZ A;  3ZRG A;  2LY1 A;  2CV0 A;  3VWB A;  2WY7 Q;  2Y0S A;  5JHF A;  3HOT A;  3OL4 A;  3PNT A;  2E5Z A;  3E0J B;  2KRC A;  5KCM A;  2Z16 A;  4Y3O A;  2VLA A;  1OLT A;  3MKY B;  2DXI A;  2IS6 A;  2CH0 A;  4XQF A;  2ZXI A;  1BR4 A;  1Z21 A;  4ZC3 A;  3ZXS A;  1W36 D;  3HOS A;  4IKF A;  1KON A;  2LBF B;  2R4G A;  1D1C A;  2KLO A;  4BQN A;  2CW8 A;  3KX2 A;  3OL3 A;  4PJN A;  3RCO A;  4C2T A;  1E0E A;  3OYM A;  3OYD A;  2OV7 A;  2VB6 A;  3SDB A;  4F52 A;  3QYF A;  2GOX B;  1P9Q C;  2LYC A;  3L2U A;  4AVZ A;  3MKZ A;  2LRE A;  3IP4 B;  4CSW A;  3CMM A;  1Y6I A;  4ZYA A;  3DTE A;  4OWR B;  4E7I A;  4II2 A;  1DGR M;  4GRI A;  5CQE A;  3BLY A;  3QOD A;  1QHG A;  3DWL E;  4R79 A;  4HST A;  2QKL B;  4XKW A;  3PNY A;  3UNG C;  4B47 A;  3PSF A;  4XLH A;  3HL2 A;  5LD2 C;  1ERD A;  3LSH A;  1S9H A;  3LSI A;  3L2Q A;  1X1D A;  1X1C A;  2AQE A;  2KMU A;  3K70 C;  2CV1 A;  1BR1 A;  1OR7 C;  2KDO A;  2JVH A;  3OYH A;  1G59 A;  3ZCO A;  3E1S A;  4LIU A;  4CCJ A;  1LVK A;  4RLQ A;  1U0J A;  3DPL C;  3NWS A;  4PK4 A;  3V42 A;  3OWT A;  1MND A;  1WJB A;  2L9S A;  4BE0 A;  2MFZ A;  3HG9 A;  4IZZ A;  1X4P A;  4LG3 A;  4JQF A;  4Y33 A;  2VL8 A;  2E1M B;  3MMY B;  4F55 A;  1N78 A;  3H0D A;  4HPQ A;  3M1C A;  1QU3 A;  2IXS A;  2VJ4 A;  4IQJ A;  3VDX A;  4BU2 A;  1MMN A;  3DLA A;  3FBI B;  2HZD A;  5HNF A;  4ZTJ A;  4ZDO A;  3RPU D;  4BAC A;  1FMV A;  1MNE A;  4N4O B;  3OYL A;  2PJR B;  4BXF A;  4CUG A;  2AQF A;  4CH7 A;  2X1C A;  2HU9 A;  3S3N A;  3KEY A;  3QYE A;  4U7B A;  2KRH A;  4ZDP A;  4NQW B;  2ZSI B;  4C2U A;  3LSK A;  4LIT A;  2VQH A;  3W2V A;  3CJR B;  3HUG B;  3OR2 C;  4IX7 A;  5KNL A;  3OIP A;  4F91 B;  3A2K A;  2IS1 A;  1N75 A;  1WJA A;  3SYT A;  2NOJ B;  3L2W A;  3ZGK A;  2L5Q A;  2ELJ A;  2JUG A;  3HPH A;  3OMY A;  3PUB A;  3S32 A;  3HXL A;  4BJT A;  2K9L A;  2IGK A;  2RRE A;  3ZQQ A;  4DBR A;  3VYU B;  3DQV C;  2M4G A;  4BL0 B;  3VYS B;  2VAS A;  2K9M A;  4XOT A;  2KPM A;  2CW7 A;  3H5A A;  4DGW B;  3D5L A;  3K70 D;  2CMP A;  3FHN A;  1T95 A;  3AL0 B;  3CF2 A;  2W4S A;  4E6K G;  2VKD A;  4BJ6 C;  2XF6 A;  2V9K A;  4PJJ A;  3H35 A;  2XF5 A;  4G6T B;  2OUM A;  2Q1Z B;  3OYG A;  2BVL A;  2LOO A;  1N77 A;  1UG0 A;  3RTR A;  4QPQ A;  3CP2 A;  1DGW Y;  3DEE A;  2DCE A;  4PFO A;  2R7X A;  2M7A A;  3K10 A;  1YX5 A;  2VQC A;  3PL8 A;  2MYS A;  3IAM 2;  1X19 A;  2RNG A;  2VXZ A;  2X6X A;  4BEH B;  4E7Z A;  4PJL A;  1DQU A;  5TGT A;  4E7J A;  1X1A A;  4XM3 A;  5LFA A;  1Z7L A;  2BW3 B;  2HVR A;  3EPZ A;  3RSN A;  4H4K C;  1VZ0 A;  4XLF A;  2R7U A;  4HSR A;  3K4B A;  4BDZ A;  1BR2 A;  3SEQ A;  2WAE A;  2HVQ A;  4HRI A;  3HKZ A;  3M8J A;  3VYR B;  3C2G A;  4HNU A;  2CV2 A;  4XOR A;  4BDY A;  3DU6 A;  3IAS 2;  3TL4 X;  4B43 A;  2R7S A;  3OYN A;  1QHH D;  4BJ5 C;  4D9J A;  3K4M A;  3VSL A;  2DOA A;  3SEZ A;  2VKH A;  3FKJ A;  3G2B A;  2R7R A;  5HOO A;  2W00 A;  1IRX A;  2HDW A;  2R7V A;  1D0Z A;  2DT6 A;  4CCL A;  3OY9 A;  1UEL B;  4IQ4 A;  2JA2 A;  3PSI A;  3AFH A;  1AA7 A;  1WJE A;  4BGD A;  3OIQ A;  2VPL A;  1LKX A;  1YE9 A;  4RLF A;  3VYT B;  2LG4 A;  2DT7 B;  2V26 A;  2VJ5 A;  4MLO A;  2L2O A;  2XF7 A;  2X6Y A;  1WJD A;  1D1A A;  3BCA A;  3UR3 C;  3GBG A;  4NC8 A;  4FAS D;  2F4I A;  2JVG A;  1V5F A;  1WFX A;  4YEL A;  2R7Q A;  2V6E A;  2WAQ A;  4B48 A;  3L2V A;  2UV1 A;  1YX3 A;  4C30 A;  3K4N A;  1D1B A;  4E7S A;  3S93 A;  2LBF A;  5HLT A;  3K4C A;  2XC7 A;  1LFP A;  3H9J A;  2R7O A;  2K3P A;  1Y56 A;  3C2H A;  2WAD A;  2DJI A;  4BQO A;  3W2A A;  2X85 A;  2KZV A;  3PFY A;  3MD2 A;  4CCM A;  3L2R A;  3QYB A;  4KIT B;  2L9N A;  4BE2 A;  1V5E A;  4F3Q A;  3CJQ B;  4NUB A;  4B44 A;  4HG2 A;  3A1Y A;  2ZXH A;  2GOM A;  1LDK B;  3VSK A;  4BUP A;  3OYF A;  3DKY A;  3K4L A;  2V7F A;  1PYV A;  4P5O A;  2E5N A;  1R6R A;  4F93 B;  1WJC A;  1MW7 A;  2HQA A;  3FDY A;  3DTI A;  4XON A;  1GLN A;  3DPU A;  4EAT A;  4XOP A;  2Z1D A;  1D0Y A;  4PSX A;  4E7L A;  1D0X A;  2X51 A;  2F6C A;  1PJR A;  2HNH A;  1X4O A;  2WB1 A;  3CP8 A;  4XL9 A;  2XSJ C;  4PSW A;  4ZDL A;  1TZL A;  3PJR A;  4PUS A;  2IGO A;  4HNT A;  3OYJ A;  4E7K A;  4BQQ A;  4N4N B;  2K5C A;  2W1O A;  4AYB A;  4XLE A;  2X1D A;  4BE1 A;  2KQR A;  2WA0 A;  3LFU A;  4KJZ A;  4XKV A;  3AKZ A;  3OYK A;  1SFK A;  3KYL A;  2V4J C;  5FRO A;  3DKX A;  2VXD A;  2X6W A;  2QKM B;  1Z3Y A;  2LH9 A;  4JOM A;  1NG7 A;  3S3M A;  2P0W A;  1MMA A;  1J09 A;  4B3X A;  5FRM A;  3LMM A;  2PJR A;  3BC8 A;  2M3A A;  3OS2 A;  2X1E A;  4F92 B;  3K6G A;  2IS4 A;  3F9K A;  1NG6 A;  2Z2S B;  2FUG 2;  4CA0 A;  4XLA A;  3PNV A;  2OC6 A;  2E1M C;  3IUO A;  4XMY A;  3TMO A;  1JI8 A;  2LC2 A;  4C9Y A;  2A6T A;  4DOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...