2ZSVA

Crystal structure of h-2kb in complex with jhmv epitope s598
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
278
structure length
273
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prevention of cytotoxic T cell escape using a heteroclitic subdominant viral T cell determinant.
pubmed doi rcsb
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
molecule tags Immune system
source organism Mus musculus
total genus 70
structure length 273
sequence length 278
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zsvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2zsvA01
2P46B 4JFEA 2EO9A 3DI2B 5IJVB 4H1LA 5HGDA 1Q0YH 4MD5A 3T65B 4P9HL 1OAXH 5GGRB 5JOFB 3BRGC 5HI5D 5DMIH 5L8KB 4JFDA 1OP9A 1NEZA 4GW4B 5C0BD 1WZ1H 2HFGH 5IHUH 3MLZL 1HH6B 1KLGB 1N6QL 3FTGA 5D8JH 5KJRL 1OCWH 3QZWB 3ULVH 1F3DH 3MBEB 4U6YB 2ZOKB 5CP7A 1J8HE 3WUWA 1IGJA 5I1IH 4PJCA 2R4SH 4POZD 1D7FA 4L3CB 4Y8DC 3RA7H 4LSVL 1GOHA 1O7SA 1NJ9A 3DUUB 4P57B 5C2BL 2B1AH 5HHMA 2BERA 2QADD 3HC3H 4JY4B 4ZTOL 1CLOH 4QHLB 2JB6B 1MCHA 2CQVA 2NY4B 3MACL 3RU8L 4M00A 4RGNE 1V3JA 3RIAF 3UPRA 1C08B 3NACH 4R2GB 3ROOB 4GAYB 3AAZA 1T2XA 4Z8FH 4UTBL 2JIXD 1NBZB 1SMOA 4PLKD 1AO7D 4HKXA 1XIWC 2XI9A 3BKJH 3CGTA 4P2OC 3VFWB 3VGAB 1UJ3B 2UV3A 1A2YA 1T21A 4IM8A 3ZKSD 4XWOD 4NHUA 1V7NL 3DX8B 1SY6L 4G6MH 3UPAA 2FGZA 3QPXH 1ZHBB 3CDYA 4Y4HD 2C5DC 2MHAB 4JZJA 4U3CA 1G6RL 3FB6B 2NYYD 2A74A 1KGCE 1R5IA 3MRPB 4JVWA 4IOFC 2WQ8A 4HK0B 3MFFB 2YBRA 3S88L 1JPFA 3QJFA 1S7XA 4Q2ZB 1S5HA 3EYSL 1A02N 3G5YB 1EERB 3BO8A 4DCQA 4PJ5B 3KYAA 2FIKA 4FFZL 2H26B 4NOBA 2NW2A 4M8QA 5JHDD 2FSEB 2FGWH 3LZFH 1CTOA 1W72B 1IGTA 3HI6H 4G7YH 5T3XH 1LVEA 3L3OA 3RWCB 4H5SA 1S78D 3OKLB 4IOIA 2J4WL 1BMGA 1DQLH 4R4NC 1I3RB 2VE6A 1CL7H 3I6GB 3WEXB 4QO1A 3KPSE 4FFYH 4Z7VA 4M6AA 4ZG1A 4TPRH 1V7MH 4K9EH 2VAJA 4OGAD 3RGVC 5C07D 5F7EH 3SQBA 1IAMA 2BNQD 1A7NL 3WO4C 3RZCD 3VXTB 1FSKB 4NQDB 2F54E 4WTZG 3QXVA 1CDJA 4NQCE 4FZEH 3GSQB 5ADOH 1FPTH 5F9JB 1DSFH 1F3DJ 4WUUA 5J7CC 1TVHA 4URTB 5C0CA 3SKOB 2AI0H 3QIBC 1UWEH 2WUCH 1GGUA 5J12B 3OKDA 1SBBA 3HHRB 5I8CA 4LBEA 2IBGA 2C1PA 2R0KH 5C9JB 3PDDA 5IVXE 1OTUD 2HFFB 3WLWC 3GBNL 1DP0A 4JG1H 1BP3B 1K3IA 1I85C 1MQKL 3DBXA 3DUSB 3QHFH 3GMOB 1EEZA 4U2YA 2A83A 1YQVH 2MKLC 4OGYH 4UOW0 1AKJA 3TCLA 3QEGL 1Z3GH 4PJGB 2AK4D 4UINL 2AXHA 4JFFD 3NA9L 4GO6B 1QR1A 1KB5A 2F58L 2X1WL 3WBDA 1MIEL 2R2BA 4ORZC 2K1MA 3EZJB 2OZ4A 4TVPE 1PKQA 4WJ5B 5C08D 4ODXA 4FTVA 4OZIF 3CXHJ 4UT6H 1LD9B 1P2CB 3ARFA 4NP4H 4HWBH 5FAAA 4Z0XA 3H9HB 3DRQA 4U33A 4XPFH 3I50L 3KXFD 1ORQA 2RIKA 3WDHA 2FL5A 1B4JL 4MXWH 1ZSDB 4F7MB 4KZDL 3CXHK 4AJ0A 3HLAB 5FHBL 1J18A 1U3HC 2FIRT 5B38B 5I9QB 4ESKA 2GTZA 2CK0L 3V6FA 1JF6A 4HJ0D 1KIPB 2XPGB 4L29B 1XIWA 1JPGA 1LP9E 1LEIB 4P2OA 4TULH 1BQLL 5E8NB 1R3HA 1ONQB 5E1HB 1RQ5A 3UO1L 4R0LC 1HK6A 2GSGA 1A6UH 5FA3A 3ZYJA 4HUWA 2BRRL 5HDQL 2DD8L 4OF0A 1XH3A 1FLRL 2X9YA 4P99A 4ENEC 4OZIA 2PNDA 1JYWA 3AU1A 4RNRB 3S96A 3D2UA 4E41D 2DQHH 3VU2A 3R4DA 4Q0XH 3MV9A 3VXUD 1F4WL 1QSEA 3TO4B 5I16A 3K4ZA 4KQ4H 2L0DA 1KB9K 2Q3ZA 3HE7D 4U1SB 4ZS7L 1X5FA 2APTA 4OZGB 4F7TA 4PD4J 3O3EB 4OCMC 3RKDC 4WUKH 4OFDA 3RTQB 4M4RA 1N59B 1KULA 3U6RA 2YK1L 1E4XH 4KKLC 3I9GL 4JCMA 5KVGH 3UAJC 2CDEA 1CFVH 1B2WL 3KPSD 4GLRI 4LNRA 2EIZB 3NGBB 4PD4K 1IM9D 1X7QA 2VDNL 3MREA 3BP6A 3MXVH 5CMAA 1KBGH 5ALBL 2XKNB 2F54D 1KIQB 4R4BB 4PG9B 3DETD 1U8PB 1F90L 1CVSC 4ZUUB 3LHPL 4PYHA 4FN0A 3BZFB 2BNRA 1K8IA 1A14L 4IIQC 3EYVA 4HJGB 3TIEA 5F9WB 1EBAA 3RGVA 3O3UN 3HC4L 3KPRD 5I1KH 3LQZB 2PXYA 1BVZA 3GJFB 2HRLA 3H9SD 2WIIB 3UTQA 5JQ6L 1OAQL 3I3EA 4I1NB 3GJFH 4FFVD 1DBAL 4OD1L 2OJEA 5I18L 4X4ME 1U36A 5LGJA 4G7VL 1IEBB 3MLUH 5D7LB 3QIBA 3UTTE 1IGCL 1YMMB 4P0DA 3B6SB 4JAMB 4ZPVB 1U3JA 1FE8L 1H8NA 5KSUA 1BWMA 1UB5B 4F58L 4I48B 2XWJA 5DR5H 2XZAH 2ZUQC 3MOAL 4I3RL 3FL7A 1I85A 4GW5A 5F1OB 5AG8A 5IB4A 4MGXA 4KXZH 5B3JF 4JZNA 1IC4H 4DKEL 1KOAA 2BC4A 4GAFB 2ZUXA 1XZ0A 2CUIA 2VXTL 2IG2L 3PGFL 4KUCD 4MB5A 3RVWD 5C1MB 4QWWD 5D70H 4WHDA 3B8SA 2R56L 2B0SH 1YN7B 4JPVL 2J12B 1CGSL 3EO9H 1K6QL 1GGIH 5F6IB 2ZUTA 4MJ2A 3TN0A 3LEYL 3UTSA 1MELA 3KLAB 1RUKH 3MUY1 3RBGA 3ULVE 4JJ5B 3C5ZD 2IH1B 1DTUA 5IMKA 1ZA6A 2HKFH 1G7IA 5M95B 1NLBH 3WHXB 1RZJH 4HF5H 3LQAC 1EUTA 5EOTA 4X5LA 3TWCL 1CGWA 5KVEH 1P7QD 4NM4H 4K2UH 5D1ZB 4K71C 3DUHA 2VLME 3F58H 2IAMB 1U3HA 3SGKA 3TNMA 4ZFOL 3T04D 5K9JL 4QOKA 1ZVYA 5I1DA 3VCLB 3MJ6A 5E1AA 2GITB 1Z0MA 2P43B 5TDPB 2X5PA 1G0XA 2ILLA 3IXAB 4XNZB 2AW2A 3DARA 3REVA 1ZT4B 2AKRB 2V2TA 3WIIL 1P4LB 3IDYB 2DAVA 4LVNB 5LBSH 4R0LA 1P6FA 1MCNA 1MY7A 4ETQB 1ZOXA 3VXMD 3VD9A 1LE9B 1IC5L 3STZB 1CBVL 3DLQR 5DRZB 1JGEA 1TPXB 2PF6A 4AMKL 5MEQA 1EA9C 1I3VA 1T66D 4ZUWB 3WNNA 4ELKB 2G60L 1ZWIB 1CICC 1SBSL 3L9RA 2BHUA 5IBLC 1HHKA 2HG5A 2N7AA 2ERJC 3P2TA 2VZTA 1B6UA 4L5FL 4YEEA 5BOZG 1GRWA 5KS9B 5EDXA 3VXSA 5ITBH 5CJOH 3CFCH 4WFED 2NR6D 4HFWB 4YUEH 4HFUL 4J3TA 1OPGH 4LCUA 4V2CB 4KK6D 1NUGA 3MUJA 3RL1A 3CH1B 1S9WB 5CCKL 2YPKA 4MA1C 5FF6B 5DMYA 4I18C 2EEDA 3QA3A 3UDWA 2P47B 4GUPB 1XF2A 1Z9OA 4DVBA 4PJ5E 4HG4K 4ZDHA 1NC4A 4DEPB 4O4YL 4IIQA 4NGHL 4DJMA 5B21A 1OD7A 1I1AC 5JW4Q 3TT3L 3CIQA 1UXWB 1UYWL 2X42A 2YS4A 4XTRD 3IDUA 1HE7A 2YMXL 5FA4B 3Q6FB 3UTTD 1FNAA 3QNXA 2LU7A 4X9BA 5E2JA 1ZHKA 4XMKH 2GYSA 1U2CA 2F8XC 4LQFH 2VERN 5KSAD 3CJJA 4L3ED 2EDBA 3R0MA 2J8UB 5FV1L 1HYRC 3TBVA 4NKIL 4NQDE 1NGQL 3QDHA 4ZFOA 1CK0H 1ZLSH 3SEPA 4LCYA 1KV3A 1LILA 1JNNH 5D96B 1L8JA 4I8DA 1RZ7L 4TRPH 2Q8BH 4JPWL 2CD0A 3O4LB 2VQTA 2DI7A 3NIFF 2LAAA 3UTOA 3QO0B 3MV7D 1BFVL 5DVLA 5JPMA 4OF7A 4OCXL 1UZ8B 1TVBB 2M26A 3V7MA 2ZOLA 4EIZC 2NXZC 4RFOL 1JGUL 5T3ZH 5E7FA 5I74B 4PGDA 4JKKA 5CJQL 1UG9A 4P48A 2X4UA 4N8VG 1FFNB 4LVOC 1UACH 1BM3L 4HIEB 4CMHB 1QD0A 1GCFA 1PYWB 2RFXA 5T5FL 5JQHC 2JJUA 4JPIA 4XPHL 4YEFA 4HS6A 3QDGB 4KJYB 1KELH 1MJ7L 3SGEI 3VD5A 5IEHB 4MQXC 3ZE2E 3MGTB 2YKLH 4PJGE 2NTFA 4BSJA 2XWTA 4XPTL 4AEFA 3KPPA 1DDHA 5EO0B 5FGRA 3MO1A 1CS6A 5EWIH 1EGJH 2E8YA 4PS4L 2MPAH 2VQUA 5GGTH 3S3PA 4NQEA 5GJTH 2H41A 4JDZA 4AENA 4KKBC 4PRAB 4Q9RL 2B2XL 5CZKA 1NDGB 5EUKA 2L7JA 4HHAA 5EC1A 3UJJL 1Q9KB 4G43B 3HZMB 3GKWL 3MRLB 3JWOC 4U3HA 5CEXB 3G6AB 8FABA 2Y06H 4HWEH 4FQQA 3U83A 3QXAA 1BZ9B 4OM0L 2LTQB 3MROA 4N1EA 1HINL 3SDDA 5DMKB 1CICA 2OJZL 1OB1B 1GPOL 5IV2A 4OQTA 5DZOA 4XNXH 4YQXH 4NN5B 4GG6B 5C70A 3WNKA 5FOBB 1TXKA 4J3SA 3FQWA 5J13B 2D2OA 4I0PD 2ITDB 4UDTB 4FABH 3MZTA 3EHBC 1IGYB 1AGCA 4WFFE 3L1OL 2QKIA 4K3EL 43C9A 1MSPA 3CFBA 3K8LA 5TE4H 3KPOA 3G6DH 4G5ZH 4WI3A 4S1QH 4UT9H 3P30L 3TT1L 2GAZA 3HMWL 1LO2L 4OZGE 3SE3C 4ONGH 4B41A 2CR3A 3U2SB 5AD0B 2PR4H 2FYYA 4I18A 3N85H 1NCBL 1BHGA 2NY0C 2D7TL 2XA3A 3OHXB 3HC0B 3NPSC 3QQNA 1GHFL 4ZSOB 2VL5A 3JWOL 4MHHI 2VL4A 4UUJA 3PDOA 2NW3A 1AY1H 3S3JA 1IAII 4BJLA 1KCVL 2BOCB 2EXWC 1G7HB 1T3FB 5FFLA 4WHCA 5F7DB 2B4CC 1AIFB 3X14A 3ARBB 1I1RA 3ILPA 5EU6A 5E5UB 5EO1B 1YEIH 2AJYL 1NAMA 5FKPB 2VXUH 5KANG 3ARZA 4Q9QL 3I75A 4YNYA 1S7QA 4TNVK 2YZ1A 1AXSA 3BZEB 2QSTA 4X5WB 5DMJB 3OR6B 3RDTA 4K23L 3DVNB 1LO4L 4DK6A 1F11B 3WHE0 35C8H 3QEHA 3Q3GB 4K3JH 1R6VA 4AEIL 5F70A 2BOBB 5IVZA 4DGIL 1LEGB 1MCPL 4WNQB 2FD6H 1N64L 3BAEH 4G8FB 5K59E 1Q72H 5D7LE 5I15L 1MAKA 1JRHI 1YMME 3IU4H 5BZDB 1AGEB 1NSNL 4M61B 1TDQA 3IJYA 4ODWA 4X6DF 3P9MA 3CC5A 4XVSL 1HHIA 3O2WH 2EDHA 4BSWA 5L7XL 3SE4A 1OM3H 4JHAL 1NGPL 5IW1B 2KPNA 3A67L 4LRIA 4DUVA 5E5MB 3U7YH 4LVEA 1VFAB 3WSQH 4XPAL 1MVUA 4OLYL 4OCSL 1NCWH 2XZQL 4QEGA 4QXTB 4X8XA 1YEFH 5IQ9A 2YHGA 4IRJC 2H2SC 4PJBB 3OB0H 4G6KH 2IBZY 1A8JH 2UZIH 1KFAH 4OD3H 4PJ8C 4PP8C 1JWSB 1MWAL 3ZKXB 3O3BA 4M93C 2QHRH 1AJ7H 3OSKA 3WFCH 1I7UB 4GSDH 3VJ6A 5CJBA 1HZHL 3ESUF 4S1SL 1YEEH 4MD4A 3VXQA 2VDPL 3VFPB 4XCFH 2APFA 1D6VH 3DX9A 3VWJD 2EZ0C 1HEZA 2DB8A 3VI3E 1CI5A 32C2A 3T0EC 2NY1B 1QEWA 3WO3B 2VZ1A 3IFNH 4FQ1L 4WFFD 2MTPA 4QYOA 5IKCB 3R06B 4N0UB 1M6OA 1WWBX 3KYKL 3TO2A 4MJIB 3TF7A 2EIEA 4W6YB 5EO9B 1EHXA 3MRNB 2YRPA 3ARDB 3QFDB 1CGXA 2DBLL 2FBJL 4JO4L 3WIHL 1JHLH 1MIMH 1BOYA 2R0WH 4OT1L 4N5UA 4OTXH 3OXSB 3B2UD 4LDOB 4GRWF 4G3YL 2A6DA 1S7TB 4LSRL 5AYQA 5IBTH 3EZ8A 5IROC 1D5MA 3SE3A 1RJCA 5HI5C 1DLFL 1VACA 5KS9E 3DSFH 5KAQF 3MRBB 4MA8H 4KPHL 5FYJH 1AHWB 1AQDB 2ZPKL 1M7IA 1JHTB 5I8KH 2W91A 2F53E 3K4AA 4WWID 1UWXH 4I3SL 4OZHF 5C0JB 3BW9A 3G08B 1ED3A 2PW2B 4IJ3C 4IMLA 4W4NA 5DSCB 4NO0B 1X5ZA 4POZC 2VUOA 1X44A 3MNVA 1MCRA 1NGZA 5I71B 2UVEA 2H8PB 3PIQB 2E6PA 4Z0BH 5M7QA 1EZVY 5J6HA 5FIEA 4K3DL 2QADC 4UT7L 2OM5A 4KMTH 3IB4A 2WW8A 5DUBA 5GGSY 5ICZA 5EG6C 3LCYA 1ZE3C 5I8OH 1OAZL 1CLZL 4TSAL 1M1SA 2C1OB 3T4AB 1ZHLB 2VITB 3KLHD 5I1GH 5IMOA 3O2VL 3BP7A 4HIJA 4Z7WF 4PLKC 2NY7L 4ZUTA 2J8UE 1JUFA 4XBPA 4UV7H 4XXDA 3SY0B 4TOYH 4JRXA 2VDQL 1T0NB 4I9WE 4OZHA 4BZ1L 3BWUC 3QCUH 2P48B 5C0DB 4XWOC 2D31A 3FAXA 1MCDA 4TTDC 3O4LE 3K2MC 3PV6B 5I1LB 4BA8A 3MLRH 5ITFA 2NZIA 5F89A 4I77L 5HVGB 5A16B 2P5WD 2HTLD 4KJQD 3OB0K 2OBGA 4YHZL 3VFGL 5GGRY 3GMMB 4YXHH 3MRMB 5JIHA 2QHLA 4JANA 4U7MA 4NC1E 3TYFB 2ADIA 4QNPF 1UWGL 2FHCA 1X5KA 4RBPH 1K5NA 2JK5A 4MNGA 3RWHB 1T22B 1TLKA 2XQYG 4UNVA 4OB5H 4PJ9B 5C0AE 1WTLA 2HTKC 2N1KA 4FQ2H 4IRJA 3QDGE 1ZLWH 1X9QA 1Z9MA 3ZSSA 3FFCA 4MB4A 3BP4A 3SDYL 4WFGE 1RV6X 1NFIA 3LS4H 4PJ8A 4AL8L 1F6AB 1UH2A 3LKRA 4HZLA 4MS8D 5HYSA 5IFJB 3VFOA 1CD8A 4K7PX 3QFJA 4CU6A 4TN9A 4JR9L 2DLFL 4KVNL 2Y6SC 1HDMA 4XNYL 1DBKH 1BJ1H 2BJML 2GCYB 4EOWL 3SDAB 3CXDL 3MRQB 3T0EA 1T2QL 4KKAD 1HHJB 2ZCLL 4YDIL 1EVUA 1V3MA 2VQ1B 4P2QA 1ITBB 2DRUA 2YPVH 4XRCA 3ETBF 1MFBL 2NY2C 1KJ3H 2XNAB 5BVPH 1CXEA 4J8RB 1EDQA 3U1SL 3BGFC 3QXWA 4G6AD 2H6PA 2BDNL 2OL3L 3TNNB 4XCEB 5TQ2H 4K94H 1EHAA 3GSRA 1JHKH 4GG6E 1NMCB 2F53D 2V5YA 2VYRE 4Z7UB 4QF1A 5IROA 3OR7A 3B3IB 5JDSB 4AEEA 4C83B 3O8XB 3ARGC 5E9DB 1XGPA 5C0BA 3MYZA 3UJIH 1JK8A 3QBTB 4UQ3A 1BREA 3TVMD 1B0GB 3PWJA 4CGTA 4U6HA 5DD6A 3TZVD 1T7YA 1CFTB 4LPWA 4PBXA 4D0CB 1D5IH 3E0GA 4ODTH 1J1PL 2VAAB 1T1WB 1RMFL 3FB7B 3LKQA 4MXVF 2AJVL 4ZSOE 3CU1A 2FLBT 2NTSP 4NWTH 2XN9D 5FYJU 1YEKL 3TFKD 4M1DL 4PRHB 5F97E 2O5ZH 1HYSD 4OLEA 3ARRA 5FO8A 5K9KB 5K9QI 5C0GB 3D0VA 1WAAF 3B5GA 3T2NL 3DI3B 1Q8MA 1A6TA 3IDIB 3DSNA 5TQ0H 1G0YR 4YXLL 3FO2B 4HS8L 3AREB 4OBRA 3S5LB 1YEDB 3BHBB 4GRMB 2PW1B 3QI9B 2JIXA 3RY4A 3O4LD 3PGDA 1AO7A 2OMBA 1N8ZA 3OKYA 4WHYG 4QXGH 3WD5H 2JJSC 5F7YC 3E1F1 1A3LL 4PR5A 4J1UB 2ADJA 1OSZA 1V3KA 1P4IH 3RVVD 4M6ML 1DN0B 4OZFG 2VZUA 2V2XA 4M7KH 3QQ3B 1T5WB 1U3YA 4XXCC 2MJWA 3IETB 3OAZH 5B39B 4WI4A 2Y07H 4DW2H 1P4BH 2Q8AH 4Y4HA 1K8DB 2XRAH 4AM0B 5HVHB 3CK0L 1P7HL 4O5LH 1NCNA 4K7PH 5C0AD 3WN5C 5LXGH 5EN2A 2VIRB 1BJ1J 3HE7C 1IGIH 4GKSB 1WAAA 3WDIA 5JNYA 3L5WA 1NCDH 2CK2A 2E7LE 3PJSA 3FB5B 4Y4FB 4U1NA 2AEQH 4UB0H 1G7LB 2XQBL 5DRWA 5H37G 1GC1C 2Q6WA 3GSOB 4X83A 1U8NB 4MXQC 3IDGB 1ETZA 1WBZA 5DJ2A 2CUHA 2W0PA 5JHDA 3LQMA 1OW0C 3CMOH 3UPCA 4MJ4A 4DVRL 1WC7A 5I1HL 1CDBA 2VLRD 4I2XB 2AJSL 1QQDA 5E2VH 1JI1A 4YZFF 4YE4L 3NABL 2X89D 2W9LA 3DETC 2R8SH 1AQKL 5JXAL 4HKBB 2FR4B 4H0IA 4M03A 4G9FB 3U46B 4PJBE 5I6XC 2JCCA 4AEHH 1CLCA 3HNVL 5F9DC 3V4UL 4HUNB 3QEQB 3FT3B 5C07A 3BPCA 5EB9A 2BNQA 2DM7A 3RZCA 1CTNA 1WZMA 3EDKA 4OFYD 1KCUL 3CVIH 3EOYG 1A5FH 5HD8D 4X7DC 4OBSA 3VFSA 1EFXB 2RQ8A 3WFDL 4FFVC 4Z7NE 4UAOB 4NRZA 2R15A 3SO3B 5IVOA 3JV4B 3JWNC 1ADQH 2EYTA 4LHJB 2ITCA 1I7TA 4LKXB 3RX7A 1VKXB 1MRDH 3QT2A 2EH8L 1RJZB 4XX1G 3OJDB 4WU7B 3ULSA 5HHXH 4ERSH 1Q9OB 4KMLB 3VG9C 5HYJE 4D9RE 1T20B 3OGCA 4FMKA 4N0UE 3RPIA 4QXUL 4YDJB 4TTGA 4DN4H 4MJIE 4X80L 4LSUH 1B0RB 4Y16B 4MMZC 2PO6B 5C0ND 1OQXA 4MQ7B 3U0WH 5INDB 5ESQB 3ARGA 2AV1A 1II4E 4PY7A 4BUGA 2FX8L 4YR6B 5I1JL 4ZTPL 3RVXC 1WICA 1S8DB 1DR9A 2X44D 2AK4A 4JFFA 2GT9A 4HIHA 5A2LH 4YHMH 5FYJE 2FBOJ 3RVWC 4RGMC 4JKWA 1SMAA 1LO5B 4NZUH 3PWVB 4PRDA 1I7RA 2IQ9H 4RAVA 5C08A 5F3BA 3KR3H 4S0UC 3V7AE 1T5XB 3C5ZC 1UM5L 3QULB 1HOCB 5D9SB 3VH8A 1FVCA 3G6JF 3KXFA 1MHPL 4W4OC 4JFQB 5GS2H 5C09B 5CP3H 2N4IA 4XNUH 3UP1A 4AH2A 3CDFA 5IP4A 1LO0H 4OLZL 5HVFB 5DJZA 3EUUA 4LHUG 5BMFH 1CF8H 1SEQL 1U8JB 1E4JA 2PCPA 3BUYB 4F3FA 1DUZA 3SE8H 4TVPL 5ILTH 3VXOA 3T0AA 1U93B 4K8RL 4XXCA 1HXMA 1QBAA 4PJAA 4P5MA 1T66C 1F4HA 4E41A 2KL6A 3BFOA 3OQ3B 3VXUA 5LKNA 2EC9U 3C6LC 4KTDH 3WN5A 3D48R 4UOW1 2DQCH 3HE7A 3T3MF 4NRYA 5TGBA 1NCTA 4HIXL 4H25B 1QSFD 5E6ID 4J7RA 3WLBB 3CVHB 2VH5L 1V3LA 1HCFX 4O2FB 2V17H 2OXGA 3AY4C 2NR6C 3CVHH 5J57B 1WBYA 3O6KL 5INCB 1NCAH 3H7LA 5E2WH 1I1YB 5DQDH 3KPSA 3BPNC 1OW0A 4KK6C 3PNWA 1EEQA 2G75A 4X4ZA 5BQ7B 3OPZL 1IM9A 3KJ4B 4MNHA 2UYLA 5HHNB 3K8MA 2JELH 1ND0A 3MRCA 4IRZH 4ODHH 2ATPB 3GIZH 3HB3D 4PTTA 5SX4I 1G9MH 3HAEH 3X3GH 4XP6H 3TM6A 2PKDA 5B8CB 3NAAH 3KPRA 2OK0L 1O7VA 1LQSR 3V0VA 5JA9A 4LOUD 3SBWA 3H9SA 4XTRC 3HZKB 3S7GA 5DJAA 3NH7L 4KUCF 4TNWK 1GGBL 3S98A 1HQRA 4L8CA 5HYJD 2E9WA 3W5MA 2EYSA 1A6VL 2E6JA 3BMVA 4ETYA 3W9EB 5IVXA 5E0QA 1FNSL 3GRWH 1TENA 1D9KD 2EDOA 5F1KC 3SGDH 3HRPA 4DQOL 1YY9D 4YBLB 5BZWA 2QQKH 2P5EB 3OKOA 1DEEB 4ZNEE 5MI0C 1HXYB 4ZPTB 3BP5A 1QR4A 5BV7B 3S34H 1KCRL 3BDYH 2AK1L 2WZPD 3QO1B 5BV7H 2DMBA 2DI9A 5DDHB 5GZNC 2HA1A 4MNQB 5I73C 5C92A 2CLZA 4X6CB 2K7PA 5J6GA 2LAGB 3GMPA 4YHNA 2WWKO 3RAJH 2W92A 4F7EB 3SOBL 2CJUH 2NX5B 4MDJB 1ZT7B 2W0FB 4ZUSA 2B1HL 4OFIA 3FB8A 1F5WA 4P4KB 5E9DE 4JQVC 1QG3A 1I9IL 3OZ9H 1TCRB 1R3JA 4WVRA 3F6IA 3DVGA 1JBJA 3C5ZA 3L7EB 4ISVB 5DEGB 1UB6B 4OLWH 1P69B 4L8DA 4M7JH 4W4OA 3V6ZA 1UADC 1CT8A 5ETUA 4JFEB 4JY6A 4X5XA 3MC0A 5EZIH 4H1LB 5HGDB 4MAUL 4P2RD 4MD5B 4DN3H 1A9EA 5DC4B 4X7SH 2W38A 3QIUC 4H1LH 3ZDXF 3RJDA 1CFNA 3MJ9A 1HILA 4LDEB 1JPSH 2W60A 4JFDB 5DMIL 5E08L 2DDQH 4PRHE 3KYMA 5EU7E 1NEZB 1WIUA 1QBMH 1E4WH 2J3SA 2DLIA 1TJIH 1WZ1L 1JPTL 5IHUL 3FTGB 1F8TL 5E70A 4D0BA 3O11A 3VXMA 4V3EB 2GKIA 15C8H 1OCWL 4NOFA 3UYRL 2YWYA 4M7ZC 4OM1H 2FO4A 4JGMA 1ZVSA 3QIWD 5CP7B 3WUWB 1IGJB 4PJCB 25C8H 5I1IL 2K9UA 5ICYA 3C6LA 1HSAA 5D7JD 3RA7L 4QRRD 3VW3H 2VJXA 3IS1X 4FQLH 2BVPA 3FRPG 5EBMA 5I0ZA 1NJ9B 4LKCA 3EGSA 1ZGLM 5HHMB 1YJDH 2B1AL 3E6HA 2R29H 1PEZA 4I0PC 1CLOL 2OMNA 3UPRB 5J06A 5IUSA 4HSQA 5AWNH 1DQQA 4EI5C 3L3JA 3AAZB 1FGNH 2YPLD 1RFDL 5A2IH 2Z93A 4LGSB 4Z8FL 1JTOA 1G9NC 1P7KA 4N9GA 4HKXB 1H15A 5DXWA 3IFOA 1A2YB 1T21B 3VXRD 4NHUB 2X4RA 3TA3D 4CVZA 2XZZA 3LB6D 3QPXL 5GIRA 4I2XE 3O6FD 3SDAD 4JZJB 4PLJD 4CADA 5EIIA 1IZJA 3UTTA 3KPNA 2A74B 2J7LA 2DLGA 5KSBE 1R5IB 3EFFA 4G9FE 1TNNA 4L3EA 5D5MA 2YBRB 4KAQH 3NMEA 3QEQE 1OAYH 1JPFB 3QJFB 3RWJA 1S7XB 1XMWA 4WY7L 1S5HB 3PP3H 3BO8B 3W2DH 4DCQB 5DT1H 2FIKB 4CRPA 4WW2F 2NW2B 1HWGB 4M8QB 5KVDH 2KZ1B 4P9HH 1TNMA 1ZANL 3LZFL 1IGTB 3L3OB 4G7YL 4H5SB 3MV7A 4IOIB 2BFVL 1PGRB 4PV8A 1W72L 3O8XD 3E6FA 2VE6B 3T2OA 3MLZH 1N6QH 3PQYA 1CL7L 3EYQD 5KJRH 3BD4A 1WT5C 4Z7VB 1XF1A 2C4FU 5L88H 2AXFA 4Y2DD 5JZ7D 1CXIA 5D7IF 5DJDB 2WANA 4JQVA 1A7OL 3MV11 4WEBL 2DS4A 1HSBA 1VHPA 4CUCA 4FZEL 2XTJD 5ADOL 5HHVH 1FPTL 3QSKB 4LSVH 5ELIA 1FN4A 4WUUB 3QCTH 1TVHB 5C0CB 2HT2D 4ZTOH 4H8WC 1UWEL 5A1AA 3OKDB 3RU8H 5DFWH 4WW1A 5I8CB 1REIA 4LBEB 2C1PB 5HI3D 3P0YH 2DQDL 1KTDA 1BZ7A 2R0KL 1QVOA 2NLJA 5ISZD 1FBIH 3QI9D 3MLWH 1OAUH 4MX7A 5GRXG 1FGVH 5C09E 1QFHA 3DBXB 2AQ1A 4JG1L 2VSCA 1EEZB 3QHFL 2A83B 1AKJB 3TCLB 1YQVL 4NHCL 1V7NH 4PLOB 1QR1B 1KB5B 3ULUC 5ADPL 1FC2D 3VWJC 2R2BB 3QZWG 3VI4E 3M1BA 2HLFD 3DV6A 1KT2A 4FQXC 1KB5H 1QRND 3V5KA 1PKQB 5DHVA 4W68A 4ODXB 4FTVB 1IL1A 4NN7C 3ARFB 2OZ4H 4UT6L 4V1DD 2MNUA 4HWBL 4Z0XB 3DRQB 3BZ4A 5I75C 3LKNA 1ORQB 4UZGA 2FL5B 4I0PA 1S7UA 1MCCA 4MXWL 3QAZC 4KRPD 2YA2A 4Y4FD 3QUXD 3EYSH 3P4MA 2D9QB 5BOPA 3D0LA 5FKAA 1N4XH 3V6FB 3B2UC 3GUTA 1DN2A 5HVWA 2DYPA 2CRYA 1FQ9C 5IEKA 3OAUH 2N56A 1XIWB 5CWSA 1JPGB 2EDWA 1FCGA 4P2OB 1R3HB 5CEZD 3V6BR 2W9DH 2GSGB 5FA3B 4HUWB 1A6UL 1DE4A 5I30H 1XH3B 3EYFA 1GGCH 4G9FD 4FQCH 1IFHL 4OZIB 3AU1B 3S96B 3D2UB 2ED8A 3PP3K 2DQHL 5JO5A 3MV9B 1QSEB 5I16B 2QV2A 2R69H 3UZQA 5GISH 4F7TB 1FLTX 4D8PA 3G5ZA 3HUJA 3HR6A 1F3JA 2PUQT 4WUKL 3TC9A 3U6RB 4JM2C 5ICXA 3MLXH 1CCZA 3K7UA 1E4XL 2VSDA 1OGAD 2CDEB 4POYA 4N1HB 2XIDA 1FYTD 3CH8A 4K07A 4LNRB 4OIBA 1MCWW 3TLRA 1X7QB 4ACPA 3MREB 5L0QC 2NY6D 2Z8SA 3BP6B 2PO6D 4NNXB 5CMAB 4BFIA 2P5EE 3IDNA 3BQUC 4K3GA 1WT5A 3SQOL 2BNRB 1K8IB 1RAMA 2APBA 3EYVB 2H1PH 3TIEB 3QEGH 2CXKA 3KYOA 3RGVB 3NA9H 3IJHA 1T7XA 5F88A 2I60H 2PXYB 1MFCL 1S7WA 2ID5A 1MIEH 1WVZA 4BSVA 3FQRA 1UCTA 3UTQB 3C09C 3OTTA 3ULUF 3BGMA 4MNQE 3M8OL 2HTLC 4Y4KD 3PWPE 3JWDC 2OJEB 5LGJB 3SDXF 1RZFL 4YDKH 5C0FA 2NX5E 1VB9A 1B4JH 3QIBB 2OP4H 5D2LA 1L9MA 2DQTH 5C09D 3T09A 4HK3N 4KZDH 5KSUB 3CZJA 3HNSH 4PY8I 1T1ZA 2XWJB 2CK0H 4FFWC 2XZAL 3LRSA 4JFEE 5HDLA 4MS8C 2HJFA 4GRLD 4GW5B 4NC0B 2YR3A 4WI5A 4U2ZA 5IB4B 1W0YT 2V5TA 4JZNB 1KIRA 2BC4B 5HDQH 1IC4L 3RL2A 4PDCE 1XZ0B 5DD5H 4JN2A 1BIHA 3VWJA 1FLRH 4JFDE 4RMQA 4LSSL 5D70L 1KXQE 4JFXA 2WY3A 3U7WH 4G8EB 3TN0B 1GGIL 3UTSB 2VKWA 5L8JB 1I9JL 3D85D 1RUKL 5IMKB 1ZA6B 1G7IB 4PRPD 1ZT1A 4ZS7H 3OJ2C 4DUXA 5EOTB 2YC1A 4XAKD 1Y0LA 4WFHD 4G6AC 5DJ0A 4PJCE 4AIOA 3MBXH 1LDSA 3UTPD 4NM4L 4K2UL 1U3HB 2YK1H 3TNMB 3L3GA 4Z18A 1I8KA 4QOKB 2X41A 5I1DB 3I9GH 4JM2F 1MJ8L 1SVZA 3A6BH 4NRXA 5E1AB 5HHQA 1MFDH 2AXGA 2YEZA 5HHME 3CZFA 3REVB 2V2TB 2ZUUA 4NZTH 3V2AR 1U8MA 2BY0A 4KRMB 4R0LB 5LBSL 5ALBH 4MJ6A 3TVMC 2WWMC 5F93C 1JGEB 3HS0A 3TZVC 1WEJL 5MEQB 2FHFA 5KOMC 1BOGA 3HC4H 1IVLA 1YNKL 4P59L 3L9RB 4JLRA 5FYLE 1HHKB 2HG5B 5JQ6H 4CAGA 1OAQH 1WTGT 2VLJD 4NHUE 4OD1H 4ZAKD 1EAJA 4MAYC 3U9PL 3TFKC 5I18H 3VXSB 1NPUA 1PX3A 1HYSC 4K55A 5MERA 4P5TD 4JM2A 3IKCA 5AZEL 3ZLQC 2IALA 1SYSA 5CJOL 5HDOA 4O2EA 4RA3A 5L2KD 1PLGH 4YUEL 1L6XA 1FE8H 1WCBA 4LCUB 4AYFA 2H3NB 3ARPA 3RL1B 3FOMA 4F58H 1VEOA 2YPKB 4DKFL 3QA3B 1XF2B 3NZ8A 3JSSA 1YA5A 2FZ3A 4DVBB 5HGAA 4OV5A 4ZDHB 1NC4B 5DTFA 5DUPL 3NCYS 1FIGL 4IIQB 3PWPD 1I9RL 4DKEH 4GAGH 2APWA 2VXTH 2IG2H 1OOAA 5SWQA 4JPVH 1K6QH 3FHAA 2P5WA 3BKYL 3QNXB 3LEYH 4N5EC 1ZHKB 4X6BA 5BJTA 1YECL 3ZKMC 5FGSA 1UH3A 1JGVH 3ZHKA 4B50A 3O2DL 3C8KA 3TBVB 3TWCH 2R2CA 5GRWA 4JFED 3P40A 4ZFOB 4DGVH 4KVCH 4LCYB 1ZLSL 3F6LA 1BBDL 2YD2A 2DJUA 1U58A 2EDNA 4UTAL 4TRPL 2P8MA 1L0YA 3JVGC 4WUUE 2ZUQB 4QRUA 2BSTA 5C0CE 1A0QH 5JPMB 4MS8A 1HNGA 1TETL 3BN9D 3DHMA 2FJHA 2ZOLB 3SDCD 1R3KA 4PGDB 1E4KC 1IC5H 1MLCA 2X4UB 2YD1A 1IQDA 4RWHA 3QUYC 1CBVH 3PWNA 2BMKA 1T89A 4UI2A 2DTML 3A0OA 2RFXB 2G60H 4XCYA 3AMKA 4JPIB 1SBSH 4HS6B 1BEYL 1CXHA 3N0PB 3OMZA 4MCYA 2NTFB 3C2SA 2XWTB 2YKLL 4L5FH 1FZMA 4CMMA 1AD9A 1FNFA 3KPPB 1DDHB 1BX2A 3P9WB 2CIKA 3S37X 3EYOA 3MO1B 1VENA 3LQAH 5EWIL 2CKNA 1PKQE 1EGJL 3QPQC 4FTVE 1JZ6A 4NQEB 1WIPA 4AENB 1F13A 4GFTB 4GQ9H 4HFUH 5JIIA 1CLYL 2F53A 1U92A 5HDBE 5EUKB 4HHAB 5EC1B 4K7PY 1HN1A 5CCKH 1IBGL 1PG7W 5FYLD 4JVUA 5E4IA 5JW4M 3KVQA 2D7QA 3TVMA 1BD2A 8FABB 4FQQB 4HWEL 3TZVA 3QXAB 2RCSL 4NGHH 3MROB 3SDDB 4RX4D 4Y7MA 3TT3H 5IV2B 1MNUL 4XGZA 3FN0H 1RZKL 3AS3A 5TJWK 3IJSA 4XNXL 2ERJB 1MF2L 2XYCA 1G0DA 2XN9A 3FQWB 3O2DA 3TFKA 3CFDA 1MUJA 4OZIE 4JRWA 1UCBL 4FABL 1EPFA 1AGCB 3MV9E 2QKIB 1QSEE 3JV0A 1NGQH 43C9B 1U3ZA 3CFBB 3KPOB 5TE4L 4QLRA 3G6DL 4G5ZL 5TDNA 5EBGA 1RZ7H 2GAZB 4UT9L 4KHXL 4ONGL 4MA1B 3BVNA 4XHJD 2FYYB 4I18B 1LWRA 1MCEA 1CGYA 3N85L 8CGTA 3CSYA 1J1XL 4U1JA 4UILL 2VL5B 3BH9A 4ELMF 2P49B 4RFOH 4ONHA 1JGUH 1SJHA 5HGHA 1C8PA 4UUJB 3PDOB 1HWHB 1MRFL 5CJQH 4Z5RA 1AY1L 2YN5A 1IAIL 3LN4A 3FZUD 5T5FH 1UENA 5FCUL 3X14B 4WI8A 5C0AA 5EU6B 3ILPB 1F02I 2C3VA 1NAMB 2BNRE 5GGUA 2VXUL 4JQIL 4BH7A 1RZIA 3I75B 4UNTA 2MOVA 2CLRA 4WUUD 4YNYB 1NAMH 1S7QB 4M1GH 5E6IC 1OT1A 3MCKA 1AXSB 2X4QA 5I1AA 2X2YA 2DWEA 2ESVA 3RDTB 1ZLUK 4LSTL 4PS4H 1FAKT 5GRVL 4LGPB 3QEHB 3VGGA 5IVZB 3DV4A 4C56D 4OI8A 4Q9RH 3GMNB 2VLRA 3N50A 2FD6L 4ELMA 2O5XH 3S37H 1GAFL 1Q72L 3UJJH 1URLA 3UXFA 1FH5H 3HB3C 1IT9H 1QYGL 4D0DA 1X3DA 4GT7A 1H3GA 1UA6L 1MCOH 1A3QA 1E4KA 1AKJD 3IJYB 4AG4H 4LVOB 1PFCA 4ODWB 1BECA 3P9MB 3CC5B 1HHIB 1KN2L 2OSLA 4BSWB 1I8LC 3L5HA 4Z95H 1KCGC 1FNEA 2MCPL 1FL6A 4OFYA 2ICWJ 5LVEA 1X6NA 1ZLVK 3U7YL 1CD9B 1MVUB 4Z7OF 2DM4A 2R0LL 3IF1A 1J0KA 1D9KC 1TJGL 3QXDA 1YEFL 5IQ9B 4R7DA 1WZLA 3L1OH 5F6HI 2XZCH 5LAXA 3GSWA 3IU3A 4K3EH 4GS7C 1PZ5A 4G6KL 4OZFA 1A7PL 1CFQA 1KFAL 3TT1H 3P30H 3FOLA 4OD3L 2Q1EA 3KAAA 1LO2H 3INUH 1IAOA 1U0QA 3O3BB 1YMHA 2G5BA 1PJ9A 4LARH 1XIWD 2QHRL 2XV6B 4P2OD 4Y5YA 4HEME 3VJ6B 3WFCL 1MH5A 2ENSA 3CPLA 4LEXL 4QOKE 4MD4B 3VXQB 3JWOH 1YEEL 1SVCP 3DX9B 4XCFL 4CN4A 1D6VL 1RZGA 1HEZB 1U8HA 5J8OA 3D6GA 5D1QD 32C2B 3RY5A 1JFMA 1QEWB 1KCVH 2Q20A 4QYOB 3L3DA 3RHWK 2VTFA 4JFOA 1M6OB 3TO2B 1EMTL 1GIGH 1W8NA 4KHTH 2MCG1 4IOFD 4JG0H 4JM4L 4JKLA 2WP3O 3NOIA 4G42A 1MIML 2R0WL 3BJ91 4QTIL 2ENYA 4K23H 3ARXA 1LO4H 4OTXL 3W39A 4KJPD 2A6DB 2CGRL 5JW5A 5IBTL 1VACB 1JGLL 1PY9A 3VXSE 1V8HA 3DSFL 4PG2C 4DGIH 2EE2A 2A6KA 4MA8L 5FYJL 5IMLA 1NFKA 3MGAA 3NPSB 5EZJA 5KZCD 1M7IB 4R4ND 3NCYP 1QHOA 1P84K 5I8KL 1U42A 2F8VA 1NSNH 1UM4L 3BW9B 1ED3B 4IMLB 3RGVD 3QIWC 4PV9A 5DFVC 3NCMA 3TPKA 4KGJA 2E7LA 1VFBA 3MNVB 5L7XH 3GZKA 1NGZB 3WV0A 1VGEH 4JHAH 2CDFA 3EDDA 3HMXA 2B4CH 3A67H 3PABA 4Z0BL 3BRDA 4PFEA 4MA7L 1QSFA 4FQPA 5DUBB 5ICZB 1WCQA 2XZQH 5E6IA 4NJAH 5ERWA 1A1NA 4KKNA 1EVTC 1MAJA 4X9HA 1G7JA 2NNAA 5I1GL 5IMOB 4XP1H 3BP7B 4HIJB 3WXVH 4LSPH 4GQPH 5K33A 2NY5C 3MJ7A 1JUFB 4XBPB 4ZUTB 2Z9TA 4XXDB 4YHOH 3FO0L 4JRXB 4UV7L 4OZHB 3X11A 2KDGA 2E7BA 3QCUL 2D31B 3TA3C 1N5AA 2CRZA 4S1SH 3LB6C 5CBAA 2VDPH 3EOBA 5ITFB 3V5DA 5JPNB 4U0RC 1MCBA 3WE6A 5F89B 5BRZD 2ZNXA 3O6FC 1DUYA 4PLJC 3O3AA 5C0EA 5ENWA 4KDWA 2YUVA 4I5BB 4CW1A 3HG1D 5HYJA 4JANB 5E00A 2ADIB 3QHZL 2E9BA 4WGWB 3BN3B 1K5NB 2JK5B 1D9KA 4MNGB 1U95A 4JFPB 1OF2A 2KQNA 4PJ7F 4ONFL 2E8ZA 4NO3A 4MDIA 4OB5L 2FBJH 2DBLH 3RNQA 4IRJB 2Q7YA 4FQ2L 1TZHA 3GHEH 3FFCB 3BP4B 2DQUL 2RB8A 1NFIB 2YUXA 4PJ8B 5J0BA 4LSRH 4LAQL 4J3OC 4R3SA 1U8OA 1DLFH 3LKRB 4M93B 2IC2A 5E8OA 5HYSB 2E27L 3VFOB 1QFWI 4H88L 2J6EA 3QFJB 4KPHH 4LSDA 3A6CL 3NIFE 2ZPKH 4NQEE 1HDMB 3O81A 3VA6A 3EYQC 4KKCD 4ZOBA 4J4PD 1JWUA 4Y2DC 5JZ7C 4CVWA 5DD1H 3T0EB 1HQ4A 2ADGA 3GIVA 5SWZD 3FFDA 4PJEA 5FYKU 4P2QB 4NM8H 4XRCB 2XTJC 2AABL 1LMKA 4PJ7A 1OD9A 1KJ3L 2H6PB 2UZYB 4K3DH 2F8OA 3Q5OA 2HT2C 3VXSD 3RKDD 2F19L 1EO5A 4MQSB 4YH6A 1EHNA 5TQ2L 4P2RA 1OAZH 3GSRB 5C6WH 4QHNA 1X5LA 1JHKL 1G1CA 3H6JA 5EBLA 5HI3C 1NANI 3UAJD 4HBCH 2P7TA 4QF1B 3OR7B 3BDXA 4PG2A 1XGPB 5C0BB 4K3HA 3VMNA 2I07A 2VDQH 4UQ3B 3UJIL 4BZ1H 3RGHA 3PWJB 1S5IH 4U6HB 4WO4D 5DD6B 3Q5YA 4KI1A 3VGFA 4IBLT 1FL5A 1RURL 5FK9A 4IJ3B 4BKLA 4N8CL 3TGXA 3QIWA 5EFIA 4A2LA 4JDTH 3MLVL 4ODTL 3LKQB 5FUZL 3IRZA 4I77H 5K9OA 1M05A 4QRRA 1Y6KR 4OSUL 4YHZH 1J87A 3VFGH 1OP5H 2P4AB 4J3WA 2QADB 4APQD 5FO8B 1NC2D 2FEDD 3HI5L 2YD6A 3D0VB 4KRPC 2QSVA 1A6TB 3LKPA 5KW9H 5DF0A 3QUXC 4OLUH 5LG1A 2YPLA 5EU6E 5MHSE 2JIXB 2O5YL 3PGDB 3SDYH 1AO7B 1U8LA 1N8ZB 5T1MA 4AL8H 4ORGA 3G5XB 3IFLH 4PR5B 3CLFL 3EOAA 3IDMA 3ROLA 3PHOA 5LCVL 4IHOA 4N0CD 2ADJB 1OSZB 3AS0A 3F5WA 3VXRA 1TZGL 3L3HA 3CUPA 4JR9H 2V2XB 3TA3A 3PGCA 4JDVA 4RFEA 4M7KL 4OLVL 3WUZA 2BJMH 3X13A 1LQVA 2FWOA 4Y4HB 2Y07L 4EOWH 2XRAL 3CXDH 1BAFH 4ALAH 5IR1A 3O6FA 3Q48A 2IF7A 4OIAA 4O5LL 2DM2A 3UJTL 1KTRL 4K7PL 5EN2B 4JHBA 5LXGL 4EDWL 2VDOH 1IGIL 5JNYB 3L5WB 4R7NA 1MFBH 5E2TH 3PJSB 1NCDL 4U1NB 4OCWH 3U1SH 4KFZC 4P3DA 4UB0L 5DRWB 2BDNH 3CMGA 2Q6WB 5TF0A 3QXUA 1J5OL 1ETZB 4V2BA 1G7PA 1ZEAL 1WBZB 1FZOA 5DJ2B 3ZTJH 5JHDB 4N9OB 1WC7B 2Z4QA 3P73A 4XNMA 1QQDB 3S35X 3VWKD 3W11D 2NY6C 2XICA 5E2VL 1TTFA 1C12A 4PRIA 3MBEC 4WCYH 4D9LH 2OTUA 5FYKE 2JCCB 4UIMA 5CBEA 3Q6GL 4Y2DA 1AFVL 2A38A 5C07B 3BPCB 3QNYA 4C59B 1EXUA 2VR9A 4UIKH 2BNQB 3MRFA 3RZCB 1CICD 1NH6A 4XZUB 3U0TA 1J1PH 3STLA 3DROB 1RMFH 3VFSB 1E6JL 2NY4C 5KTEH 4X6DE 2E9IA 2P24A 2RGSA 3FONA 3VE0A 2EYTB 1YEKH 5IT2H 2JE8A 3BGFB 5IJKC 3T3PF 4L4VE 2ITCB 1I7TB 4L9LC 1YC7A 1MRDL 2DOCA 5JUEL 3U9UA 3ULSB 1QPPA 1JYNA 4AY0A 3RX8A 1AH1A 4ERSL 5IWLC 1W2KT 1PG7X 5JOPE 4YXLH 1QHPA 3OGCB 4GBXD 5MP6L 4HS8H 3RPIB 5F7LB 3V5HA 2C4XA 4DN4L 4X9FA 3D39D 4LSUL 5ISZA 3KPLA 3ARGB 2AV1B 1HCVA 3AVEA 2HH0H 4PY7B 5DRXA 4FS0A 3U79A 2CO6B 4GRLC 1E6OL 1A3LH 3DVFA 1OP5K 2HJLA 2AK4B 4NCC2 4JFFB 4U7SA 2GT9B 4HIHB 5BS0D 3HE6D 4HXBH 2IAND 1LE5A 1I1AD 4AT6A 2H32A 4PRDB 1QRNA 1I7RB 5CUSL 3F7RA 4HC1A 4RAVB 5C08B 5F3BB 2IQ9L 1VADB 3CK0H 3LV3A 3CLEH 4WRLA 4V1DA 3VH8B 3EOTH 4NBZB 1FVCB 3KXFB 4PJDA 1XF5A 1MVFA 5BVJA 1V5JA 5FHAH 4EQ3A 3VFMA 5HJ3A 1IMHC 4NPYA 2GK0A 3QUXA 2XQBH 4XNUL 4AH2B 4X6FA 2R0ZH 4HKZA 1S7RA 2QBWA 3N1FC 5DUML 1RU9H 2BVTA 4HWZA 1LO0L 3DYOA 2GJ6D 4K9EC 3S5LG 3MOBL 5DJZB 4LAJH 1PEWA 3UBXG 4DVRH 2VDLH 5I1HH 3TCXA 3GO1H 1RI8A 1CF8L 1IKNC 3ULVF 2PCPB 5C2UB 1F97A 4NIKB 4F3FB 4YE4H 3B4NA 1DUZB 5JLZA 1CD1A 5DHXB 3SE8L 3VXOB 1ZA3A 2NXZD 1T83C 2ZCHH 4Q6YA 1HXMB 5KSBA 4PJAB 5F71A 3V4UH 4P5MB 5CKGA 4E41B 3MV01 5B39G 3VXUB 4JRXE 1MCIA 4OZHE 1UKTA 3WN5B 1KCUH 3HE7B 4NRYB 2DQCL 4O58L 3WXWH 2A1WL 5TGBB 4P23D 4ZAKC 3PG2A 5GGQH 4B7IA 3EBAA 1XR8A 3RQ3A 5JR1H 2X4PA 4P5TC 4OFKA 3VRIA 1N7ML 3BISA 3ZKNC 3HRZA 3CVHL 1OGAA 1WBYB 4O2CA 1GC1H 2WWKT 4MJ5A 3KPSB 1NCAL 5E2WL 1FYTA 3O0RH 5DQDL 2PTVA 2G75B 3PNWB 5FYKD 5SX5K 3E3QC 4QXUH 1IM9B 1CVRA 3MV8E 4MNHB 2UYLB 4JFYA 4X80H 3N1GC 5EZOL 2JELL 1ND0B 3MRCB 4MNGE 5ANMA 3X12A 1QP1A 4IRZL 5E95B 4ODHL 4PTTB 3MBEA 1QLFA 3GIZL 4RDQG 3RJQB 2D0GA 1PG7H 1G9ML 4QHKJ 4ZTPH 4XP6L 3FFCE 1P5VA 3VDBA 3KPRB 1A3RH 2EE6A 3GDBA 4HX1A 2D3VA 3NAAL 4L4VD 4Z6AT 3V0VB 2FX9H 3BWAA 3H9SB 1ES0A 4JFHE 5DJAB 1DZBA 3QFJE 4JCLA 4Y4KA 1MHCA 2J2ZA 1R3IH 1HQRB 4Y5VC 4L8CB 3G9VA 4N8PA 4EN3C 3ROOA 2EYSB 4GAYA 2XY1A 5IVXB 3OAYH 1DBBL 1EO7A 2BVEA 4U7KA 5EORL 1Z6JT 4L9LA 3T0EE 5BZWB 1WFNA 1QFUH 3WJJC 3OKOB 1PW3A 4X7TA 4P2QE 1YYML 1H9VA 2NQCA 2YD7A 3BP5B 4DKAA 2J5LC 1L7TL 4D9QD 3BDYL 2GIYA 5BV7L 4NSKA 5I2IA 2IADA 1EH9A 3ESVF 4U1IA 5A2JH 4GMSL 1SEQH 1RIHL 3O3DA 4GRLA 3BN9C 3IXTA 1IQWL 2NY0D 3VGBA 3WKNA 2CLZB 3SDCC 1CXFA 3FT4A 5J6GB 1FFPA 3GMPB 5JW4N 1YNLH 4YHNB 5D6DC 4FXGA 3QUMA 3SPVA 3RAJL 3MZGB 3NCJH 3MXWH 1MEXH 3OX8A 4RGMB 4XCCL 2R1YA 1T04A 4ZUSB 3MTRA 3FB8B 1FG9C 1RJYA 3FN3A 4YBQC 1JJUA 3KHOA 5C0BE 1IEHA 3V52L 4DWHA 1R3JB 3D85A 3DVGB 3OZ9L 3C5ZB 5HYEA 4OI9A 4PRPA 4LCIL 4AQOA 5IW6A 2HT4D 2CMRH 3EAKA 4L8DB 4ZOCA 3V6ZB 4M7JL 3DXAD 1CT8B 2J8HA 5ETUB 4M9OA 4HIXH 4JY6B 4X5XB 2I9LA 2HN7A 3U4BH 5EZIL 2VH5H 1A9EB 5HSFA 4DN3L 2HRPL 4LPTA 2XKSA 3NFNA 1U8KA 1TQBC 4X7SL 1CFNB 1HILB 2W60B 3O6KH 4PJXF 5A43C 2D9CA 3KYMB 3MJ9H 3OPZH 1IKNA 1QBML 1E4WL 5EUOF 4N0FA 1QKZH 4PJGF 2RHEA 5FGBC 4D0BB 5CEYA 3O11B 3VXMB 4KV5F 4S0SD 4Z78A 5J11B 5JW3H 3B83A 2FO4B 1ZVSB 1AO7E 5GS0D 5DD3L 5ICYB 1Z0NA 3C6LB 1HSAB 5AG9A 3P9LA 2EO1A 3VGDA 3NH7H 5J3HD 2EYRA 3MRRA 2BVPB 5EBMB 1G7QA 2VLJA 1GGBH 4LKCB 3EGSB 4OGXL 4B5EA 3QCVH 2FJGA 2FH8A 4ZAKA 4OUOA 5AAWA 1YJDL 3E6HB 4MXVE 3LN5B 4HH9A 4OCNC 1FRGH 3MV8D 1A6VH 5GHWL 4CU8A 1F2XK 1WLHA 2W9EH 4P5TA 4NNYA 1WBXA 3MYJA 1IC7H 4PJXA 2GI7A 1DQQB 1KNOA 3L3JB 3QWRD 4HDIA 1N5YL 1Q1JH 5L2KA 2Z93B 1BQHA 4PBVC 1C7TA 4MLIA 5GRYA 3BPNB 1WAAE 3QWOA 1P7KB 3E3QA 4N9GB 5EUOA 1H15B 1KCRH 2BNUA 3LPWA 5T1KD 3IFOB 1YPZA 2AK1H 3PXHA 1J05A 3VXNA 1YEJL 5F3HA 5F96L 3MLTA 2C26A 4JFHD 3R0NA 5TE7L 2X4RB 3HAEG 3K2UL 5FYLL 4CVZB 4EUPG 1TZIA 4Y1AD 5F6IC 3DO7A 3PWPA 3OAYK 5JHDE 5SV3A 1H5BC 4M6OH 1RZJC 4MCZA 4S10A 3SOBH 4P46C 5GIRB 5L8LB 2B1HH 4JZOA 4CADB 5EIIB 1VPOH 4EBQL 3DYMA 3UTTB 4Q7DA 1JNHA 3KPNB 1I9IH 1ZMYA 4Y5VA 1N2RA 4OZGF 5DGQA 3EFFB 1Q9LA 4EN3A 1BJ8A 3GJEA 2IAMC 4QRTA 4UBDC 4L3EB 4XVJL 5D5MB 3RWJB 3P4NA 1OAYL 4BUHA 2BNQE 4MZ2A 5IHBA 3WJJA 5CGYD 3W2DL 3BI9X 5DT1L 4MAUH 3PE9A 5MI0B 4WI7A 4KK9C 4LVNC 1QBBA 5KVDL 4F37K 5F7MC 4DZBA 4ZFFB 3MV7B 5E08H 4L8BA 3BYYA 3KWWA 4PV8B 1T1XA 4A6YL 5I73B 1EFQA 1FG2A 3E6FB 5EOCL 1JPTH 3PQYB 2VLKA 3SDCA 1F8TH 5HBBA 5D6DA 3VD3A 2AXFB 5L88L 4E5XA 4QGTA 3UYRH 3I6KA 1OY3B 2P1YA 1H3UA 4BFBD 1HSBB 2X05A 3QUKA 5HHVL 4X9IA 4M48L 1FN4B 2AK4E 1GSMA 4JFFE 4LIQH 4RMTA 5K59F 3QCTL 2B7DT 5C86A 5FCSH 4NWUH 4I0KA 1ROWA 1YNTA 4WW1B 1XGTA 5CIPA 5C08E 1H0DA 4DKDC 1KTDB 1BZ7B 3P0YL 1QVOB 2NLJB 1RFDH 4YX2H 1YUHA 4TYUA 3KXFE 1FBIL 1GOFA 3GB7A 4DEPC 2ZP0T 3MLWL 4MX7B 1OAUL 1FGVL 2DQGL 1NEZG 5E8PA 4HGWA 3Q0HA 5FGBA 1P1ZA 5C3TA 4M7ZB 4RWYL 4TTDD 1ULVA 3M1BB 4RGOH 1JF1A 4HW6A 4RX4A 5D1QC 3DV6B 1KT2B 3V5KB 43CAA 5DHVB 4YAQA 1KB5L 1IL1B 1DEDA 3S8WA 4G8IA 2OZ4L 5DHVH 1Z9SA 2FHBA 3BZ4B 3LKNB 3V79C 1CGVA 1A7RH 1S7UB 4I0PB 2A73A 4PJAE 4U6VL 2NMSA 4E41E 1LDPL 4O51A 3DNKA 4WY7H 3VXUE 4DUWA 3P4MB 3D0LB 5FKAB 3IT8D 3HI1A 2HTKD 2AERT 3GBLA 1N4XL 3GUTB 2DYPB 3UEZA 1CWVA 1TTUA 4KJPC 2HFEA 4NKOA 1JMZA 5IEKB 1ZANH 2ICCA 5CWSB 3NIDE 3VMPA 3OAUL 4A6YA 2V7NA 2O61A 1G9NH 3JV6A 1X4ZA 4DK3A 4NNPL 2BFVH 1QBLL 1YN6A 1W72H 2W9DL 1XFPA 2GEEA 1DE4B 1FJ1A 5FO9A 5I30L 2IFFH 2UUDH 2Y6SD 3EYFB 3LD8C 1BFSA 1GGCL 1H5BA 1T1YA 3V0WL 4FQCL 4JJ5A 4D2NA 1UQSA 1J11A 3ET9F 4P46A 4WWKD 4ZUVA 4YHIA 5JO5B 1YC8A 4LLDA 1C5BL 1UC6A 2W07A 5F7HA 4WEBH 1A7OH 3QG7H 1AXIB 5TE6H 2R69L 4JFZH 5IHZA 3D9AL 1TMCA 4MVBD 5KS9F 5GISL 1Q0XH 4D8PB 3WFZA 2F5BL 5F1SA 3G5ZB 2NY2D 2HJKA 3HUJB 1F3JB 5AEAA 3KPRE 3ZO0A 1D5ZA 2DI8A 1FAIH 3MNWA 5ICXB 3T3ME 3H9SE 3MLXL 3MRKA 1J0JA 4IDJL 4HXAL 1P4LA 1F4AA 4Q9CA 3FKUS 2DQDH 3WL9A 4C56A 5IQ7H 4BFIB 1X5YA 3ARGD 2Y25A 3IDNB 3VDCA 1CDYA 4KK8C 5CINL 3SCMD 2R4RL 3RWFA 3LAFA 1YEGH 3KYOB 3CFEA 2H1PL 4NHCH 2ZG1A 4RMUA 4QHMA 4YGAB 3IJHB 5F88B 5ADPH 1S7WB 2I60L 4BSVB 3FQRB 3PDGA 4JVPA 1XCQA 5HHOD 3M17A 2AJXL 2FECI 3X3FL 3KS0H 3BGMB 3GMLA 3LPGA 1I75A 2F15A 1INQA 3P0VL 1MQ8A 2J8UF 3SHSA 1BLNA 2YD5A 1DQML 5EU4A 5C0FB 4YDKL 2MWCA 3ARUA 4NN6C 5D2LB 3WS6C 2OP4L 2MMXA 2DQTL 3EJZC 3ARQA 1T1ZB 4WEUD 3HNSL 2VXSH 4TNVF 3HA0A 1L4IA 3CX2A 5GS3A 3UCRA 3QJHA 3T08A 3LRSB 2KQMA 2HJFB 5LGKA 1P53A 5IB1A 1KIRB 2P44B 4KKCC 3RL2B 4E0RA 4J4PC 5F1NA 4JN2B 5DD5L 3VWJB 1MHHA 1IFHH 4JFXB 5D1QA 4KI5C 3U7WL 5KANI 4WV1C 1QACA 4NN7B 3MUHL 4NUGL 2HMID 1VGKA 3RWEA 4NBXB 3VXME 1ZT1B 2Z8WC 1VEMA 1D5BA 5I75B 1OSPL 4Q6IC 2YC1B 3X17A 3LDBB 1Y0LB 3BEWA 3QAZB 4Y19D 3LKOA 3WFBH 1JWMA 3MBXL 3CAFA 3L3GB 1I8KB 2UUDK 4G8GE 4MXQD 5HHQB 4NRXB 3A6BL 2AXGB 4XP4H 1MFDL 2YEZB 5CGMA 3CZFB 2FCBA 4GLRH 1CXLA 2D4DA 1U8MB 1WFUA 4NZTL 4U4BA 4YFLF 4MJ6B 1KENL 1W0WA 4WFEE 1CG9A 2AJ3A 1Z9LA 4WO4C 3HS0B 3SQOH 2ZKHL 3BH8A 1BOGB 1JZ5A 4JLRB 1MFCH 3KPMA 2D03H 3BXNA 1A4KA 3M8OH 4J2XA 3GBML 4BFGA 4Q97A 4RAUA 4LP4A 1IM3A 5MERB 1RZFH 4APQC 4RQQA 2FEDC 4JM2B 3IKCB 2PYED 4FZ8H 4YJZL 2IALB 1SYSB 3FN9A 3U4EA 4O2EB 3P11H 3ZKXC 1PLGL 1WCBB 3SO5A 3JTTA 4CN1A 3FOMB 4OCYL 4L3EE 5D5ME 5L0QB 3PL6D 1JNJA 1Q9WA 3AB0C 3NZ8B 1WITA 2FZ3B 4OV5B 5HGAB 4RFNC 4UV4H 4QRPA 4N0CC 5DTFB 1AE6H 2QTEA 2ARJA 5DFTA 3RVXD 4CBPA 5ECJE 3UC0L 1FDLH 4GAGL 2DQIH 5HYFA 3MV7E 5SWQB 4LSSH 5BRZA 3C09B 3CFJA 2CIIA 3NFSL 2DJ4A 2P5WB 2V2WA 4YWGL 3G5VA 4KI5F 3PQYE 2X1OA 1I9JH 3L3KB 2WUBH 4U1GB 4X6BB 1T7ZA 5BJTB 4LPYA 1SYVA 3HG1A 3LEXA 4ODSH 1IAKA 2GJJA 2Y36H 3LH2H 1JGVL 3C8KB 1NUDA 3P3YA 5CD5D 4OD2A 4DGVL 4KVCL 1U58B 1DVFD 4LIQE 1QFWM 1MI5E 1AHWC 2I9TA 3GMQA 2A0LD 2IEPA 1MJ8H 2P8MB 3LKSA 3QDAA 1IGMH 1T2JA 4QRUB 2BSTB 1LK2A 5EU5A 4XVTL 3VWKC 3IKKA 3W11C 1A0QL 2ZZUT 3BKML 4N1CA 2SEBA 5E94A 2FJHB 1R3KB 1FZKA 4HUVA 1MJUL 3QRGH 1MLCB 3OB8A 1IQDB 4J4PA 1GZQA 5DD0L 3PWNB 2BMKB 3BMWA 1AGBA 1WEJH 4O02L 4WIQA 3ZDYE 4C58B 1W8OA 2JJVA 3OKKA 4XCYB 4FQHB 4QHUA 4S1RL 4WV1A 5IF0A 1YNKH 2HP4A 4P59H 9CGTA 5SWZA 4IDLA 4MCYB 5D7IE 2BK8A 3C6LD 4ZO6A 4G8GD 3S4SA 1FZMB 4CMMB 1AD9B 4Q6IA 5T33L 1BX2B 3ALXA 4XAWH 3U9PH 2CIKB 3EYOB 2BHYA 3EJJX 4X99A 4XBEL 1AI1H 3LQAL 1RUMH 3I02A 5AZEH 1A1OA 3MRJA 4GQ9L 4GBXC 2F53B 4NQVA 1KXVC 1U92B 5TPWL 3ZT6A 4M8VA 2XXCB 4OJFH 4DKFH 1RULL 4JY5L 4HUXA 3TVMB 3GJFK 4BQBA 6FABL 4WO4A 5DUPH 2D0HA 2AGJH 1BFOA 3TZVB 1FIGH 1KJVA 3QUZD 4XNQA 3HE6C 2RAMA 2L4OA 1I9RH 5CAYB 4EKXA 1MAML 1NMBL 5DQJA 4XGZB 3FN0L 3IJSB 2IH3A 4ZMAT 3BKYH 4UMGA 2XN9B 4OQTL 4AIZA 1YY8A 3CFDB 1YECH 4ODVH 1MUJB 4APQA 3ZT5A 1NC2A 4M7LT 2Y9RT 3O2DH 1RUQL 5DVKA 1KEMH 4PGCA 5DJ6A 2DKMA 3D3VA 1BBDH 3CFKA 5TDNB 2DLTA 4LLWA 4UTAH 1F6LL 5FM4A 2VABA 3BVNB 3NZHL 3HUJE 2HKHL 3WFEH 4G9DA 3CSYB 5EOQL 1HHGA 5GZND 4U1JB 4N0CA 1FNHA 1TETH 5MEOA 3BH9B 3OKNA 3VXPA 1U8IA 4P4RA 3PQYD 3RWIA 5FEBA 4FP8H 1SJHB 4ONHB 5HGHB 2AEIT 4NO2A 4Z5RB 2ZUYA 3I2CH 5EA0L 3MSPA 3LN4B 2DTMH 3DURA 4K94C 4LRNH 3MRNA 4R96A 5C0AB 3S3SA 1BEYH 2BCKA 3EO0A 2C3VB 1KTLB 4PB9L 1MI5D 5GGUB 5T1LD 5F7KC 1J7VR 4P23C 3SGEH 4BH7B 3V8OA 1RZIB 1ZHNA 5F21B 2CLRB 3L5XH 3BPLC 1K4DA 1NAML 2X4QB 3CSPA 1S7TA 3MCKB 4M1GL 5I1AB 2DWEB 2ESVB 3ALWA 1JI2A 4OF5A 2BSSA 3QIUD 3DV4B 1CLYH 5ACZA 2GSIA 3L5IA 2VLRB 3VWKA 4ELMB 5D2LE 2O5XL 3BUTA 4MZ3A 1IBGH 2R23A 4WDIA 3S37L 2E6QA 5IB3A 4N90D 4YIQA 4D0DB 1FH5L 1IT9L 4LFHG 4X8JA 5E7BA 1MCOL 3SE9L 2BVOA 4AG4L 2PYFA 2WP3T 1FP5A 1ZK9A 2RCSH 1KPUA 3GSXA 3MQIA 2OSLB 1PQZA 5DA0B 1KJMA 1FNEB 4Z95L 1FL6B 1MNUH 4LLMA 3ZE0E 1RZKH 3O9WD 1MF2H 1FNGA 1RUAH 1PSKL 2QL1A 4GMTH 3ULUE 3IF1B 3LEVH 1FORL 3H0TA 3IAPA 1UCBH 3QXDB 4R7DB 4QXWA 2XA8H 5J56B 2Z92A 1IILE 2F74A 5LAXB 3GSWB 2XZCL 3IU3B 4EI5D 1PZ5B 4GBXA 4OZFB 5GRZA 1CFQB 1LO3L 5DEFA 4LF3A 1EJOH 2DYPD 4TUJA 3D39A 4OZFH 1IAOB 2VXQH 4N68A 5FYKL 1YMHB 2G5BB 4KHXH 3INUL 3LPFA 3QG6A 1JL8A 4LARL 4M5YH 4Y5YB 3C8HA 3MLSH 1JF5A 5CFHA 4OAWA 1J1XH 1BF2A 1MH5B 3CPLB 4F57L 3IYLW 1ITCA 3W0WA 4UILH 1RZGB 3CD4A 5BS0A 1U8HB 3HE6A 5DVMA 2IANA 2QQLL 4JJHA 1MRFH 4BH8A 4R8WL 1I1AA 5D71H 3OXRA 1IAIH 2XACC 4RZCA 2FRGP 3L3DB 2I27N 4JFOB 5FCUH 1JZ8A 2Y5TA 2OTWA 4P2YA 4QTHA 1GIGL 2HT4C 2JJWA 1NCUA 3AMLA 4KHTL 4JG0L 4U1MA 4JQIH 3MRHA 4G42B 4PB0H 1MHEA 4P49A 1CE1H 1JPST 2ARWA 5AUMA 1J8KA 2J88H 4CU7A 2V5MA 1I4FA 4LSTH 4Z7UF 3W39B 1H3XA 2GJ6A 5JW5B 4YPJA 3GHBL 3GSNA 2A6KB 2Z35A 5EU3A 4OCLC 3TBWA 5IMLB 3K0WA 5MEPA 5EZJB 1GAFH 3PWLA 2UZXB 3SJVA 1OARL 1QYGH 1JRHH 3QH3A 5C3LD 1UA6H 4M62H 5TH2A 2DQFA 1E0OB 5AAMA 4PV9B 4LLYA 3MLYL 5GS0C 1VFBB 4ZXBD 3QB7C 1KN2H 5BXFA 4LLQA 4HAGA 4CL7A 2CDFB 5JA8B 1VGEL 4AZ8A 2MCPH 5J3HC 4NCDA 2B4CL 1NLDH 3PABB 4TSBH 4P23A 4OZ4A 3HMXH 1QSFB 1C5DA 4ZQKA 2R0LH 5E6IB 1A6ZA 2NXYD 1VFMA 4HV8A 5ERWB 4Z7UA 1A1NB 2Z31D 4NJAL 1FZJA 4R26L 4Y16C 3ME0A 1TJGH 2I26N 3E2HC 2P5WE 3HKFA 4M5ZL 1G7JB 5A3IC 2NNAB 3UZEA 2P45B 5JMOC 4XP1L 1A7PH 4RA0C 3WXVL 3MJ7B 4JREC 4LSPL 2IPUG 1CFSA 4YHOL 3X11B 1FNLA 1UKQA 4JE4B 2VB5A 3ORJA 2DIJA 4LVHC 3GK8H 1N5AB 4G80A 5I17A 4LEXH 4X6DA 5CBAB 3EOBB 1EBPA 2GJZA 3MODH 5J1AA 3ULUD 3V5DB 3C08H 3WE6B 4L4VA 3QDME 5DRNA 1DUYB 3O3AB 4FQXD 5C0EB 4J6RL 3JTSA 5ENWB 2A9NL 4K7FA 2VZOA 1AR2A 4CW1B 5HYJB 5IK3A 2FNBA 5E00B 3EYUH 3MX0A 2DKUA 3FO2A 1XT5A 4PGJA 2P42B 1EMTH 1J1OL 1D9KB 3UBXA 1U95B 4JM4H 2V6HA 1OF2B 5LQBH 1OL0A 3MGOA 4NO3B 5CILH 4MDIB 1VCAA 5CGYC 3RNQB 3MR9A 2Q7YB 1HIMH 1TZHB 4M43L 4GS7B 4QTIH 3GHEL 4NZJA 3RP1A 3TEUA 3J8F7 2CGRH 1RSFA 4R3SB 1U8OB 1JGLH 4RDQF 5E8OB 1AD0A 1C16A 3N1QC 4ZODA 1FVDA 5K93A 1UFUA 3KNBA 2J6EH 1ORSA 2KH2B 1JWUB 1UM4H 3JV5A 1KYOJ 1IKFL 5DD1L 3OF6D 1HQ4B 1RVFH 2ADGB 4PBWD 3SKMA 4Z76A 3GIVB 3VFRA 2IWGA 3VRLF 3FFDB 4PJEB 4PJFF 5DQ9A 5GRVK 3K3QA 1BD2E 2PN5A 2VDRL 4NM8L 4RISH 3ZYZA 4PJ7B 2GQHA 4EZMA 2OR8A 3D25A 2OXHA 3DXAA 4MA7H 4TNWF 3V4VH 1OAKH 1KF9B 2CLVA 5I1EH 4P2RB 3QP3A 4JM2D 4HGMA 4QHNB 1XF3A 3TBYA 5EBLB 1GYAA 3HNTH 3L7FA 2P7TB 2XN9E 4HBCL 1C1EL 4GXUM 4EEEA 2FEEI 3MLPA 4NDMA 2I07B 3FO0H 3O6LL 3D87B 3QRFM 3BQUD 5I19L 1S5IL 2KKQA 1FL5B 2V5SA 5FK9B 4BKLB 1ADQA 2DL9A 3RNKA 1K2DA 3NFPA 3QIWB 5EFIB 4PJFA 4HBQA 4JDTL 5K9OB 4YLQT 4ODUA 4KMQA 5D7JB 4ZFGH 1M05B 4QRRB 4CKVX 4N0YL 4WU7A 3ZT7A 3FQNA 5H35A 4GW1A 5DZLA 3RWDA 2DLHA 3MV8A 2C9AA 3QHZH 3LKPB 3MNZA 4OIIL 5KW9L 3E2HA 4U1HA 4OLUL 1QLRA 4ONFH 4X7FC 1NBVL 5C9KA 3QWRA 2YPLB 5HYIA 1VFOA 4Z7WA 3VI4F 1G6VK 2DQUH 1U8LB 3SN6N 5T1MB 5T1KA 4FFWD 4ORGB 4W81A 3B9KD 4LAQH 5LGHH 3IFLL 3BD3A 3EOAB 3QDMD 2NY5H 2ESVE 3PHOB 5HI4C 4IHOB 3RKPA 3ROLB 3W9DA 2E27H 3F5WB 3VXRB 4H88H 3L3HB 4P4KC 3A6CH 3TA3B 3PGCB 4RFEB 4Y1AA 1A22B 4YK4B 3X13B 3CU7A 2FWOB 4U0RB 4HLJA 2VLRE 4WWKC 3VFNA 5IR1B 1FFRA 3O6FB 1MPAH 4ELME 1BAFL 2DQEL 4J3VA 4ALAL 1G9EA 1YDPA 2VZSA 5CD3A 4YHLL 5DK2A 4MVBC 2FB4L 3F65A 2VDOL 4B0MM 2AABH 4R7NB 1FL3A 1NFDF 5E4EC 1F45A 5E2TL 4P3DB 4OCWL 3SGJC 4E42A 2CDGA 5IFAL 4PJHF 4KK5D 2F19H 5CSZA 1G7PB 4NJ9L 4JPKH 1FZOB 1UWXK 2Z4QB 4PGEA 2BX5A 3FQTA 3P73B 5IBUB 4XNMB 4J23A 4ZD3L 2D7MA 4G59A 3BT2L 1C12B 1NUNB 2AJUL 4AIXA 3SCMC 2OTUB 4WCYL 5F7WC 4D9LL 2VISA 1KCLA 4UIMB 2WWMD 1BD2D 1UH4A 5CBEB 4Y2DB 3QNYB 1DBML 1RURH 1CQKA 3WDJA 1EXUB 4S11A 3C6SA 2HVJA 4UIKL 3MRFB 4N8CH 3F12A 2EE9A 3U0TB 4UDUA 5IM7A 3STLB 3MLVH 5FUOL 1NFDA 5FUZH 1SM3L 2XTJB 5KTEL 1NUFA 1A6WL 2UWEF 2P24B 3FONB 4OSUH 3VE0B 4PJHA 3ELAT 4MAYD 5IT2L 2VWEC 3BZDA 1PAMA 4N0RA 3U9UB 2W65A 3HI5H 4FXLA 1NMAH 3ISWA 4NC2B 5HY9A 4Z7OE 5KSVA 1S7VA 4HT1L 4BQ8A 3B9VA 3KJ6L 3HAEA 3V5HB 4EUPA 2E7CA 3ES6A 4M3KB 5ISZB 2O5YH 3KPLB 4LCWE 4MB3A 3SKJL 5DRXB 2HH0L 4X6CF 3WMSA 3CLFH 4NUJA 5GSRA 5LCVH 4AK1A 2HJLB 1TZGH 1TITA 1X4YA 1LE5B 4OLVH 4HXBL 4AT6B 3GRWA 3MRDA 4RBPK 1MRCH 3VD4A 2H32B 1OVZA 1QRNB 2UWEA 3AM8C 3LV3B 3H3PL 3CLEL 2HMIC 2H32H 3UJTH 4V1DB 2DICA 1ZLWK 4N5ED 1A7QH 4P9HC 1KCKA 3EOTL 4EDWH 1CZ8L 4PJDB 1XF5B 2B8OT 1JNLL 3ZKMD 5BVJB 2EXYC 3VFMB 4MD0A 5HJ3B 5FHAL 3NN8A 4KRPB 2UY6A 1OQOA 4NPYB 2GK0B 3QUXB 4TSCL 3QDJE 1FFQA 4X6FB 2ESVD 3DGGA 4HKZB 4XX1E 4YHKH 5D1XD 1S7RB 2R0ZL 1J5OH 1XGUA 1RU9L 1GGTA 4HWZB 2Y1VA 1ZEAH 3T0XA 5FB8A 4P3CH 1A9BA 1ZXQA 5EZLB 4U6XA 2R1WA 1B3JA 1EEYA 2VDLL 5KVMC 1QSFE 4IMKC 3GO1L 3ARWA 1WFTA 5JLZB 1CD1B 3L3IA 5CEZH 1ZA3B 3JTCA 4NT6A 1TQCC 2IPKB 3JUZA 3LSOA 5KSBB 2ZCHL 1DL7L 3GI8L 4PJCF 3ZL4H 3QUYD 1EIBA 3Q6GH 4X6EA 1AFVH 4WWKA 4F15C 2Q76A 3S35L 1L9NA 4IRSD 1J0ZA 3N9GL 4MVBA 1NKOA 1E6JH 2XWBA 3WXWL 2ADFH 4KRLB 2QQNH 3SGJA 3ILQD 1XR8B 5GGQL 2IJ0C 2X4PB 2K7QA 5JR1L 3VRIB 1JN6A 3PHSA 5JUEH 1W0VA 1QPXA 3OJMB 2E7MA 3QPQD 3MCLL 4GAJH 3ZTJG 3HRZB 5GJSH 5IMMA 1OGAB 5KG9A 3NVQA 2ICES 4O2CB 3PF2A 3K46A 4MJ5B 4Y2OA 1GC1L 5MP6H 1FYTB 3O0RL 5GGVL 5SWSD 3D69B 4JFYB 3PL6C 2NY6B 5ANMB 4HJJH 1L7IL 3X12B 2I24N 3HPLA 1QLFB 2CKBL 2VR5A 1LK3H 3SCMA 1E6OH 3HFML 1ERNA 1KJ2A 1PG7L 5CKAA 3ARFC 2M1KA 4HX1B 1A3RL 3NCEB 3BWAB 2V9TA 1ES0B 5A40E 2DN7A 2FX9L 2ZG2A 4YDLC 5DJCA 5HHOA 3OL2A 1GL4B 1XAUA 1E27A 5CUSH 4JHWL 4Y4KB 1MHCB 1R3IL 3VFVA 3GI9H 2WK2A 3S6CA 1MFEH 3GGWA 4OLXL 1H3TA 5ESAA 2YSSA 4LCWD 4L9LB 5CD5C 2VNCA 4JO1H 1FCCA 1AR1D 1QFUL 3V4PH 1U8QA 2Q86A 4CDGC 4PJEE 1BGXL 4X7TB 5IB2A 1B9ZA 3W5NA 1DVFC 2JLLA 5DUMH 5MEND 2A0LC 4PJ7E 3HR5A 3WNLA 4X98A 3OAZK 4OFPA 3MOBH 2LVEA 4NSKB 5I2IB 2IADB 2FX7L 1I3UA 3ABZA 4U1IB 4D3CH 1RHFA 4F7CA 3O3DB 4GRLB 2JJSA 3IXTB 4P2RE 4FHBD 4Z7VF 3FT4B 2B5IC 1FFPB 4WTZA 3VFUA 4FXGB 3QUMB 1YNLL 3SPVB 1X6LA 2R1XA 3OX8B 3NCJL 1T04B 1MEXL 2R1YB 3MXWL 1Y18A 4G6FB 3QUMH 3V6OC 4JRYA 1R24A 1RJYB 5DC0A 3AM8A 1M7XA 3P0GB 3D85B 4DZ8A 3QDJD 2X6MA 3G6JA 4PRPB 4X4YA 5IW6B 1KN4L 2FATH 4O58H 2CMRL 2A1WH 3VH8G 2YD3A 2I9LB 4KC3B 4Y19A 2HN7B 4XC1L 2EDDA 3U4BL 5F7NC 1N7MH 4NO5A 3NFNB 1U8KB 1JZ4A 4QRRE 4MXQA 1CL7I 4KDVA 2BXYA 5ACMA 3MJ9L 2EKSA 4IMKA 5EZOH 2CKBA 4N0FB 1QKZL 2PXYC 5DJDA 5CEYB 1OHQA 4LLUA 1QFPA 2YPLE 1XGRA 5SX4H 4Z78B 5IIEA 5JW3L 3MUZ1 3QUZC 5J1SC 2HAZA 2GY7B 2OI9C 4PYGA 3P9LB 3VXRE 3TH3T 2EYRB 3MRRB 5HDBF 1G7QB 2VLJB 4Z7QE 4PRBA 1KPRA 2B39A 2FJGB 4ZAKB 3QCVL 2HLAA 4HH9B 4BK5A 1DBBH 1FRGL 4G6JL 3DYPA 4P5TB 4BYHA 4NNYB 1WBXB 2PYEA 2W9EL 3MYJB 4LHUD 5EORH 4PJXB 1KNOB 1IC7L 4HDIB 5DA4A 5FUCC 5L2KB 1J8HD 5DS8A 1Q1JL 1BQHB 1SY6A 1YYMH 3QWOB 4L1DA 2G2RA 5EUOB 2BNUB 1S9YA 1YPZB 2VDKH 1L7TH 4R97C 1J05B 1OT2A 3PL6A 4YXKH 1VERA 3VXNB 5J89A 4TUOA 5F3HB 3MLTB 3RVTD 4GMSH 1DCLA 1RIHH 4B53A 1IQWH 4F8TA 1G6RA 4L4JA 3DO7B 1TZIB 3D5OF 4RGND 3TN0C 3PWPB 1NGXA 2WV3A 4MCZB 4NBYB 5FOJA 2DWDA 2I5YL 4M6OL 4U49A 1E28A 1QNZL 3B2VL 4XCCH 4JZOB 1O0VA 2FO1A 1VPOL 4PRIE 1JNHB 3Q1SL 4Y5VB 1N2RB 3V52H 1Q9LB 4EN3B 2VDML 3GJEB 3SGKC 4QRTB 2VXVH 4LCIH 4H26A 3GMRA 3RX5A 4X7EC 5DJXA 3F7VA 2FJFA 3P4NB 4XMPL 3NIGF 1F58L 1S9VA 1BJMA 4WW2C 3T1FA 5IB5A 2WBJD 1Z2KA 2HRPH 1DVFA 2DTSA 2XTJE 1OTSD 4DZBB 2J5LB 1KB9J 5IOPA 4UOJA 2D7NA 4L8BB 1KGCD 3KWWB 4X7CC 5E56A 4IS6A 1T1XB 1FG2B 2NZ9D 2VLKB 3DGCR 3SDCB 4E5XB 1XCTA 3HZYA 1KIUA 4NKMA 2PTTA 2AQ2A 5ISZE 3I6KB 4A2MA 4AQ1B 3V6OA 3T77A 1PX4A 5DFVD 1A64A 5DD3H 3VFTA 5A2KH 2AS5M 1UZ6E 1B0WA 3V9FA 3O41A 4KDTC 1T0MA 5ID0A 5DO2D 3QUKB 3FRUA 1E4XI 4G8GA 4S0TD 3O9WC 1X5XA 4F9PC 2ATKA 4QCIA 4OGXH 4LIQL 1RY7B 4NWUL 1YNTB 5GHWH 4JO2H 1QRNE 3Q2CA 1XGTB 5CIPB 1X4XA 4NNXA 1TQBB 1H0DB 3UDWC 4HCRL 3T3PE 1N5YH 2ZNWA 3FO9A 5GZOD 4V1DE 3AY4A 2ORBL 2ZCKL 1DANT 3B9DA 5CIPH 3S36X 4YX2L 1WV7T 1YUHB 4PJDE 4NQCD 4L4TE 3GB7B 2WAHA 2H9GA 5E8PB 4BQ6A 2C7UA 3R1GH 4HGWB 1NBQA 1UEMA 3ARSA 1YEJH 5F96H 2EDLA 2OS7A 4YFDB 1HI6A 1P1ZB 3O6ML 5TE7H 3K2UH 3C5SA 5FYLH 3QUZA 4YO0A 1JF1B 1WFOA 4RGOL 4QRSA 43CAB 3LS5L 4YAQB 2OI9A 1D3CA 5CEZE 4G8IB 2X09A 4EBQH 1JYVA 2R2HA 2WINA 5C0RH 3K1DA 3C60D 1PY4A 1DFBL 2H45A 5L2JA 4EXKA 2A73B 1A7RL 4XVJH 5B22A 1R5VA 2ICEA 4O51B 5D7KE 4WI2A 4CNIA 5FO7A 1ZS8A 3HI1B 5DI8A 2OTPA 4TVPD 3IDJA 4NKOB 2HFEB 4DOHB 4KXZI 4K8RD 2A2QT 4A6YB 1TJHH 1KC5L 2V7NB 2O61B 3JV6B 1G9NL 1SJEA 1YN6B 4U6TA 4A6YH 3EFDL 4PRID 1FJ1B 4G8EA 5EOCH 5FO9B 1BIIA 2IMMA 5HPMA 1OGAE 1ODAA 1CXKA 2IFFL 5HGGS 1H5BB 1T1YB 1FYTE 1UQSB 4P46B 4W6WB 4ZUVB 4HWUA 4YHIB 5EIVA 4LLDB 2X70A 2IGFH 5ANME 4HULB 4ZXBC 4HPYL 2DIAA 3QG7L 4WGVB 5TE6L<