2ZSIB

Structural basis of gibberellin(ga4)-induced della recognition by the gibberellin receptor
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
60
Chain Sequence
b'GMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVLATETVHYNPAELYTWLDSMLTDLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable gibberellin receptor GID1L1
publication title Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 20
structure length 60
sequence length 67
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12041 DELLA Transcriptional regulator DELLA protein N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1290 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zsiB00
2ZSIB 2ZSHB
chains in the Genus database with same CATH superfamily
4L5EA 2G0EA 1D0YA 3I4PA 1HW2A 1ZGJA 5IP6A 5L3FA 2R7XA 4ZYHA 3PIPF 3FX3A 2IGOA 1HDPA 3F22A 1W7PD 2MH9A 4PJ0C 4MTDA 3J81Z 2EFNA 2EFWA 1R1UA 2AHQA 3I56I 1J59A 2XUBA 2QF7A 2VBXA 4MEYF 1LKXA 1VQKI 1HXDA 3G2BA 5EJCA 4BJTA 5E17F 5DD8A 1TT5B 2LR8A 1ZLJA 4YFXF 3EUKL 3ISPA 5FJ8J 5D5WB 1X58A 5BS6A 4HF2A 2QWWA 2PEXA 4AIKA 5LD2C 2K40A 3O8HA 3RQ4A 1Y56A 3WE2A 2RQPA 4W97A 1XSDA 2H8RA 4BE2A 3N05A 4EM0B 2IT0A 2QCOA 4F55A 3OOPA 1Z6TA 3RKWA 1R5HA 4ZZDA 1E3HA 1JGGA 1O4XA 1TW2A 1WQ2A 3R61A 3V8JA 2IAIA 3OYHA 2L9NA 3ZQGA 1VNDA 4AU7A 2F5EA 1B6AA 5KHDA 1NK3P 2PG4A 4KN7X 1UAAA 3TP0A 3SZGA 3TW6A 2JA2A 2LF8A 1B8IA 2EFOA 1TNSA 4M3EA 3AG2H 4A0YA 2DA5A 2Y0MA 4E7JA 1QO0D 1HQCA 1K78B 3M4OJ 2YSRA 4IHSA 2OD5A 4F93B 1R49A 4I09A 2O7OA 2W48A 2M7AA 3UKGA 3GVAA 3Q0VA 4XM3A 4GO1A 4LK0F 2M45A 3WTXC 3AG3H 3CCLI 3CCMI 3D5RC 2YU3A 5ICEA 2WAQA 2CO5A 3B73A 3LSJA 1FBSA 3H9JA 4XICA 4IHTA 3A4CA 3PSFA 4YIFA 5KAFC 1UMQA 5EF6A 3QOPA 2R7OA 2VC0A 1IRXA 3I59B 2KDZA 4ON0A 1G8XA 2F5CA 4PCQA 1WI9A 2X6OA 3AG4H 1K79A 1JT6A 2GA1A 3HHGA 3MCZA 3DEWA 4B44A 3OS1A 1VQPI 1X1CA 3ASNH 5D6EA 4XKWA 4E4HA 4KJZA 2EINH 4XIDA 2XF7A 4BBSJ 5CYVA 5IYBJ 3CLQA 4Y3OA 1VQ7I 4R8HA 3E5UA 3KPHA 4EATA 3ZQLA 1S9HA 2VBZA 2CV2A 4CXFA 3I9V2 1BC7C 3OSGA 2GWRA 5CVJA 1KQ9A 2OAZA 1X2NA 1T39A 2O03A 5J1UA 2P5VA 2X6XA 2M3AA 5BPDA 2QYOA 2BEOA 2BW3B 2KZGA 2UXNA 3FXLA 2O8KA 3TMOA 3B02A 4DW6A 3PUFA 3WU2C 2VOPA 1H8AC 4MFDA 1B4AA 1X19A 2ME6A 2DA2A 4JQFA 1G3YA 5DUIA 2F5DA 2B7EA 3H9QA 2LVSA 2XGXA 2XPWA 4MNUA 4ETSA 1ZG1A 4BHPA 3K69A 3FXJA 2IGKA 2R3SA 3ZQIA 2WA0A 3DP7A 3UNGC 3K4JA 2GXGA 4WXHA 3FXUA 4IPAA 1NG7A 2AQFA 1MIJA 2W85A 1Z3XA 3K0LA 2WWYA 2R93J 1WGXA 1SMYF 2XSJC 2QQBA 2IEKA 3HM5A 3DKWA 1BOBA 2MD0A 4FE7A 4B48A 1QPMA 3H0GJ 3WODF 1A04A 3F9KA 5JLXA 3MKYB 4HW0A 5D5UB 2M34A 2EZHA 3FZVA 2YS9A 4X1EA 4LG0B 3FXOA 2CFOA 2X48A 1TQPA 5TGTA 4DZJA 5ILSA 1FOWA 3MKWB 4V2FA 2F2EA 3F8FA 1JI8A 1YO5C 1PP7U 1H9GA 1WJDA 2VT3A 2ID6A 2Z99A 1K78A 3H92A 1B59A 2CQQA 2ZJQF 2L01A 5LRRA 1Z05A 3DFGA 3HOXJ 1RETA 4XORA 2HWVA 3D5SC 2NNYA 5L3BA 1IXCA 3F8MA 1IN6A 2A69F 3E1SA 4DBRA 1QZEA 2GLOA 3H5AA 4NHJA 3E97A 1DUXC 3QYEA 4A3CJ 3I59A 3CDHA 3QOEA 4BDZA 3WTYC 3LAJA 3CZ6A 2DJIA 2JMWA 4HNUA 1G3SA 1DQUA 3LA3A 5FLXZ 3HKZA 4V2GA 4YIRX 3KZIC 2NYXA 3N4MA 1PUEE 1U5TC 1KQ0A 3PJRA 1FOXA 3LSHA 2ZJ2A 4D5CA 4XOTA 3HG9A 1G59A 3LSIA 2WADA 5HOOA 3IC7A 3W6VA 1P4WA 1OYIA 5CQEA 4OWRB 4Z2YA 1D5YA 4ESBA 2VXDA 1X1DA 2EIJH 1A31A 2VODA 4CCMA 2DMTA 4WF2A 5BMZA 2KDOA 3LFKA 3ULQB 4UNOA 2EFQA 2XF6A 1OQYA 2FD5A 2VKVA 4Y52J 2BW3A 3E7LA 3DTEA 2FNPA 3E6DA 2DN0A 4BE1A 4UUSB 1KYZA 1MJAA 2A07F 4A5MA 4K2EA 3IAS2 1LFPA 3CCQI 3E3VA 2VQHA 4BKXA 3L9FA 2DFIA 2R7WA 3KEYA 3HOTA 2I8DA 1WJEA 4F91B 1MH4A 2L7FP 5HVQC 3GTQJ 3E6BA 4ZTFA 3KEOA 4UHTA 3OYKA 1DGRM 2E36A 5LBQA 2X85A 3S1NJ 5JHUA 3P5JA 1D3YA 3ZN1A 3LSMA 4XRFA 2K86A 3V8LA 2W25A 3KP6A 1ETXA 1IGNA 4L5IA 1MJ9A 1Z1DA 2L7ZA 4NC6A 3FKIJ 2A6TA 4GGGA 2RQQA 1IN8A 4LG0A 3F3XA 3I64A 2ZJPF 2CW0F 1H0MA 2BHZA 2E1NA 2IS6A 3QYBA 4LIUA 1W5SA 2LREA 3BR5A 2K7LA 3HPHA 1YX5A 3KYLA 2DXIA 2VE8A 4M3GA 2I5UA 3WGGA 3QYFA 4KIGA 1MMGA 1GXPA 4UUTA 4U0YA 1IZ1A 1U9OA 4AVPA 3T0YA 4BY1J 1P7JA 1ZN2A 1F9NA 5D5VB 2XAGA 1S3JA 5JVTA 4G12A 1YLFA 2LYCA 1NH3A 3OSFA 5H6QA 2HPMA 1SFKA 3CJQB 3GZ6A 4E7LA 3U1DA 4B3XA 4X0GA 2A68F 1G2HA 2QBYB 3JRDA 2DLLA 2RDPA 3BY6A 4UV9A 1WH5A 3OYLA 5ILUA 2TRTA 4IRHA 1E0EA 1HKSA 2K3FA 3CP2A 2DFHA 5FFXA 5TRDA 2X6WA 1ZRDA 2AQEA 5CPRB 5J8FA 5J8CA 3R6SA 1YYVA 2JK3A 1N77A 4I2OA 1YE9A 4EJTA 3ROUA 1Y6IA 1ULYA 2IS4A 5FD5A 4LIVA 4YELA 5HS8A 2L2OA 3DXJF 4RLFA 5JVGF 1IAWA 4PFPA 2HU9A 3S3MA 1DU6A 3CCVI 2W7NA 4XRMA 2BY3A 3ECOA 2EZLA 2K4JA 2KIFA 2E71A 1IN5A 3SEZA 1RUNA 2B9SA 3FWEA 1FIAA 1HLVA 4QPQA 1HKTA 5FB2A 1DP3A 1AA7A 1RPWA 3RPQA 4HRIA 1WJCA 4B1RA 1N78A 1XDSA 2HFHA 3REOA 4AIHA 2VONA 4LGWA 4C2MJ 4E6KG 4FTHA 2E7WA 4DYRA 1FP2A 1YW9A 1IF1A 4OMYA 3BPXA 5LGTA 4N0BA 3OYMA 4KN4X 1SD6A 3HB9A 1D0XA 3KEQA 2KRHA 3S8PA 3S93A 1X1PA 2OTLI 1X1AA 1ZTRA 3HSRA 4PJLA 1ITYA 4IHYA 1W4MA 1WSUA 5A2QK 1X4OA 2HQRA 2R7FA 1JHFA 4IZZA 4BHCA 2HOTA 3B6AA 4MHGA 4UUSA 3SEQA 3OYEA 3A01B 3HSFA 1V5EA 1VQ6I 2ICWG 1Z0XA 3ABLH 3HOSA 4CYDA 3ZMDA 1MNDA 5DM7F 2XAHA 5AONA 1UZCA 3DWLE 4E7HA 2CFXA 3GFIA 2XVCA 4BXFA 4CCKA 4M9ZA 1POGA 1QRYA 3F8BA 1CGPA 4RM2A 1NK2P 1SFEA 2KP6A 2VASA 3ZGKA 5TJJA 2JJ7A 2DT6A 2ZCWA 2PLYA 2DA4A 2ZC2A 4XKCA 5E8GA 4EJWA 5F64A 3W2VA 4YRVA 5GTHC 1IRZA 2DMNA 2P0WA 1FT9A 3DBHB 5FFZA 3CMEI 2XSDC 2MYSA 2A61A 2LLKA 5CVIA 3WTSC 1USTA 1JT0A 4M9XA 3ZQHA 2DFEA 3TL4X 3K7AJ 3F21A 4Q5SF 3C3WA 3G71I 1FC3A 1R23A 3NWSA 2PMUA 1KYWA 5LLQA 2HR3A 1WJ5A 1ON2A 4DNCA 2W4SA 3DEEA 3FM5A 4IXAA 2E19A 3L09A 3FM3A 3ABKH 3PFIA 3KIOA 3RJPA 2TDXA 3X2QH 1VQNI 4HSRA 1UHMA 5IP7J 2UZKA 2R7RA 1O3RA 2Z16A 3HPGA 2RVCA 3WU0A 4BY7J 5E8IA 1XTAA 3BQYA 3WTVC 4F92B 4HNVA 2BXZA 4BQQA 2L54A 2QBYA 4D7NA 1H89C 1D8KA 3ERED 1YJNI 3CD6I 2PMHA 2V1XA 4PDKA 3GTJJ 2EFPA 4ZDPA 4G6QA 1SVMA 3SZTA 4JP0A 4PGGA 2BE5F 1UG2A 3I58A 3TP3A 2BXYA 3BG5A 3DQVC 1N25A 2QEXI 2EV5A 1BL0A 2YR2A 4FX4A 3KE2A 3SQNA 3ZMVA 2Z9OA 4FASD 2ELKA 4KFCA 4LJZF 2AXLA 1D5VA 2F4MB 3VOEA 3S2DJ 3CMAI 3OYAA 2MC3A 2J5OA 1XMXA 3JAMZ 2RAEA 3DPLC 2ZMEB 4BACA 5DD4A 3JRIA 5IP9J 3SFIA 2DBBA 3SZPA 1D1BA 4EQQA 4XONA 4HX8A 2KZVA 1JKOC 1RR7A 2W24A 1DPUA 2GOMA 1OMIA 5HS7A 3BR6A 2LY1A 2Y30A 2DTRA 2RKHA 1OR7C 2NVQJ 2V26A 5GTIC 4IF4A 2FA5A 1ZGAA 3DU6A 3BR2A 4L9JA 2D1VA 4OIOF 3HOYJ 4YEJA 4C3JJ 2H6CA 4L18B 2V79A 4C3HJ 1I27A 2QQAA 5GAHJ 2HZDA 5L3DA 2Y9YA 3C2GA 4IOCF 2ZXHA 4B47A 3LA7A 2CGPA 3WE3A 1RR8C 2QA4I 2LY9A 1IRFA 3GZ5A 3QWLA 1IDZA 3MKLA 2RV8A 3VDXA 4XSZF 1F43A 3A01A 2DPUA 4LFUA 5K5QA 1Y1WJ 1TWAJ 3S16J 2FSWA 3ZRGA 3KZZA 4IO9F 3J7YJ 1S7OA 1ON1A 3TKYA 1MSEC 1IJWC 3OYDA 3CCYA 3DKXA 3KYDB 1E17A 2ZNZA 4FHTA 4IHWA 3H5NA 3H5RA 1RIOH 3GBGA 4E7SA 2ZMEC 5J1RA 1RI7A 2HOEA 2WY7Q 4B3AA 1WJFA 2FOWA 1BA5A 1KQ8A 3OYFA 2NS0A 3JRGA 3JCUC 1XG1A 2HKXA 3HRSA 4I0AA 1MMSA 2MD5A 1K7AA 3OIPA 3JREA 4YFNF 2EA2A 4HV5A 4DYCA 1TWFJ 3DV8A 4I99C 6PAXA 1YI2I 2RC4A 2XGEA 3M1EA 4BNCA 2V4JC 4GXOA 3RTRA 5HNHA 1ACIA 1BI0A 3MZ8A 2M7BA 3J80K 3R60A 4HLXA 1OR7A 1SFOJ 1DP7P 1FYLA 1GXQA 2LOOA 3CC2I 1ETKA 1DU0A 3WHCA 1TP4A 2OZ6A 3OS2A 2Y0SN 3DEUA 2JTVA 3BDDA 2MG4A 1Z67A 3K6GA 5HDKA 2VJJA 5IOYA 3C2BA 2F48A 3ZMSA 1IN4A 3ZN0A 4B4CA 4J00A 2VBWA 3HXLA 3TO6A 2VQLA 3K4NA 2G9WA 4ZTJA 1FWZA 3FKJA 3SHFA 2VOOA 2ZXIA 2HVSA 2UV1A 3D0SA 2E7XA 1WHUA 1FJLA 4OAZA 3IHUA 3F6VA 4ENJA 3KX2A 4GRIA 4M3BA 1LE8B 2WY8Q 4E7IA 2QLZA 2EQRA 2H6BA 1BOAA 3ZQQA 5CKTA 1SAXA 3JSOA 5FD6A 4RB3C 4EGZA 2Z3YA 3RIRA 4PZJA 1MMDA 4RLQA 3GFMA 2M8GX 2XDVA 1MSFC 3BROA 4HF1A 3KLOA 5F0FA 2DW4A 2ZMEA 3BG6A 2CUZA 3C1DA 5JI6A 4BEHB 1B9NA 4BE0A 3FBNB 3VYTB 4BQOA 1S5LC 4A3GJ 4NDLA 5E3LA 2P6TA 5B3SH 2KJBA 4UB6C 3JRFA 3OR2C 2LKSA 3BR3A 1YIJI 3HIFA 2L3DA 3OV8A 2ETHA 1APLC 1MBFA 3LWFA 1ZELA 5LGNA 1XN7A 3DTIA 2E2IJ 2ISYA 2K3PA 3CJTB 1BM9A 1XDUA 2LP0A 3PNYA 2WB1N 1R4MB 1T33A 1FIPA 3DKYA 3E6CC 3ZQCA 2JVHA 4FISA 5GPCA 3BR0A 1LPQA 1QA6A 3IRRA 1ZHFA 2X0LA 3J7AY 3VPRA 3DBRB 5D6FA 1TL8A 1VTNC 1BW6A 2FF4A 2OCEA 1OKRA 1FEXA 1QQIA 5H6RA 2QKMB 5EG0B 4PK4A 4P5OA 3CCRI 1SD7A 4LLGF 4EGYA 5CVUA 2BV6A 1KZHA 1S7AA 4I76A 1XS9A 3DF8A 1LJ9A 1UELB 4L9TA 1HW5A 4QSHA 1KA8A 5F27A 5M5WJ 4FT8A 4HZFA 1FZPB 3H36A 2IVMA 2OU2A 2VE9A 1XMKA 5EZHA 4UV8A 1ZKGA 1FBUA 1T6SA 3GTMJ 1Z91A 1T38A 3JRCA 3W3CA 2IBDA 3C7JA 1YX3A 1S8NA 3JW4A 5HLIA 1YITI 4L9VA 3CMMA 4B8XA 1MBJA 4KA4A 2G7HA 2O0YA 4MEXF 4W1UA 3FMQA 1MMAA 3IKVA 4II3A 3M7GA 2EK5A 1XCBA 1FMWA 2DTZA 3U1KA 4HDUA 5GADJ 5ICFA 2XROA 2YU9J 2X6YA 3EDPA 3I3LA 4H4KC 3K10A 4OOIA 3KP4A 1A6QA 3VODA 4DJAA 2NVTJ 1IUYA 1V5GA 3SXYA 4A93J 1FSEA 3JRAA 2ESHA 2ID3A 1F1ZA 1X2MA 1W7PB 2HI3A 3FXRA 1FTTA 4RB2C 5M3FJ 4D7MA 2R7DA 5IT9Z 4II2A 4RAFA 3GFJA 1JE8A 1QVUA 2EB7A 4HAMA 4A6DA 4WCGA 1EKEA 1WRJA 2P8TA 4KICA 2JA7J 2QZ8A 2DK8A 4XSXF 3PQKA 3S1RJ 1E2XA 2WAFA 3BT9A 2DOFA 1QBJA 4LLLA 4FX0A 3IWZA 3HOVJ 3ESWB 5C3EJ 2GIZA 1LE8A 3S1MJ 1SFXA 2F4OB 3VFZA 4A3IJ 1STZA 1TLHB 1Y0NA 2PJPA 3BTLA 4Y7NJ 4LITA 4Y13A 3CCJI 3BCBA 1IW7F 5J6XA 1YOVB 3BZCA 3BJAA 3ZPLA 4OINF 2K5CA 1BJAA 5B1BH 4F7ZA 2JUCA 2JPBA 3RPUA 3H35A 3VWBA 5LHIA 1P4XA 3LSGA 5BNGA 1S29A 3Q0UA 4BEHA 1RUOA 1I6HJ 2VJIA 2Q8KA 2STWA 2Q1ZB 3HOUJ 2IGMA 2O5RA 4HOBA 4XLHA 2XKPA 3S14J 2HOAA 3T8RA 1TWHJ 2QENA 1SFUA 2R7TA 3R0AA 2IS2A 1U5TB 4KMFA 5DYMA 5FKKA 2D5VA 1HSJA 2PI0A 2A5WA 2GOXB 1Z7LA 5AIPA 2AS5F 2DCEA 5F1RA 3PNVA 3L2QA 1I39A 2LBFB 2P5KA 2M1BA 2H1LA 1FOKA 4PSWA 1Y8QB 4ESFA 1YIOA 3SYTA 3H9GA 3V7SA 4XLFA 1AHDP 3MQ0A 5E3MA 1USSA 2FE3A 2Y48A 5DCFA 4AD9A 4M71A 2PBIA 2PX9A 2XB5A 1BIAA 5HS9A 2GQQA 1K61A 2NNNA 2HYGD 3WGHA 1OCTC 1WPKA 5LRSA 3Q5FA 4IQJA 2XAFA 4P96A 2RNJA 3LQQA 2W1OA 2X4HA 2ESNA 2JZYA 2QSFX 1YG2A 4FE4A 3S2WA 1GDTA 3K4CA 2G7UA 3U2RA 5LFAA 5EG0A 1G3TA 4M3DA 3VB2A 4GDFA 3BPVA 5FKMA 1W5CC 5C4JJ 5FO5A 3BJOA 4BUPA 3DBLB 4CCJA 2VJ5A 1V54H 4XRSA 2GXBA 2LC2A 2KHMA 4C3IJ 2L5QA 3G1MA 5K7HA 2E2HJ 3RKQA 3HOZJ 2COMA 1X3ZB 2LFBA 1O3SA 3IV5A 1HF0A 3TGNA 2NOGA 2VN2A 1R6RA 1HBXG 5E1ZB 5D8KB 2H94A 1TWCJ 3I53A 4XLPF 3EYYA 2VL8A 4E70A 2WAEA 5CLSA 5HDGA 2HYJA 3K2AA 2PQ8A 2CV1A 1JTXA 1K6YA 2CU7A 5DUKA 4MO7A 5M5XJ 2PMZN 1O3QA 5KK1A 2L0KA 2FMYA 1D0ZA 2KL4A 2VB6A 3EPZA 1W7PA 2CJJA 5F6FA 4ZDLA 1Y8RB 3VYRB 2MW8A 3ZMTA 1JTYA 5FLXK 2D2WA 2DQLA 1XGNA 2HNHA 4HX4A 2O9LA 1A35A 2FQ3A 3V7CA 5L3EA 3HYIA 5DM6F 2P81A 1QU3A 3H1CA 9ANTA 3ZXSA 4UY8I 2EZIA 1P9QC 3ONQA 2CSOA 2DAOA 4HQEA 2X1EA 4U88A 4OMZA 2ZBKA 3GW2A 1WH7A 3W6KB 2WTEA 2MLKA 3H3VK 5LEKA 2P7CB 5J40A 1LEAA 1XD7A 5HDNA 1QGPA 4WWCA 4KDPA 1TQIA 3RQIA 2LKXA 2RNGA 3PO3J 2XKOA 5ICCA 1FSHA 4DIQA 3PFYA 1J2XA 3SJMA 2XASA 2VI6A 1G3WA 2K9NA 1ZARA 3CLOA 2HPIA 1UG0A 1HSTA 2F5FA 2H8WA 2K9MA 4XKVA 2IP2A 2MC4A 3W2AA 5CVRA 3AAFA 2AO9A 1XPXA 2LG4A 1X4PA 2V9PA 4M73A 3LAPA 2BVLA 1MBHA 4RAZA 1U5TA 3ZP5A 1UB9A 2QSGX 2NRAC 5ICGA 4G7ZF 4IEJA 4NBQA 3L2WA 1T95A 1XX5A 1IN7A 1V55H 2LBFA 2WB1A 5FKOA 3WU1B 3KP5A 3F6OA 1R00A 4RAGA 4DQ2A 1Z6RA 3P7NA 4KITB 1I1GA 2MABA 3NRVA 3OYJA 3IH4A 3KETA 4M9SA 1MNEA 3MFKA 1QHGA 1J09A 2HXIA 1GUUA 2E60A 5F08A 4RM3A 3BWGA 4MLOA 1S6LA 5BOXA 1MKMA 1ZYRF 4PFOA 2L02A 4EMSA 3S1QJ 1L3LA 4FETA 1BI3A 2O3FA 4ZYAA 3NQOA 2K9LA 1S72I 2DODA 2HDDA 3GO5A 4XN3A 5JLWA 2IW5A 4L0YB 4AIDA 1ORKA 3CCUI 3N97A 2CV0A 1YRNB 5IYDJ 3DPUA 4M6XA 2L9RA 4CSWA 2H27A 1BR2A 1UHWA 3O6BB 4BJ6C 3CCSI 3ZQFA 3L7WA 1IG7A 1YQAA 2OQRA 2O6GE 2ZXJA 1HC8A 4ZYEA 4IQ4A 2JSCA 2DMPA 4L0ZB 5IYCJ 1U6GA 3M8FA 1FMVA 3K1NA 4NQWB 1AWCA 4ABZA 1JUPA 4XNFA 3TW7A 1EA3A 2XB0X 2R7UA 1B1BA 1R1TA 1MJBA 3CJRB 3HRMA 5K7ZA 2KMUA 2P6SA 3HRUA 4U0VA 3HC7A 3TEDA 1I50J 1OLTA 3MZYA 2B63J 2K9QA 5F04A 4G7HF 4GFBA 2ZKZA 2M2EA 3HZJA 1VFCA 4MQ9F 4AIJA 4RB1A 2R92J 2OBPA 3ABMH 1QHHD 2HDCA 3H3ZA 4QTRA 3CCEI 5LHGA 4R1HA 4CYCB 5E18F 2EV6A 4NUBA 4CO8A 3HBLA 3L2UA 4M6YA 2EBIA 1ZLKA 3K70C 1SANA 2IGNA 3IAM2 4HF0A 4PJJA 2M0MA 3O2PE 1ZG3A 4UXNA 3H3UA 1ETWA 5D5XB 4JX4A 2DU9A 4P9UA 1HKQA 5JR3A 2QUFA 2IA2A 3LNQA 3I71A 4XRSG 3F0CA 4C30A 4R79A 1W0UA 3HOWJ 5H2FC 3NAUA 2ZO4A 1TC3C 2CQKA 5HLGA 1W36C 2A6HF 2GM4A 3QQAA 2C6YA 4ITVA 4ZZLA 2LDUA 2K9SA 3QPSA 2A3SA 2M30A 3FXQA 2E35A 2E5NA 3OYIA 4I01A 2HQNA 2HTJA 1D1AA 1BBYA 2H09A 5DV5A 5ED4A 2YX7A 4BL0B 1LNWA 2BVMA 3GLLA 3FMRA 4XBFA 3V42A 5KAIC 1ZR4A 2UWMA 1O3TA 1JJ6C 2V6CA 2K02A 2KISA 2QSHX 4MGRA 5J47A 1LVKA 1Z3YA 3GZNB 5EDNA 2DFFA 3S32A 3HL2A 4LK1F 2LSOA 3A03A 1XGMA 4C2UA 1TWGJ 3BTJA 3S3NA 2IXSA 3BQZA 2OTJI 4LMYA 2ZJRF 4AM3A 3C2HA 1A5JA 1IC8A 2IA1A 1I5ZA 1PYVA 4A69C 2W84A 3MN2A 4N4NB 2OQGA 1M1EB 4YG2F 3G73A 2LK2A 3IUOA 2V1DA 3VYUB 1U8BA 1WZ2A 4LOCA 2KQRA 2FX0A 3FHZA 1OPCA 1RKTA 5D8LB 1V5FA 2KFDA 4LLNA 2K85A 1JKQC 1YRNA 1LUJB 4HQMA 1VI0A 4HX7A 4IKFA 1ZAOA 5E20A 4CCLA 1OCCH 2COBA 2BHYA 3RYPA 1A6IA 4G8XA 3COAC 1J0RA 5LHHA 3VSLA 2DMQA 3MVPA 5KCMA 1J9IA 4RAYA 1S7EA 2DI3A 1LVAA 4NQWA 3TBIA 3TQNA 2ZFWA 1DGWY 3Q9SA 3HDDA 2WBMA 2LKPA 5D4RA 1HW1A 4YFKF 5IT3A 2PMZA 3HRTA 4Q47A 1QZYA 2EZKA 1BR4A 5HODA 4XLCA 3AKZA 4A6EA 1O7LA 3RPUD 4KISA 1SC7A 4G6TB 1QNTA 4P9FA 3OIOA 4JYKA 4CDGA 2VLAA 1K6OA 1YTYA 3VEPA 3JAMK 4EV0A 4CYCA 2VJ4A 1REPC 1TQMA 2CYYA 2ISZA 4KNYA 3WG7H 3FBIB 2OUMA 2A5YB 1MMNA 1T0FC 4BDYA 3CDIA 3AFHA 4A5NA 5HNFA 4JBAA 4NC8A 3ABUA 4M3FA 3IL2A 3CJNA 3M1CA 4GYGA 1OCRH 3A02A 3OWTA 1I6XA 1F4KA 2R7VA 4XLNF 2N8GA 4S05A 1JGSA 2PFBA 2WC2A 3FIWA 3V4GA 3AG1H 1YJ9I 1B72B 3MZHA 2V7FA 1T8IA 3FDYA 3FXMA 1Y1VJ 3CESA 4M74A 3TO7A 3JTGA 1IO2A 2DO7A 2CQXA 3GEZA 3NEUA 5KVRA 5LEJA 2OF7A 3QP6A 5KNLA 4BYYA 4S04A 2VT2A 2ELJA 5E3OA 2PN6A 4Z6YA 4UB8C 1G6NA 1OCPA 2CWEA 1RNLA 1TT0A 2GZWA 4XOPA 1ONVA 2RREA 4XN0A 1V3FA 1VQOI 5F0HA 3RDIA 3M07A 1D8JA 1RC9A 3P9CA 1FYMA 1AKHB 2IA0A 4MTEA 2OC6A 4G9YA 2KT0A 2IJLA 4ANJA 1IV8A 1SVLA 4CHUA 3M8JA 3JTHA 2FU4A 5D4SA 4Q48A 3ZMZA 1JUMA 2J5PA 5J4YA 5LGUA 1YJWI 4LD5A 3F72A 3DU5A 1R22A 1ENHA 3HSEA 2R5YB 4DYQA 1J75A 1R7JA 1EJ9A 2NVYJ 2X1DA 2HOSA 1R4NB 1T0FA 1U3EM 3LSTA 1O7FA 5M5YJ 4C9YA 1N75A 1HCRA 5EEHA 3HUGB 2EIKH 1UCRA 1IUFA 2ZFUA 3LSRA 4RMNA 1Z9CA 4XR6A 2R5ZB 2LTPA 3IH2A 3ERMA 3PQJA 3E5XA 4HLYA 3QPLA 1BI1A 3CO6C 5EYRA 2EPFA 5FKLA 4B43A 3L2RA 3CF2A 1JHHA 2GBYA 2VPRA 3KZYA 3Q0WA 4KMUX 3J81K 4IHXA 4IJAA 2VKHA 4A2UA 2LMDA 4QIWN 1ZR2A 3R4KA 3GUDA 4Y4RA 5ERIA 4P55A 3ZMUA 1BW5A 4EEFG 1Z21A 2Y75A 3HTUA 2OZUA 3P9KA 4DBQA 2R7ZJ 1KU2A 3KLNA 3OYBA 4JK1X 1TBXA 2XHKA 2XRLA 3KFWX 3TOAA 4A3LJ 4O3MA 1R58A 3LQRA 4L5JA 2VQCA 4XLAA 4A0XA 4BGDA 3CC4I 1BJZA 2GIVA 2O8XA 2CH0A 2XAUA 5BQTA 4P1WA 2EV0A 1VQ8I 1FNNA 4M6VA 4A12A 4D0PA 1EV7A 1H88C 4XQFA 4IL6C 1VF9A 3QP5A 4BQNA 3I4NJ 3OOUA 3QU3A 3S17J 4A0ZA 3LOCA 2V1NA 1TTYA 4OAYA 4UVAA 1IV6A 3FHNA 1B72A 2M4KA 1RESA 4CH7A 5B1AH 5BPIA 4A3MJ 3G3ZA 3H0DA 2NVUB 2NXNB 2LF7A 1I1SA 4D9JA 3OR1C 3K4KA 4IX7A 3E0JB 3A0HC 3Q9VA 2DDBA 4JOMA 5EZGA 3PNTA 4I7HA 1K4TA 1WKMA 2QKLB 5FLVA 2FXAA 3T1BA 3RYRA 2VKDA 3OYGA 3IWFA 5FRNA 1X3WB 2CW7A 1WJAA 2LRDA 2I10A 3GXOA 5CQGA 1U8RA 1B9MA 1QVTA 2M4GA 3B6CA 4LB6B 2W57A 2NVXJ 4HNTA 5AIQA 3OY9A 3CTAA 3JR9A 5JFRA 3ML6A 1ETOA 1P4AA 2JSPA 4GYIA 1MD0A 1I3QJ 1AKHA 1R5ID 1R71A 2TCTA 3OL3A 1YW8A 3KP7A 1VQMI 3HTSB 2VKEA 2UUZA 1ETVA 3WGIA 1FYKA 2HQ5A 2HGCA 4F52A 4IHVA 4XLEA 3LMMA 3BJ6A 2R5YA 2VPLA 5DTDA 5FROA 3FK6A 4GCVA 3IKTA 4D1QA 3GFLA 3BG7A 5E1WA 1MNMC 3PM1A 4PUSA 1Q1VA 2FOKA 1R9TJ 3HUGA 4HA8A 4XKBA 1GT0C 1T08B 2ZB9A 2R5ZA 1OJLA 2DT5A 4ZDOA 3WTWC 1VQLI 2L7MP 2VQGA 2OJED 4DZPA 1LFBA 3BTCA 5E3NA 2X9DA 4BHBA 1FLIA 4ZYGA 1ZRFA 4CCNA 2Q2EB 1U0JA 2Z33A 2K4BA 4BJ5C 1LQ1A 4N9HA 5IT9K 4M72A 1XCVA 4JX5A 1SAUA 2QGUA 5F0CA 2F6CA 1D1CA 2GA2A 2KRCA 1X3UA 1GLNA 5B66C 1C0WA 1GHCA 1BI2A 1AOYA 3CP8A 4DOZA 2NS8A 2HVQA 2O61A 3CO7C 2CRGA 1DDNA 1OYYA 1SEUA 4RGXA 4CA0A 3KP3A 3GTLJ 5IPAA 4U7BA 4PSXA 4BXXJ 5FLMJ 3SFZA 2CG4A 4J19A 2IRFG 3I4MJ 1GV5A 2CUFA 4MQVA 3TDUC 2AXTC 2M5WA 3IRQA 2HKOA 2WV0A 4RBOA 3DCFA 4FCYA 4PJNA 4KIBA 4XMYA 1EF4A 1P6RA 1FBQA 5K5RA 2FBHA 1IXRC 4A3FJ 3FF5A 2KIUA 4I6ZA 1MH3A 2FBKA 3O3KA 1ZG5A 2STTA 2E5ZA 2EIMH 3R0JA 4ENNA 1KU9A 2CUJA 3Q3SA 5GPAA 4QWQA 3MEXA 1R1VA 1JXSA 5J3LA 5L3GA 2VBYA 4EJOA 1OCZH 3J7ZI 5CVVA 2HXOA 2R4GA 4XK4A 3P9IA 5J1YA 4KUMA 4AC0A 2CUEA 4BS9A 4ZH4F 3U21A 2DT7B 3A0BC 2GXAA 3L00A 2H1KA 3BC8A 5E79C 2HEOA 2XPUA 3T5XA 1Q1HA 3RI4A 4RGRA 4KYWA 5B5EC 4MFEA 5EEAA 1YW7A 3D5LA 4OU0A 4AYBN 5C44J 3G6EI 2LH9A 3QU6A 2DA7A 4B09A 3K70D 3U9GA 2W82A 4HG2A 3TDZC 3JSPA 3KCCA 1NG6A 1A36A 2V1UA 2PJRB 1MZBA 1E3PA 1UJ8A 2D1HA 1TW3A 2QM3A 2ADUA 1Z7UA 3HEFA 1XGSA 2CMPA 3EUHC 1OFCX 2K27A 4I98B 2Y0SA 1GV2A 4WX9A 3S15J 1LFUP 2ELHA 3RKXA 2JA5J 3BCAA 4Q4ZF 1KU3A 1I3AA 3EUAA 1MW7A 3LL7A 1W36D 1J7KA 4OIRF 3KP2A 2DK5A 2M87A 1BC8C 3F8NA 1HDDC 3I0TA 4E7KA 2Q0OA 3PUBA 3W2WA 2BZTA 2HDWA 2DA3A 3F23A 3GX4X 2MA3A 4BU2A 4IOAF 4CUGA 3S3OA 1HA8A 3FXKA 2OV7A 4I0BA 1YS6A 4KIFA 2YX4A 4N9IA 2E1MB 3BTIA 1CF7B 2ZSHB 1YHQI 4JX6A 5FKNA 3CUOA 2JWTA 3HGYA 1VQ9I 5FRMA 4RGUA 4PGHA 3G4SI 2FBIA 3CMYA 4ENKA 3EYIA 3LSPA 3GMEA 2Q2EA 1CQTA 4V19K 1VQ4I 1P92A 1ERDA 4HEA2 4OIPF 1OYWA 2CQ7A 3I54A 4LB5A 5GP9A 3W6JB 1RZ4A 5EEGA 2XC7A 2XGDA 3PIOF 2FRHA 2XAJA 3K4BA 1P2FA 2M9HA 5K7FA 2HQAA 3JRHA 4H0EA 2JA8J 2MGQA 2KPMA 3HJEA 1BIBA 3UR3C 1Y0UA 5FGMA 3SDGA 2P5LC 3BG3A 4Y33A 3I5UA 1XSVA 5HLHA 4IRGA 2L7KA 1XSXA 4AVZA 1YS7A 5DDGA 1OCOH 2DYRH 1W1WE 3EUHA 5JHFA 2DA6A 3ZCOA 4EJUA 5J4VA 3DTKA 2LD5A 2JPCA 5CJ9A 1FTZA 1PP8F 2E1MC 2CQNA 4HV6A 3LFUA 1O57A 1YFHA 3ECHA 3O8GA 4KT5C 1IDYA 1JUSA 4RS8A 2E2JJ 2Z5UA 3NWTA 2HTSA 1PUFB 2ME0A 3CF5F 4AWXB 1R36A 2QVOA 1K4SA 1FY7A 4S0HB 2W00A 2GAUA 3RCOA 3WHBA 3OMYA 3BP8A 2MH2A 3E6MA 4I02A 4C2TA 3S2HJ 2BOLA 2E34A 2M8EA 3M8EA 4KT6A 3HGGA 2JA6J 1VQ5I 1ZGWA 2FUG2 4UUVA 2DQRA 3BZ6A 3GLXA 4E7ZA 1MDMB 1ZQ3P 1J5YA 1EH8A 3ELKA 3KYCB 3GTOJ 1WJBA 1AU7A 3DPTA 2DDAA 3BR1A 3GF2A 2CW8A 2EH3A 4HDVA 5M3MJ 2OA4A 2A6EF 3MD2A 3D1NI 2XPVA 4PJMA 1ETYA 4J01A 3K1MA 2ZXWH 5L3CA 2NAZA 5A2QZ 4EVIA 2LNBA 2PJRA 1X1BA 1LB2A 4L9NA 2XV4S 2P4WA 4NNJA 3A1YA 4CGZA 3PSIA 1EH7A 3PL8A 5GAEJ 3BZKA 4CCOA 1BN5A 3CQZJ 2Y9ZA 3K1PA 1PVEA 1FX7A 2X1CA 4RB0A 3T8TA 5DCMB 2L4AA 1PJRA 2L4MA 4U7DA 3EQLF 3RZDJ 4A3KJ 1WVRA 2XAQA 3I55I 1LEBA 4Y15A 2NS7A 4ENMA 2D45A 2YPRA 2Y2ZA 1RKWA 3WTTC 4MIMA 2DYSH 2V9VA 3E5QA 1QPIA 2ECCA 2DOEA 2KJCA 1XMAA 4G6DA 1WCMJ 1JKRC 1CF7A 3RSNA 4G94A 1F5TA 3DLAA 2B0LA 2BYVE 2XGCA 4CZZA 4CZCA 3CUQB 4A3BJ 4YIIA 4U0WA 1F36A 1BR1A 3K4MA 3ZQ7A 2RGVA 1OISA 1ODDA 2HZTA 2IS1A 1L0OC 1P7IA 3MWMA 1T2KA 2F5VA 1UHSA 3IH3A 4NB5A 2WAQN 1LDDA 1U9NA 1SVOA 2MLGA 2EWNA 3HHHA 1ZH5A 2FQ4A 1FPQA 2Z1DA 4HYEA 2YUSA 4U87A 1Y39A 4DGWB 2LY2A 3QODA 2BY2A 4ZJZA 3AL0B 3A2KA 2KRFA 2MBFA 2JT1A 3FISA 5K1YA 2VC1A 2Y31A 3F8CA 3OYCA 4ZC3A 1TZLA 5HLTA 3GTPJ 1U2WA 2V9KA 1T98A 4EJVA 3K4LA 3GYHX 4BQAA 2EILH 3MMYB 1DPRA 3K2ZA 5EGOB 4G7OF 4UVCA 4QLCU 3QPTA 1LDKB 1W5TA 4BBRJ 1EH6A 3WTZA 2MSYA 4NC7A 1LDJA 2IPQX 5TISC 3OS0A 2HYFA 1RRJA 3EETA 3CDLA 4N4OB 2NOJB 1E3OC 4HSTA 3CUQC 2V6EA 2ZSIB 5F1JA 1PUFA 4BAYA 3FMSA 1WWXA 1NHAA 1W0TA 4BH9A 4TV7A 3ASOH 2OCCH 2DPDA 1FP1D 2M0CA 4QPOA 2XF5A 3JRBA 5H20A 1XGOA 3DLLF 3RZOJ 2HVRA 1MBKA 4EM2A 2Y69H 4A3JJ 2DOAA 3G1OA 4UVBA 3QAHA 5K5OA 4O5VA 1MDMA 2BBYA 2BY0A 2L9VA 2R7QA 4AYBA 4D5FA 3G1LA 3LA2A 3SDBA 5IY5H 3BOQA 3V8KA 3AL0C 2EJRA 1G4DA 2CS3A 3RKYA 1MBGA 4WXCA 5GAGJ 4IVNA 4BXUA 3OYNA 4FQGA 2QQ9A 4HBLA 4O6JA 4HPQA 1V4RA 3L2VA 5E1XA 4AUXA 1WI3A 2FMLA 2A05A 3M3YJ 2JRMA 3GCMA 5DCMA 2JQ7A 2VIXA 1TNTA 4Y17A 1T56A 4EM1A 2KKOA 3VSKA 1GVJA 3WG9A 1ETQA 2EA4A 1SMTA 2FNAA 2RN7A 3ABTA 3ZR8X 1ZK8A 2JRTA 1MGTA 3BLYA 2UXXA 1B8IB 3V7RA 1JKPC 1KGSA 2JVGA 3L1PA 1PDNC 3L2CA 3QRFF 4LG3A 2BGCA 4RA2A 3OL4A 2ZNYA 4CICA 1VZ0A 1R5GA 2R0QC 4A3EJ 3CUQA 2XIGA 3VYSB 1H9TA 2E1OA 2BY1A 3OIQA 2ACJA 4WXDA 4XL9A 4X6AJ 2QQ8A 3K9TA 2DA1A 4ESJA 1U78A 2XRNA 3QPHA 2WV1A 2KIQA 4F3QA 4WK8F 3MAJA 3CC7I 2JN6A 3C18A 3IP4B 1KU7A 3J80Z 2DMUA 2E1CA 1SD4A 1Z77A 2ECBA 4A3DJ 1WFXA 1XC5A 2L9SA 3FK7A 4ZYDA 1IXSB 1ZREA 2R7SA 1SD5A 5ILVA 1NTCA 1IRGA 3ZOBA 3LSKA 1MBEA 3TOBA 2VUMJ 4IRIA 2VXZA 1FOYA 3GTKJ 2X51A 2HS5A 2KLOA 2Z2SB 2KIMA 3NARA 5EGOA 1QZZA 3HKZN 5DEQA 5DS9A 5C4XJ 3BG9A 4ASNA 1KONA 2FEZA 3PO2J 2MFZA 3GWZA 3GTGJ 3TO9A 2F4IA 2FJ1A 5IOZA 2DJNA 3M9AA 1HOMA 3J7AO 2JUGA 2OPTA 4RDUA 1K83J 4RGSA 2P7VB 1ZRCA 1XB4A 3WTUC 4OIQF 1JJ8C 1GVDA 3MKZA 1UFMA
chains in the Genus database with same CATH topology
2HPIA 1UG0A 2W4SA 3DEEA 4ZDOA 1D0YA 2K9MA 4XKVA 2VQGA 2MC4A 3W2AA 2R7XA 2IGOA 4HSRA 2LG4A 4CCNA 2Q2EB 2R7RA 1U0JA 1X4PA 2Z16A 3HPGA 4BJ5C 2BVLA 4F92B 1SAUA 2F6CA 1D1CA 2KRCA 1GLNA 4BQQA 3L2WA 1T95A 1LKXA 2LBFA 2WB1A 3CP8A 3G2BA 4DOZA 4BJTA 2HVQA 4ZDPA 3EUKL 4CA0A 4KITB 4U7BA 2MABA 4PSXA 3OYJA 5LD2C 3RQ4A 1MNEA 1QHGA 1Y56A 1J09A 3DQVC 2E60A 4BE2A 4RM3A 3N05A 4FASD 4MLOA 4PJNA 4XMYA 4F55A 4PFOA 4FETA 4ZYAA 3OYAA 2K9LA 3OYHA 4XN3A 2L9NA 3DPLC 4AU7A 4BACA 2E5ZA 5KHDA 2CV0A 2CUJA 3DPUA 1D1BA 4XONA 4CSWA 1UAAA 1BR2A 2KZVA 4BJ6C 3SZGA 2GOMA 2JA2A 4E7JA 2LY1A 1OR7C 2V26A 2R4GA 3DU6A 4F93B 4IQ4A 2M7AA 4YEJA 4BS9A 4XM3A 2HZDA 1FMVA 2DT7B 3C2GA 4NQWB 3U21A 2ZXHA 4XNFA 4B47A 3BC8A 3D5RC 1EA3A 2R7UA 3CJRB 2WAQA 2KMUA 3D5LA 3HC7A 2LH9A 1OLTA 3VDXA 3H9JA 3K70D 2W82A 3A4CA 4HG2A 3PSFA 1NG6A 3ZRGA 2PJRB 2R7OA 1QHHD 1IRXA 2CMPA 3EUHC 3OYDA 1G8XA 2Y0SA 4NUBA 3DKXA 4B44A 3L2UA 3OS1A 3BCAA 3H5NA 1X1CA 3H5RA 3EUAA 3GBGA 1MW7A 3LL7A 4XKWA 4E4HA 4E7SA 1W36D 3K70C 4KJZA 2IGNA 3IAM2 2XF7A 2M0MA 4PJJA 4E7KA 3PUBA 3W2WA 2WY7Q 2HDWA 4Y3OA 1WJFA 4BU2A 4CUGA 4EATA 3S3OA 1S9HA 1HA8A 2CV2A 2OV7A 3OYFA 4C30A 3I9V2 4R79A 3OIPA 2E1MB 1W36C 2ZSHB 4ITVA 2X6XA 2M3AA 5FRMA 2V4JC 3RTRA 5HNHA 2M7BA 2BW3B 2E5NA 3TMOA 3OYIA 1D1AA 2LOOA 1ERDA 4HEA2 1X19A 4BL0B 2BVMA 3OS2A 4JQFA 3H9QA 3K6GA 3V42A 2VJJA 2XC7A 2UWMA 3K4BA 2HQAA 2IGKA 4J00A 2KPMA 2WA0A 3HXLA 3UNGC 3K4JA 2VQLA 3K4NA 1LVKA 1NG7A 1Z3YA 3FKJA 4ZTJA 2AQFA 2ZXIA 2HVSA 2UV1A 1Z3XA 3S32A 3UR3C 3HL2A 2XSJC 4C2UA 4Y33A 4OAZA 3S3NA 2IXSA 1BOBA 2L7KA 2MD0A 3KX2A 4GRIA 4AVZA 2WY8Q 4E7IA 4B48A 3ZQQA 3C2HA 5CKTA 5JHFA 3F9KA 3MKYB 1PYVA 4N4NB 3ZCOA 3DTKA 3IUOA 3VYUB 1MMDA 2CFOA 4RLQA 2E1MC 2XDVA 2KQRA 3LFUA 1V5FA 5TGTA 3BG6A 2CUZA 4BEHB 3NWTA 3MKWB 4BE0A 3FBNB 3VYTB 4BQOA 4IKFA 1JI8A 2W00A 3RCOA 1WJDA 4CCLA 3OR2C 3OMYA 4C2TA 2BOLA 4KT6A 2FUG2 3VSLA 4E7ZA 5KCMA 1ZELA 4XORA 3DTIA 1WJBA 3TBIA 2K3PA 1DGWY 2WBMA 3DPTA 3D5SC 2CW8A 2PMZA 3PNYA 1BR4A 3MD2A 4J01A 4PJMA 4XLCA 3AKZA 3DKYA 3RPUD 4KISA 2JVHA 3E1SA 4DBRA 3H5AA 4G6TB 2PJRA 1X1BA 3QYEA 3J7AY 2VLAA 4NNJA 3QOEA 4BDZA 3A1YA 2VJ4A 3PSIA 3PL8A 3CZ6A 2OUMA 3FBIB 1MMNA 4CCOA 1T0FC 4BDYA 2DJIA 3AFHA 4HNUA 5HNFA 2QKMB 2X1CA 4NC8A 4PK4A 1PJRA 4P5OA 3M1CA 1DQUA 3HKZA 3OWTA 1UELB 2R7VA 3PJRA 3LSHA 4XOTA 3HG9A 2V7FA 3LSIA 1G59A 3FDYA 2WADA 3W3CA 5HOOA 3CESA 1YX3A 5CQEA 4OWRB 3RSNA 3CMMA 2VXDA 1X1DA 3DLAA 5KNLA 1MMAA 4II3A 4CCMA 1FMWA 2ELJA 4CZCA 2KDOA 2X6YA 3I3LA 4H4KC 2XF6A 3K10A 1BR1A 2BW3A 3K4MA 3DTEA 2IS1A 4BE1A 1TT0A 4XOPA 2F5VA 4DJAA 1V5GA 2RREA 4XN0A 3IAS2 1LFPA 2VQHA 2R7WA 3KEYA 4II2A 2Z1DA 2I8DA 3HOTA 1WJEA 4U87A 4F91B 4DGWB 2LY2A 3QODA 2OC6A 5HVQC 4ANJA 4ZJZA 3AL0B 3A2KA 3M8JA 4ZTFA 3OYCA 3OYKA 2WAFA 4ZC3A 1DGRM 1TZLA 5HLTA 2V9KA 2X85A 3K4LA 3DU5A 3MMYB 3LSMA 1LDKB 2X1DA 2A6TA 2RQQA 4LITA 3BCBA 4NC7A 4C9YA 1N75A 3OS0A 2IS6A 3HUGB 2K5CA 3QYBA 4LIUA 4N4OB 2LREA 2ZFUA 3H35A 3VWBA 3HPHA 2NOJB 1YX5A 3LSGA 4RMNA 3KYLA 4XR6A 4HSTA 4BEHA 2DXIA 2V6EA 2ZSIB 3QYFA 1MMGA 2VJIA 2Q1ZB 2IGMA 2O5RA 4XLHA 4QPOA 4B43A 2XF5A 3L2RA 3CF2A 2R7TA 2HVRA 2LYCA 2IS2A 2HPMA 1SFKA 2VKHA 3CJQB 2DOAA 4E7LA 4B3XA 4X0GA 4Y4RA 2A5WA 2GOXB 1Z7LA 3OYLA 2DCEA 2R7QA 3PNVA 3L2QA 2LBFB 4AYBA 1E0EA 3CP2A 1Z21A 3SDBA 2X6WA 4DBQA 2AQEA 5CPRB 3AL0C 4PSWA 3OYBA 2CS3A 3SYTA 3H9GA 4XLFA 1N77A 1YE9A 1Y6IA 2IS4A 4LIVA 4YELA 2L2OA 4RLFA 3OYNA 4PFPA 2HU9A 3S3MA 2VQCA 4HPQA 4XLAA 3L2VA 2W7NA 4IQJA 4BGDA 2CH0A 2XAUA 3SEZA 4P1WA 2W1OA 4QPQA 4XQFA 3K4CA 5LFAA 2VIXA 1DP3A 1AA7A 4HRIA 4BQNA 1WJCA 1N78A 3VSKA 3OOUA 4E6KG 2V1NA 4OAYA 3ZR8X 4BUPA 4CCJA 2VJ5A 3FHNA 3BLYA 2LC2A 2M4KA 2KHMA 4CH7A 3OYMA 2L5QA 3H0DA 2JVGA 1D0XA 4LG3A 4D9JA 2KRHA 3S8PA 3S93A 3OR1C 3OL4A 1X1AA 3K4KA 3E0JB 4IX7A 4JOMA 1R6RA 3PNTA 4PJLA 1VZ0A 2QKLB 3VYSB 2VL8A 3OIQA 1X4OA 2WAEA 4IZZA 4XL9A 2VKDA 3OYGA 5FRNA 2CV1A 1K6YA 2CW7A 1WJAA 3SEQA 3OYEA 2LRDA 1V5EA 4F3QA 5CQGA 1D0ZA 2KL4A 3IP4B 2M4GA 2VB6A 3EPZA 3HOSA 4HNTA 3OY9A 1MNDA 4ZDLA 2JSPA 3VYRB 1WFXA 2L9SA 2HNHA 3DWLE 2R7SA 4E7HA 4BXFA 4CCKA 3LSKA 1QU3A 3OL3A 4RM2A 3ZXSA 2UUZA 2KP6A 2VASA 3ZGKA 1P9QC 2DT6A 2VXZA 3ONQA 2X51A 2KLOA 4F52A 4XKCA 2X1EA 2Z2SB 4XLEA 3LMMA 2VPLA 3W2VA 4YRVA 1KONA 5FROA 2P0WA 2MFZA 2MYSA 2F4IA 4D1QA 3BG7A 2JUGA 4PUSA 3TL4X 2RNGA 4XKBA 4DIQA 3PFYA 3NWSA 3MKZA 1WJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSI B;  2ZSH B; 
#chains in the Genus database with same CATH topology
 4L5E A;  2G0E A;  1D0Y A;  3I4P A;  1HW2 A;  1ZGJ A;  5IP6 A;  5L3F A;  2R7X A;  4ZYH A;  3PIP F;  3FX3 A;  2IGO A;  1HDP A;  3F22 A;  1W7P D;  2MH9 A;  4PJ0 C;  4MTD A;  3J81 Z;  2EFN A;  2EFW A;  1R1U A;  2AHQ A;  3I56 I;  1J59 A;  2XUB A;  2QF7 A;  2VBX A;  4MEY F;  1LKX A;  1VQK I;  1HXD A;  3G2B A;  5EJC A;  4BJT A;  5E17 F;  5DD8 A;  1TT5 B;  2LR8 A;  1ZLJ A;  4YFX F;  3EUK L;  3ISP A;  5FJ8 J;  5D5W B;  1X58 A;  5BS6 A;  4HF2 A;  2QWW A;  2PEX A;  4AIK A;  5LD2 C;  2K40 A;  3O8H A;  3RQ4 A;  1Y56 A;  3WE2 A;  2RQP A;  4W97 A;  1XSD A;  2H8R A;  4BE2 A;  3N05 A;  4EM0 B;  2IT0 A;  2QCO A;  4F55 A;  3OOP A;  1Z6T A;  3RKW A;  1R5H A;  4ZZD A;  1E3H A;  1JGG A;  1O4X A;  1TW2 A;  1WQ2 A;  3R61 A;  3V8J A;  2IAI A;  3OYH A;  2L9N A;  3ZQG A;  1VND A;  4AU7 A;  2F5E A;  1B6A A;  5KHD A;  1NK3 P;  2PG4 A;  4KN7 X;  1UAA A;  3TP0 A;  3SZG A;  3TW6 A;  2JA2 A;  2LF8 A;  1B8I A;  2EFO A;  1TNS A;  4M3E A;  3AG2 H;  4A0Y A;  2DA5 A;  2Y0M A;  4E7J A;  1QO0 D;  1HQC A;  1K78 B;  3M4O J;  2YSR A;  4IHS A;  2OD5 A;  4F93 B;  1R49 A;  4I09 A;  2O7O A;  2W48 A;  2M7A A;  3UKG A;  3GVA A;  3Q0V A;  4XM3 A;  4GO1 A;  4LK0 F;  2M45 A;  3WTX C;  3AG3 H;  3CCL I;  3CCM I;  3D5R C;  2YU3 A;  5ICE A;  2WAQ A;  2CO5 A;  3B73 A;  3LSJ A;  1FBS A;  3H9J A;  4XIC A;  4IHT A;  3A4C A;  3PSF A;  4YIF A;  5KAF C;  1UMQ A;  5EF6 A;  3QOP A;  2R7O A;  2VC0 A;  1IRX A;  3I59 B;  2KDZ A;  4ON0 A;  1G8X A;  2F5C A;  4PCQ A;  1WI9 A;  2X6O A;  3AG4 H;  1K79 A;  1JT6 A;  2GA1 A;  3HHG A;  3MCZ A;  3DEW A;  4B44 A;  3OS1 A;  1VQP I;  1X1C A;  3ASN H;  5D6E A;  4XKW A;  4E4H A;  4KJZ A;  2EIN H;  4XID A;  2XF7 A;  4BBS J;  5CYV A;  5IYB J;  3CLQ A;  4Y3O A;  1VQ7 I;  4R8H A;  3E5U A;  3KPH A;  4EAT A;  3ZQL A;  1S9H A;  2VBZ A;  2CV2 A;  4CXF A;  3I9V 2;  1BC7 C;  3OSG A;  2GWR A;  5CVJ A;  1KQ9 A;  2OAZ A;  1X2N A;  1T39 A;  2O03 A;  5J1U A;  2P5V A;  2X6X A;  2M3A A;  5BPD A;  2QYO A;  2BEO A;  2BW3 B;  2KZG A;  2UXN A;  3FXL A;  2O8K A;  3TMO A;  3B02 A;  4DW6 A;  3PUF A;  3WU2 C;  2VOP A;  1H8A C;  4MFD A;  1B4A A;  1X19 A;  2ME6 A;  2DA2 A;  4JQF A;  1G3Y A;  5DUI A;  2F5D A;  2B7E A;  3H9Q A;  2LVS A;  2XGX A;  2XPW A;  4MNU A;  4ETS A;  1ZG1 A;  4BHP A;  3K69 A;  3FXJ A;  2IGK A;  2R3S A;  3ZQI A;  2WA0 A;  3DP7 A;  3UNG C;  3K4J A;  2GXG A;  4WXH A;  3FXU A;  4IPA A;  1NG7 A;  2AQF A;  1MIJ A;  2W85 A;  1Z3X A;  3K0L A;  2WWY A;  2R93 J;  1WGX A;  1SMY F;  2XSJ C;  2QQB A;  2IEK A;  3HM5 A;  3DKW A;  1BOB A;  2MD0 A;  4FE7 A;  4B48 A;  1QPM A;  3H0G J;  3WOD F;  1A04 A;  3F9K A;  5JLX A;  3MKY B;  4HW0 A;  5D5U B;  2M34 A;  2EZH A;  3FZV A;  2YS9 A;  4X1E A;  4LG0 B;  3FXO A;  2CFO A;  2X48 A;  1TQP A;  5TGT A;  4DZJ A;  5ILS A;  1FOW A;  3MKW B;  4V2F A;  2F2E A;  3F8F A;  1JI8 A;  1YO5 C;  1PP7 U;  1H9G A;  1WJD A;  2VT3 A;  2ID6 A;  2Z99 A;  1K78 A;  3H92 A;  1B59 A;  2CQQ A;  2ZJQ F;  2L01 A;  5LRR A;  1Z05 A;  3DFG A;  3HOX J;  1RET A;  4XOR A;  2HWV A;  3D5S C;  2NNY A;  5L3B A;  1IXC A;  3F8M A;  1IN6 A;  2A69 F;  3E1S A;  4DBR A;  1QZE A;  2GLO A;  3H5A A;  4NHJ A;  3E97 A;  1DUX C;  3QYE A;  4A3C J;  3I59 A;  3CDH A;  3QOE A;  4BDZ A;  3WTY C;  3LAJ A;  3CZ6 A;  2DJI A;  2JMW A;  4HNU A;  1G3S A;  1DQU A;  3LA3 A;  5FLX Z;  3HKZ A;  4V2G A;  4YIR X;  3KZI C;  2NYX A;  3N4M A;  1PUE E;  1U5T C;  1KQ0 A;  3PJR A;  1FOX A;  3LSH A;  2ZJ2 A;  4D5C A;  4XOT A;  3HG9 A;  1G59 A;  3LSI A;  2WAD A;  5HOO A;  3IC7 A;  3W6V A;  1P4W A;  1OYI A;  5CQE A;  4OWR B;  4Z2Y A;  1D5Y A;  4ESB A;  2VXD A;  1X1D A;  2EIJ H;  1A31 A;  2VOD A;  4CCM A;  2DMT A;  4WF2 A;  5BMZ A;  2KDO A;  3LFK A;  3ULQ B;  4UNO A;  2EFQ A;  2XF6 A;  1OQY A;  2FD5 A;  2VKV A;  4Y52 J;  2BW3 A;  3E7L A;  3DTE A;  2FNP A;  3E6D A;  2DN0 A;  4BE1 A;  4UUS B;  1KYZ A;  1MJA A;  2A07 F;  4A5M A;  4K2E A;  3IAS 2;  1LFP A;  3CCQ I;  3E3V A;  2VQH A;  4BKX A;  3L9F A;  2DFI A;  2R7W A;  3KEY A;  3HOT A;  2I8D A;  1WJE A;  4F91 B;  1MH4 A;  2L7F P;  5HVQ C;  3GTQ J;  3E6B A;  4ZTF A;  3KEO A;  4UHT A;  3OYK A;  1DGR M;  2E36 A;  5LBQ A;  2X85 A;  3S1N J;  5JHU A;  3P5J A;  1D3Y A;  3ZN1 A;  3LSM A;  4XRF A;  2K86 A;  3V8L A;  2W25 A;  3KP6 A;  1ETX A;  1IGN A;  4L5I A;  1MJ9 A;  1Z1D A;  2L7Z A;  4NC6 A;  3FKI J;  2A6T A;  4GGG A;  2RQQ A;  1IN8 A;  4LG0 A;  3F3X A;  3I64 A;  2ZJP F;  2CW0 F;  1H0M A;  2BHZ A;  2E1N A;  2IS6 A;  3QYB A;  4LIU A;  1W5S A;  2LRE A;  3BR5 A;  2K7L A;  3HPH A;  1YX5 A;  3KYL A;  2DXI A;  2VE8 A;  4M3G A;  2I5U A;  3WGG A;  3QYF A;  4KIG A;  1MMG A;  1GXP A;  4UUT A;  4U0Y A;  1IZ1 A;  1U9O A;  4AVP A;  3T0Y A;  4BY1 J;  1P7J A;  1ZN2 A;  1F9N A;  5D5V B;  2XAG A;  1S3J A;  5JVT A;  4G12 A;  1YLF A;  2LYC A;  1NH3 A;  3OSF A;  5H6Q A;  2HPM A;  1SFK A;  3CJQ B;  3GZ6 A;  4E7L A;  3U1D A;  4B3X A;  4X0G A;  2A68 F;  1G2H A;  2QBY B;  3JRD A;  2DLL A;  2RDP A;  3BY6 A;  4UV9 A;  1WH5 A;  3OYL A;  5ILU A;  2TRT A;  4IRH A;  1E0E A;  1HKS A;  2K3F A;  3CP2 A;  2DFH A;  5FFX A;  5TRD A;  2X6W A;  1ZRD A;  2AQE A;  5CPR B;  5J8F A;  5J8C A;  3R6S A;  1YYV A;  2JK3 A;  1N77 A;  4I2O A;  1YE9 A;  4EJT A;  3ROU A;  1Y6I A;  1ULY A;  2IS4 A;  5FD5 A;  4LIV A;  4YEL A;  5HS8 A;  2L2O A;  3DXJ F;  4RLF A;  5JVG F;  1IAW A;  4PFP A;  2HU9 A;  3S3M A;  1DU6 A;  3CCV I;  2W7N A;  4XRM A;  2BY3 A;  3ECO A;  2EZL A;  2K4J A;  2KIF A;  2E71 A;  1IN5 A;  3SEZ A;  1RUN A;  2B9S A;  3FWE A;  1FIA A;  1HLV A;  4QPQ A;  1HKT A;  5FB2 A;  1DP3 A;  1AA7 A;  1RPW A;  3RPQ A;  4HRI A;  1WJC A;  4B1R A;  1N78 A;  1XDS A;  2HFH A;  3REO A;  4AIH A;  2VON A;  4LGW A;  4C2M J;  4E6K G;  4FTH A;  2E7W A;  4DYR A;  1FP2 A;  1YW9 A;  1IF1 A;  4OMY A;  3BPX A;  5LGT A;  4N0B A;  3OYM A;  4KN4 X;  1SD6 A;  3HB9 A;  1D0X A;  3KEQ A;  2KRH A;  3S8P A;  3S93 A;  1X1P A;  2OTL I;  1X1A A;  1ZTR A;  3HSR A;  4PJL A;  1ITY A;  4IHY A;  1W4M A;  1WSU A;  5A2Q K;  1X4O A;  2HQR A;  2R7F A;  1JHF A;  4IZZ A;  4BHC A;  2HOT A;  3B6A A;  4MHG A;  4UUS A;  3SEQ A;  3OYE A;  3A01 B;  3HSF A;  1V5E A;  1VQ6 I;  2ICW G;  1Z0X A;  3ABL H;  3HOS A;  4CYD A;  3ZMD A;  1MND A;  5DM7 F;  2XAH A;  5AON A;  1UZC A;  3DWL E;  4E7H A;  2CFX A;  3GFI A;  2XVC A;  4BXF A;  4CCK A;  4M9Z A;  1POG A;  1QRY A;  3F8B A;  1CGP A;  4RM2 A;  1NK2 P;  1SFE A;  2KP6 A;  2VAS A;  3ZGK A;  5TJJ A;  2JJ7 A;  2DT6 A;  2ZCW A;  2PLY A;  2DA4 A;  2ZC2 A;  4XKC A;  5E8G A;  4EJW A;  5F64 A;  3W2V A;  4YRV A;  5GTH C;  1IRZ A;  2DMN A;  2P0W A;  1FT9 A;  3DBH B;  5FFZ A;  3CME I;  2XSD C;  2MYS A;  2A61 A;  2LLK A;  5CVI A;  3WTS C;  1UST A;  1JT0 A;  4M9X A;  3ZQH A;  2DFE A;  3TL4 X;  3K7A J;  3F21 A;  4Q5S F;  3C3W A;  3G71 I;  1FC3 A;  1R23 A;  3NWS A;  2PMU A;  1KYW A;  5LLQ A;  2HR3 A;  1WJ5 A;  1ON2 A;  4DNC A;  2W4S A;  3DEE A;  3FM5 A;  4IXA A;  2E19 A;  3L09 A;  3FM3 A;  3ABK H;  3PFI A;  3KIO A;  3RJP A;  2TDX A;  3X2Q H;  1VQN I;  4HSR A;  1UHM A;  5IP7 J;  2UZK A;  2R7R A;  1O3R A;  2Z16 A;  3HPG A;  2RVC A;  3WU0 A;  4BY7 J;  5E8I A;  1XTA A;  3BQY A;  3WTV C;  4F92 B;  4HNV A;  2BXZ A;  4BQQ A;  2L54 A;  2QBY A;  4D7N A;  1H89 C;  1D8K A;  3ERE D;  1YJN I;  3CD6 I;  2PMH A;  2V1X A;  4PDK A;  3GTJ J;  2EFP A;  4ZDP A;  4G6Q A;  1SVM A;  3SZT A;  4JP0 A;  4PGG A;  2BE5 F;  1UG2 A;  3I58 A;  3TP3 A;  2BXY A;  3BG5 A;  3DQV C;  1N25 A;  2QEX I;  2EV5 A;  1BL0 A;  2YR2 A;  4FX4 A;  3KE2 A;  3SQN A;  3ZMV A;  2Z9O A;  4FAS D;  2ELK A;  4KFC A;  4LJZ F;  2AXL A;  1D5V A;  2F4M B;  3VOE A;  3S2D J;  3CMA I;  3OYA A;  2MC3 A;  2J5O A;  1XMX A;  3JAM Z;  2RAE A;  3DPL C;  2ZME B;  4BAC A;  5DD4 A;  3JRI A;  5IP9 J;  3SFI A;  2DBB A;  3SZP A;  1D1B A;  4EQQ A;  4XON A;  4HX8 A;  2KZV A;  1JKO C;  1RR7 A;  2W24 A;  1DPU A;  2GOM A;  1OMI A;  5HS7 A;  3BR6 A;  2LY1 A;  2Y30 A;  2DTR A;  2RKH A;  1OR7 C;  2NVQ J;  2V26 A;  5GTI C;  4IF4 A;  2FA5 A;  1ZGA A;  3DU6 A;  3BR2 A;  4L9J A;  2D1V A;  4OIO F;  3HOY J;  4YEJ A;  4C3J J;  2H6C A;  4L18 B;  2V79 A;  4C3H J;  1I27 A;  2QQA A;  5GAH J;  2HZD A;  5L3D A;  2Y9Y A;  3C2G A;  4IOC F;  2ZXH A;  4B47 A;  3LA7 A;  2CGP A;  3WE3 A;  1RR8 C;  2QA4 I;  2LY9 A;  1IRF A;  3GZ5 A;  3QWL A;  1IDZ A;  3MKL A;  2RV8 A;  3VDX A;  4XSZ F;  1F43 A;  3A01 A;  2DPU A;  4LFU A;  5K5Q A;  1Y1W J;  1TWA J;  3S16 J;  2FSW A;  3ZRG A;  3KZZ A;  4IO9 F;  3J7Y J;  1S7O A;  1ON1 A;  3TKY A;  1MSE C;  1IJW C;  3OYD A;  3CCY A;  3DKX A;  3KYD B;  1E17 A;  2ZNZ A;  4FHT A;  4IHW A;  3H5N A;  3H5R A;  1RIO H;  3GBG A;  4E7S A;  2ZME C;  5J1R A;  1RI7 A;  2HOE A;  2WY7 Q;  4B3A A;  1WJF A;  2FOW A;  1BA5 A;  1KQ8 A;  3OYF A;  2NS0 A;  3JRG A;  3JCU C;  1XG1 A;  2HKX A;  3HRS A;  4I0A A;  1MMS A;  2MD5 A;  1K7A A;  3OIP A;  3JRE A;  4YFN F;  2EA2 A;  4HV5 A;  4DYC A;  1TWF J;  3DV8 A;  4I99 C;  6PAX A;  1YI2 I;  2RC4 A;  2XGE A;  3M1E A;  4BNC A;  2V4J C;  4GXO A;  3RTR A;  5HNH A;  1ACI A;  1BI0 A;  3MZ8 A;  2M7B A;  3J80 K;  3R60 A;  4HLX A;  1OR7 A;  1SFO J;  1DP7 P;  1FYL A;  1GXQ A;  2LOO A;  3CC2 I;  1ETK A;  1DU0 A;  3WHC A;  1TP4 A;  2OZ6 A;  3OS2 A;  2Y0S N;  3DEU A;  2JTV A;  3BDD A;  2MG4 A;  1Z67 A;  3K6G A;  5HDK A;  2VJJ A;  5IOY A;  3C2B A;  2F48 A;  3ZMS A;  1IN4 A;  3ZN0 A;  4B4C A;  4J00 A;  2VBW A;  3HXL A;  3TO6 A;  2VQL A;  3K4N A;  2G9W A;  4ZTJ A;  1FWZ A;  3FKJ A;  3SHF A;  2VOO A;  2ZXI A;  2HVS A;  2UV1 A;  3D0S A;  2E7X A;  1WHU A;  1FJL A;  4OAZ A;  3IHU A;  3F6V A;  4ENJ A;  3KX2 A;  4GRI A;  4M3B A;  1LE8 B;  2WY8 Q;  4E7I A;  2QLZ A;  2EQR A;  2H6B A;  1BOA A;  3ZQQ A;  5CKT A;  1SAX A;  3JSO A;  5FD6 A;  4RB3 C;  4EGZ A;  2Z3Y A;  3RIR A;  4PZJ A;  1MMD A;  4RLQ A;  3GFM A;  2M8G X;  2XDV A;  1MSF C;  3BRO A;  4HF1 A;  3KLO A;  5F0F A;  2DW4 A;  2ZME A;  3BG6 A;  2CUZ A;  3C1D A;  5JI6 A;  4BEH B;  1B9N A;  4BE0 A;  3FBN B;  3VYT B;  4BQO A;  1S5L C;  4A3G J;  4NDL A;  5E3L A;  2P6T A;  5B3S H;  2KJB A;  4UB6 C;  3JRF A;  3OR2 C;  2LKS A;  3BR3 A;  1YIJ I;  3HIF A;  2L3D A;  3OV8 A;  2ETH A;  1APL C;  1MBF A;  3LWF A;  1ZEL A;  5LGN A;  1XN7 A;  3DTI A;  2E2I J;  2ISY A;  2K3P A;  3CJT B;  1BM9 A;  1XDU A;  2LP0 A;  3PNY A;  2WB1 N;  1R4M B;  1T33 A;  1FIP A;  3DKY A;  3E6C C;  3ZQC A;  2JVH A;  4FIS A;  5GPC A;  3BR0 A;  1LPQ A;  1QA6 A;  3IRR A;  1ZHF A;  2X0L A;  3J7A Y;  3VPR A;  3DBR B;  5D6F A;  1TL8 A;  1VTN C;  1BW6 A;  2FF4 A;  2OCE A;  1OKR A;  1FEX A;  1QQI A;  5H6R A;  2QKM B;  5EG0 B;  4PK4 A;  4P5O A;  3CCR I;  1SD7 A;  4LLG F;  4EGY A;  5CVU A;  2BV6 A;  1KZH A;  1S7A A;  4I76 A;  1XS9 A;  3DF8 A;  1LJ9 A;  1UEL B;  4L9T A;  1HW5 A;  4QSH A;  1KA8 A;  5F27 A;  5M5W J;  4FT8 A;  4HZF A;  1FZP B;  3H36 A;  2IVM A;  2OU2 A;  2VE9 A;  1XMK A;  5EZH A;  4UV8 A;  1ZKG A;  1FBU A;  1T6S A;  3GTM J;  1Z91 A;  1T38 A;  3JRC A;  3W3C A;  2IBD A;  3C7J A;  1YX3 A;  1S8N A;  3JW4 A;  5HLI A;  1YIT I;  4L9V A;  3CMM A;  4B8X A;  1MBJ A;  4KA4 A;  2G7H A;  2O0Y A;  4MEX F;  4W1U A;  3FMQ A;  1MMA A;  3IKV A;  4II3 A;  3M7G A;  2EK5 A;  1XCB A;  1FMW A;  2DTZ A;  3U1K A;  4HDU A;  5GAD J;  5ICF A;  2XRO A;  2YU9 J;  2X6Y A;  3EDP A;  3I3L A;  4H4K C;  3K10 A;  4OOI A;  3KP4 A;  1A6Q A;  3VOD A;  4DJA A;  2NVT J;  1IUY A;  1V5G A;  3SXY A;  4A93 J;  1FSE A;  3JRA A;  2ESH A;  2ID3 A;  1F1Z A;  1X2M A;  1W7P B;  2HI3 A;  3FXR A;  1FTT A;  4RB2 C;  5M3F J;  4D7M A;  2R7D A;  5IT9 Z;  4II2 A;  4RAF A;  3GFJ A;  1JE8 A;  1QVU A;  2EB7 A;  4HAM A;  4A6D A;  4WCG A;  1EKE A;  1WRJ A;  2P8T A;  4KIC A;  2JA7 J;  2QZ8 A;  2DK8 A;  4XSX F;  3PQK A;  3S1R J;  1E2X A;  2WAF A;  3BT9 A;  2DOF A;  1QBJ A;  4LLL A;  4FX0 A;  3IWZ A;  3HOV J;  3ESW B;  5C3E J;  2GIZ A;  1LE8 A;  3S1M J;  1SFX A;  2F4O B;  3VFZ A;  4A3I J;  1STZ A;  1TLH B;  1Y0N A;  2PJP A;  3BTL A;  4Y7N J;  4LIT A;  4Y13 A;  3CCJ I;  3BCB A;  1IW7 F;  5J6X A;  1YOV B;  3BZC A;  3BJA A;  3ZPL A;  4OIN F;  2K5C A;  1BJA A;  5B1B H;  4F7Z A;  2JUC A;  2JPB A;  3RPU A;  3H35 A;  3VWB A;  5LHI A;  1P4X A;  3LSG A;  5BNG A;  1S29 A;  3Q0U A;  4BEH A;  1RUO A;  1I6H J;  2VJI A;  2Q8K A;  2STW A;  2Q1Z B;  3HOU J;  2IGM A;  2O5R A;  4HOB A;  4XLH A;  2XKP A;  3S14 J;  2HOA A;  3T8R A;  1TWH J;  2QEN A;  1SFU A;  2R7T A;  3R0A A;  2IS2 A;  1U5T B;  4KMF A;  5DYM A;  5FKK A;  2D5V A;  1HSJ A;  2PI0 A;  2A5W A;  2GOX B;  1Z7L A;  5AIP A;  2AS5 F;  2DCE A;  5F1R A;  3PNV A;  3L2Q A;  1I39 A;  2LBF B;  2P5K A;  2M1B A;  2H1L A;  1FOK A;  4PSW A;  1Y8Q B;  4ESF A;  1YIO A;  3SYT A;  3H9G A;  3V7S A;  4XLF A;  1AHD P;  3MQ0 A;  5E3M A;  1USS A;  2FE3 A;  2Y48 A;  5DCF A;  4AD9 A;  4M71 A;  2PBI A;  2PX9 A;  2XB5 A;  1BIA A;  5HS9 A;  2GQQ A;  1K61 A;  2NNN A;  2HYG D;  3WGH A;  1OCT C;  1WPK A;  5LRS A;  3Q5F A;  4IQJ A;  2XAF A;  4P96 A;  2RNJ A;  3LQQ A;  2W1O A;  2X4H A;  2ESN A;  2JZY A;  2QSF X;  1YG2 A;  4FE4 A;  3S2W A;  1GDT A;  3K4C A;  2G7U A;  3U2R A;  5LFA A;  5EG0 A;  1G3T A;  4M3D A;  3VB2 A;  4GDF A;  3BPV A;  5FKM A;  1W5C C;  5C4J J;  5FO5 A;  3BJO A;  4BUP A;  3DBL B;  4CCJ A;  2VJ5 A;  1V54 H;  4XRS A;  2GXB A;  2LC2 A;  2KHM A;  4C3I J;  2L5Q A;  3G1M A;  5K7H A;  2E2H J;  3RKQ A;  3HOZ J;  2COM A;  1X3Z B;  2LFB A;  1O3S A;  3IV5 A;  1HF0 A;  3TGN A;  2NOG A;  2VN2 A;  1R6R A;  1HBX G;  5E1Z B;  5D8K B;  2H94 A;  1TWC J;  3I53 A;  4XLP F;  3EYY A;  2VL8 A;  4E70 A;  2WAE A;  5CLS A;  5HDG A;  2HYJ A;  3K2A A;  2PQ8 A;  2CV1 A;  1JTX A;  1K6Y A;  2CU7 A;  5DUK A;  4MO7 A;  5M5X J;  2PMZ N;  1O3Q A;  5KK1 A;  2L0K A;  2FMY A;  1D0Z A;  2KL4 A;  2VB6 A;  3EPZ A;  1W7P A;  2CJJ A;  5F6F A;  4ZDL A;  1Y8R B;  3VYR B;  2MW8 A;  3ZMT A;  1JTY A;  5FLX K;  2D2W A;  2DQL A;  1XGN A;  2HNH A;  4HX4 A;  2O9L A;  1A35 A;  2FQ3 A;  3V7C A;  5L3E A;  3HYI A;  5DM6 F;  2P81 A;  1QU3 A;  3H1C A;  9ANT A;  3ZXS A;  4UY8 I;  2EZI A;  1P9Q C;  3ONQ A;  2CSO A;  2DAO A;  4HQE A;  2X1E A;  4U88 A;  4OMZ A;  2ZBK A;  3GW2 A;  1WH7 A;  3W6K B;  2WTE A;  2MLK A;  3H3V K;  5LEK A;  2P7C B;  5J40 A;  1LEA A;  1XD7 A;  5HDN A;  1QGP A;  4WWC A;  4KDP A;  1TQI A;  3RQI A;  2LKX A;  2RNG A;  3PO3 J;  2XKO A;  5ICC A;  1FSH A;  4DIQ A;  3PFY A;  1J2X A;  3SJM A;  2XAS A;  2VI6 A;  1G3W A;  2K9N A;  1ZAR A;  3CLO A;  2HPI A;  1UG0 A;  1HST A;  2F5F A;  2H8W A;  2K9M A;  4XKV A;  2IP2 A;  2MC4 A;  3W2A A;  5CVR A;  3AAF A;  2AO9 A;  1XPX A;  2LG4 A;  1X4P A;  2V9P A;  4M73 A;  3LAP A;  2BVL A;  1MBH A;  4RAZ A;  1U5T A;  3ZP5 A;  1UB9 A;  2QSG X;  2NRA C;  5ICG A;  4G7Z F;  4IEJ A;  4NBQ A;  3L2W A;  1T95 A;  1XX5 A;  1IN7 A;  1V55 H;  2LBF A;  2WB1 A;  5FKO A;  3WU1 B;  3KP5 A;  3F6O A;  1R00 A;  4RAG A;  4DQ2 A;  1Z6R A;  3P7N A;  4KIT B;  1I1G A;  2MAB A;  3NRV A;  3OYJ A;  3IH4 A;  3KET A;  4M9S A;  1MNE A;  3MFK A;  1QHG A;  1J09 A;  2HXI A;  1GUU A;  2E60 A;  5F08 A;  4RM3 A;  3BWG A;  4MLO A;  1S6L A;  5BOX A;  1MKM A;  1ZYR F;  4PFO A;  2L02 A;  4EMS A;  3S1Q J;  1L3L A;  4FET A;  1BI3 A;  2O3F A;  4ZYA A;  3NQO A;  2K9L A;  1S72 I;  2DOD A;  2HDD A;  3GO5 A;  4XN3 A;  5JLW A;  2IW5 A;  4L0Y B;  4AID A;  1ORK A;  3CCU I;  3N97 A;  2CV0 A;  1YRN B;  5IYD J;  3DPU A;  4M6X A;  2L9R A;  4CSW A;  2H27 A;  1BR2 A;  1UHW A;  3O6B B;  4BJ6 C;  3CCS I;  3ZQF A;  3L7W A;  1IG7 A;  1YQA A;  2OQR A;  2O6G E;  2ZXJ A;  1HC8 A;  4ZYE A;  4IQ4 A;  2JSC A;  2DMP A;  4L0Z B;  5IYC J;  1U6G A;  3M8F A;  1FMV A;  3K1N A;  4NQW B;  1AWC A;  4ABZ A;  1JUP A;  4XNF A;  3TW7 A;  1EA3 A;  2XB0 X;  2R7U A;  1B1B A;  1R1T A;  1MJB A;  3CJR B;  3HRM A;  5K7Z A;  2KMU A;  2P6S A;  3HRU A;  4U0V A;  3HC7 A;  3TED A;  1I50 J;  1OLT A;  3MZY A;  2B63 J;  2K9Q A;  5F04 A;  4G7H F;  4GFB A;  2ZKZ A;  2M2E A;  3HZJ A;  1VFC A;  4MQ9 F;  4AIJ A;  4RB1 A;  2R92 J;  2OBP A;  3ABM H;  1QHH D;  2HDC A;  3H3Z A;  4QTR A;  3CCE I;  5LHG A;  4R1H A;  4CYC B;  5E18 F;  2EV6 A;  4NUB A;  4CO8 A;  3HBL A;  3L2U A;  4M6Y A;  2EBI A;  1ZLK A;  3K70 C;  1SAN A;  2IGN A;  3IAM 2;  4HF0 A;  4PJJ A;  2M0M A;  3O2P E;  1ZG3 A;  4UXN A;  3H3U A;  1ETW A;  5D5X B;  4JX4 A;  2DU9 A;  4P9U A;  1HKQ A;  5JR3 A;  2QUF A;  2IA2 A;  3LNQ A;  3I71 A;  4XRS G;  3F0C A;  4C30 A;  4R79 A;  1W0U A;  3HOW J;  5H2F C;  3NAU A;  2ZO4 A;  1TC3 C;  2CQK A;  5HLG A;  1W36 C;  2A6H F;  2GM4 A;  3QQA A;  2C6Y A;  4ITV A;  4ZZL A;  2LDU A;  2K9S A;  3QPS A;  2A3S A;  2M30 A;  3FXQ A;  2E35 A;  2E5N A;  3OYI A;  4I01 A;  2HQN A;  2HTJ A;  1D1A A;  1BBY A;  2H09 A;  5DV5 A;  5ED4 A;  2YX7 A;  4BL0 B;  1LNW A;  2BVM A;  3GLL A;  3FMR A;  4XBF A;  3V42 A;  5KAI C;  1ZR4 A;  2UWM A;  1O3T A;  1JJ6 C;  2V6C A;  2K02 A;  2KIS A;  2QSH X;  4MGR A;  5J47 A;  1LVK A;  1Z3Y A;  3GZN B;  5EDN A;  2DFF A;  3S32 A;  3HL2 A;  4LK1 F;  2LSO A;  3A03 A;  1XGM A;  4C2U A;  1TWG J;  3BTJ A;  3S3N A;  2IXS A;  3BQZ A;  2OTJ I;  4LMY A;  2ZJR F;  4AM3 A;  3C2H A;  1A5J A;  1IC8 A;  2IA1 A;  1I5Z A;  1PYV A;  4A69 C;  2W84 A;  3MN2 A;  4N4N B;  2OQG A;  1M1E B;  4YG2 F;  3G73 A;  2LK2 A;  3IUO A;  2V1D A;  3VYU B;  1U8B A;  1WZ2 A;  4LOC A;  2KQR A;  2FX0 A;  3FHZ A;  1OPC A;  1RKT A;  5D8L B;  1V5F A;  2KFD A;  4LLN A;  2K85 A;  1JKQ C;  1YRN A;  1LUJ B;  4HQM A;  1VI0 A;  4HX7 A;  4IKF A;  1ZAO A;  5E20 A;  4CCL A;  1OCC H;  2COB A;  2BHY A;  3RYP A;  1A6I A;  4G8X A;  3COA C;  1J0R A;  5LHH A;  3VSL A;  2DMQ A;  3MVP A;  5KCM A;  1J9I A;  4RAY A;  1S7E A;  2DI3 A;  1LVA A;  4NQW A;  3TBI A;  3TQN A;  2ZFW A;  1DGW Y;  3Q9S A;  3HDD A;  2WBM A;  2LKP A;  5D4R A;  1HW1 A;  4YFK F;  5IT3 A;  2PMZ A;  3HRT A;  4Q47 A;  1QZY A;  2EZK A;  1BR4 A;  5HOD A;  4XLC A;  3AKZ A;  4A6E A;  1O7L A;  3RPU D;  4KIS A;  1SC7 A;  4G6T B;  1QNT A;  4P9F A;  3OIO A;  4JYK A;  4CDG A;  2VLA A;  1K6O A;  1YTY A;  3VEP A;  3JAM K;  4EV0 A;  4CYC A;  2VJ4 A;  1REP C;  1TQM A;  2CYY A;  2ISZ A;  4KNY A;  3WG7 H;  3FBI B;  2OUM A;  2A5Y B;  1MMN A;  1T0F C;  4BDY A;  3CDI A;  3AFH A;  4A5N A;  5HNF A;  4JBA A;  4NC8 A;  3ABU A;  4M3F A;  3IL2 A;  3CJN A;  3M1C A;  4GYG A;  1OCR H;  3A02 A;  3OWT A;  1I6X A;  1F4K A;  2R7V A;  4XLN F;  2N8G A;  4S05 A;  1JGS A;  2PFB A;  2WC2 A;  3FIW A;  3V4G A;  3AG1 H;  1YJ9 I;  1B72 B;  3MZH A;  2V7F A;  1T8I A;  3FDY A;  3FXM A;  1Y1V J;  3CES A;  4M74 A;  3TO7 A;  3JTG A;  1IO2 A;  2DO7 A;  2CQX A;  3GEZ A;  3NEU A;  5KVR A;  5LEJ A;  2OF7 A;  3QP6 A;  5KNL A;  4BYY A;  4S04 A;  2VT2 A;  2ELJ A;  5E3O A;  2PN6 A;  4Z6Y A;  4UB8 C;  1G6N A;  1OCP A;  2CWE A;  1RNL A;  1TT0 A;  2GZW A;  4XOP A;  1ONV A;  2RRE A;  4XN0 A;  1V3F A;  1VQO I;  5F0H A;  3RDI A;  3M07 A;  1D8J A;  1RC9 A;  3P9C A;  1FYM A;  1AKH B;  2IA0 A;  4MTE A;  2OC6 A;  4G9Y A;  2KT0 A;  2IJL A;  4ANJ A;  1IV8 A;  1SVL A;  4CHU A;  3M8J A;  3JTH A;  2FU4 A;  5D4S A;  4Q48 A;  3ZMZ A;  1JUM A;  2J5P A;  5J4Y A;  5LGU A;  1YJW I;  4LD5 A;  3F72 A;  3DU5 A;  1R22 A;  1ENH A;  3HSE A;  2R5Y B;  4DYQ A;  1J75 A;  1R7J A;  1EJ9 A;  2NVY J;  2X1D A;  2HOS A;  1R4N B;  1T0F A;  1U3E M;  3LST A;  1O7F A;  5M5Y J;  4C9Y A;  1N75 A;  1HCR A;  5EEH A;  3HUG B;  2EIK H;  1UCR A;  1IUF A;  2ZFU A;  3LSR A;  4RMN A;  1Z9C A;  4XR6 A;  2R5Z B;  2LTP A;  3IH2 A;  3ERM A;  3PQJ A;  3E5X A;  4HLY A;  3QPL A;  1BI1 A;  3CO6 C;  5EYR A;  2EPF A;  5FKL A;  4B43 A;  3L2R A;  3CF2 A;  1JHH A;  2GBY A;  2VPR A;  3KZY A;  3Q0W A;  4KMU X;  3J81 K;  4IHX A;  4IJA A;  2VKH A;  4A2U A;  2LMD A;  4QIW N;  1ZR2 A;  3R4K A;  3GUD A;  4Y4R A;  5ERI A;  4P55 A;  3ZMU A;  1BW5 A;  4EEF G;  1Z21 A;  2Y75 A;  3HTU A;  2OZU A;  3P9K A;  4DBQ A;  2R7Z J;  1KU2 A;  3KLN A;  3OYB A;  4JK1 X;  1TBX A;  2XHK A;  2XRL A;  3KFW X;  3TOA A;  4A3L J;  4O3M A;  1R58 A;  3LQR A;  4L5J A;  2VQC A;  4XLA A;  4A0X A;  4BGD A;  3CC4 I;  1BJZ A;  2GIV A;  2O8X A;  2CH0 A;  2XAU A;  5BQT A;  4P1W A;  2EV0 A;  1VQ8 I;  1FNN A;  4M6V A;  4A12 A;  4D0P A;  1EV7 A;  1H88 C;  4XQF A;  4IL6 C;  1VF9 A;  3QP5 A;  4BQN A;  3I4N J;  3OOU A;  3QU3 A;  3S17 J;  4A0Z A;  3LOC A;  2V1N A;  1TTY A;  4OAY A;  4UVA A;  1IV6 A;  3FHN A;  1B72 A;  2M4K A;  1RES A;  4CH7 A;  5B1A H;  5BPI A;  4A3M J;  3G3Z A;  3H0D A;  2NVU B;  2NXN B;  2LF7 A;  1I1S A;  4D9J A;  3OR1 C;  3K4K A;  4IX7 A;  3E0J B;  3A0H C;  3Q9V A;  2DDB A;  4JOM A;  5EZG A;  3PNT A;  4I7H A;  1K4T A;  1WKM A;  2QKL B;  5FLV A;  2FXA A;  3T1B A;  3RYR A;  2VKD A;  3OYG A;  3IWF A;  5FRN A;  1X3W B;  2CW7 A;  1WJA A;  2LRD A;  2I10 A;  3GXO A;  5CQG A;  1U8R A;  1B9M A;  1QVT A;  2M4G A;  3B6C A;  4LB6 B;  2W57 A;  2NVX J;  4HNT A;  5AIQ A;  3OY9 A;  3CTA A;  3JR9 A;  5JFR A;  3ML6 A;  1ETO A;  1P4A A;  2JSP A;  4GYI A;  1MD0 A;  1I3Q J;  1AKH A;  1R5I D;  1R71 A;  2TCT A;  3OL3 A;  1YW8 A;  3KP7 A;  1VQM I;  3HTS B;  2VKE A;  2UUZ A;  1ETV A;  3WGI A;  1FYK A;  2HQ5 A;  2HGC A;  4F52 A;  4IHV A;  4XLE A;  3LMM A;  3BJ6 A;  2R5Y A;  2VPL A;  5DTD A;  5FRO A;  3FK6 A;  4GCV A;  3IKT A;  4D1Q A;  3GFL A;  3BG7 A;  5E1W A;  1MNM C;  3PM1 A;  4PUS A;  1Q1V A;  2FOK A;  1R9T J;  3HUG A;  4HA8 A;  4XKB A;  1GT0 C;  1T08 B;  2ZB9 A;  2R5Z A;  1OJL A;  2DT5 A;  4ZDO A;  3WTW C;  1VQL I;  2L7M P;  2VQG A;  2OJE D;  4DZP A;  1LFB A;  3BTC A;  5E3N A;  2X9D A;  4BHB A;  1FLI A;  4ZYG A;  1ZRF A;  4CCN A;  2Q2E B;  1U0J A;  2Z33 A;  2K4B A;  4BJ5 C;  1LQ1 A;  4N9H A;  5IT9 K;  4M72 A;  1XCV A;  4JX5 A;  1SAU A;  2QGU A;  5F0C A;  2F6C A;  1D1C A;  2GA2 A;  2KRC A;  1X3U A;  1GLN A;  5B66 C;  1C0W A;  1GHC A;  1BI2 A;  1AOY A;  3CP8 A;  4DOZ A;  2NS8 A;  2HVQ A;  2O61 A;  3CO7 C;  2CRG A;  1DDN A;  1OYY A;  1SEU A;  4RGX A;  4CA0 A;  3KP3 A;  3GTL J;  5IPA A;  4U7B A;  4PSX A;  4BXX J;  5FLM J;  3SFZ A;  2CG4 A;  4J19 A;  2IRF G;  3I4M J;  1GV5 A;  2CUF A;  4MQV A;  3TDU C;  2AXT C;  2M5W A;  3IRQ A;  2HKO A;  2WV0 A;  4RBO A;  3DCF A;  4FCY A;  4PJN A;  4KIB A;  4XMY A;  1EF4 A;  1P6R A;  1FBQ A;  5K5R A;  2FBH A;  1IXR C;  4A3F J;  3FF5 A;  2KIU A;  4I6Z A;  1MH3 A;  2FBK A;  3O3K A;  1ZG5 A;  2STT A;  2E5Z A;  2EIM H;  3R0J A;  4ENN A;  1KU9 A;  2CUJ A;  3Q3S A;  5GPA A;  4QWQ A;  3MEX A;  1R1V A;  1JXS A;  5J3L A;  5L3G A;  2VBY A;  4EJO A;  1OCZ H;  3J7Z I;  5CVV A;  2HXO A;  2R4G A;  4XK4 A;  3P9I A;  5J1Y A;  4KUM A;  4AC0 A;  2CUE A;  4BS9 A;  4ZH4 F;  3U21 A;  2DT7 B;  3A0B C;  2GXA A;  3L00 A;  2H1K A;  3BC8 A;  5E79 C;  2HEO A;  2XPU A;  3T5X A;  1Q1H A;  3RI4 A;  4RGR A;  4KYW A;  5B5E C;  4MFE A;  5EEA A;  1YW7 A;  3D5L A;  4OU0 A;  4AYB N;  5C44 J;  3G6E I;  2LH9 A;  3QU6 A;  2DA7 A;  4B09 A;  3K70 D;  3U9G A;  2W82 A;  4HG2 A;  3TDZ C;  3JSP A;  3KCC A;  1NG6 A;  1A36 A;  2V1U A;  2PJR B;  1MZB A;  1E3P A;  1UJ8 A;  2D1H A;  1TW3 A;  2QM3 A;  2ADU A;  1Z7U A;  3HEF A;  1XGS A;  2CMP A;  3EUH C;  1OFC X;  2K27 A;  4I98 B;  2Y0S A;  1GV2 A;  4WX9 A;  3S15 J;  1LFU P;  2ELH A;  3RKX A;  2JA5 J;  3BCA A;  4Q4Z F;  1KU3 A;  1I3A A;  3EUA A;  1MW7 A;  3LL7 A;  1W36 D;  1J7K A;  4OIR F;  3KP2 A;  2DK5 A;  2M87 A;  1BC8 C;  3F8N A;  1HDD C;  3I0T A;  4E7K A;  2Q0O A;  3PUB A;  3W2W A;  2BZT A;  2HDW A;  2DA3 A;  3F23 A;  3GX4 X;  2MA3 A;  4BU2 A;  4IOA F;  4CUG A;  3S3O A;  1HA8 A;  3FXK A;  2OV7 A;  4I0B A;  1YS6 A;  4KIF A;  2YX4 A;  4N9I A;  2E1M B;  3BTI A;  1CF7 B;  2ZSH B;  1YHQ I;  4JX6 A;  5FKN A;  3CUO A;  2JWT A;  3HGY A;  1VQ9 I;  5FRM A;  4RGU A;  4PGH A;  3G4S I;  2FBI A;  3CMY A;  4ENK A;  3EYI A;  3LSP A;  3GME A;  2Q2E A;  1CQT A;  4V19 K;  1VQ4 I;  1P92 A;  1ERD A;  4HEA 2;  4OIP F;  1OYW A;  2CQ7 A;  3I54 A;  4LB5 A;  5GP9 A;  3W6J B;  1RZ4 A;  5EEG A;  2XC7 A;  2XGD A;  3PIO F;  2FRH A;  2XAJ A;  3K4B A;  1P2F A;  2M9H A;  5K7F A;  2HQA A;  3JRH A;  4H0E A;  2JA8 J;  2MGQ A;  2KPM A;  3HJE A;  1BIB A;  3UR3 C;  1Y0U A;  5FGM A;  3SDG A;  2P5L C;  3BG3 A;  4Y33 A;  3I5U A;  1XSV A;  5HLH A;  4IRG A;  2L7K A;  1XSX A;  4AVZ A;  1YS7 A;  5DDG A;  1OCO H;  2DYR H;  1W1W E;  3EUH A;  5JHF A;  2DA6 A;  3ZCO A;  4EJU A;  5J4V A;  3DTK A;  2LD5 A;  2JPC A;  5CJ9 A;  1FTZ A;  1PP8 F;  2E1M C;  2CQN A;  4HV6 A;  3LFU A;  1O57 A;  1YFH A;  3ECH A;  3O8G A;  4KT5 C;  1IDY A;  1JUS A;  4RS8 A;  2E2J J;  2Z5U A;  3NWT A;  2HTS A;  1PUF B;  2ME0 A;  3CF5 F;  4AWX B;  1R36 A;  2QVO A;  1K4S A;  1FY7 A;  4S0H B;  2W00 A;  2GAU A;  3RCO A;  3WHB A;  3OMY A;  3BP8 A;  2MH2 A;  3E6M A;  4I02 A;  4C2T A;  3S2H J;  2BOL A;  2E34 A;  2M8E A;  3M8E A;  4KT6 A;  3HGG A;  2JA6 J;  1VQ5 I;  1ZGW A;  2FUG 2;  4UUV A;  2DQR A;  3BZ6 A;  3GLX A;  4E7Z A;  1MDM B;  1ZQ3 P;  1J5Y A;  1EH8 A;  3ELK A;  3KYC B;  3GTO J;  1WJB A;  1AU7 A;  3DPT A;  2DDA A;  3BR1 A;  3GF2 A;  2CW8 A;  2EH3 A;  4HDV A;  5M3M J;  2OA4 A;  2A6E F;  3MD2 A;  3D1N I;  2XPV A;  4PJM A;  1ETY A;  4J01 A;  3K1M A;  2ZXW H;  5L3C A;  2NAZ A;  5A2Q Z;  4EVI A;  2LNB A;  2PJR A;  1X1B A;  1LB2 A;  4L9N A;  2XV4 S;  2P4W A;  4NNJ A;  3A1Y A;  4CGZ A;  3PSI A;  1EH7 A;  3PL8 A;  5GAE J;  3BZK A;  4CCO A;  1BN5 A;  3CQZ J;  2Y9Z A;  3K1P A;  1PVE A;  1FX7 A;  2X1C A;  4RB0 A;  3T8T A;  5DCM B;  2L4A A;  1PJR A;  2L4M A;  4U7D A;  3EQL F;  3RZD J;  4A3K J;  1WVR A;  2XAQ A;  3I55 I;  1LEB A;  4Y15 A;  2NS7 A;  4ENM A;  2D45 A;  2YPR A;  2Y2Z A;  1RKW A;  3WTT C;  4MIM A;  2DYS H;  2V9V A;  3E5Q A;  1QPI A;  2ECC A;  2DOE A;  2KJC A;  1XMA A;  4G6D A;  1WCM J;  1JKR C;  1CF7 A;  3RSN A;  4G94 A;  1F5T A;  3DLA A;  2B0L A;  2BYV E;  2XGC A;  4CZZ A;  4CZC A;  3CUQ B;  4A3B J;  4YII A;  4U0W A;  1F36 A;  1BR1 A;  3K4M A;  3ZQ7 A;  2RGV A;  1OIS A;  1ODD A;  2HZT A;  2IS1 A;  1L0O C;  1P7I A;  3MWM A;  1T2K A;  2F5V A;  1UHS A;  3IH3 A;  4NB5 A;  2WAQ N;  1LDD A;  1U9N A;  1SVO A;  2MLG A;  2EWN A;  3HHH A;  1ZH5 A;  2FQ4 A;  1FPQ A;  2Z1D A;  4HYE A;  2YUS A;  4U87 A;  1Y39 A;  4DGW B;  2LY2 A;  3QOD A;  2BY2 A;  4ZJZ A;  3AL0 B;  3A2K A;  2KRF A;  2MBF A;  2JT1 A;  3FIS A;  5K1Y A;  2VC1 A;  2Y31 A;  3F8C A;  3OYC A;  4ZC3 A;  1TZL A;  5HLT A;  3GTP J;  1U2W A;  2V9K A;  1T98 A;  4EJV A;  3K4L A;  3GYH X;  4BQA A;  2EIL H;  3MMY B;  1DPR A;  3K2Z A;  5EGO B;  4G7O F;  4UVC A;  4QLC U;  3QPT A;  1LDK B;  1W5T A;  4BBR J;  1EH6 A;  3WTZ A;  2MSY A;  4NC7 A;  1LDJ A;  2IPQ X;  5TIS C;  3OS0 A;  2HYF A;  1RRJ A;  3EET A;  3CDL A;  4N4O B;  2NOJ B;  1E3O C;  4HST A;  3CUQ C;  2V6E A;  2ZSI B;  5F1J A;  1PUF A;  4BAY A;  3FMS A;  1WWX A;  1NHA A;  1W0T A;  4BH9 A;  4TV7 A;  3ASO H;  2OCC H;  2DPD A;  1FP1 D;  2M0C A;  4QPO A;  2XF5 A;  3JRB A;  5H20 A;  1XGO A;  3DLL F;  3RZO J;  2HVR A;  1MBK A;  4EM2 A;  2Y69 H;  4A3J J;  2DOA A;  3G1O A;  4UVB A;  3QAH A;  5K5O A;  4O5V A;  1MDM A;  2BBY A;  2BY0 A;  2L9V A;  2R7Q A;  4AYB A;  4D5F A;  3G1L A;  3LA2 A;  3SDB A;  5IY5 H;  3BOQ A;  3V8K A;  3AL0 C;  2EJR A;  1G4D A;  2CS3 A;  3RKY A;  1MBG A;  4WXC A;  5GAG J;  4IVN A;  4BXU A;  3OYN A;  4FQG A;  2QQ9 A;  4HBL A;  4O6J A;  4HPQ A;  1V4R A;  3L2V A;  5E1X A;  4AUX A;  1WI3 A;  2FML A;  2A05 A;  3M3Y J;  2JRM A;  3GCM A;  5DCM A;  2JQ7 A;  2VIX A;  1TNT A;  4Y17 A;  1T56 A;  4EM1 A;  2KKO A;  3VSK A;  1GVJ A;  3WG9 A;  1ETQ A;  2EA4 A;  1SMT A;  2FNA A;  2RN7 A;  3ABT A;  3ZR8 X;  1ZK8 A;  2JRT A;  1MGT A;  3BLY A;  2UXX A;  1B8I B;  3V7R A;  1JKP C;  1KGS A;  2JVG A;  3L1P A;  1PDN C;  3L2C A;  3QRF F;  4LG3 A;  2BGC A;  4RA2 A;  3OL4 A;  2ZNY A;  4CIC A;  1VZ0 A;  1R5G A;  2R0Q C;  4A3E J;  3CUQ A;  2XIG A;  3VYS B;  1H9T A;  2E1O A;  2BY1 A;  3OIQ A;  2ACJ A;  4WXD A;  4XL9 A;  4X6A J;  2QQ8 A;  3K9T A;  2DA1 A;  4ESJ A;  1U78 A;  2XRN A;  3QPH A;  2WV1 A;  2KIQ A;  4F3Q A;  4WK8 F;  3MAJ A;  3CC7 I;  2JN6 A;  3C18 A;  3IP4 B;  1KU7 A;  3J80 Z;  2DMU A;  2E1C A;  1SD4 A;  1Z77 A;  2ECB A;  4A3D J;  1WFX A;  1XC5 A;  2L9S A;  3FK7 A;  4ZYD A;  1IXS B;  1ZRE A;  2R7S A;  1SD5 A;  5ILV A;  1NTC A;  1IRG A;  3ZOB A;  3LSK A;  1MBE A;  3TOB A;  2VUM J;  4IRI A;  2VXZ A;  1FOY A;  3GTK J;  2X51 A;  2HS5 A;  2KLO A;  2Z2S B;  2KIM A;  3NAR A;  5EGO A;  1QZZ A;  3HKZ N;  5DEQ A;  5DS9 A;  5C4X J;  3BG9 A;  4ASN A;  1KON A;  2FEZ A;  3PO2 J;  2MFZ A;  3GWZ A;  3GTG J;  3TO9 A;  2F4I A;  2FJ1 A;  5IOZ A;  2DJN A;  3M9A A;  1HOM A;  3J7A O;  2JUG A;  2OPT A;  4RDU A;  1K83 J;  4RGS A;  2P7V B;  1ZRC A;  1XB4 A;  3WTU C;  4OIQ F;  1JJ8 C;  1GVD A;  3MKZ A;  1UFM A; 
#chains in the Genus database with same CATH homology
 2HPI A;  1UG0 A;  2W4S A;  3DEE A;  4ZDO A;  1D0Y A;  2K9M A;  4XKV A;  2VQG A;  2MC4 A;  3W2A A;  2R7X A;  2IGO A;  4HSR A;  2LG4 A;  4CCN A;  2Q2E B;  2R7R A;  1U0J A;  1X4P A;  2Z16 A;  3HPG A;  4BJ5 C;  2BVL A;  4F92 B;  1SAU A;  2F6C A;  1D1C A;  2KRC A;  1GLN A;  4BQQ A;  3L2W A;  1T95 A;  1LKX A;  2LBF A;  2WB1 A;  3CP8 A;  3G2B A;  4DOZ A;  4BJT A;  2HVQ A;  4ZDP A;  3EUK L;  4CA0 A;  4KIT B;  4U7B A;  2MAB A;  4PSX A;  3OYJ A;  5LD2 C;  3RQ4 A;  1MNE A;  1QHG A;  1Y56 A;  1J09 A;  3DQV C;  2E60 A;  4BE2 A;  4RM3 A;  3N05 A;  4FAS D;  4MLO A;  4PJN A;  4XMY A;  4F55 A;  4PFO A;  4FET A;  4ZYA A;  3OYA A;  2K9L A;  3OYH A;  4XN3 A;  2L9N A;  3DPL C;  4AU7 A;  4BAC A;  2E5Z A;  5KHD A;  2CV0 A;  2CUJ A;  3DPU A;  1D1B A;  4XON A;  4CSW A;  1UAA A;  1BR2 A;  2KZV A;  4BJ6 C;  3SZG A;  2GOM A;  2JA2 A;  4E7J A;  2LY1 A;  1OR7 C;  2V26 A;  2R4G A;  3DU6 A;  4F93 B;  4IQ4 A;  2M7A A;  4YEJ A;  4BS9 A;  4XM3 A;  2HZD A;  1FMV A;  2DT7 B;  3C2G A;  4NQW B;  3U21 A;  2ZXH A;  4XNF A;  4B47 A;  3BC8 A;  3D5R C;  1EA3 A;  2R7U A;  3CJR B;  2WAQ A;  2KMU A;  3D5L A;  3HC7 A;  2LH9 A;  1OLT A;  3VDX A;  3H9J A;  3K70 D;  2W82 A;  3A4C A;  4HG2 A;  3PSF A;  1NG6 A;  3ZRG A;  2PJR B;  2R7O A;  1QHH D;  1IRX A;  2CMP A;  3EUH C;  3OYD A;  1G8X A;  2Y0S A;  4NUB A;  3DKX A;  4B44 A;  3L2U A;  3OS1 A;  3BCA A;  3H5N A;  1X1C A;  3H5R A;  3EUA A;  3GBG A;  1MW7 A;  3LL7 A;  4XKW A;  4E4H A;  4E7S A;  1W36 D;  3K70 C;  4KJZ A;  2IGN A;  3IAM 2;  2XF7 A;  2M0M A;  4PJJ A;  4E7K A;  3PUB A;  3W2W A;  2WY7 Q;  2HDW A;  4Y3O A;  1WJF A;  4BU2 A;  4CUG A;  4EAT A;  3S3O A;  1S9H A;  1HA8 A;  2CV2 A;  2OV7 A;  3OYF A;  4C30 A;  3I9V 2;  4R79 A;  3OIP A;  2E1M B;  1W36 C;  2ZSH B;  4ITV A;  2X6X A;  2M3A A;  5FRM A;  2V4J C;  3RTR A;  5HNH A;  2M7B A;  2BW3 B;  2E5N A;  3TMO A;  3OYI A;  1D1A A;  2LOO A;  1ERD A;  4HEA 2;  1X19 A;  4BL0 B;  2BVM A;  3OS2 A;  4JQF A;  3H9Q A;  3K6G A;  3V42 A;  2VJJ A;  2XC7 A;  2UWM A;  3K4B A;  2HQA A;  2IGK A;  4J00 A;  2KPM A;  2WA0 A;  3HXL A;  3UNG C;  3K4J A;  2VQL A;  3K4N A;  1LVK A;  1NG7 A;  1Z3Y A;  3FKJ A;  4ZTJ A;  2AQF A;  2ZXI A;  2HVS A;  2UV1 A;  1Z3X A;  3S32 A;  3UR3 C;  3HL2 A;  2XSJ C;  4C2U A;  4Y33 A;  4OAZ A;  3S3N A;  2IXS A;  1BOB A;  2L7K A;  2MD0 A;  3KX2 A;  4GRI A;  4AVZ A;  2WY8 Q;  4E7I A;  4B48 A;  3ZQQ A;  3C2H A;  5CKT A;  5JHF A;  3F9K A;  3MKY B;  1PYV A;  4N4N B;  3ZCO A;  3DTK A;  3IUO A;  3VYU B;  1MMD A;  2CFO A;  4RLQ A;  2E1M C;  2XDV A;  2KQR A;  3LFU A;  1V5F A;  5TGT A;  3BG6 A;  2CUZ A;  4BEH B;  3NWT A;  3MKW B;  4BE0 A;  3FBN B;  3VYT B;  4BQO A;  4IKF A;  1JI8 A;  2W00 A;  3RCO A;  1WJD A;  4CCL A;  3OR2 C;  3OMY A;  4C2T A;  2BOL A;  4KT6 A;  2FUG 2;  3VSL A;  4E7Z A;  5KCM A;  1ZEL A;  4XOR A;  3DTI A;  1WJB A;  3TBI A;  2K3P A;  1DGW Y;  2WBM A;  3DPT A;  3D5S C;  2CW8 A;  2PMZ A;  3PNY A;  1BR4 A;  3MD2 A;  4J01 A;  4PJM A;  4XLC A;  3AKZ A;  3DKY A;  3RPU D;  4KIS A;  2JVH A;  3E1S A;  4DBR A;  3H5A A;  4G6T B;  2PJR A;  1X1B A;  3QYE A;  3J7A Y;  2VLA A;  4NNJ A;  3QOE A;  4BDZ A;  3A1Y A;  2VJ4 A;  3PSI A;  3PL8 A;  3CZ6 A;  2OUM A;  3FBI B;  1MMN A;  4CCO A;  1T0F C;  4BDY A;  2DJI A;  3AFH A;  4HNU A;  5HNF A;  2QKM B;  2X1C A;  4NC8 A;  4PK4 A;  1PJR A;  4P5O A;  3M1C A;  1DQU A;  3HKZ A;  3OWT A;  1UEL B;  2R7V A;  3PJR A;  3LSH A;  4XOT A;  3HG9 A;  2V7F A;  3LSI A;  1G59 A;  3FDY A;  2WAD A;  3W3C A;  5HOO A;  3CES A;  1YX3 A;  5CQE A;  4OWR B;  3RSN A;  3CMM A;  2VXD A;  1X1D A;  3DLA A;  5KNL A;  1MMA A;  4II3 A;  4CCM A;  1FMW A;  2ELJ A;  4CZC A;  2KDO A;  2X6Y A;  3I3L A;  4H4K C;  2XF6 A;  3K10 A;  1BR1 A;  2BW3 A;  3K4M A;  3DTE A;  2IS1 A;  4BE1 A;  1TT0 A;  4XOP A;  2F5V A;  4DJA A;  1V5G A;  2RRE A;  4XN0 A;  3IAS 2;  1LFP A;  2VQH A;  2R7W A;  3KEY A;  4II2 A;  2Z1D A;  2I8D A;  3HOT A;  1WJE A;  4U87 A;  4F91 B;  4DGW B;  2LY2 A;  3QOD A;  2OC6 A;  5HVQ C;  4ANJ A;  4ZJZ A;  3AL0 B;  3A2K A;  3M8J A;  4ZTF A;  3OYC A;  3OYK A;  2WAF A;  4ZC3 A;  1DGR M;  1TZL A;  5HLT A;  2V9K A;  2X85 A;  3K4L A;  3DU5 A;  3MMY B;  3LSM A;  1LDK B;  2X1D A;  2A6T A;  2RQQ A;  4LIT A;  3BCB A;  4NC7 A;  4C9Y A;  1N75 A;  3OS0 A;  2IS6 A;  3HUG B;  2K5C A;  3QYB A;  4LIU A;  4N4O B;  2LRE A;  2ZFU A;  3H35 A;  3VWB A;  3HPH A;  2NOJ B;  1YX5 A;  3LSG A;  4RMN A;  3KYL A;  4XR6 A;  4HST A;  4BEH A;  2DXI A;  2V6E A;  2ZSI B;  3QYF A;  1MMG A;  2VJI A;  2Q1Z B;  2IGM A;  2O5R A;  4XLH A;  4QPO A;  4B43 A;  2XF5 A;  3L2R A;  3CF2 A;  2R7T A;  2HVR A;  2LYC A;  2IS2 A;  2HPM A;  1SFK A;  2VKH A;  3CJQ B;  2DOA A;  4E7L A;  4B3X A;  4X0G A;  4Y4R A;  2A5W A;  2GOX B;  1Z7L A;  3OYL A;  2DCE A;  2R7Q A;  3PNV A;  3L2Q A;  2LBF B;  4AYB A;  1E0E A;  3CP2 A;  1Z21 A;  3SDB A;  2X6W A;  4DBQ A;  2AQE A;  5CPR B;  3AL0 C;  4PSW A;  3OYB A;  2CS3 A;  3SYT A;  3H9G A;  4XLF A;  1N77 A;  1YE9 A;  1Y6I A;  2IS4 A;  4LIV A;  4YEL A;  2L2O A;  4RLF A;  3OYN A;  4PFP A;  2HU9 A;  3S3M A;  2VQC A;  4HPQ A;  4XLA A;  3L2V A;  2W7N A;  4IQJ A;  4BGD A;  2CH0 A;  2XAU A;  3SEZ A;  4P1W A;  2W1O A;  4QPQ A;  4XQF A;  3K4C A;  5LFA A;  2VIX A;  1DP3 A;  1AA7 A;  4HRI A;  4BQN A;  1WJC A;  1N78 A;  3VSK A;  3OOU A;  4E6K G;  2V1N A;  4OAY A;  3ZR8 X;  4BUP A;  4CCJ A;  2VJ5 A;  3FHN A;  3BLY A;  2LC2 A;  2M4K A;  2KHM A;  4CH7 A;  3OYM A;  2L5Q A;  3H0D A;  2JVG A;  1D0X A;  4LG3 A;  4D9J A;  2KRH A;  3S8P A;  3S93 A;  3OR1 C;  3OL4 A;  1X1A A;  3K4K A;  3E0J B;  4IX7 A;  4JOM A;  1R6R A;  3PNT A;  4PJL A;  1VZ0 A;  2QKL B;  3VYS B;  2VL8 A;  3OIQ A;  1X4O A;  2WAE A;  4IZZ A;  4XL9 A;  2VKD A;  3OYG A;  5FRN A;  2CV1 A;  1K6Y A;  2CW7 A;  1WJA A;  3SEQ A;  3OYE A;  2LRD A;  1V5E A;  4F3Q A;  5CQG A;  1D0Z A;  2KL4 A;  3IP4 B;  2M4G A;  2VB6 A;  3EPZ A;  3HOS A;  4HNT A;  3OY9 A;  1MND A;  4ZDL A;  2JSP A;  3VYR B;  1WFX A;  2L9S A;  2HNH A;  3DWL E;  2R7S A;  4E7H A;  4BXF A;  4CCK A;  3LSK A;  1QU3 A;  3OL3 A;  4RM2 A;  3ZXS A;  2UUZ A;  2KP6 A;  2VAS A;  3ZGK A;  1P9Q C;  2DT6 A;  2VXZ A;  3ONQ A;  2X51 A;  2KLO A;  4F52 A;  4XKC A;  2X1E A;  2Z2S B;  4XLE A;  3LMM A;  2VPL A;  3W2V A;  4YRV A;  1KON A;  5FRO A;  2P0W A;  2MFZ A;  2MYS A;  2F4I A;  4D1Q A;  3BG7 A;  2JUG A;  4PUS A;  3TL4 X;  2RNG A;  4XKB A;  4DIQ A;  3PFY A;  3NWS A;  3MKZ A;  1WJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...