2ZT9B

Crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2008-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2zt9B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2zt9B01
2WSFJ 5L8RJ 5KKZC 4H13B 4RKUJ 4H44B 2O01J 1VF5B 2QIWA 1S5LX 2QJPC 4OGQB 2K9YA 4H0LB 2WSEJ 4KT0J 4Y28J 2D2CB 1ZRTE 2FYNC 3C8VA 2WSCJ 2E75B 2QSIA 2E74B 2WPVB 2E76B 2QJYC 4I7ZB 3LW5J 1JB0J 2YIUC 2ZT9B 5KLIC 1Q90D 2QJKC 4IL6X 4PV1B
chains in the Genus database with same CATH superfamily
1GAXA 1OZ0A 2WLNA 2YIAA 3MHSC 4EDFA 3T1YO 1HNXO 5GW7A 4OPHA 1EZVI 1X79B 2HEPA 1BL8A 3CRCA 1RQUA 3G9RA 1L4AA 1QR8A 1PL4A 1DTOA 3AEBC 1NU1J 3WU2E 2NZ2A 4JAUA 1TA8A 3K08A 3TNUB 1GD2E 3K5BA 1NTKG 5B5EZ 3WUUA 1UPGA 1SQVD 1I7FA 1JCDA 4WFHA 2CTRA 1GL2C 2M0BA 1S5LE 2YIUC 1K33A 2A45I 3L4FA 2Z5UA 1XMQB 2OYIC 4EFBA 3BRTB 3JD3A 4JI6B 4AQRD 4J11A 4LCUC 1QR9A 4Q6GA 1RE3A 4W4KA 4DR4B 2J58A 1IBLB 4K35A 2Q0AA 3G80A 3CCUP 1K34A 1AFOA 3TGUH 1NTME 1OCZC 1L0LG 1FJGO 1N7LA 2B5UA 1X9VA 4JGSA 5TISE 4UVAA 1KYOF 3MAQA 5CJ4A 4H0LD 3UT5A 2M5AB 4X65O 1F51A 4LFCO 3HKBA 2L91A 4WY4A 5GONB 2N74A 1QLNA 4LF9O 3O65A 1IXMA 2GTAA 3CJHA 1M5IA 2KSEA 3H1JJ 4C46A 3CPWU 2UXCO 1NVPB 3K79A 3B8EB 4NXMB 4DXWA 1YQ4C 1Y74B 5IYBO 4NTYA 2HLDG 2C0XA 5AVZB 1I0HA 3H1HE 1IFPA 4DR3O 4LFAB 5B1BB 5JVDA 4H37A 2NRGA 1L0NJ 2LW7A 2FKWB 1MSWD 2XAJA 4N6JA 1URQB 2JEEA 3CCJP 1Y6XA 1KYOI 3B71A 4F6RA 3NXSA 3NMDA 3GHGB 4MW8A 1QVGO 4NXNO 2OARA 3D71A 3P32A 3AE2C 3BVOA 4XBFA 4B3TB 1NTZH 3A0BZ 2Z5IA 2AW9A 1I94B 5GTHE 5E79H 1ZTEA 2Q7EA 1JOYA 3RL0D 1KV4A 1R6KA 4LF6O 1L0LE 2LFRA 1GTWA 1J1DB 3OGCC 3BPZA 2GV9A 1PPJE 2AXTZ 1W2BO 3FYEB 2DYRB 5CB4B 3SYAA 2JEUA 1HNWB 4JI3B 1WNSA 3ASOC 3BY6A 4DUYB 1FOSE 3AG1C 4IIJA 5KX5A 4DV1O 3N2GB 4UB8E 2BCCH 1Y47A 2IJHA 5KHJA 4WY4B 2ZKOA 1SQVG 2YKPA 3L36A 2UUBB 1KFMA 1LTTC 2LFSA 2W83C 4JV5B 1BGYH 2EIMC 5KA6A 1BQ0A 5B3SB 2QJKC 4PD4I 1N0JA 2DWDC 3KKYA 4LF8O 3X2QC 1N7SA 1Y4MA 5DJTB 4FLWA 1PNKA 3HKEB 1WA8A 3JD0A 4KL1A 3H1IE 3CC7P 2DJVA 1SQXH 2QGNA 1RM1B 4X89A 2CAZC 4LP8A 3OMNB 1GO3F 1Q86W 2J59M 1L2PA 1WA8B 3WB0A 5B1AB 2OIGA 1JFFA 3TXQA 1KYOD 2GM4A 2B1GA 1J95A 2EIJB 3DC6A 1AI5A 4XDKA 1GN3A 4CZZA 3APQA 2OYHC 4BW9A 3RVZA 3L75E 3JD1A 1JQ0A 1PGJA 3HR0A 4UCTA 4JI4B 1MFTA 4HZ3A 1OZHA 4ZKUA 2DYSB 1JUNA 1QLEB 1FS0E 3GF3A 4IOIH 2DN9A 3SYPA 5B1NA 3E8GA 3JSNA 3ASNB 2FYUG 1GM8A 3JCZA 3OUFA 3AE4C 4DV7B 3RK3C 2F66C 3H25A 4CC6A 1NU1D 1LJ2A 1KYOE 1L0LD 4JYYA 1G1XB 3L70H 3D36A 1O9HA 1BE3D 2OYHB 3HPLC 5IJ9B 4B3SO 1BHAA 2BCCE 2R3CA 2QTSA 1FDIA 3D6ZA 5H2FH 1MV8A 1LT1A 2OT5A 2KIKA 3EWKA 4RKUJ 2QJPB 1BGYG 5BR8B 1ZLLA 1DLBA 1K73W 2E75D 2KXPB 2E43A 2R9AA 2WA4A 1BE3J 1KD1Q 1JPXA 2WSSH 1QVGU 4FIPC 3H1KD 1S5HC 3L74D 4WB4A 3AEGC 1OCZB 1NTKE 1PGQA 2E5YA 1F7YA 3R2PA 2RNBA 3AK1A 1B04A 3ML0A 1GMJA 4JZ2A 4CH3A 3MGNA 1NBMG 3L74G 4J7ZA 2RQ6A 5BR8O 3ZHQA 3U11A 2UUAB 4X88A 2XNDH 2YEVB 4C7NB 1K3EA 1FD9A 3OGIB 3PN1A 2WAMA 1L0LK 5BMVA 2CPSA 1AROP 1OWAA 4U3FJ 3OEEG 1VQLV 1N8RW 1W2BU 1K97A 1MFZA 3GG2A 4MTFA 2E5TA 1R3LC 4Y99C 2V1DA 5DJUB 1ZWIC 1DIPA 2WSSG 2Q9LA 1N34B 2IBZH 5E79Z 3JYCA 2KB1A 2MW2B 1ZRTD 2KB7P 1Y9BA 3H1IG 3ABLB 4LGDE 5H5NA 3U59A 2KZJA 4H0LB 4IHJB 3H1LE 3G4SV 5KUMA 3CCLV 3B8MA 1JCHA 4NTXA 2J5UA 2X6BA 1DEEG 2UU9O 2C0WA 3G71P 3CPWO 4YIPA 1YTFD 4AHCA 5LMNB 2OWOA 3BEHA 2WQYC 2FXPA 2CH7B 2HFEC 3SFDC 4OH8B 1SQPD 2EIMB 1JOCA 3D6YA 2BASA 5CA0B 3CRRA 3HKBB 1FU1A 3Q3DA 5LHGA 2WA3A 2JP3A 3CWBG 5B1OA 3ZDMA 3ITKA 1DD4A 3ZMTA 5M1BA 2W90A 4X1KB 3I55V 4JYCA 2QJYB 1FPOA 3CC2V 4K8ZA 4PV1C 3VOUA 1SQQH 3E8FA 1KFNA 2JKVA 2GUSA 5AVWB 3KZIH 1HP8A 2H8PC 2YC0A 4WY4D 1MNGA 3L75D 4X1KA 2Q3EA 1VMGA 1YDXA 1HNZO 2ZE8A 5AW5B 2V7QG 1Q43A 2YIBD 1SQXG 1EZVH 3CLQA 1N73B 5A2QN 1PZQA 2BCCG 4C7NA 2H89C 3IR9A 1BCCE 4D6TH 2P2UA 1TU3F 4H44B 4WWIA 2FBWC 2E42A 3WB2A 2WLIA 3K0DA 4QJFB 1XI1A 3J80N 1N2DC 3L72J 3A8TA 1J1EB 1KKCA 1YYCA 1TUEB 2ETNA 1ZW0A 4LH6A 1BCCH 2R5DA 2LXBA 2E75B 4I4TA 2IPPA 2F95B 1PP9J 1L0ND 3SJQC 4JQ0D 4YHHB 4DOJA 3N7NA 5J2TA 3AE1C 1G6UA 1Q5OA 3C90A 4OPAA 1ZL8B 2YIUB 1JY2N 2KK7A 4R50A 2LO1A 2ODMA 1XBLA 5E1AC 3M0DA 2HR3A 1AV1A 2C9LY 1VQ6V 1IVSA 3C3TA 2OCCB 5EC2C 1GM9A 3JARB 4FPPA 1N73C 3CCQV 1H8EG 3MHVA 5LOVA 1HDJA 1PPJH 1SQBD 1Y8AA 4HBNA 1JR9A 2JR8A 2MKVA 2F93B 2CH7A 4DR5B 1ZXGA 2A9HA 3QNEA 4I6MC 1W0KG 2M6YA 1CI6A 4FFKA 3N2GA 2JDIG 5LP6B 1YF2A 5IJ9A 1URQA 1LR1A 2ZM6B 1NAFA 4G28B 1IBKO 1RF0C 1VP7A 3RYHA 4G2KA 2WLJA 1Q81W 1WN7A 1L8DA 3HD7C 5KLVK 1VQLP 2O01N 2XT9A 2PI5A 4UB6Z 2VWJA 1S9KE 2ZE7A 4BIOA 3L70J 2CTWA 3CCEP 1SQVJ 2IFMA 3CWBJ 2Z4EA 1CP9A 4WFBV 4KHPB 2KYVA 4GKJB 4DCKA 3LNNA 2M3EA 1S2EA 4O2AA 4B3SB 1FE6A 1X22A 4JI6O 1GU4A 3H1HH 1DX7A 2YEVA 2HJFC 2Y0DA 3B5NC 1KC8W 1NT2B 4JAVA 5KAFH 4IGGA 3CCSP 3K58A 4YTPC 2ZD9A 2F43G 4E2LA 1JX9A 2NNUA 3C3SA 2AHYA 2ZDIC 2XHBA 3ABUA 1USDA 1H2SB 4I4TB 5JH7B 4TUYA 1Q6IA 1WT6A 1SS1A 4DR6O 3CC4P 1V55B 4IIJB 1Q7YQ 4PDLA 4FLZA 1SQQK 5L3DA 1VQPV 3L73D 1YEWA 1TUBA 1R3JC 5GTHZ 1BGYE 3MUDC 1A02J 1EXIA 1S76D 2DYSC 2XZRA 3ZHTA 2HPCA 2EJ7A 5KTBA 3CD6P 2RN0A 1LNQA 3STLC 5APQA 2YMYA 3CWBD 4UB6E 1EZJA 1T6AA 2QDOA 3ZRVA 1SERA 4PJ0E 1HVVA 4CC5A 1OCCB 1CSBA 4I9WA 2Q7GA 3UO2A 1IFNA 2YI9A 3UQ8A 4EKWA 1HNZB 2K1EA 4TV8B 3D8CA 2ZAEB 2A0LA 2A06G 3K5LA 1TGOA 3F5TA 2NPSB 3AG3C 3CMEP 4O2BA 2FYUJ 2IM9A 2KP8A 1G8MA 2IDBA 1YIJP 4AQYO 1MZ9A 3M9BA 3LIDA 3ETGA 2CUGA 4D6TG 5IWAO 4GT1A 2B87A 1JJ2U 5DM6V 1JMKC 4MVUA 4X1IB 3ETEA 4DT0A 5GTIE 3PRJA 4MVRA 3RWRD 5D5QA 1FS0G 1JCCA 5KA5A 1FZAA 1RF1B 5AW0B 3RGBA 3JASB 4X64B 3BCCH 4N21A 1KORA 1LT9B 1CXZB 1EN5A 1A02F 1QQCA 3S9OA 2ZE6A 1EFRG 4GYCB 3K3WA 1FZCC 5AW9B 1NTZE 2QIWA 4D7TA 4B3MB 4FLUA 2LKMA 1IFIA 2KSDA 1OXZA 2DYRC 3OR7C 1YQ3C 3H32B 1NTKH 1WPXA 3U0ZA 2Y4UA 1S72V 1IBMO 4MS2A 3AG7A 2HKOA 2P4VA 5LMUO 3NTNA 2QEXV 1NI8A 1XTCC 2QWOB 3KZIZ 4Z2WA 1UJWB 5IT9N 1Y76B 1AB3A 1N7SB 1WP8A 2E75C 3ASNC 2YKQA 3QWOC 2WLHA 1FKAO 2GUZB 1SS3A 3FKSG 4K0KB 3IC9A 2JO1A 3JARA 1BDCA 2A06E 1M1JB 1PFIA 1IZ3A 3KXDA 4R7CA 2AZ2A 4EI2A 3H1IH 2UXNA 2JJ2G 2PI4A 2QG4A 3SPIA 2B9ZA 1KILD 1KB9E 2O3JA 3I56V 4JI2B 3M9HA 4YIOA 2Z3YA 3K59A 1NTMK 2Y69C 2AEJA 5CMUA 4GKJO 1JMBA 3U1AA 4LBEC 5CCGA 3RN4A 5C93A 4TT3G 4W80A 5B66H 4I2LC 2HFED 3MUDA 1VQMV 1HW7A 3RK3E 4PV1B 2I8DA 4LNUA 4KHPO 1ZSPA 4KHXA 5GTIH 2OIEA 1WPBA 1VF5B 3AE8C 5GTHH 3ZS8C 2JWAA 4DR1B 2ATKC 4ICGA 4PV1D 4LFCB 4IL6H 3CC4V 3TYYA 1M56C 1QHTA 3ICXA 1NJIW 4GX2A 1VEWA 1U96A 1RSOB 3H1JE 1QVFU 3B5NA 3VQYA 1KN7A 1QNMA 4PDRA 1FJKA 1FYJA 4XFJA 1T8ZA 4DJGA 1RSOA 3SYCA 5CA1A 4B3RO 1PNMA 3JCUH 3K5OA 2ZT9C 1VARA 2FMLA 4DRXA 2FYUE 5CA0A 1P7BA 4X66B 1JY3O 3M0AA 1NU1E 2BOCC 3OW2U 4CH6A 1BT8A 1XILA 2M5AA 3JATB 2PUSA 2P10A 4WBAA 4DYLA 3CMAP 3H1JG 3EVKA 3FGAD 5EBLC 3IF4A 1H8AA 2E76B 1R73A 2KKWA 3OFNG 2WTYA 1V55C 2MK3A 1JVMA 4TLFA 2BE3A 3VQXA 3A0BH 4F6RB 2KQXA 3AG3B 2BEZF 3GMAA 1VQ4P 3HKCB 3VOPA 4LWSA 4J7KA 5K1XA 1PP9G 1NR7A 2WLLB 3F5WC 4PD4F 1HGZA 1K05A 4R4LA 2ZXWB 3PJSK 2L6LA 4JZGA 1S5LH 3OEHG 3HUSA 2P67A 4D6TJ 3MIWA 2N9YB 2EX3A 4TQDA 3FFQA 1M90W 3MP7B 4UB8H 5JQGA 3CXHD 3P3PA 2Q67A 3THOA 2N9BA 3LW5J 2OCHA 4BWAA 5J2TB 3LDCA 2EIKB 1NTZK 5AW1B 3ZRXA 1GL2A 2ZNIA 1OHHG 4JF3A 2ZXEB 1BGYD 3NFQA 1KECA 3L75J 3H1KH 1R5SA 5H2FZ 1K4CC 2ZXWC 2XTAA 2KG7A 4P9PA 4MT8A 2JVDA 4Y99B 3HD7D 3U10A 4DZOA 2UXBB 5JJNB 1CEZA 1HGVA 1NU1G 1SZXA 1SFCB 4JI7B 1GM7A 4X1YB 1IURA 4U3FE 3RK2B 2HVJC 5APTA 3W67A 1FAVA 1SQVH 1SQPJ 5IYZB 2RH0A 3JSLA 3V5BA 4RUFA 3LSUA 3CX5H 3JSVC 3E7KA 4PI2A 4PJ0Z 4IYHA 4DV0O 5LMUB 2KOGA 3VN0A 2EIJC 5CHXA 4O4IA 2QM4A 1KQLA 3FYIB 4MVMA 3TGUD 1VQ7P 1FAFA 5TJHA 3ZEDA 3Q4HA 3CCVV 2WSEH 1M7LA 2Z0AA 1Z56A 5AVSB 3Q2YA 1XEQA 1M93A 3ZRWA 2WPVB 4FM0A 3ETQA 2QJYC 2QA4P 3L74J 1QGKB 1WAZA 3UKMA 2WLLA 1N0NA 1L1FA 1H2NA 4DUZB 3FB8C 4O4JA 3TDKA 3HKEA 2WT7B 3WB1A 1OW8A 3S3XA 2JEXA 1YXBA 1J5EB 1SP4A 3L71D 3E8HA 1KU9A 1N33B 5C39A 2PTMA 2XV5A 2YNYA 1SQQE 2YIBA 3N27A 4FFBB 4RO2A 1RE4C 3KHUA 4RJTA 3B5ND 3CXCU 1BCCG 1ZP0C 1ROPA 1WB7A 5B1BC 2XKMA 2YDEA 2IJJA 1Q2NA 3C1LA 3OA7A 2FFDB 5L3GA 1M56D 4OXSA 3LW5H 4O4LA 5TISH 3CB2A 1S9KD 1G2CA 1IZNB 1NTZD 3TGUE 2Y0EA 2XUMA 2K9YA 3VMZA 1EDKA 1SF9A 2EILB 2QM8A 1AA0A 1F4MA 4L8JA 2ZDIA 1NTMJ 1YTZI 3FXEA 5KAIH 4F4LA 3WU2H 2JGDA 3TJTA 2Q7HA 4DR5O 1SQXK 4ZI7A 3UM7A 5KX5B 4L76A 4B7EA 2RCVA 3IFXA 3EHBB 2DMXA 5FNVB 3WU2Z 3T1HO 4H44C 3ZN0A 4D6TD 4GOEA 4PD4H 2BTQA 1MKMA 4KP4A 5EZYA 1VQ4V 1V9PA 5B3SC 2QJKB 1UFIA 2XNDG 1Y76A 1T3JA 1JMMA 3D3QA 4LF4O 4WFEA 1H8HG 1K4DC 3W7WA 3T1CA 3CCJV 2PP6A 1IX9A 1YHQV 3EFGA 2JWDA 2CGOA 5IJ0B 3U1CA 3H1HJ 2B87B 4XDJA 4OWFA 2YUAA 4H0LC 2N1TC 2OCCC 5LHHA 4J41A 3H9VA 3MHHC 2YXYA 2QRXA 2BCCJ 1U7MA 1JFFB 1HR0O 1CW5A 3ZHVA 4JI4O 1XL4A 5BMVB 1WP7A 4D6TE 4YY3B 2IJKA 1M57B 2FYNB 3CL3D 3E89A 1PPJD 1S3JA 2B89A 2EINB 3JC22 4ZNCA 1PKXA 4KFMA 3T2MA 2HG5C 1Z2GA 3ZHSA 2UUCB 3AEDC 4BWNA 1LTSC 3KCYA 5CCHA 1LWUC 5CBHA 4IL6E 2ZCEA 4MW3A 4FMTA 4JPRA 5H6QA 2QM7A 3BA8A 4GLXA 5JCOC 2NLJC 2PYJA 2NN4A 3RYIB 2MJZA 1JNMA 1SQXJ 2VRZA 3L70E 1E1QG 1EZVE 5KLIC 4C7UA 4ASVA 1BS3A 3A7OA 1X4TA 3CHXA 2JJLA 5EBMC 3GLMA 4O4HB 1FFXB 3F7VC 2WMMA 3JASA 1LT9A 1VQ9P 3HD7B 4JV5O 3RVYA 3EXAA 1VQ7V 2IU0A 2BSKB 3E22A 4X62B 1YTFB 3MZWB 4LC1A 2AGAA 4DRXB 1SQPE 2B9BA 2JRIA 4N78E 2QJ1A 1EQ7A 1M9NA 3OAKA 3VBBA 1Z5WA 5FL7G 1L0NH 1NU1H 1XDCA 1VQKV 4TQFA 1YJ9V 1CZQA 5JJEB 1LWUB 1KILC 1W2EA 1M8OB 2R44A 1HTLC 3HKDB 4PDVA 3AEAC 2PAJA 3CE2A 4GCZA 1S5JA 3OTOO 2ZJSE 5FPRA 2V7QH 5AW8B 5CCGC 3SSUA 2Y0PA 1FZGA 4DR7B 1SQBH 4MN4C 1QX8A 1NVPD 3HUSB 3LIEA 5ITZA 2IBZE 2JIZG 3JAWA 1XL6A 3AG4C 3E83A 1YTZT 4N78D 1GK4A 1D5AA 5FLXN 3CWBH 3OTFA 2YS8A 4EB6A 3JCUZ 3PH0A 3T4DA 3LDDA 4IFDK 3TF5A 1PP9H 3CCMV 4ZIBA 1PIXA 4C7RA 4EB6B 5J2UA 4RUEA 4AILC 3TNUA 1OMIA 1ZUQA 3S1KA 5LGUA 4X65B 1BGYJ 2KNCB 2VS0A 1KB9I 1B6QA 4RQFA 5CBNA 1SQBK 2E3CA 3TETA 2E5LO 2WPDG 1DF5A 5BY1A 2D2CC 2BSKA 5LMNO 3F5HA 1RF0A 2M8RA 4LWSB 2P1JA 4FZ1A 2Q7CA 3CYOA 1YHQP 2OYHA 3VP8A 1KB9H 2N1TB 4UV8A 4I0XA 1KQGB 4ABMA 4XDLA 2AXTH 3L35A 4QIWF 3TXSA 1NTZJ 3E1RA 5BU5A 1LUWA 1NU1K 2A45G 4LNUB 3BCCD 4O2BB 1FFTB 1EXJA 2EJRA 2K88A 1BSNA 4ZOLB 1ZOYC 1MZEA 1NO4A 4WBNB 1SQPH 3A0BE 2YI8A 4YY3O 1SQBE 4RO0A 2VQEO 4W4LA 1NR1A 3Q1MA 5JVDB 2M3BA 1LTJC 5KJ7D 1SQQD 3D70A 5F2VO 1EDJA 1FZBA 3T1HB 1RY3A 1SETA 1JM0A 1XQ8A 3L75H 2V7QJ 3WG7B 2P06A 1D5NA 2F23A 1R5LA 3CCRP 1VQOV 1VL2A 3TGUG 2KS1A 2YMKA 2P7TC 4WFFA 4G27B 1EDIA 3BCCE 1VPCA 4GZRB 1IFMA 3JCUE 3V2QA 1USEA 2LGQA 4EOTA 3H1ID 4YXWH 2HPCB 1S0VA 1RPOA 4MSWC 1ORQC 4LH7A 4DV3O 1N36O 4QPJA 2GBOA 1JA8A 2ZNJA 4I7ZC 1GMGA 5CBFA 3ZN1A 4QE7A 2ZVOB 1BCCD 4P30A 4DR4O 2IBZI 1XNRO 5KHGA 4JI0B 1RHZB 1AILA 4MVSA 3H1LD 4JI2O 3P8MC 1SA0B 1MA1A 4LF7O 1SFCC 1WLEA 2QKCA 2JGDB 4DUYO 2OTLP 1FXKC 2ZIMA 3CP1A 3ZMVA 2EILC 5KAIE 1RE3C 3UCSC 3L71H 1BSHA 4I0XB 5JQGB 2Y0IA 1HWTC 1OW6A 2QTOA 1YSCA 3HUSC 3DXRA 1BDDA 3BAAA 4TSFG 4JASA 3CCEV 1HNWO 1ZLZA 1COWG 4J10A 2OTKE 4UXNA 2IZ0A 3HB3B 2VQEB 2PZSA 5AW2B 5AW7B 5IYCO 2AHZA 2B1IA 1SRYA 4UV9A 1JTHA 1M57D 2DWEC 3T97A 3WUVA 3AEEC 3BHPA 2IYPA 3CC2P 1LTGC 5CCGD 3H1LJ 1LP1A 2VWKA 3SPHA 3RL0B 4FM1A 3CCSV 3EFFK 3T4ZA 2L5GB 1ZV8A 3SWYA 3ZMSA 1QCEA 3BA9A 3QG5A 1KILA 3CCMP 2C9NY 4LF5B 3P8CE 3V2PA 3N2KB 3KPEA 2OTJV 2PYLA 4WY4C 1NGMB 2DQ3A 1NYHA 3A0RA 1XOUA 4NR1A 5LHIA 2VQFB 1GW3A 2WPRA 3CCQP 2QSAA 4P9OA 3ABKB 4H13D 1L4AB 3JALA 1NTMH 5KAIZ 2PFXA 5IE9A 2B88A 4PA9A 1HJBA 3CD6V 4N3YB 2Q6AA 2OQQA 1OCCC 5FPOA 3Q4HB 3AG4B 1KBHA 2LGWA 3JD4A 4J7JA 3W7SA 4U3JA 4LFAO 5B1AC 1P84I 4X62O 4HNAA 1GRJA 4I50B 3S3WA 1N32O 4H44D 1E5WA 3V2RA 3E35A 3DTUB 4UCVA 3CXHH 1H0TB 1V54B 3GB7C 4P2ZA 5JCOA 4U3JB 1VQ6P 4M3LA 5L3EA 1Q3EA 2Y9YA 1F4NA 1KQSU 3UIAA 5CCHC 4RESB 4U3FH 2FYUD 3RBZA 4LFBB 3SR2C 2CPBA 2ZYGA 1VQNV 1AVOA 2Q3IA 3ZMZA 2XNXA 3KZIE 4AQYB 2JK5C 1RH5B 3UT5B 3GHGA 3TCUA 1NH2D 2P22C 3MD0A 1YIJV 3VMXA 1AJYA 3IAYA 2I1KA 2N1TD 1IFDA 2PF4E 2BEQD 2IBZG 3KQGA 2POHA 3W68A 1OCOC 5CA3A 3G6EP 2FYUK 3F89A 2NR5A 2QWPB 4DV3B 2K37A 2GSMB 3H1JH 4O4LB 4QNHB 2Q5ZA 1EDLA 2SPZA 4L87A 1SQVE 2QE7H 3OW2O 5IY5B 5E79E 1YITP 1ZAUA 3M0DC 5A9GA 1ZR4A 4OVNF 3OMAB 1LUVA 2P4KA 1IK7A 3JD2A 4DV7O 1T2KC 1Q8IA 1EM1A 2WVRA 4DK0A 4MTGA 1P84H 1AI6A 1I5YA 1NKDA 4TV9A 3ZCCA 1H38A 1SQPK 3GWKC 1YCIA 4O4HA 2VRSA 3CRAA 5LA6A 4CH4A 3CI9A 2A79B 4I55B 4GX5A 4B08A 2DW3A 2G38A 1GTOA 5IYZA 1VQ5V 2XAHA 1LTBC 2CK3H 2KUBA 1EZVG 3JAKA 4DW0A 2QEXP 4TWKA 4ZBMA 5APYA 3BATA 3M8AA 3OMIB 4OX9O 5BXZA 1SQQJ 1AJPA 5J9PC 2ADPA 4JYBA 4K3AA 4O4IB 3M99B 1VQ8P 4NPEA 3CXHE 1K9MW 4JYAB 2O57A 4LF4B 3FWLA 4I50A 4PI0A 5KAFE 1YJWP 5AVRB 2W27A 1KKDA 2WLMA 3O9OA 5EBWC 4PDMA 5D5PA 4RWUA 2G3AA 5AVQB 4ZMDA 2V4HA 3LSSA 2Y4TA 2F1MA 4JBZA 1NTKD 3DGEA 1N36B 1OCOB 2YIDA 2LQTA 1GDTA 3N4XA 1KTMA 5EYPB 4JI8B 1NZ6A 4GKKO 3QO8A 2XASA 4KXRA 4FLVA 3P8CD 3E8BA 2EZOA 1HR0B 1PL0A 3SWFA 4LFBO 4NPFX 3K5MA 1MABG 3R4YA 4QGPA 2D3OW 1AR5A 4OX9B 4H13B 2UXDB 2EZPA 4FFBA 3J81N 1JJOA 1M1JC 2YXQB 1WJZA 2DE0X 1YI2V 2FL4A 1DK1A 5IYDO 1NKNA 1ZX3A 2L35A 2ADQB 1NKZB 3VYIA 3HKDA 3B09A 3AEFC 3I5CA 4GODA 1UIIA 5LXTA 4DR7O 3L72G 1QBZA 1R8EA 1JB0J 3L75G 4X1YA 3RFRA 3B2EE 1KUQA 3K57A 1L4AC 3FXDA 1FJPA 5LOVB 4U7OA 2QWNB 4YXDC 1K5QA 1R3IC 5KHHA 4UCUA 5HFLA 3SPJA 4R4MA 2K1AA 2WLIB 4BAYA 4YHHO 2A7WA 1R6TA 1E79G 4FVMA 4DV4B 1FXVA 2KLUA 1CPYA 2ZIOA 5CJ0A 1PP9E 2Q9IA 4FK5C 1VIBA 5DEDA 1L0NK 3V6IA 3H1HG 2A06H 1PGPA 4KJMA 1JO5A 2HHHO 2QKAA 5LYJA 2K3RA 1VQNP 3AE3C 1K73Q 1XMOO 4JAAA 1LGHB 1J1EC 4LF8B 5BU8B 1OCRC 3AE9C 1R3KC 2KNCA 1W59A 2Q69A 4LLHA 4NVPA 1O9GA 2UXBO 4EEQA 3G6BA 1H2KA 3SJCC 3IJ4A 3K5NA 1PL5A 3G6EV 4X9QA 4ASWA 1KZUB 3SYOA 1RF1C 4X20B 3FB5C 2AXTE 2UUAO 5LGTA 3M91A 5H2FE 3SFEC 5C8YB 3DXRB 2GTSA 1YITV 5KHIA 3W7XA 2WT7A 4RQEA 3D36C 4GOFA 3A0HE 3VQWA 3SGIA 1SFCD 2LJ2A 1PPJG 1Z5VA 2EULA 1S1CX 2KS1B 4PHZA 2ZFCA 5EFWB 3DC5A 2WSFJ 3ABVC 3ABKC 2FY8A 1KB9F 2W6AA 4FLYA 5LGNA 1S5LX 4IFFA 4FZ0A 1QLEC 2R3SA 2R70A 2ZXXA 4N23A 1M1KW 3X2QB 2W6IG 2HYNA 1H2GA 1QU7A 1IBLO 2VQFO 4WVZA 1KILB 2WSFH 3L37A 2FFDA 5APVA 2X6AA 3M7MX 5EC1C 3H1LH 3OM3B 4W7ZA 5KJ7A 1BHBA 5AW4B 1JY3N 4X1IA 1GZLA 1NH2B 2Q1KA 4L73A 3WG7C 1FDMA 4GDOA 4QE9A 1K8AW 1Q6UA 2CTQA 2IH3C 4GKGA 2O01J 2K9PA 3CX5F 3ZBHA 3WMM0 2AEMA 2QJPC 3CCUV 1TAEA 5HFMA 2I1JA 3BVHA 1OV9A 1NWQA 5FNVA 2P7JA 1PGOA 4OGQD 1K7DA 2GUZA 2JS5A 3P30A 4DR6B 4B3RB 3PHLA 2XAFA 3A2AA 1FXKA 4DR3B 4GIFA 4ZHQA 2HODB 1A32A 4BIUA 1PP9D 3K9AA 3CX5D 4ZHQB 5TISZ 1XREA 2UXCB 3ZX6A 3OE7G 4J9YB 1URFA 1JY2P 4JYAO 2JDIH 1ZRTE 5JJJB 5B5EE 1M57C 2FYNC 1YI2P 5EK0A 1PV3A 4DV6O 1SQXE 4JI0O 1DF4A 3L72D 2UXXA 4CBCA 1QEXA 2YXRB 3PP5A 1G4YB 2WZ7A 4L75A 3AG2B 4J9ZB 2DOSA 1SQBG 1NTMD 5CCHD 2H3OA 2QWRB 3VQVA 2ZT9B 3C9IA 4DV2O 3FWNA 3CC7V 1N33O 3W7UA 4NB5A 3RK3B 4HYTB 1T5EA 2DW4A 4B86A 3II6A 1KB9D 1H89A 4DV1B 1KQFB 4DUZO 1LTJA 4H13C 2ILMA 1N86A 5LBQA 1F23A 3PTZA 2WPSA 4AI8A 2XAQA 1J5EO 1SVFA 4CH5A 3E22B 3BCCG 4TV9B 2Q8VA 2PY5A 1RF1A 1GN4A 1WB8A 3RYCA 1Q81Q 3FAVB 1X59A 2KSJA 3CEIA 2WLKA 4I55A 1L0NE 3ABMC 1KP2A 1VF5D 1SFCA 1OX3A 3QO5A 4IL6X 5EIBD 1I5XA 2IH1C 1THZA 5KKZC 5LP6C 1IBMB 5KLVH 1BCCJ 2OYOA 4DV0B 3SJAC 4I1LA 4YJ3B 3K03A 3O6QA 1MSDA 3JATA 5CN0A 3S4RA 4FM2A 4I5SA 3RYHB 3EQ2A 1WRGA 4FJCC 4JI1O 3H6PA 2QR4A 1JTHB 5L3BA 3IN6A 3T97B 5BZBA 2AXCA 1I94O 4UVBA 1SQVK 3BABA 3CS5A 3K06A 3IFMA 1MMMA 1RPRA 3L73J 5AVYB 3AEIA 2YXLA 3ETDA 4DR2B 2HODA 3RBXA 1NAYA 2QVAA 3BRVB 5LYJB 1GH6A 4WBNA 5K1PA 4UVCA 1SQQG 4NPDA 2E74D 3FX7A 5ITZB 3H1KG 5APXA 3CWBE 4IL6Z 1URQD 2AEFA 3K04A 4PD4D 1JEKA 2A3QA 2N05A 3CCVP 3VTPC 3JAMN 2R32A 3IC7A 3IGAC 3ZHRA 2QA4V 1Q6HA 3H1LG 4YJ2A 3AE6C 3P3NA 1H2MA 1W0JG 4TOIA 1U7JA 1ENVA 2KZIA 3O8ZA 4JPZB 1KC8Q 2QSIA 1MZFA 2W0XA 3G4SP 3JAKB 1VF6C 2CGNA 2UU9B 2YO2A 3L70D 1N8RQ 1P84F 1GK9A 4BRYA 1AVMA 4UCRA 4HNAB 1BE3H 4I9QA 1G1IA 1NJIQ 3RYIA 3G71V 1XNRB 4BR6A 3J7AU 4ZKIA 3BASA 5APSA 1HH0A 3Q5RA 2Y0CA 3BCCJ 1J2JB 3STZC 4DV4O 5CBGA 3QH9A 2Y69B 1K04A 3HE4B 2Q5UA 1XMOB 4O9BA 2RN9A 2ZR2A 2D2CB 1CI6B 1FFXA 1OCRB 2H8PD 3RL0g 4LF5O 1OIPA 1N34O 4EIJA 3QO7A 5K5GB 3HE4A 3P7KA 2DQ0A 1P49A 3KDPB 3I55P 2W0FC 2YXHA 3OUSA 3ZIAG 2P5OA 3OAAG 4Z1MG 2WSCH 2M7WA 5LA6B 1VQKP 4AUWA 1SQBJ 5CA1B 3QF7A 3L73E 1BMFG 2Z5HA 5CMZA 4MTXA 4ZKPA 1L4AD 1YJ9P 3RT3C 5CB4A 4ZOLA 4PA3A 3O6QB 3WUTA 2O1KA 2BTOA 1KMIZ 3K0GA 4E4EA 4NTWA 2JGUA 3L71E 1FOSF 1H2LA 2RJZA 3RK2D 4PA7A 1DD3A 4EYYQ 3HRNA 3PLNA 1VF6A 3R66A 1EN4A 4X66O 2JJ1G 3T1YB 1HNXB 1N73A 1L0NG 1K92A 1YBKA 4NXMO 2O1JA 1G1JA 1GKFA 2IU3A 3FB6C 3GVMA 1OVRA 3AE7C 1M1KQ 4X8AA 1LT9C 3N2KA 1H88A 4FLTA 3B4SA 3L72E 3USSA 2HP8A 3WFVA 2CE4A 2XAGA 5B66Z 1D2DA 1AJNA 1T3UA 4TT3H 3AK3A 2BCCD 3VMAA 2NPSA 3GF7A 2JS3A 2UUCO 1BE3E 1YZBA 4GX1A 2R9RB 4JI8O 4WF9V 4GKKB 5IDJA 3CX5E 1IXBA 3CX5I 3SPGA 2WITA 2ZINA 2XOKG 2WWWA 2FYUH 2X7RB 1NVOA 4HKZH 3L74E 3HE5A 3H1KE 1VQ9V 3M06A 4DV6B 3SYQA 1KP3A 2E5LB 1FJGB 2OGUA 1ZMEC 1Y66A 3M9QA 2CTPA 4R6ZA 1XMQO 4U7NA 4IHJA 1IDSA 1S5LZ 1M90Q 1HWYA 2RMZA 4A7PA 2UWJE 3SJBC 3BRCA 3OR6C 1EC5A 2YICA 4OGQB 1MG1A 1QLED 1Q82W 4K0KO 3CCLP 3BFRA 5KHKA 2HG5D 5EIBC 2OYQA 1TVKA 2W6BA 4GX0A 2N1TA 3FAVA 4UUJC 3TSIA 1SZTA 4CS3A 4AYCA 1EZVD 2Q68A 1J1DC 3GWOA 4J42A 2CK3G 2GA1A 3CRQA 2QKSA 3NR7A 2ZQMA 4U7JA 3SPCA 4CS4A 2O01H 4B3MO 1DH3A 3LSQA 3AECC 2FTKA 2GUVA 4ZI7B 3I5DA 4DV5B 1JY3P 2E74C 1LWUA 4CPGA 1P7GA 3OTOB 2OYIA 2Q4PA 2YSUB 4K8XA 1NH4A 1URQC 1SKVA 3HTKA 5B5EH 1M1JA 2FXMA 2PRRA 1BSMA 2BOBC 2LR2A 2ZYAA 2HJDA 4OGQC 3ASOB 3OJAB 4XA4A 1FZCB 1FDOA 2NPSD 1NQTA 1KD1W 4U3FD 1Q90D 5H6RA 1EBOA 2RKLA 3L71G 5KLVE 5L8RJ 3JAWB 3ABMB 1GL2D 3KYQA 4YJ2B 4RAIA 1AR4A 1QVFO 2X6CA 4D7SA 1FZFA 4MTOA 4NYKA 5B66E 3SDLA 2K9JA 5KUKA 1RM1C 2A45H 1B06A 1SQFA 2HHHB 2CDYA 1LTJB 2E74B 2R9IA 3Q5PA 1XUQA 1V54C 2N04A 1VF7A 3ABTA 4PELA 5APUA 2P58A 4QPKA 3H1JD 3FX0A 1RQVA 3K9SA 1AP6A 1U57A 3TGUJ 3G67A 1KYOH 1VDFA 2E76C 1G2CB 1NTZG 2Y48A 4YXWG 1AQ5A 2IFNA 2W8ZA 3AK2A 1NS1A 5AVXB 1BE3G 2WSEJ 3CXHI 1L0LJ 2FXOA 4DV5O 1MUUA 4GUNA 2Y9ZA 2EBOA 3A0HZ 3SWKA 1R6NA 1N7SD 4H33A 1NTKJ 4WFGA 2ITAA 4JTDB 4B7KA 4MVOA 4F6EA 1XTGB 3A0HH 5EZYB 2W6JG 4HAMA 5JWPA 1AI7A 1YVWA 4JI5B 2Q6QA 1L0LH 4EFEA 1HUCA 2G8YA 4PA6A 1EN6A 2RDCA 2UXDO 1YJNP 1FXKB 2D2CD 1LP1B 5DN6G 5KLVG 1KQSO 3CRMA 5IJ0A 3RYFB 1QL1A 2A06D 5IWAB 2QE7G 2IYOA 3HKCA 4R8CA 2IZ1A 3L71J 4WCEV 3CMEV 3RYFA 2ITCC 2H7HA 4NKGB 4I7ZB 3ZJZA 2RMKB 4L74A 1Q82Q 3KCXA 1QL2A 3HD7A 2C2AA 3B5NB 1XNQB 1LTAC 2Q73A 2YKOA 4IFMA 5KLVD 4UCOA 1SQGA 1HF9A 2IX7C 3H32A 1OVUA 5JH7A 4UCSA 2K9JB 5H9CA 4KT0J 4HH2A 1IBKB 3CCRV 2ZR3A 4IT5A 1VQOP 1US6A 2OTLV 4HJGH 1AJQA 1VF5C 4DO2A 1OJHA 3C8VA 5KJ7C 4Q20A 3FD9A 3CJHB 5AVTB 2XU6A 1XNQO 2ZM6O 1AVYA 1VQPP 5J2UB 5AW6B 1SLQA 5EYPA 2EINC 3IAOA 2X0LA 5BVZA 1Q86Q 1OVVA 1I08A 1XHZA 2IW5A 1DEBA 3QTCA 2V4DA 1S72P 3OT7A 1IC2A 4O4JB 1W5CE 3E1IA 2H94A 3GHGC 1TVKB 3RL0C 5IY5C 1R1BA 2GDSA 1BZKA 4PD4E 3B40A 3V4WA 1XHXA 5KLIB 2EIKC 2WSCJ 3QVNA 1GL2B 3APOA 4BXLA 4LR3A 4UB6H 4XE5B 2ZVNB 4W7YA 3CXHF 3H01A 2OTJP 5AW3B 4DW1A 4DV2B 2XDJA 1E79H 3E2EA 1Q7YW 2ZT9D 1PM9A 3I56P 3B77A 3ZRWB 5AVVB 2R72A 4PA4A 5L3FA 1IK9A 3OD4A 2ARHA 2Q0OC 5KMGA 3MDSA 3A3YB 1SQPG 3ZRSA 1SQXD 4DR1O 5LXTB 1VQ5P 2LW1A 3CSXA 1IO4A 1B3QA 5KMGB 4TUYB 3LNMB 1UIXA 1GN6A 4JF7A 1N4CA 1RFYA 5KLVJ 2P6JA 4YJ3A 4ASUG 1D7MA 5GONA 3CMAV 2FKXA 1S4XA 2UUBO 4UFZA 3RK3D 3MTUE 1ZL8A 3VMYA 1U97A 2P90A 2ZE5A 1IFJA 1FZEA 1JY2O 4YPCA 4BRYB 4PJ0H 3AG2C 2W6JH 5L3CA 1P84D 1N32B 2E76D 1ZR2A 1P4RA 1DGSA 1GK6A 5KKZB 3E86A 3D3IA 4J80A 4MVZA 1TUBB 1K5SA 1S77D 1KILE 2AZ0A 1SC5B 5LL6Y 3H1HD 1H0TA 4JI5O 5APWA 3RK2C 4BW5A 4JI3O 1PD3A 3GW6A 5DECA 5CBOA 4Z1VA 1GU5A 2H43A 4JTAB 1N7SC 1YJNV 2PGDA 5LP6A 1Y67A 2F4VB 3KG2A 3A2FA 4Y28J 4WFAV 3R65A 4X20A 4NXNB 3F7YC 4IYIA 3VP9A 2H88C 3B8NA 2FB5A 1NTMG 3L74H 1GN2A 3DSQA 4B3TO 2FFDC 3W7TA 3TK1A 4BIZA 3Q5SA 2KI7B 3HTKB 2FYZA 4QMAA 4DK1A 2PGGA 4A5UB 1NTKK 1PV0A 4UB8Z 3ABLC 4FLXA 3LUTB 3UO3A 4CS2A 2F4VO 1VQMP 2KG7B 1HBWA 4O2AB 1ZN5A 1P84E 1X0TA 1FZCA 1E1RG 1RE4A 5AVUB 1NHLA 3G3ZA 1AQTA 1FBMA 3ZMUA 4X64O 2GHYA 3RYCB 2ZYDA 2WPQA 1IJDB 1SA0A 3L70G 2R5BA 3RGUA 1GW4A 4MVQA 4JI7O 3JALB 3V2NA 1K9MQ 2YO3A 3L72H 1K8AQ 1BQZA 3AE5C 4JTCB 4HYOA 2KLVA 1M56B 1MOFA 2IBZD 2NPSC 1AP5A 2LXCB 2IJIA 5GTIZ 3ZHUA 1FC2C 3HE5B 4KUMA 1T2KD 2BTQB 5AG2A 3A5TA 2ITDC 4LF6B 4LF7B 5KAFZ 1WMKA 3V4QA 1PNLA 3LDEA 4LF9B 4U3FG 1FXHA 1Y74A 3AG1B 1OFCX 3L73G 1M4UA 4JI1B 2OYIB 2LP7A 1VQ8V 2HLOA 3RW0A 4DR2O 4Z1MH 1HJ0A 3H1IJ 4HB1A 1YJWV 1OW7A 1SESA 1X8YA 3H1KJ 1LTIC 1NOHA 1RP3B 3L9DA 5C8YA 1AR1B 3L73H 2HVKC 3FB7C 1AI4A 4TV8A 2QWQB
chains in the Genus database with same CATH topology
2G8YA 2OQQA 1OW8A 2ZT9C 4H13B 3GLMA 2IDBA 2D2CD 2O01J 2QJPC 4OGQB 3Q1MA 4H44D 1RQUA 2E76D 3G9RA 3AE6C 3AEBC 3D70A 2NZ2A 2P10A 2MKVA 3FGAD 1ZP0C 2QSIA 4OGQD 2V7QJ 3AEFC 1KILE 2E76B 4I7ZB 1R8EA 1JB0J 1DIPA 1VL2A 1KORA 2YIUC 2YMKA 4U7JA 4YXDC 2QJKC 4R4MA 2BEZF 3GMAA 3S9OA 3Q5RA 3AECC 1HF9A 1Y9BA 1K05A 1AJYA 4R4LA 2E74C 2QIWA 3AEAC 1K04A 4H0LB 2K9YA 4KT0J 4Y28J 2BEQD 2D2CB 1ZRTE 2FYNC 4I7ZC 1PV3A 1VF5C 1YQ3C 3C8VA 2J5UA 3RL0g 2H88C 4H0LD 3Q5SA 4OGQC 3LW5J 2WQYC 4H44C 2E75C 2FXPA 3AE3C 1FDOA 3SFDC 2ZT9B 3IAOA 1MKMA 1Q90D 2JO1A 3D6YA 1IK7A 5L8RJ 3Q3DA 3AE9C 4YTPC 2JP3A 1YQ4C 1KMIZ 1DD4A 5M1BA 1PIXA 1OW6A 1KQFB 4H13C 3GF3A 1PL5A 4PV1C 1DD3A 2WSCJ 3AE4C 1OMIA 2E74B 3Q5PA 3SFEC 4H0LC 3AE5C 3H25A 1RQVA 3B71A 1EXIA 1VF5D 1U57A 3AEEC 2E76C 2H89C 3AE7C 4IL6X 1S1CX 3RK3E 4PV1B 2ZT9D 3D71A 3AE2C 2WSFJ 5KKZC 3ABVC 1FDIA 3D6ZA 2D2CC 4RKUJ 3EWKA 1TU3F 4H44B 2FBWC 3O6QA 1VF5B 2E75D 3AE8C 1S5LX 2G3AA 2WSEJ 4TT3H 1WMKA 3GF7A 1KQGB 3T97B 3IN6A 3AEDC 4PV1D 3AEGC 1NGMB 3Q2YA 2E75B 1NYHA 4Z1MH 1HJ0A 1UIXA 2WPVB 1KTMA 3AE1C 2QJYC 1GMJA 1EXJA 1OW7A 4H13D 2E74D 1ZMEC 1ZOYC 4XFJA 5KLIC 3R4YA 4GDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF J;  5L8R J;  5KKZ C;  4H13 B;  4RKU J;  4H44 B;  2O01 J;  1VF5 B;  2QIW A;  1S5L X;  2QJP C;  4OGQ B;  2K9Y A;  4H0L B;  2WSE J;  4KT0 J;  4Y28 J;  2D2C B;  1ZRT E;  2FYN C;  3C8V A;  2WSC J;  2E75 B;  2QSI A;  2E74 B;  2WPV B;  2E76 B;  2QJY C;  4I7Z B;  3LW5 J;  1JB0 J;  2YIU C;  2ZT9 B;  5KLI C;  1Q90 D;  2QJK C;  4IL6 X;  4PV1 B; 
#chains in the Genus database with same CATH topology
 1GAX A;  1OZ0 A;  2WLN A;  2YIA A;  3MHS C;  4EDF A;  3T1Y O;  1HNX O;  5GW7 A;  4OPH A;  1EZV I;  1X79 B;  2HEP A;  1BL8 A;  3CRC A;  1RQU A;  3G9R A;  1L4A A;  1QR8 A;  1PL4 A;  1DTO A;  3AEB C;  1NU1 J;  3WU2 E;  2NZ2 A;  4JAU A;  1TA8 A;  3K08 A;  3TNU B;  1GD2 E;  3K5B A;  1NTK G;  5B5E Z;  3WUU A;  1UPG A;  1SQV D;  1I7F A;  1JCD A;  4WFH A;  2CTR A;  1GL2 C;  2M0B A;  1S5L E;  2YIU C;  1K33 A;  2A45 I;  3L4F A;  2Z5U A;  1XMQ B;  2OYI C;  4EFB A;  3BRT B;  3JD3 A;  4JI6 B;  4AQR D;  4J11 A;  4LCU C;  1QR9 A;  4Q6G A;  1RE3 A;  4W4K A;  4DR4 B;  2J58 A;  1IBL B;  4K35 A;  2Q0A A;  3G80 A;  3CCU P;  1K34 A;  1AFO A;  3TGU H;  1NTM E;  1OCZ C;  1L0L G;  1FJG O;  1N7L A;  2B5U A;  1X9V A;  4JGS A;  5TIS E;  4UVA A;  1KYO F;  3MAQ A;  5CJ4 A;  4H0L D;  3UT5 A;  2M5A B;  4X65 O;  1F51 A;  4LFC O;  3HKB A;  2L91 A;  4WY4 A;  5GON B;  2N74 A;  1QLN A;  4LF9 O;  3O65 A;  1IXM A;  2GTA A;  3CJH A;  1M5I A;  2KSE A;  3H1J J;  4C46 A;  3CPW U;  2UXC O;  1NVP B;  3K79 A;  3B8E B;  4NXM B;  4DXW A;  1YQ4 C;  1Y74 B;  5IYB O;  4NTY A;  2HLD G;  2C0X A;  5AVZ B;  1I0H A;  3H1H E;  1IFP A;  4DR3 O;  4LFA B;  5B1B B;  5JVD A;  4H37 A;  2NRG A;  1L0N J;  2LW7 A;  2FKW B;  1MSW D;  2XAJ A;  4N6J A;  1URQ B;  2JEE A;  3CCJ P;  1Y6X A;  1KYO I;  3B71 A;  4F6R A;  3NXS A;  3NMD A;  3GHG B;  4MW8 A;  1QVG O;  4NXN O;  2OAR A;  3D71 A;  3P32 A;  3AE2 C;  3BVO A;  4XBF A;  4B3T B;  1NTZ H;  3A0B Z;  2Z5I A;  2AW9 A;  1I94 B;  5GTH E;  5E79 H;  1ZTE A;  2Q7E A;  1JOY A;  3RL0 D;  1KV4 A;  1R6K A;  4LF6 O;  1L0L E;  2LFR A;  1GTW A;  1J1D B;  3OGC C;  3BPZ A;  2GV9 A;  1PPJ E;  2AXT Z;  1W2B O;  3FYE B;  2DYR B;  5CB4 B;  3SYA A;  2JEU A;  1HNW B;  4JI3 B;  1WNS A;  3ASO C;  3BY6 A;  4DUY B;  1FOS E;  3AG1 C;  4IIJ A;  5KX5 A;  4DV1 O;  3N2G B;  4UB8 E;  2BCC H;  1Y47 A;  2IJH A;  5KHJ A;  4WY4 B;  2ZKO A;  1SQV G;  2YKP A;  3L36 A;  2UUB B;  1KFM A;  1LTT C;  2LFS A;  2W83 C;  4JV5 B;  1BGY H;  2EIM C;  5KA6 A;  1BQ0 A;  5B3S B;  2QJK C;  4PD4 I;  1N0J A;  2DWD C;  3KKY A;  4LF8 O;  3X2Q C;  1N7S A;  1Y4M A;  5DJT B;  4FLW A;  1PNK A;  3HKE B;  1WA8 A;  3JD0 A;  4KL1 A;  3H1I E;  3CC7 P;  2DJV A;  1SQX H;  2QGN A;  1RM1 B;  4X89 A;  2CAZ C;  4LP8 A;  3OMN B;  1GO3 F;  1Q86 W;  2J59 M;  1L2P A;  1WA8 B;  3WB0 A;  5B1A B;  2OIG A;  1JFF A;  3TXQ A;  1KYO D;  2GM4 A;  2B1G A;  1J95 A;  2EIJ B;  3DC6 A;  1AI5 A;  4XDK A;  1GN3 A;  4CZZ A;  3APQ A;  2OYH C;  4BW9 A;  3RVZ A;  3L75 E;  3JD1 A;  1JQ0 A;  1PGJ A;  3HR0 A;  4UCT A;  4JI4 B;  1MFT A;  4HZ3 A;  1OZH A;  4ZKU A;  2DYS B;  1JUN A;  1QLE B;  1FS0 E;  3GF3 A;  4IOI H;  2DN9 A;  3SYP A;  5B1N A;  3E8G A;  3JSN A;  3ASN B;  2FYU G;  1GM8 A;  3JCZ A;  3OUF A;  3AE4 C;  4DV7 B;  3RK3 C;  2F66 C;  3H25 A;  4CC6 A;  1NU1 D;  1LJ2 A;  1KYO E;  1L0L D;  4JYY A;  1G1X B;  3L70 H;  3D36 A;  1O9H A;  1BE3 D;  2OYH B;  3HPL C;  5IJ9 B;  4B3S O;  1BHA A;  2BCC E;  2R3C A;  2QTS A;  1FDI A;  3D6Z A;  5H2F H;  1MV8 A;  1LT1 A;  2OT5 A;  2KIK A;  3EWK A;  4RKU J;  2QJP B;  1BGY G;  5BR8 B;  1ZLL A;  1DLB A;  1K73 W;  2E75 D;  2KXP B;  2E43 A;  2R9A A;  2WA4 A;  1BE3 J;  1KD1 Q;  1JPX A;  2WSS H;  1QVG U;  4FIP C;  3H1K D;  1S5H C;  3L74 D;  4WB4 A;  3AEG C;  1OCZ B;  1NTK E;  1PGQ A;  2E5Y A;  1F7Y A;  3R2P A;  2RNB A;  3AK1 A;  1B04 A;  3ML0 A;  1GMJ A;  4JZ2 A;  4CH3 A;  3MGN A;  1NBM G;  3L74 G;  4J7Z A;  2RQ6 A;  5BR8 O;  3ZHQ A;  3U11 A;  2UUA B;  4X88 A;  2XND H;  2YEV B;  4C7N B;  1K3E A;  1FD9 A;  3OGI B;  3PN1 A;  2WAM A;  1L0L K;  5BMV A;  2CPS A;  1ARO P;  1OWA A;  4U3F J;  3OEE G;  1VQL V;  1N8R W;  1W2B U;  1K97 A;  1MFZ A;  3GG2 A;  4MTF A;  2E5T A;  1R3L C;  4Y99 C;  2V1D A;  5DJU B;  1ZWI C;  1DIP A;  2WSS G;  2Q9L A;  1N34 B;  2IBZ H;  5E79 Z;  3JYC A;  2KB1 A;  2MW2 B;  1ZRT D;  2KB7 P;  1Y9B A;  3H1I G;  3ABL B;  4LGD E;  5H5N A;  3U59 A;  2KZJ A;  4H0L B;  4IHJ B;  3H1L E;  3G4S V;  5KUM A;  3CCL V;  3B8M A;  1JCH A;  4NTX A;  2J5U A;  2X6B A;  1DEE G;  2UU9 O;  2C0W A;  3G71 P;  3CPW O;  4YIP A;  1YTF D;  4AHC A;  5LMN B;  2OWO A;  3BEH A;  2WQY C;  2FXP A;  2CH7 B;  2HFE C;  3SFD C;  4OH8 B;  1SQP D;  2EIM B;  1JOC A;  3D6Y A;  2BAS A;  5CA0 B;  3CRR A;  3HKB B;  1FU1 A;  3Q3D A;  5LHG A;  2WA3 A;  2JP3 A;  3CWB G;  5B1O A;  3ZDM A;  3ITK A;  1DD4 A;  3ZMT A;  5M1B A;  2W90 A;  4X1K B;  3I55 V;  4JYC A;  2QJY B;  1FPO A;  3CC2 V;  4K8Z A;  4PV1 C;  3VOU A;  1SQQ H;  3E8F A;  1KFN A;  2JKV A;  2GUS A;  5AVW B;  3KZI H;  1HP8 A;  2H8P C;  2YC0 A;  4WY4 D;  1MNG A;  3L75 D;  4X1K A;  2Q3E A;  1VMG A;  1YDX A;  1HNZ O;  2ZE8 A;  5AW5 B;  2V7Q G;  1Q43 A;  2YIB D;  1SQX G;  1EZV H;  3CLQ A;  1N73 B;  5A2Q N;  1PZQ A;  2BCC G;  4C7N A;  2H89 C;  3IR9 A;  1BCC E;  4D6T H;  2P2U A;  1TU3 F;  4H44 B;  4WWI A;  2FBW C;  2E42 A;  3WB2 A;  2WLI A;  3K0D A;  4QJF B;  1XI1 A;  3J80 N;  1N2D C;  3L72 J;  3A8T A;  1J1E B;  1KKC A;  1YYC A;  1TUE B;  2ETN A;  1ZW0 A;  4LH6 A;  1BCC H;  2R5D A;  2LXB A;  2E75 B;  4I4T A;  2IPP A;  2F95 B;  1PP9 J;  1L0N D;  3SJQ C;  4JQ0 D;  4YHH B;  4DOJ A;  3N7N A;  5J2T A;  3AE1 C;  1G6U A;  1Q5O A;  3C90 A;  4OPA A;  1ZL8 B;  2YIU B;  1JY2 N;  2KK7 A;  4R50 A;  2LO1 A;  2ODM A;  1XBL A;  5E1A C;  3M0D A;  2HR3 A;  1AV1 A;  2C9L Y;  1VQ6 V;  1IVS A;  3C3T A;  2OCC B;  5EC2 C;  1GM9 A;  3JAR B;  4FPP A;  1N73 C;  3CCQ V;  1H8E G;  3MHV A;  5LOV A;  1HDJ A;  1PPJ H;  1SQB D;  1Y8A A;  4HBN A;  1JR9 A;  2JR8 A;  2MKV A;  2F93 B;  2CH7 A;  4DR5 B;  1ZXG A;  2A9H A;  3QNE A;  4I6M C;  1W0K G;  2M6Y A;  1CI6 A;  4FFK A;  3N2G A;  2JDI G;  5LP6 B;  1YF2 A;  5IJ9 A;  1URQ A;  1LR1 A;  2ZM6 B;  1NAF A;  4G28 B;  1IBK O;  1RF0 C;  1VP7 A;  3RYH A;  4G2K A;  2WLJ A;  1Q81 W;  1WN7 A;  1L8D A;  3HD7 C;  5KLV K;  1VQL P;  2O01 N;  2XT9 A;  2PI5 A;  4UB6 Z;  2VWJ A;  1S9K E;  2ZE7 A;  4BIO A;  3L70 J;  2CTW A;  3CCE P;  1SQV J;  2IFM A;  3CWB J;  2Z4E A;  1CP9 A;  4WFB V;  4KHP B;  2KYV A;  4GKJ B;  4DCK A;  3LNN A;  2M3E A;  1S2E A;  4O2A A;  4B3S B;  1FE6 A;  1X22 A;  4JI6 O;  1GU4 A;  3H1H H;  1DX7 A;  2YEV A;  2HJF C;  2Y0D A;  3B5N C;  1KC8 W;  1NT2 B;  4JAV A;  5KAF H;  4IGG A;  3CCS P;  3K58 A;  4YTP C;  2ZD9 A;  2F43 G;  4E2L A;  1JX9 A;  2NNU A;  3C3S A;  2AHY A;  2ZDI C;  2XHB A;  3ABU A;  1USD A;  1H2S B;  4I4T B;  5JH7 B;  4TUY A;  1Q6I A;  1WT6 A;  1SS1 A;  4DR6 O;  3CC4 P;  1V55 B;  4IIJ B;  1Q7Y Q;  4PDL A;  4FLZ A;  1SQQ K;  5L3D A;  1VQP V;  3L73 D;  1YEW A;  1TUB A;  1R3J C;  5GTH Z;  1BGY E;  3MUD C;  1A02 J;  1EXI A;  1S76 D;  2DYS C;  2XZR A;  3ZHT A;  2HPC A;  2EJ7 A;  5KTB A;  3CD6 P;  2RN0 A;  1LNQ A;  3STL C;  5APQ A;  2YMY A;  3CWB D;  4UB6 E;  1EZJ A;  1T6A A;  2QDO A;  3ZRV A;  1SER A;  4PJ0 E;  1HVV A;  4CC5 A;  1OCC B;  1CSB A;  4I9W A;  2Q7G A;  3UO2 A;  1IFN A;  2YI9 A;  3UQ8 A;  4EKW A;  1HNZ B;  2K1E A;  4TV8 B;  3D8C A;  2ZAE B;  2A0L A;  2A06 G;  3K5L A;  1TGO A;  3F5T A;  2NPS B;  3AG3 C;  3CME P;  4O2B A;  2FYU J;  2IM9 A;  2KP8 A;  1G8M A;  2IDB A;  1YIJ P;  4AQY O;  1MZ9 A;  3M9B A;  3LID A;  3ETG A;  2CUG A;  4D6T G;  5IWA O;  4GT1 A;  2B87 A;  1JJ2 U;  5DM6 V;  1JMK C;  4MVU A;  4X1I B;  3ETE A;  4DT0 A;  5GTI E;  3PRJ A;  4MVR A;  3RWR D;  5D5Q A;  1FS0 G;  1JCC A;  5KA5 A;  1FZA A;  1RF1 B;  5AW0 B;  3RGB A;  3JAS B;  4X64 B;  3BCC H;  4N21 A;  1KOR A;  1LT9 B;  1CXZ B;  1EN5 A;  1A02 F;  1QQC A;  3S9O A;  2ZE6 A;  1EFR G;  4GYC B;  3K3W A;  1FZC C;  5AW9 B;  1NTZ E;  2QIW A;  4D7T A;  4B3M B;  4FLU A;  2LKM A;  1IFI A;  2KSD A;  1OXZ A;  2DYR C;  3OR7 C;  1YQ3 C;  3H32 B;  1NTK H;  1WPX A;  3U0Z A;  2Y4U A;  1S72 V;  1IBM O;  4MS2 A;  3AG7 A;  2HKO A;  2P4V A;  5LMU O;  3NTN A;  2QEX V;  1NI8 A;  1XTC C;  2QWO B;  3KZI Z;  4Z2W A;  1UJW B;  5IT9 N;  1Y76 B;  1AB3 A;  1N7S B;  1WP8 A;  2E75 C;  3ASN C;  2YKQ A;  3QWO C;  2WLH A;  1FKA O;  2GUZ B;  1SS3 A;  3FKS G;  4K0K B;  3IC9 A;  2JO1 A;  3JAR A;  1BDC A;  2A06 E;  1M1J B;  1PFI A;  1IZ3 A;  3KXD A;  4R7C A;  2AZ2 A;  4EI2 A;  3H1I H;  2UXN A;  2JJ2 G;  2PI4 A;  2QG4 A;  3SPI A;  2B9Z A;  1KIL D;  1KB9 E;  2O3J A;  3I56 V;  4JI2 B;  3M9H A;  4YIO A;  2Z3Y A;  3K59 A;  1NTM K;  2Y69 C;  2AEJ A;  5CMU A;  4GKJ O;  1JMB A;  3U1A A;  4LBE C;  5CCG A;  3RN4 A;  5C93 A;  4TT3 G;  4W80 A;  5B66 H;  4I2L C;  2HFE D;  3MUD A;  1VQM V;  1HW7 A;  3RK3 E;  4PV1 B;  2I8D A;  4LNU A;  4KHP O;  1ZSP A;  4KHX A;  5GTI H;  2OIE A;  1WPB A;  1VF5 B;  3AE8 C;  5GTH H;  3ZS8 C;  2JWA A;  4DR1 B;  2ATK C;  4ICG A;  4PV1 D;  4LFC B;  4IL6 H;  3CC4 V;  3TYY A;  1M56 C;  1QHT A;  3ICX A;  1NJI W;  4GX2 A;  1VEW A;  1U96 A;  1RSO B;  3H1J E;  1QVF U;  3B5N A;  3VQY A;  1KN7 A;  1QNM A;  4PDR A;  1FJK A;  1FYJ A;  4XFJ A;  1T8Z A;  4DJG A;  1RSO A;  3SYC A;  5CA1 A;  4B3R O;  1PNM A;  3JCU H;  3K5O A;  2ZT9 C;  1VAR A;  2FML A;  4DRX A;  2FYU E;  5CA0 A;  1P7B A;  4X66 B;  1JY3 O;  3M0A A;  1NU1 E;  2BOC C;  3OW2 U;  4CH6 A;  1BT8 A;  1XIL A;  2M5A A;  3JAT B;  2PUS A;  2P10 A;  4WBA A;  4DYL A;  3CMA P;  3H1J G;  3EVK A;  3FGA D;  5EBL C;  3IF4 A;  1H8A A;  2E76 B;  1R73 A;  2KKW A;  3OFN G;  2WTY A;  1V55 C;  2MK3 A;  1JVM A;  4TLF A;  2BE3 A;  3VQX A;  3A0B H;  4F6R B;  2KQX A;  3AG3 B;  2BEZ F;  3GMA A;  1VQ4 P;  3HKC B;  3VOP A;  4LWS A;  4J7K A;  5K1X A;  1PP9 G;  1NR7 A;  2WLL B;  3F5W C;  4PD4 F;  1HGZ A;  1K05 A;  4R4L A;  2ZXW B;  3PJS K;  2L6L A;  4JZG A;  1S5L H;  3OEH G;  3HUS A;  2P67 A;  4D6T J;  3MIW A;  2N9Y B;  2EX3 A;  4TQD A;  3FFQ A;  1M90 W;  3MP7 B;  4UB8 H;  5JQG A;  3CXH D;  3P3P A;  2Q67 A;  3THO A;  2N9B A;  3LW5 J;  2OCH A;  4BWA A;  5J2T B;  3LDC A;  2EIK B;  1NTZ K;  5AW1 B;  3ZRX A;  1GL2 A;  2ZNI A;  1OHH G;  4JF3 A;  2ZXE B;  1BGY D;  3NFQ A;  1KEC A;  3L75 J;  3H1K H;  1R5S A;  5H2F Z;  1K4C C;  2ZXW C;  2XTA A;  2KG7 A;  4P9P A;  4MT8 A;  2JVD A;  4Y99 B;  3HD7 D;  3U10 A;  4DZO A;  2UXB B;  5JJN B;  1CEZ A;  1HGV A;  1NU1 G;  1SZX A;  1SFC B;  4JI7 B;  1GM7 A;  4X1Y B;  1IUR A;  4U3F E;  3RK2 B;  2HVJ C;  5APT A;  3W67 A;  1FAV A;  1SQV H;  1SQP J;  5IYZ B;  2RH0 A;  3JSL A;  3V5B A;  4RUF A;  3LSU A;  3CX5 H;  3JSV C;  3E7K A;  4PI2 A;  4PJ0 Z;  4IYH A;  4DV0 O;  5LMU B;  2KOG A;  3VN0 A;  2EIJ C;  5CHX A;  4O4I A;  2QM4 A;  1KQL A;  3FYI B;  4MVM A;  3TGU D;  1VQ7 P;  1FAF A;  5TJH A;  3ZED A;  3Q4H A;  3CCV V;  2WSE H;  1M7L A;  2Z0A A;  1Z56 A;  5AVS B;  3Q2Y A;  1XEQ A;  1M93 A;  3ZRW A;  2WPV B;  4FM0 A;  3ETQ A;  2QJY C;  2QA4 P;  3L74 J;  1QGK B;  1WAZ A;  3UKM A;  2WLL A;  1N0N A;  1L1F A;  1H2N A;  4DUZ B;  3FB8 C;  4O4J A;  3TDK A;  3HKE A;  2WT7 B;  3WB1 A;  1OW8 A;  3S3X A;  2JEX A;  1YXB A;  1J5E B;  1SP4 A;  3L71 D;  3E8H A;  1KU9 A;  1N33 B;  5C39 A;  2PTM A;  2XV5 A;  2YNY A;  1SQQ E;  2YIB A;  3N27 A;  4FFB B;  4RO2 A;  1RE4 C;  3KHU A;  4RJT A;  3B5N D;  3CXC U;  1BCC G;  1ZP0 C;  1ROP A;  1WB7 A;  5B1B C;  2XKM A;  2YDE A;  2IJJ A;  1Q2N A;  3C1L A;  3OA7 A;  2FFD B;  5L3G A;  1M56 D;  4OXS A;  3LW5 H;  4O4L A;  5TIS H;  3CB2 A;  1S9K D;  1G2C A;  1IZN B;  1NTZ D;  3TGU E;  2Y0E A;  2XUM A;  2K9Y A;  3VMZ A;  1EDK A;  1SF9 A;  2EIL B;  2QM8 A;  1AA0 A;  1F4M A;  4L8J A;  2ZDI A;  1NTM J;  1YTZ I;  3FXE A;  5KAI H;  4F4L A;  3WU2 H;  2JGD A;  3TJT A;  2Q7H A;  4DR5 O;  1SQX K;  4ZI7 A;  3UM7 A;  5KX5 B;  4L76 A;  4B7E A;  2RCV A;  3IFX A;  3EHB B;  2DMX A;  5FNV B;  3WU2 Z;  3T1H O;  4H44 C;  3ZN0 A;  4D6T D;  4GOE A;  4PD4 H;  2BTQ A;  1MKM A;  4KP4 A;  5EZY A;  1VQ4 V;  1V9P A;  5B3S C;  2QJK B;  1UFI A;  2XND G;  1Y76 A;  1T3J A;  1JMM A;  3D3Q A;  4LF4 O;  4WFE A;  1H8H G;  1K4D C;  3W7W A;  3T1C A;  3CCJ V;  2PP6 A;  1IX9 A;  1YHQ V;  3EFG A;  2JWD A;  2CGO A;  5IJ0 B;  3U1C A;  3H1H J;  2B87 B;  4XDJ A;  4OWF A;  2YUA A;  4H0L C;  2N1T C;  2OCC C;  5LHH A;  4J41 A;  3H9V A;  3MHH C;  2YXY A;  2QRX A;  2BCC J;  1U7M A;  1JFF B;  1HR0 O;  1CW5 A;  3ZHV A;  4JI4 O;  1XL4 A;  5BMV B;  1WP7 A;  4D6T E;  4YY3 B;  2IJK A;  1M57 B;  2FYN B;  3CL3 D;  3E89 A;  1PPJ D;  1S3J A;  2B89 A;  2EIN B;  3JC2 2;  4ZNC A;  1PKX A;  4KFM A;  3T2M A;  2HG5 C;  1Z2G A;  3ZHS A;  2UUC B;  3AED C;  4BWN A;  1LTS C;  3KCY A;  5CCH A;  1LWU C;  5CBH A;  4IL6 E;  2ZCE A;  4MW3 A;  4FMT A;  4JPR A;  5H6Q A;  2QM7 A;  3BA8 A;  4GLX A;  5JCO C;  2NLJ C;  2PYJ A;  2NN4 A;  3RYI B;  2MJZ A;  1JNM A;  1SQX J;  2VRZ A;  3L70 E;  1E1Q G;  1EZV E;  5KLI C;  4C7U A;  4ASV A;  1BS3 A;  3A7O A;  1X4T A;  3CHX A;  2JJL A;  5EBM C;  3GLM A;  4O4H B;  1FFX B;  3F7V C;  2WMM A;  3JAS A;  1LT9 A;  1VQ9 P;  3HD7 B;  4JV5 O;  3RVY A;  3EXA A;  1VQ7 V;  2IU0 A;  2BSK B;  3E22 A;  4X62 B;  1YTF B;  3MZW B;  4LC1 A;  2AGA A;  4DRX B;  1SQP E;  2B9B A;  2JRI A;  4N78 E;  2QJ1 A;  1EQ7 A;  1M9N A;  3OAK A;  3VBB A;  1Z5W A;  5FL7 G;  1L0N H;  1NU1 H;  1XDC A;  1VQK V;  4TQF A;  1YJ9 V;  1CZQ A;  5JJE B;  1LWU B;  1KIL C;  1W2E A;  1M8O B;  2R44 A;  1HTL C;  3HKD B;  4PDV A;  3AEA C;  2PAJ A;  3CE2 A;  4GCZ A;  1S5J A;  3OTO O;  2ZJS E;  5FPR A;  2V7Q H;  5AW8 B;  5CCG C;  3SSU A;  2Y0P A;  1FZG A;  4DR7 B;  1SQB H;  4MN4 C;  1QX8 A;  1NVP D;  3HUS B;  3LIE A;  5ITZ A;  2IBZ E;  2JIZ G;  3JAW A;  1XL6 A;  3AG4 C;  3E83 A;  1YTZ T;  4N78 D;  1GK4 A;  1D5A A;  5FLX N;  3CWB H;  3OTF A;  2YS8 A;  4EB6 A;  3JCU Z;  3PH0 A;  3T4D A;  3LDD A;  4IFD K;  3TF5 A;  1PP9 H;  3CCM V;  4ZIB A;  1PIX A;  4C7R A;  4EB6 B;  5J2U A;  4RUE A;  4AIL C;  3TNU A;  1OMI A;  1ZUQ A;  3S1K A;  5LGU A;  4X65 B;  1BGY J;  2KNC B;  2VS0 A;  1KB9 I;  1B6Q A;  4RQF A;  5CBN A;  1SQB K;  2E3C A;  3TET A;  2E5L O;  2WPD G;  1DF5 A;  5BY1 A;  2D2C C;  2BSK A;  5LMN O;  3F5H A;  1RF0 A;  2M8R A;  4LWS B;  2P1J A;  4FZ1 A;  2Q7C A;  3CYO A;  1YHQ P;  2OYH A;  3VP8 A;  1KB9 H;  2N1T B;  4UV8 A;  4I0X A;  1KQG B;  4ABM A;  4XDL A;  2AXT H;  3L35 A;  4QIW F;  3TXS A;  1NTZ J;  3E1R A;  5BU5 A;  1LUW A;  1NU1 K;  2A45 G;  4LNU B;  3BCC D;  4O2B B;  1FFT B;  1EXJ A;  2EJR A;  2K88 A;  1BSN A;  4ZOL B;  1ZOY C;  1MZE A;  1NO4 A;  4WBN B;  1SQP H;  3A0B E;  2YI8 A;  4YY3 O;  1SQB E;  4RO0 A;  2VQE O;  4W4L A;  1NR1 A;  3Q1M A;  5JVD B;  2M3B A;  1LTJ C;  5KJ7 D;  1SQQ D;  3D70 A;  5F2V O;  1EDJ A;  1FZB A;  3T1H B;  1RY3 A;  1SET A;  1JM0 A;  1XQ8 A;  3L75 H;  2V7Q J;  3WG7 B;  2P06 A;  1D5N A;  2F23 A;  1R5L A;  3CCR P;  1VQO V;  1VL2 A;  3TGU G;  2KS1 A;  2YMK A;  2P7T C;  4WFF A;  4G27 B;  1EDI A;  3BCC E;  1VPC A;  4GZR B;  1IFM A;  3JCU E;  3V2Q A;  1USE A;  2LGQ A;  4EOT A;  3H1I D;  4YXW H;  2HPC B;  1S0V A;  1RPO A;  4MSW C;  1ORQ C;  4LH7 A;  4DV3 O;  1N36 O;  4QPJ A;  2GBO A;  1JA8 A;  2ZNJ A;  4I7Z C;  1GMG A;  5CBF A;  3ZN1 A;  4QE7 A;  2ZVO B;  1BCC D;  4P30 A;  4DR4 O;  2IBZ I;  1XNR O;  5KHG A;  4JI0 B;  1RHZ B;  1AIL A;  4MVS A;  3H1L D;  4JI2 O;  3P8M C;  1SA0 B;  1MA1 A;  4LF7 O;  1SFC C;  1WLE A;  2QKC A;  2JGD B;  4DUY O;  2OTL P;  1FXK C;  2ZIM A;  3CP1 A;  3ZMV A;  2EIL C;  5KAI E;  1RE3 C;  3UCS C;  3L71 H;  1BSH A;  4I0X B;  5JQG B;  2Y0I A;  1HWT C;  1OW6 A;  2QTO A;  1YSC A;  3HUS C;  3DXR A;  1BDD A;  3BAA A;  4TSF G;  4JAS A;  3CCE V;  1HNW O;  1ZLZ A;  1COW G;  4J10 A;  2OTK E;  4UXN A;  2IZ0 A;  3HB3 B;  2VQE B;  2PZS A;  5AW2 B;  5AW7 B;  5IYC O;  2AHZ A;  2B1I A;  1SRY A;  4UV9 A;  1JTH A;  1M57 D;  2DWE C;  3T97 A;  3WUV A;  3AEE C;  3BHP A;  2IYP A;  3CC2 P;  1LTG C;  5CCG D;  3H1L J;  1LP1 A;  2VWK A;  3SPH A;  3RL0 B;  4FM1 A;  3CCS V;  3EFF K;  3T4Z A;  2L5G B;  1ZV8 A;  3SWY A;  3ZMS A;  1QCE A;  3BA9 A;  3QG5 A;  1KIL A;  3CCM P;  2C9N Y;  4LF5 B;  3P8C E;  3V2P A;  3N2K B;  3KPE A;  2OTJ V;  2PYL A;  4WY4 C;  1NGM B;  2DQ3 A;  1NYH A;  3A0R A;  1XOU A;  4NR1 A;  5LHI A;  2VQF B;  1GW3 A;  2WPR A;  3CCQ P;  2QSA A;  4P9O A;  3ABK B;  4H13 D;  1L4A B;  3JAL A;  1NTM H;  5KAI Z;  2PFX A;  5IE9 A;  2B88 A;  4PA9 A;  1HJB A;  3CD6 V;  4N3Y B;  2Q6A A;  2OQQ A;  1OCC C;  5FPO A;  3Q4H B;  3AG4 B;  1KBH A;  2LGW A;  3JD4 A;  4J7J A;  3W7S A;  4U3J A;  4LFA O;  5B1A C;  1P84 I;  4X62 O;  4HNA A;  1GRJ A;  4I50 B;  3S3W A;  1N32 O;  4H44 D;  1E5W A;  3V2R A;  3E35 A;  3DTU B;  4UCV A;  3CXH H;  1H0T B;  1V54 B;  3GB7 C;  4P2Z A;  5JCO A;  4U3J B;  1VQ6 P;  4M3L A;  5L3E A;  1Q3E A;  2Y9Y A;  1F4N A;  1KQS U;  3UIA A;  5CCH C;  4RES B;  4U3F H;  2FYU D;  3RBZ A;  4LFB B;  3SR2 C;  2CPB A;  2ZYG A;  1VQN V;  1AVO A;  2Q3I A;  3ZMZ A;  2XNX A;  3KZI E;  4AQY B;  2JK5 C;  1RH5 B;  3UT5 B;  3GHG A;  3TCU A;  1NH2 D;  2P22 C;  3MD0 A;  1YIJ V;  3VMX A;  1AJY A;  3IAY A;  2I1K A;  2N1T D;  1IFD A;  2PF4 E;  2BEQ D;  2IBZ G;  3KQG A;  2POH A;  3W68 A;  1OCO C;  5CA3 A;  3G6E P;  2FYU K;  3F89 A;  2NR5 A;  2QWP B;  4DV3 B;  2K37 A;  2GSM B;  3H1J H;  4O4L B;  4QNH B;  2Q5Z A;  1EDL A;  2SPZ A;  4L87 A;  1SQV E;  2QE7 H;  3OW2 O;  5IY5 B;  5E79 E;  1YIT P;  1ZAU A;  3M0D C;  5A9G A;  1ZR4 A;  4OVN F;  3OMA B;  1LUV A;  2P4K A;  1IK7 A;  3JD2 A;  4DV7 O;  1T2K C;  1Q8I A;  1EM1 A;  2WVR A;  4DK0 A;  4MTG A;  1P84 H;  1AI6 A;  1I5Y A;  1NKD A;  4TV9 A;  3ZCC A;  1H38 A;  1SQP K;  3GWK C;  1YCI A;  4O4H A;  2VRS A;  3CRA A;  5LA6 A;  4CH4 A;  3CI9 A;  2A79 B;  4I55 B;  4GX5 A;  4B08 A;  2DW3 A;  2G38 A;  1GTO A;  5IYZ A;  1VQ5 V;  2XAH A;  1LTB C;  2CK3 H;  2KUB A;  1EZV G;  3JAK A;  4DW0 A;  2QEX P;  4TWK A;  4ZBM A;  5APY A;  3BAT A;  3M8A A;  3OMI B;  4OX9 O;  5BXZ A;  1SQQ J;  1AJP A;  5J9P C;  2ADP A;  4JYB A;  4K3A A;  4O4I B;  3M99 B;  1VQ8 P;  4NPE A;  3CXH E;  1K9M W;  4JYA B;  2O57 A;  4LF4 B;  3FWL A;  4I50 A;  4PI0 A;  5KAF E;  1YJW P;  5AVR B;  2W27 A;  1KKD A;  2WLM A;  3O9O A;  5EBW C;  4PDM A;  5D5P A;  4RWU A;  2G3A A;  5AVQ B;  4ZMD A;  2V4H A;  3LSS A;  2Y4T A;  2F1M A;  4JBZ A;  1NTK D;  3DGE A;  1N36 B;  1OCO B;  2YID A;  2LQT A;  1GDT A;  3N4X A;  1KTM A;  5EYP B;  4JI8 B;  1NZ6 A;  4GKK O;  3QO8 A;  2XAS A;  4KXR A;  4FLV A;  3P8C D;  3E8B A;  2EZO A;  1HR0 B;  1PL0 A;  3SWF A;  4LFB O;  4NPF X;  3K5M A;  1MAB G;  3R4Y A;  4QGP A;  2D3O W;  1AR5 A;  4OX9 B;  4H13 B;  2UXD B;  2EZP A;  4FFB A;  3J81 N;  1JJO A;  1M1J C;  2YXQ B;  1WJZ A;  2DE0 X;  1YI2 V;  2FL4 A;  1DK1 A;  5IYD O;  1NKN A;  1ZX3 A;  2L35 A;  2ADQ B;  1NKZ B;  3VYI A;  3HKD A;  3B09 A;  3AEF C;  3I5C A;  4GOD A;  1UII A;  5LXT A;  4DR7 O;  3L72 G;  1QBZ A;  1R8E A;  1JB0 J;  3L75 G;  4X1Y A;  3RFR A;  3B2E E;  1KUQ A;  3K57 A;  1L4A C;  3FXD A;  1FJP A;  5LOV B;  4U7O A;  2QWN B;  4YXD C;  1K5Q A;  1R3I C;  5KHH A;  4UCU A;  5HFL A;  3SPJ A;  4R4M A;  2K1A A;  2WLI B;  4BAY A;  4YHH O;  2A7W A;  1R6T A;  1E79 G;  4FVM A;  4DV4 B;  1FXV A;  2KLU A;  1CPY A;  2ZIO A;  5CJ0 A;  1PP9 E;  2Q9I A;  4FK5 C;  1VIB A;  5DED A;  1L0N K;  3V6I A;  3H1H G;  2A06 H;  1PGP A;  4KJM A;  1JO5 A;  2HHH O;  2QKA A;  5LYJ A;  2K3R A;  1VQN P;  3AE3 C;  1K73 Q;  1XMO O;  4JAA A;  1LGH B;  1J1E C;  4LF8 B;  5BU8 B;  1OCR C;  3AE9 C;  1R3K C;  2KNC A;  1W59 A;  2Q69 A;  4LLH A;  4NVP A;  1O9G A;  2UXB O;  4EEQ A;  3G6B A;  1H2K A;  3SJC C;  3IJ4 A;  3K5N A;  1PL5 A;  3G6E V;  4X9Q A;  4ASW A;  1KZU B;  3SYO A;  1RF1 C;  4X20 B;  3FB5 C;  2AXT E;  2UUA O;  5LGT A;  3M91 A;  5H2F E;  3SFE C;  5C8Y B;  3DXR B;  2GTS A;  1YIT V;  5KHI A;  3W7X A;  2WT7 A;  4RQE A;  3D36 C;  4GOF A;  3A0H E;  3VQW A;  3SGI A;  1SFC D;  2LJ2 A;  1PPJ G;  1Z5V A;  2EUL A;  1S1C X;  2KS1 B;  4PHZ A;  2ZFC A;  5EFW B;  3DC5 A;  2WSF J;  3ABV C;  3ABK C;  2FY8 A;  1KB9 F;  2W6A A;  4FLY A;  5LGN A;  1S5L X;  4IFF A;  4FZ0 A;  1QLE C;  2R3S A;  2R70 A;  2ZXX A;  4N23 A;  1M1K W;  3X2Q B;  2W6I G;  2HYN A;  1H2G A;  1QU7 A;  1IBL O;  2VQF O;  4WVZ A;  1KIL B;  2WSF H;  3L37 A;  2FFD A;  5APV A;  2X6A A;  3M7M X;  5EC1 C;  3H1L H;  3OM3 B;  4W7Z A;  5KJ7 A;  1BHB A;  5AW4 B;  1JY3 N;  4X1I A;  1GZL A;  1NH2 B;  2Q1K A;  4L73 A;  3WG7 C;  1FDM A;  4GDO A;  4QE9 A;  1K8A W;  1Q6U A;  2CTQ A;  2IH3 C;  4GKG A;  2O01 J;  2K9P A;  3CX5 F;  3ZBH A;  3WMM 0;  2AEM A;  2QJP C;  3CCU V;  1TAE A;  5HFM A;  2I1J A;  3BVH A;  1OV9 A;  1NWQ A;  5FNV A;  2P7J A;  1PGO A;  4OGQ D;  1K7D A;  2GUZ A;  2JS5 A;  3P30 A;  4DR6 B;  4B3R B;  3PHL A;  2XAF A;  3A2A A;  1FXK A;  4DR3 B;  4GIF A;  4ZHQ A;  2HOD B;  1A32 A;  4BIU A;  1PP9 D;  3K9A A;  3CX5 D;  4ZHQ B;  5TIS Z;  1XRE A;  2UXC B;  3ZX6 A;  3OE7 G;  4J9Y B;  1URF A;  1JY2 P;  4JYA O;  2JDI H;  1ZRT E;  5JJJ B;  5B5E E;  1M57 C;  2FYN C;  1YI2 P;  5EK0 A;  1PV3 A;  4DV6 O;  1SQX E;  4JI0 O;  1DF4 A;  3L72 D;  2UXX A;  4CBC A;  1QEX A;  2YXR B;  3PP5 A;  1G4Y B;  2WZ7 A;  4L75 A;  3AG2 B;  4J9Z B;  2DOS A;  1SQB G;  1NTM D;  5CCH D;  2H3O A;  2QWR B;  3VQV A;  2ZT9 B;  3C9I A;  4DV2 O;  3FWN A;  3CC7 V;  1N33 O;  3W7U A;  4NB5 A;  3RK3 B;  4HYT B;  1T5E A;  2DW4 A;  4B86 A;  3II6 A;  1KB9 D;  1H89 A;  4DV1 B;  1KQF B;  4DUZ O;  1LTJ A;  4H13 C;  2ILM A;  1N86 A;  5LBQ A;  1F23 A;  3PTZ A;  2WPS A;  4AI8 A;  2XAQ A;  1J5E O;  1SVF A;  4CH5 A;  3E22 B;  3BCC G;  4TV9 B;  2Q8V A;  2PY5 A;  1RF1 A;  1GN4 A;  1WB8 A;  3RYC A;  1Q81 Q;  3FAV B;  1X59 A;  2KSJ A;  3CEI A;  2WLK A;  4I55 A;  1L0N E;  3ABM C;  1KP2 A;  1VF5 D;  1SFC A;  1OX3 A;  3QO5 A;  4IL6 X;  5EIB D;  1I5X A;  2IH1 C;  1THZ A;  5KKZ C;  5LP6 C;  1IBM B;  5KLV H;  1BCC J;  2OYO A;  4DV0 B;  3SJA C;  4I1L A;  4YJ3 B;  3K03 A;  3O6Q A;  1MSD A;  3JAT A;  5CN0 A;  3S4R A;  4FM2 A;  4I5S A;  3RYH B;  3EQ2 A;  1WRG A;  4FJC C;  4JI1 O;  3H6P A;  2QR4 A;  1JTH B;  5L3B A;  3IN6 A;  3T97 B;  5BZB A;  2AXC A;  1I94 O;  4UVB A;  1SQV K;  3BAB A;  3CS5 A;  3K06 A;  3IFM A;  1MMM A;  1RPR A;  3L73 J;  5AVY B;  3AEI A;  2YXL A;  3ETD A;  4DR2 B;  2HOD A;  3RBX A;  1NAY A;  2QVA A;  3BRV B;  5LYJ B;  1GH6 A;  4WBN A;  5K1P A;  4UVC A;  1SQQ G;  4NPD A;  2E74 D;  3FX7 A;  5ITZ B;  3H1K G;  5APX A;  3CWB E;  4IL6 Z;  1URQ D;  2AEF A;  3K04 A;  4PD4 D;  1JEK A;  2A3Q A;  2N05 A;  3CCV P;  3VTP C;  3JAM N;  2R32 A;  3IC7 A;  3IGA C;  3ZHR A;  2QA4 V;  1Q6H A;  3H1L G;  4YJ2 A;  3AE6 C;  3P3N A;  1H2M A;  1W0J G;  4TOI A;  1U7J A;  1ENV A;  2KZI A;  3O8Z A;  4JPZ B;  1KC8 Q;  2QSI A;  1MZF A;  2W0X A;  3G4S P;  3JAK B;  1VF6 C;  2CGN A;  2UU9 B;  2YO2 A;  3L70 D;  1N8R Q;  1P84 F;  1GK9 A;  4BRY A;  1AVM A;  4UCR A;  4HNA B;  1BE3 H;  4I9Q A;  1G1I A;  1NJI Q;  3RYI A;  3G71 V;  1XNR B;  4BR6 A;  3J7A U;  4ZKI A;  3BAS A;  5APS A;  1HH0 A;  3Q5R A;  2Y0C A;  3BCC J;  1J2J B;  3STZ C;  4DV4 O;  5CBG A;  3QH9 A;  2Y69 B;  1K04 A;  3HE4 B;  2Q5U A;  1XMO B;  4O9B A;  2RN9 A;  2ZR2 A;  2D2C B;  1CI6 B;  1FFX A;  1OCR B;  2H8P D;  3RL0 g;  4LF5 O;  1OIP A;  1N34 O;  4EIJ A;  3QO7 A;  5K5G B;  3HE4 A;  3P7K A;  2DQ0 A;  1P49 A;  3KDP B;  3I55 P;  2W0F C;  2YXH A;  3OUS A;  3ZIA G;  2P5O A;  3OAA G;  4Z1M G;  2WSC H;  2M7W A;  5LA6 B;  1VQK P;  4AUW A;  1SQB J;  5CA1 B;  3QF7 A;  3L73 E;  1BMF G;  2Z5H A;  5CMZ A;  4MTX A;  4ZKP A;  1L4A D;  1YJ9 P;  3RT3 C;  5CB4 A;  4ZOL A;  4PA3 A;  3O6Q B;  3WUT A;  2O1K A;  2BTO A;  1KMI Z;  3K0G A;  4E4E A;  4NTW A;  2JGU A;  3L71 E;  1FOS F;  1H2L A;  2RJZ A;  3RK2 D;  4PA7 A;  1DD3 A;  4EYY Q;  3HRN A;  3PLN A;  1VF6 A;  3R66 A;  1EN4 A;  4X66 O;  2JJ1 G;  3T1Y B;  1HNX B;  1N73 A;  1L0N G;  1K92 A;  1YBK A;  4NXM O;  2O1J A;  1G1J A;  1GKF A;  2IU3 A;  3FB6 C;  3GVM A;  1OVR A;  3AE7 C;  1M1K Q;  4X8A A;  1LT9 C;  3N2K A;  1H88 A;  4FLT A;  3B4S A;  3L72 E;  3USS A;  2HP8 A;  3WFV A;  2CE4 A;  2XAG A;  5B66 Z;  1D2D A;  1AJN A;  1T3U A;  4TT3 H;  3AK3 A;  2BCC D;  3VMA A;  2NPS A;  3GF7 A;  2JS3 A;  2UUC O;  1BE3 E;  1YZB A;  4GX1 A;  2R9R B;  4JI8 O;  4WF9 V;  4GKK B;  5IDJ A;  3CX5 E;  1IXB A;  3CX5 I;  3SPG A;  2WIT A;  2ZIN A;  2XOK G;  2WWW A;  2FYU H;  2X7R B;  1NVO A;  4HKZ H;  3L74 E;  3HE5 A;  3H1K E;  1VQ9 V;  3M06 A;  4DV6 B;  3SYQ A;  1KP3 A;  2E5L B;  1FJG B;  2OGU A;  1ZME C;  1Y66 A;  3M9Q A;  2CTP A;  4R6Z A;  1XMQ O;  4U7N A;  4IHJ A;  1IDS A;  1S5L Z;  1M90 Q;  1HWY A;  2RMZ A;  4A7P A;  2UWJ E;  3SJB C;  3BRC A;  3OR6 C;  1EC5 A;  2YIC A;  4OGQ B;  1MG1 A;  1QLE D;  1Q82 W;  4K0K O;  3CCL P;  3BFR A;  5KHK A;  2HG5 D;  5EIB C;  2OYQ A;  1TVK A;  2W6B A;  4GX0 A;  2N1T A;  3FAV A;  4UUJ C;  3TSI A;  1SZT A;  4CS3 A;  4AYC A;  1EZV D;  2Q68 A;  1J1D C;  3GWO A;  4J42 A;  2CK3 G;  2GA1 A;  3CRQ A;  2QKS A;  3NR7 A;  2ZQM A;  4U7J A;  3SPC A;  4CS4 A;  2O01 H;  4B3M O;  1DH3 A;  3LSQ A;  3AEC C;  2FTK A;  2GUV A;  4ZI7 B;  3I5D A;  4DV5 B;  1JY3 P;  2E74 C;  1LWU A;  4CPG A;  1P7G A;  3OTO B;  2OYI A;  2Q4P A;  2YSU B;  4K8X A;  1NH4 A;  1URQ C;  1SKV A;  3HTK A;  5B5E H;  1M1J A;  2FXM A;  2PRR A;  1BSM A;  2BOB C;  2LR2 A;  2ZYA A;  2HJD A;  4OGQ C;  3ASO B;  3OJA B;  4XA4 A;  1FZC B;  1FDO A;  2NPS D;  1NQT A;  1KD1 W;  4U3F D;  1Q90 D;  5H6R A;  1EBO A;  2RKL A;  3L71 G;  5KLV E;  5L8R J;  3JAW B;  3ABM B;  1GL2 D;  3KYQ A;  4YJ2 B;  4RAI A;  1AR4 A;  1QVF O;  2X6C A;  4D7S A;  1FZF A;  4MTO A;  4NYK A;  5B66 E;  3SDL A;  2K9J A;  5KUK A;  1RM1 C;  2A45 H;  1B06 A;  1SQF A;  2HHH B;  2CDY A;  1LTJ B;  2E74 B;  2R9I A;  3Q5P A;  1XUQ A;  1V54 C;  2N04 A;  1VF7 A;  3ABT A;  4PEL A;  5APU A;  2P58 A;  4QPK A;  3H1J D;  3FX0 A;  1RQV A;  3K9S A;  1AP6 A;  1U57 A;  3TGU J;  3G67 A;  1KYO H;  1VDF A;  2E76 C;  1G2C B;  1NTZ G;  2Y48 A;  4YXW G;  1AQ5 A;  2IFN A;  2W8Z A;  3AK2 A;  1NS1 A;  5AVX B;  1BE3 G;  2WSE J;  3CXH I;  1L0L J;  2FXO A;  4DV5 O;  1MUU A;  4GUN A;  2Y9Z A;  2EBO A;  3A0H Z;  3SWK A;  1R6N A;  1N7S D;  4H33 A;  1NTK J;  4WFG A;  2ITA A;  4JTD B;  4B7K A;  4MVO A;  4F6E A;  1XTG B;  3A0H H;  5EZY B;  2W6J G;  4HAM A;  5JWP A;  1AI7 A;  1YVW A;  4JI5 B;  2Q6Q A;  1L0L H;  4EFE A;  1HUC A;  2G8Y A;  4PA6 A;  1EN6 A;  2RDC A;  2UXD O;  1YJN P;  1FXK B;  2D2C D;  1LP1 B;  5DN6 G;  5KLV G;  1KQS O;  3CRM A;  5IJ0 A;  3RYF B;  1QL1 A;  2A06 D;  5IWA B;  2QE7 G;  2IYO A;  3HKC A;  4R8C A;  2IZ1 A;  3L71 J;  4WCE V;  3CME V;  3RYF A;  2ITC C;  2H7H A;  4NKG B;  4I7Z B;  3ZJZ A;  2RMK B;  4L74 A;  1Q82 Q;  3KCX A;  1QL2 A;  3HD7 A;  2C2A A;  3B5N B;  1XNQ B;  1LTA C;  2Q73 A;  2YKO A;  4IFM A;  5KLV D;  4UCO A;  1SQG A;  1HF9 A;  2IX7 C;  3H32 A;  1OVU A;  5JH7 A;  4UCS A;  2K9J B;  5H9C A;  4KT0 J;  4HH2 A;  1IBK B;  3CCR V;  2ZR3 A;  4IT5 A;  1VQO P;  1US6 A;  2OTL V;  4HJG H;  1AJQ A;  1VF5 C;  4DO2 A;  1OJH A;  3C8V A;  5KJ7 C;  4Q20 A;  3FD9 A;  3CJH B;  5AVT B;  2XU6 A;  1XNQ O;  2ZM6 O;  1AVY A;  1VQP P;  5J2U B;  5AW6 B;  1SLQ A;  5EYP A;  2EIN C;  3IAO A;  2X0L A;  5BVZ A;  1Q86 Q;  1OVV A;  1I08 A;  1XHZ A;  2IW5 A;  1DEB A;  3QTC A;  2V4D A;  1S72 P;  3OT7 A;  1IC2 A;  4O4J B;  1W5C E;  3E1I A;  2H94 A;  3GHG C;  1TVK B;  3RL0 C;  5IY5 C;  1R1B A;  2GDS A;  1BZK A;  4PD4 E;  3B40 A;  3V4W A;  1XHX A;  5KLI B;  2EIK C;  2WSC J;  3QVN A;  1GL2 B;  3APO A;  4BXL A;  4LR3 A;  4UB6 H;  4XE5 B;  2ZVN B;  4W7Y A;  3CXH F;  3H01 A;  2OTJ P;  5AW3 B;  4DW1 A;  4DV2 B;  2XDJ A;  1E79 H;  3E2E A;  1Q7Y W;  2ZT9 D;  1PM9 A;  3I56 P;  3B77 A;  3ZRW B;  5AVV B;  2R72 A;  4PA4 A;  5L3F A;  1IK9 A;  3OD4 A;  2ARH A;  2Q0O C;  5KMG A;  3MDS A;  3A3Y B;  1SQP G;  3ZRS A;  1SQX D;  4DR1 O;  5LXT B;  1VQ5 P;  2LW1 A;  3CSX A;  1IO4 A;  1B3Q A;  5KMG B;  4TUY B;  3LNM B;  1UIX A;  1GN6 A;  4JF7 A;  1N4C A;  1RFY A;  5KLV J;  2P6J A;  4YJ3 A;  4ASU G;  1D7M A;  5GON A;  3CMA V;  2FKX A;  1S4X A;  2UUB O;  4UFZ A;  3RK3 D;  3MTU E;  1ZL8 A;  3VMY A;  1U97 A;  2P90 A;  2ZE5 A;  1IFJ A;  1FZE A;  1JY2 O;  4YPC A;  4BRY B;  4PJ0 H;  3AG2 C;  2W6J H;  5L3C A;  1P84 D;  1N32 B;  2E76 D;  1ZR2 A;  1P4R A;  1DGS A;  1GK6 A;  5KKZ B;  3E86 A;  3D3I A;  4J80 A;  4MVZ A;  1TUB B;  1K5S A;  1S77 D;  1KIL E;  2AZ0 A;  1SC5 B;  5LL6 Y;  3H1H D;  1H0T A;  4JI5 O;  5APW A;  3RK2 C;  4BW5 A;  4JI3 O;  1PD3 A;  3GW6 A;  5DEC A;  5CBO A;  4Z1V A;  1GU5 A;  2H43 A;  4JTA B;  1N7S C;  1YJN V;  2PGD A;  5LP6 A;  1Y67 A;  2F4V B;  3KG2 A;  3A2F A;  4Y28 J;  4WFA V;  3R65 A;  4X20 A;  4NXN B;  3F7Y C;  4IYI A;  3VP9 A;  2H88 C;  3B8N A;  2FB5 A;  1NTM G;  3L74 H;  1GN2 A;  3DSQ A;  4B3T O;  2FFD C;  3W7T A;  3TK1 A;  4BIZ A;  3Q5S A;  2KI7 B;  3HTK B;  2FYZ A;  4QMA A;  4DK1 A;  2PGG A;  4A5U B;  1NTK K;  1PV0 A;  4UB8 Z;  3ABL C;  4FLX A;  3LUT B;  3UO3 A;  4CS2 A;  2F4V O;  1VQM P;  2KG7 B;  1HBW A;  4O2A B;  1ZN5 A;  1P84 E;  1X0T A;  1FZC A;  1E1R G;  1RE4 A;  5AVU B;  1NHL A;  3G3Z A;  1AQT A;  1FBM A;  3ZMU A;  4X64 O;  2GHY A;  3RYC B;  2ZYD A;  2WPQ A;  1IJD B;  1SA0 A;  3L70 G;  2R5B A;  3RGU A;  1GW4 A;  4MVQ A;  4JI7 O;  3JAL B;  3V2N A;  1K9M Q;  2YO3 A;  3L72 H;  1K8A Q;  1BQZ A;  3AE5 C;  4JTC B;  4HYO A;  2KLV A;  1M56 B;  1MOF A;  2IBZ D;  2NPS C;  1AP5 A;  2LXC B;  2IJI A;  5GTI Z;  3ZHU A;  1FC2 C;  3HE5 B;  4KUM A;  1T2K D;  2BTQ B;  5AG2 A;  3A5T A;  2ITD C;  4LF6 B;  4LF7 B;  5KAF Z;  1WMK A;  3V4Q A;  1PNL A;  3LDE A;  4LF9 B;  4U3F G;  1FXH A;  1Y74 A;  3AG1 B;  1OFC X;  3L73 G;  1M4U A;  4JI1 B;  2OYI B;  2LP7 A;  1VQ8 V;  2HLO A;  3RW0 A;  4DR2 O;  4Z1M H;  1HJ0 A;  3H1I J;  4HB1 A;  1YJW V;  1OW7 A;  1SES A;  1X8Y A;  3H1K J;  1LTI C;  1NOH A;  1RP3 B;  3L9D A;  5C8Y A;  1AR1 B;  3L73 H;  2HVK C;  3FB7 C;  1AI4 A;  4TV8 A;  2QWQ B; 
#chains in the Genus database with same CATH homology
 2G8Y A;  2OQQ A;  1OW8 A;  2ZT9 C;  4H13 B;  3GLM A;  2IDB A;  2D2C D;  2O01 J;  2QJP C;  4OGQ B;  3Q1M A;  4H44 D;  1RQU A;  2E76 D;  3G9R A;  3AE6 C;  3AEB C;  3D70 A;  2NZ2 A;  2P10 A;  2MKV A;  3FGA D;  1ZP0 C;  2QSI A;  4OGQ D;  2V7Q J;  3AEF C;  1KIL E;  2E76 B;  4I7Z B;  1R8E A;  1JB0 J;  1DIP A;  1VL2 A;  1KOR A;  2YIU C;  2YMK A;  4U7J A;  4YXD C;  2QJK C;  4R4M A;  2BEZ F;  3GMA A;  3S9O A;  3Q5R A;  3AEC C;  1HF9 A;  1Y9B A;  1K05 A;  1AJY A;  4R4L A;  2E74 C;  2QIW A;  3AEA C;  1K04 A;  4H0L B;  2K9Y A;  4KT0 J;  4Y28 J;  2BEQ D;  2D2C B;  1ZRT E;  2FYN C;  4I7Z C;  1PV3 A;  1VF5 C;  1YQ3 C;  3C8V A;  2J5U A;  3RL0 g;  2H88 C;  4H0L D;  3Q5S A;  4OGQ C;  3LW5 J;  2WQY C;  4H44 C;  2E75 C;  2FXP A;  3AE3 C;  1FDO A;  3SFD C;  2ZT9 B;  3IAO A;  1MKM A;  1Q90 D;  2JO1 A;  3D6Y A;  1IK7 A;  5L8R J;  3Q3D A;  3AE9 C;  4YTP C;  2JP3 A;  1YQ4 C;  1KMI Z;  1DD4 A;  5M1B A;  1PIX A;  1OW6 A;  1KQF B;  4H13 C;  3GF3 A;  1PL5 A;  4PV1 C;  1DD3 A;  2WSC J;  3AE4 C;  1OMI A;  2E74 B;  3Q5P A;  3SFE C;  4H0L C;  3AE5 C;  3H25 A;  1RQV A;  3B71 A;  1EXI A;  1VF5 D;  1U57 A;  3AEE C;  2E76 C;  2H89 C;  3AE7 C;  4IL6 X;  1S1C X;  3RK3 E;  4PV1 B;  2ZT9 D;  3D71 A;  3AE2 C;  2WSF J;  5KKZ C;  3ABV C;  1FDI A;  3D6Z A;  2D2C C;  4RKU J;  3EWK A;  1TU3 F;  4H44 B;  2FBW C;  3O6Q A;  1VF5 B;  2E75 D;  3AE8 C;  1S5L X;  2G3A A;  2WSE J;  4TT3 H;  1WMK A;  3GF7 A;  1KQG B;  3T97 B;  3IN6 A;  3AED C;  4PV1 D;  3AEG C;  1NGM B;  3Q2Y A;  2E75 B;  1NYH A;  4Z1M H;  1HJ0 A;  1UIX A;  2WPV B;  1KTM A;  3AE1 C;  2QJY C;  1GMJ A;  1EXJ A;  1OW7 A;  4H13 D;  2E74 D;  1ZME C;  1ZOY C;  4XFJ A;  5KLI C;  3R4Y A;  4GDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...