2ZT9B

Crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2008-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2zt9B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2zt9B01
4KT0J 1S5LX 2WSCJ 1VF5B 2QIWA 2ZT9B 2D2CB 4IL6X 2WSFJ 3C8VA 5KLIC 5KKZC 2K9YA 3LW5J 5L8RJ 2WPVB 2E75B 1ZRTE 2FYNC 4H0LB 2QJKC 2QJYC 2QSIA 2O01J 4H13B 4PV1B 4Y28J 4I7ZB 2WSEJ 4OGQB 1JB0J 1Q90D 2E76B 4H44B 2QJPC 4RKUJ 2E74B 2YIUC
chains in the Genus database with same CATH superfamily
3RYIB 3SSUA 4GKJO 2R32A 2DYSB 4FK5C 1S2EA 4DV3O 2XV5A 1BDCA 2UUBB 3AE7C 4JAUA 3EFGA 3O65A 1M93A 2A06E 3AK3A 4AQYO 5CBFA 1S77D 2IDBA 5KHGA 1MKMA 1ZRTE 3CCVV 5APQA 1Z5WA 4LF4B 3W67A 2H3OA 5DECA 4ABMA 5B3SC 1JJ2U 1VQ7V 5CBOA 2M0BA 3D36C 4U3FH 3C3SA 1N33B 1W2BU 4LF8O 4WBAA 4LH7A 1FYJA 1VQ6P 4TUYA 4O4JB 4Y99C 1Q8IA 1X22A 3AEDC 1VQ7P 4JI7O 1AI6A 3E7KA 5CA1A 3L75E 5AVUB 1MZEA 3KKYA 1KB9I 1SQVK 3AE1C 1K5SA 1M56D 1G2CA 2E74C 5CB4A 4JI8B 1PNKA 2WPVB 5APTA 2Q3IA 1S1CX 3QO7A 4DO2A 4JI5B 5J2UA 1TUBA 1B04A 1NBMG 1KB9H 4B08A 2HODB 1G8MA 2C2AA 2EILB 2OIEA 2KB7P 2B89A 2N74A 2W6AA 2UUAB 2Y0DA 3ABVC 3K9AA 1ZL8A 3V2PA 1SKVA 1N32O 1W2EA 1M57C 3LSUA 3RWRD 3BCCG 5AVYB 3S4RA 3R2PA 1WN7A 3UM7A 5GTIE 1R3IC 4JYAO 4XBFA 4NPDA 5AW6B 3RVZA 3APQA 4QNHB 5APWA 1AJPA 5FLXN 4CH6A 5IYCO 1FJKA 1GMJA 2GDSA 3ETDA 1PP9D 3L72D 1SQXE 3PLNA 2CH7A 5B1BB 1DK1A 2UXXA 1PPJE 3UT5A 1YVWA 3H9VA 4PA9A 3VQXA 4JI4B 1AV1A 1KQLA 3G67A 1RPRA 4UCUA 4DV7O 1Q5OA 2R3SA 4XDLA 4B3SO 3JD4A 1M8OB 1OFCX 1ZV8A 1Z2GA 3H1KD 1I0HA 1WP7A 2QM7A 3OTOO 2JDIH 3AEBC 4DV5O 2KG7B 3D3IA 1MFZA 2H94A 2Q8VA 4A5UB 4M3LA 1K73Q 4LBEC 1E5WA 1W0JG 5LOVA 3B8NA 2K37A 1EZJA 4TSFG 3CD6P 2DQ0A 2A7WA 1USDA 3T1HO 3MDSA 3NXSA 1R3KC 3L73D 2WLMA 2DYSC 4X88A 4GKKB 2ZE6A 1LGHB 3HPLC 1RF1C 2QTOA 3MHVA 4L75A 1LWUC 5DJTB 2W90A 4XDKA 1MSDA 4Z2WA 1PGPA 5AVXB 4DV7B 2FTKA 4DV4O 4IL6E 1L0NE 1HTLC 3D3QA 2IX7C 3MZWB 3VQWA 3CXCU 1SA0A 2W6BA 3GHGA 2N9YB 3JYCA 3K0DA 3VOUA 3L74G 1BHAA 3OMIB 2OYQA 2JO1A 2PFXA 3U10A 4XE5B 2YEVA 1FXKC 4MVSA 4H33A 1QQCA 3E8GA 3KXDA 3RK3E 2E43A 5AVSB 3JD3A 4LR3A 4IT5A 4K0KB 5BMVB 4YPCA 4MW8A 2A06G 2Q5ZA 3SYCA 3OD4A 1OCOC 3BABA 4BWNA 4FM1A 1Q2NA 1JFFA 4HBNA 1BE3J 1KUQA 1GN6A 2JEXA 4LF9B 4PJ0H 2WLJA 1X0TA 2N05A 3ZN0A 1OVVA 2QJYC 1Y4MA 4NPFX 3X2QC 3JSNA 3N27A 2KI7B 1COWG 1NU1E 2UXBO 1KU9A 1NTKD 5LXTB 1OCZC 2E76B 3HKEA 1K92A 1URFA 1H89A 3VMZA 2UUCB 5C8YB 1KTMA 2CTRA 3RK2C 1U7JA 4JTCB 3SYPA 1VQNV 1HJBA 1DD4A 3N2KB 5J2UB 4LFAO 5H2FE 5CBGA 1Y66A 1H2NA 3B2EE 1DEBA 2VWJA 3DC6A 3CCMP 1YTFD 1IFPA 1SVFA 3CXHF 5GTIH 4QPJA 2KLVA 2O01J 3JATB 4GODA 4CS3A 1YJ9V 1US6A 1GM8A 1NO4A 1IK9A 2N9BA 4H0LD 1KYOD 1LR1A 1KQFB 2ZR2A 3PN1A 4LH6A 3BVHA 4TQDA 2XAQA 2JIZG 2ZAEB 4OVNF 1JJOA 5GONA 3W7TA 4DV3B 1HNXB 4WFEA 3GHGC 1JNMA 4J11A 1NH2B 1NTZJ 2P7JA 1NGMB 2Y4UA 4UCRA 1FXHA 1X59A 2WAMA 3D6ZA 4IYIA 1XMOO 1FXKA 2AXTZ 2FB5A 2HLDG 2RN0A 3UT5B 5D5QA 1HNZO 2YSUB 3JAKA 4G28B 3G3ZA 4EIJA 4YJ2A 4DR4B 3QO8A 1W0KG 5L3BA 4PD4D 4K35A 1NH2D 2C9NY 4R4MA 4ZHQA 2ZT9B 2QIWA 5EZYA 4U3FE 3TETA 4FVMA 1QU7A 4IL6H 3A3YB 4HB1A 2IM9A 2JKVA 3RYFB 2VWKA 1GL2D 5JJJB 1P49A 3L71E 4LWSB 3ZHQA 1SFCA 1JO5A 3RBZA 1VPCA 4JV5O 3SJBC 1YCIA 1LJ2A 3TGUG 2ITDC 1S0VA 3E83A 1YTFB 3BATA 5LGTA 1GW4A 2WZ7A 1JTHA 1EZVI 4I4TB 4PI0A 5FPRA 5B66H 3V2RA 2QWOB 1DGSA 2OCCB 3IC7A 3T4DA 2IH1C 4OGQC 3FFQA 2BE3A 5LMUO 2YMKA 3ABLC 5B1NA 1S9KE 4UUJC 2CGOA 2WPRA 3MAQA 3CMEP 1R6NA 2PF4E 4H13D 2YIBA 3ASNC 2CUGA 2RCVA 3RK2D 4YXDC 3CWBH 1KFNA 2GTSA 2NPSB 2DW4A 1LTTC 1KD1Q 1V54C 3OAAG 1KORA 1M1JC 3S3WA 3P30A 4JI3O 1EQ7A 1L0NH 1PPJH 4HKZH 3CJHA 1N86A 1SLQA 3TK1A 5CA3A 2ZKOA 4UCTA 3TYYA 2EIMB 5GTIZ 4XFJA 3B77A 1VQKV 2I1JA 3CCUP 2H89C 4LGDE 3TF5A 4DV5B 5IYZB 2ZXXA 3CMAV 1RM1C 1JFFB 1SESA 5LYJA 4X89A 5JCOC 3TGUJ 3GG2A 1S5LZ 4UCOA 3EVKA 2K3RA 3AEFC 3IFMA 2JRIA 5A9GA 2NR5A 2P06A 1P84H 1NTZE 1LTJC 2Q6QA 2V4HA 1XDCA 4QIWF 1RFYA 1YQ4C 1S5JA 1YIJV 1NVPD 4MW3A 1GK4A 1RE3C 1EN5A 3OM3B 1AR5A 1KB9E 4L73A 2OWOA 3RYIA 2G3AA 3D70A 3OTOB 1ORQC 2JGDB 2NNUA 5B1BC 3L73H 4I55B 4OPHA 4I9WA 1HWYA 1R73A 4OX9B 2WWWA 1NTMH 2LGQA 3ABKB 1SFCD 2OQQA 2ILMA 4H0LC 4XDJA 5IY5C 1NTMJ 1WAZA 2IBZD 5CCGC 3U59A 4I2LC 3L75H 5JH7A 5B1OA 1CZQA 1NTZD 2E3CA 3MGNA 1JY2P 1ZUQA 1P7GA 3WB0A 1URQB 1K8AQ 1GKFA 4UB6Z 2V7QJ 2N1TC 4YIOA 2QR4A 3QH9A 1NU1H 5CJ0A 1MG1A 3K0GA 2P1JA 1L4AC 3RK3D 5KUKA 1T8ZA 2UU9B 1GH6A 1VF6A 4OH8B 3TXSA 1Y6XA 1FZCC 1N32B 4TWKA 3ZHTA 3CXHD 4O4IA 1M1JA 1SQPH 4PD4H 3M9BA 3AK1A 4P9OA 3ITKA 4ZBMA 1QVFU 4RO0A 5AVQB 1JTHB 2GBOA 3PJSK 1IBLO 4PV1D 1N4CA 3OJAB 3AG1C 4X62B 3K3WA 5CHXA 1L0LH 1G1XB 4YIPA 4DV1O 5IJ9A 3HE4A 4NTYA 3STZC 3K79A 2YS8A 1ZOYC 3KQGA 2A9HA 4WY4B 3SYAA 1BGYJ 4U3FD 1NU1D 3AG3C 4DT0A 3TJTA 4NYKA 1LTJA 3VN0A 2P4VA 2CK3H 2FYUD 2R5BA 3Q4HA 1QCEA 3LSQA 4NXMO 1G2CB 3GVMA 3JARA 3MTUE 4JPZB 2R9RB 4P2ZA 3SWFA 3KYQA 3T4ZA 2WLIB 5B66Z 3H6PA 1VMGA 4K8XA 1IFMA 1EN4A 3H1ID 3AG2C 1Z5VA 3SJCC 2ARHA 2HLOA 4MS2A 3CSXA 2LR2A 4ZI7A 5KHKA 5KLVK 1IZNB 1JPXA 2LP7A 3ETGA 2R5DA 3CCRP 1IK7A 4I1LA 3H1LH 3VMXA 2NPSA 2G8YA 2LXBA 5L3GA 3M0DC 2HPCB 3EXAA 1BT8A 1SETA 2BTOA 1G1IA 1S4XA 3N4XA 1VF6C 3H1LJ 3P8CE 1BHBA 4F4LA 2EZOA 1SQXH 4LP8A 4KT0J 1N36B 3B71A 1B3QA 5TISZ 4FFBB 4FLVA 2WLLB 1LTBC 5H5NA 4UB6H 5KTBA 3GHGB 1FFTB 3HKDA 1KYOE 3SDLA 2UXDO 5D5PA 1JCHA 3CPWU 1HBWA 2Z5IA 2MKVA 3Q2YA 2RQ6A 2BSKB 3TNUA 1SQGA 3CCLV 5C93A 3M9HA 2A45H 3N2GB 2QWNB 3B5NA 2FYUE 2IYPA 2Y4TA 1AJQA 2EBOA 4EOTA 1FFXA 4PV1C 4WFGA 4DV2O 1SQPD 4PHZA 4UVBA 2ZE5A 5GTHZ 4O4LB 4O2BB 4GLXA 1VF5B 3ZMUA 1EC5A 2Q9IA 3K5NA 4JYCA 4CC5A 3H1IG 2E74D 1S9KD 1QLNA 1MZFA 5EYPA 1AP5A 1BCCJ 4D6TJ 4QE7A 4TQFA 1QR8A 1OW8A 2BOCC 1RM1B 2IBZI 3GF3A 5IWAB 5CCHA 1XMQO 5LP6B 1LT9A 4FPPA 4TV8B 3M06A 1RSOB 1F4NA 4PI2A 3A0HE 3H1JE 1YJ9P 2D3OW 4DR7B 3P32A 3TXQA 1IXBA 1Q6HA 2CK3G 3DC5A 2RN9A 4DK1A 2QJPC 3H1JG 1VARA 4LF5O 2FXPA 3ZMTA 3BA8A 4WY4D 1CI6A 1FZBA 5C39A 3HKEB 2IJKA 5AW7B 1N8RQ 2IFMA 2NPSC 4Z1VA 5JWPA 4CH5A 4X20B 3CC2P 5CJ4A 1HH0A 2O1KA 2UXBB 1GN3A 4LCUC 4MVMA 3H1IE 3S1KA 2E75D 2DOSA 2YDEA 2OTJV 1OVRA 2X0LA 4BXLA 2W0FC 3D71A 4CH3A 1I5XA 5CMUA 2QVAA 3V6IA 3T97B 3DTUB 1LT1A 3J80N 1AVMA 2NZ2A 1RF0C 1M9NA 3I55V 1K7DA 5L8RJ 3H1KH 2PZSA 1Y9BA 1AB3A 3RYCA 1OCRC 1JX9A 3IAOA 4DRXB 2M8RA 3L70H 1QLEC 3B8MA 4W4LA 2QTSA 2ZM6B 4CS4A 5JJEB 1YTZI 3MIWA 3HD7B 1HDJA 4GKGA 5KLIB 3H01A 1A02J 5KHHA 3B09A 3JCZA 5CB4B 1HJ0A 2QWRB 4B3RO 3FGAD 4IOIH 2DE0X 4WB4A 1KV4A 3F5HA 3KZIZ 2A3QA 5B3SB 1QL1A 4OGQB 3AG1B 1KC8W 1S5LH 1RPOA 1F51A 1AFOA 1EZVD 1U7MA 1KQSU 4ICGA 1GU5A 2QWPB 3CCSP 1IZ3A 1J1EC 4GKKO 1EZVG 2QJYB 5AVTB 2Z4EA 3ETQA 3ABMB 2A79B 4UV8A 4DUZB 2X6AA 3KHUA 3JSVC 4GCZA 2ZYGA 2OTKE 4J42A 1WPBA 4DV4B 2IW5A 1T3JA 1L0NJ 1MABG 1DIPA 3Q4HB 1SQBH 1KILE 1Q7YQ 2ZXWC 3MUDC 1BGYG 4FFBA 1KN7A 4IFFA 1SRYA 3E22A 2WLIA 4G27B 3CL3D 3CRMA 2AHYA 2XAGA 4JTAB 2C0WA 5GTHE 3H25A 2LFRA 4DW1A 4NXNB 3GMAA 1FBMA 2KXPB 1EN6A 3JD0A 3H1JH 3LDDA 1NJIW 2XNXA 3W68A 3OGCC 4JI3B 5AW5B 1IX9A 3CXHI 1BMFG 4BWAA 1NAYA 5KLVH 2NPSD 3CC7P 3IJ4A 5IYBO 4LF7B 3RGUA 1HNWB 3CEIA 2JGDA 5LBQA 5IWAO 1GDTA 3ZS8C 1KILB 1Y76B 4JI8O 1NTMK 4N78E 3IN6A 1NTME 3IAYA 1PV0A 4DR1O 4AQYB 4IFMA 4OGQD 3ZIAG 1CP9A 2YIUB 2FYUJ 3CRRA 3U0ZA 2OCCC 2D2CD 2WA4A 3WU2H 4PDVA 3FD9A 4X8AA 2UUAO 2K1AA 4BIUA 1PNMA 4DYLA 3CRQA 1DX7A 3CPWO 5LGUA 4EFBA 4NPEA 3BY6A 2JR8A 4LFCB 2FFDA 2FXMA 3B5ND 1SQQD 1RQUA 4MVOA 3HKBB 2ZDIA 3OW2U 1VQ8P 1LTIC 3M91A 1KQSO 5KHJA 4JYYA 1SQXD 3H32B 3AG7A 4GYCB 4I50A 2ZXWB 3K58A 4JI7B 2Z0AA 1FU1A 4TLFA 5BMVA 2E75B 3JASB 1TA8A 2WPQA 3AE6C 1GN2A 1KYOF 4O2AB 5JVDB 3MUDA 1XEQA 1OXZA 3S9OA 1FD9A 1N2DC 4I7ZB 1VQ9V 5J2TA 1L0LJ 2P7TC 1URQA 2JEEA 3AEGC 3OE7G 1J1DB 5LP6A 1LT9B 4X64B 2E5YA 2J58A 3RN4A 1PNLA 2DMXA 1BE3D 1XL4A 3BASA 4FLTA 2A06H 4UVCA 4YHHB 2EIJC 4X1KB 3G6EV 4DR7O 2VQEO 1SP4A 2BCCE 3H1HG 1R6KA 5B66E 2O01N 1Q86Q 4J7ZA 2P67A 2V7QG 1Y47A 3O6QB 3T1YB 1W5CE 3VP9A 1QVGO 1SQBG 3E1RA 2CH7B 4H0LB 1JVMA 2BOBC 2JK5C 1PGOA 2JJ2G 1D2DA 2RMZA 4F6EA 2GSMB 2YKQA 3E22B 1K73W 2P22C 1GO3F 1VEWA 2XKMA 4J9ZB 1N73B 1YJNV 4MT8A 3JD1A 1RP3B 1VQPV 2AEJA 2ZVOB 3OW2O 1BL8A 4QE9A 3UO3A 5KAFH 4HYTB 3G80A 2N1TB 2D2CB 2XAJA 2JS3A 3RYFA 1FJGB 3KDPB 2FYUG 2OYOA 3V5BA 4ZOLA 2HFED 4R7CA 3ZHUA 3FB8C 3E8HA 2AXTH 1GAXA 1FZCB 4DK0A 3ZRWA 1J5EB 1L4AA 1PP9H 3L72H 3RYHA 3THOA 2XHBA 1WB8A 4LF6B 2Y9YA 1T6AA 2IBZH 3IR9A 4Y99B 4JI6B 1YBKA 4X62O 5KJ7C 4CBCA 4YHHO 2G38A 1L0LK 3EFFK 4H44B 2PYLA 1FAVA 3T1CA 4WBNB 4YXWH 1P84F 2GTAA 3ZN1A 3L71H 1WB7A 2BSKA 2M3BA 3JAMN 1N0JA 2JVDA 4JGSA 4PDMA 1YZBA 1P84D 1URQC 3L71J 1XTCC 4WCEV 1XOUA 4MVRA 1ZP0C 1RE3A 2VRSA 2JJLA 4B86A 5BXZA 1Q3EA 4GOEA 2E76C 1DH3A 1AA0A 2OTLP 3G6BA 1IC2A 2YKOA 3ZRSA 1I94B 3RT3C 4JF7A 2MJZA 4FLXA 1MSWD 2FKXA 3APOA 4N23A 1BCCE 1L4AB 1RE4C 1USEA 2ZINA 1N7LA 4J7KA 4PJ0Z 1NTMD 5CCHD 3PTZA 5EFWB 3LSSA 1IDSA 2WSSG 1I08A 3LW5H 1SERA 4Q20A 4B3SB 2LFSA 4Q6GA 1X4TA 1YQ3C 4NXMB 5KKZB 1M90Q 1SQVJ 1NKZB 4TUYB 1SQFA 2IJIA 3ZBHA 2YNYA 3TSIA 3L74H 2JS5A 2C9LY 3RL0D 4JQ0D 3H1HH 1O9GA 1RY3A 2P6JA 1P4RA 5LXTA 2O57A 3SPHA 3ZHVA 4ZIBA 3WMM0 4L8JA 1SC5B 3H1HJ 3ABUA 1WPXA 2Q4PA 4GOFA 4RO2A 1JQ0A 1IBMB 2MK3A 2VRZA 4O9BA 5JJNB 2PP6A 3HD7D 2UWJE 5AW4B 4FIPC 2ZM6O 2PGDA 4OX9O 3M0DA 1HW7A 2Z3YA 2P90A 2A45I 1GTWA 2AZ2A 3ABLB 3SR2C 3LNMB 4FMTA 2YXYA 5KLVE 5KHIA 2WSEH 1NR7A 4YTPC 3NMDA 1BCCG 3CCQP 2XT9A 1YJWV 1IJDB 3ABMC 1L0NG 1XBLA 4I5SA 3IC9A 2OTJP 3GW6A 1XQ8A 3FB7C 3MHSC 4N6JA 5L3EA 1VL2A 1F23A 1K97A 2BCCD 1XL6A 3CLQA 1JY2N 2J59M 5AVRB 3WUTA 3L75D 4A7PA 1ZMEC 4BIOA 2R44A 1LWUB 4JAVA 4IYHA 2BTQA 2WVRA 1N34B 4UB8E 1T5EA 4W80A 3OFNG 1PGJA 2HHHO 4Y28J 1E79H 1RHZB 1OIPA 4JV5B 2HFEC 3K5OA 1K33A 5EIBD 5LHHA 5L3DA 3BCCD 2DYRC 3CCVP 3LIEA 1J1EB 1CSBA 1FPOA 4C7RA 1SQQH 1LT9C 3ASNB 3CI9A 1BSNA 1NHLA 1PFIA 1FJGO 3UKMA 1X8YA 4FLYA 4MVQA 5FPOA 2EZPA 1KB9D 2ZYDA 3ZRVA 1V54B 1Q81Q 2CE4A 5EBLC 5CA0B 2DN9A 3KG2A 1ZN5A 1SQVG 1LP1A 1NWQA 1CPYA 1OV9A 1P84I 1YIJP 2QSIA 2H8PC 1MA1A 2CTPA 2P2UA 3HTKA 5L3FA 2GA1A 4PELA 4AILC 1YTZT 3X2QB 1L0ND 1NU1G 1TGOA 1NTKK 4OPAA 3BFRA 2EIKB 1UFIA 2KSDA 5H2FZ 3T1YO 3CCJP 4IGGA 1ZLZA 1SQVE 1BE3H 2Q9LA 3SJAC 1NJIQ 2OIGA 5KMGB 1L8DA 3GWOA 5HFLA 1XNRO 5ITZB 1RF0A 3G71V 2ZQMA 4W7ZA 2YMYA 5LOVB 2AEFA 1QLEB 4MTGA 3WG7B 2GUSA 4H13B 2CPBA 2BASA 2QJPB 4AHCA 2Y0EA 1J95A 1MFTA 2EINC 2B87A 1J5EO 1YYCA 5AW1B 2LW1A 1MV8A 5APVA 4ZKUA 4YJ3B 3PP5A 3QTCA 5AW8B 2ITCC 5EC2C 3CHXA 5CMZA 3Q5RA 3OUSA 1JOYA 5EK0A 3CWBD 2L35A 3I5DA 3FB6C 3CCEV 4DV2B 2YIAA 1WA8B 2OCHA 1PPJD 2Y69B 5IE9A 1UJWB 4PDLA 1SQQK 4DJGA 1Q43A 1IFJA 1GL2B 1Y74B 2ATKC 3DGEA 1VQLV 4CS2A 2RKLA 2YXLA 1PPJG 3HKBA 2Y48A 3AK2A 1GN4A 3JALB 2M7WA 2ZT9D 2WSCH 3L37A 1JY2O 4RKUJ 4DV6B 4UFZA 1YF2A 1KILA 3V2QA 3EHBB 4KP4A 4NVPA 4JPRA 3HB3B 3I5CA 4AYCA 3A7OA 5B1AC 5TJHA 3ZEDA 2H88C 1B6QA 2HKOA 3QF7A 1H2KA 1U96A 5JVDA 2E5LO 3T2MA 3BPZA 3AG2B 2HODA 1HNZB 3BCCE 3Q3DA 4F6RA 5IYZA 3K5MA 2PUSA 1EXJA 5KAFZ 4CZZA 2Z5HA 2F1MA 1D5NA 2FYZA 3ICXA 5E79H 3GB7C 3AE9C 2VQEB 2HHHB 1AQTA 3JD2A 1SQXG 5GTHH 1CW5A 2B1GA 3I56V 5B5EH 1Q6UA 2NN4A 1CEZA 2ZE7A 3HKCA 1WRGA 4QGPA 1T2KC 1X9VA 2B9ZA 5EIBC 2DWDC 2ZXEB 4AQRD 4EEQA 3ZDMA 1AROP 1Z56A 2H7HA 2YUAA 2X6BA 1P7BA 4N21A 4H37A 2LO1A 2YI8A 3M8AA 3SFEC 1PL4A 1X79B 4DR2O 1YJNP 1K9MQ 1R3JC 3H1IJ 4WY4A 1GU4A 4X9QA 1FE6A 5KKZC 1XNQB 3KZIH 4LLHA 5LHGA 3H1IH 1SFCB 3WB2A 2C0XA 3PH0A 4UV9A 4C7NA 5CCGD 1IFDA 1NTKE 2PYJA 3OUFA 1PP9J 3L72J 1N0NA 2BTQB 2ZFCA 3N2KA 3ZRXA 4LF9O 1KILC 1OW6A 1TVKB 1L0LG 2B9BA 1Q7YW 2QG4A 3WFVA 2KNCA 4B3RB 4JYBA 1H2SB 4DR1B 4K0KO 3JATA 1YHQV 3L70E 2IJJA 2AHZA 1QEXA 3PRJA 1Y74A 2L5GB 2LKMA 3D6YA 1M4UA 3BRCA 5DJUB 1WLEA 3L9DA 3OMNB 2F4VO 1TUEB 3Q5PA 3T1HB 1W59A 4RUFA 2WITA 4HJGH 1H0TB 2H43A 2EIMC 1IVSA 3A2AA 1NAFA 2QE7H 3CRCA 4JF3A 3ASOB 4IHJB 3U11A 1WMKA 3HTKB 3A5TA 4G2KA 3W7SA 2QRXA 1V9PA 4LC1A 4ZKIA 2IPPA 4AI8A 1DLBA 1GMGA 4QJFB 2B1IA 3CC2V 1VQ6V 3ZCCA 3L70G 4I9QA 2POHA 3H1LD 3OR6C 2FFDC 3OGIB 1R5LA 2D2CC 2HYNA 4U7NA 3TNUB 2W83C 2ZDIC 2F4VB 5KA6A 3H1LG 1KB9F 2FKWB 3U1CA 1M1KQ 5APYA 4X65O 2R72A 3SFDC 1F4MA 5KAIE 1HF9A 5KJ7D 3CX5H 3FXDA 3OEHG 1G6UA 3RVYA 2M5AB 4WFBV 2QGNA 2EJRA 3MHHC 4JI4O 5IT9N 3JCUZ 1XI1A 1VQOV 3NFQA 2E5LB 1AJYA 4HZ3A 4FM2A 3FX0A 4U3FG 2W6JH 1SQPJ 4J80A 3G4SP 3QWOC 2V1DA 1N33O 2QDOA 3J81N 1HGZA 1KP3A 3FXEA 3N7NA 1VQOP 5AW0B 2UXCB 3IFXA 1B06A 2PTMA 4JYAB 1VIBA 2Q6AA 1GRJA 2Y69C 2P10A 4PD4I 2MW2B 3C90A 4HNAA 4D6TD 4JI0O 2JWAA 1S5LE 3FX7A 1MZ9A 2PY5A 1BGYH 4GX0A 4ZKPA 3L36A 3SPJA 4BRYB 1JCDA 1BZKA 3BAAA 3L4FA 2HVKC 1Q82W 3C3TA 1A02F 3L70D 1SZTA 4TT3G 4X1YA 2F43G 2FL4A 4WFHA 4RJTA 3L73G 1T3UA 3GLMA 1NTMG 3CWBE 1NQTA 3CCUV 4CPGA 2F95B 3VTPC 1GTOA 2B5UA 1LTJB 1UIXA 3L75G 1ZLLA 3K5LA 2ZYAA 3CD6V 1LNQA 1K9MW 4LFBO 4O4HB 4WWIA 4O4IB 4IL6X 2VQFO 1ZWIC 2DQ3A 1R1BA 4B3MO 5LMNO 2CTQA 1H88A 1IURA 4HH2A 1H8AA 3CX5F 2FYNC 3VMAA 2J5UA 2VS0A 1FDIA 3HD7A 2AXCA 5KJ7A 3M99B 5EBMC 2E76D 1OHHG 1VQMV 4L76A 4OWFA 1N73A 2W6IG 3TDKA 4B7EA 3LDCA 1SQBD 2BCCJ 1KFMA 1SQVD 5FL7G 1VF7A 1SQPG 3L74D 3ZMVA 5F2VO 3LDEA 4FLUA 3FAVB 1OZ0A 1AI7A 1FXVA 4ASWA 2WPDG 1NVOA 3B40A 2JJ1G 2AEMA 2UUCO 2OYIC 1TU3F 3T97A 2IZ0A 2K9YA 1BSHA 3A0RA 3CCJV 4JAAA 4DR3O 4UCSA 1LTGC 3U1AA 4N78D 1DTOA 1LP1B 4O4HA 3OR7C 1L0LD 2EINB 4FZ0A 1YI2V 3ZMZA 2E75C 2Y9ZA 1VQ4P 1N7SA 3FWNA 3ZHSA 2IFNA 2QEXV 1VQ8V 4YJ3A 2VQFB 1EDLA 2PI5A 2HG5D 4L74A 4LFBB 1H2GA 1UPGA 4X66B 1R5SA 3UIAA 4JI2B 5HFMA 4LFAB 4I7ZC 3NTNA 5CCHC 5LYJB 1N8RW 5AW9B 1KD1W 4MSWC 1N7SD 1NU1J 4FJCC 3B8EB 1NKDA 4QMAA 1WNSA 2O01H 2W27A 2IYOA 1QBZA 5ITZA 4X1IA 4LF7O 1GK6A 2Q1KA 3CCEP 5KMGA 1SA0B 2I1KA 1YITV 4WFAV 4R6ZA 4UVAA 2XAFA 3KCXA 1GD2E 2JGUA 1VQLP 2HPCA 4O2BA 3V2NA 3SPGA 2KZJA 4DOJA 1NZ6A 5LL6Y 4PDRA 3SPCA 4JZGA 2ZR3A 3HD7C 3TCUA 2X6CA 1XILA 1PD3A 1ZXGA 1K3EA 2RNBA 2NRGA 1OCCB 4K3AA 3KZIE 3BHPA 1RSOA 2N04A 2Q73A 2OYIB 2QM4A 4X65B 2XOKG 3HKDB 1G1JA 1PP9G 3L72G 4MTFA 2ADPA 2K88A 3F5TA 4U3JB 2O3JA 1NTZG 4NKGB 3IGAC 4H13C 4W7YA 2GM4A 5E1AC 1NR1A 5LHIA 2CAZC 1OX3A 2CTWA 2KB1A 3RBXA 4O4LA 1NI8A 3CC4V 3I56P 3L70J 4GIFA 3LIDA 3JASA 3CB2A 3USSA 1Y76A 4RUEA 5JH7B 2BEQD 3QVNA 1QL2A 1FC2C 1QGKB 4BAYA 1RF1A 2AZ0A 2XDJA 3SPIA 2H8PD 3CC4P 1NTKH 1KQGB 1DF5A 4D7SA 1L4AD 5BU8B 1RF1B 2WMMA 2KLUA 2HJFC 5KAFE 1NTKJ 1FOSF 3RGBA 1ZAUA 3CX5I 2ZT9C 2XUMA 4PA6A 1AR4A 2OGUA 1ZR4A 2Z5UA 1HWTC 1SQXJ 1HR0B 3BCCH 4B3TO 2WT7B 4AUWA 1KMIZ 2QKSA 2WSSH 3LUTB 1IBMO 5IJ0A 2LGWA 1FZFA 1R6TA 3RK3C 5B1AB 1NVPB 2OTLV 3GWKC 3UCSC 4X66O 4U7JA 3R66A 5AW3B 2ZD9A 4UB8Z 4DXWA 1JY3P 2GUVA 3CMEV 4NTWA 2DWEC 5BY1A 1XMQB 4IL6Z 4EYYQ 2E5TA 2YO3A 3BA9A 1LUWA 3CS5A 4D7TA 2A06D 5B5EE 2YXHA 3VQYA 4D6TE 5H9CA 1S3JA 1XNQO 3KPEA 1L1FA 3BRTB 4LF5B 3TGUH 3M7MX 2WSFJ 2JDIG 5FNVB 1RQVA 4H44D 1DEEG 3V4QA 4GKJB 2N1TD 3L71D 2JWDA 2WSFH 3H1JJ 2B87B 3BRVB 4EB6B 1HP8A 1Q6IA 1KECA 4DV0O 3R4YA 1AP6A 3CMAP 1BCCH 4L87A 3ETEA 1KKDA 3CX5D 4GUNA 4HAMA 5K1XA 4J10A 4IIJB 3L73J 3RK2B 2OT5A 3O8ZA 4XA4A 4I4TA 3DXRA 4J41A 3IF4A 4KUMA 3RL0g 3F89A 3HRNA 5DEDA 2LJ2A 3E8FA 3F5WC 2FYUH 1KBHA 1BQZA 2BCCG 1NTZH 1BE3E 3AE2C 3QO5A 3L74E 5KUMA 1HNXO 2CDYA 4FLZA 2IZ1A 1OW7A 1N36O 1AR1B 3CCQV 1S72P 2HP8A 4R4LA 2YEVB 3NR7A 1K4CC 2IBZG 4CH4A 2IBZE 3JSLA 1UIIA 2YI9A 1G4YB 1GW3A 1NT2B 5M1BA 5LMNB 2ZNIA 1NKNA 2PI4A 2P58A 2F93B 1FDMA 3M9QA 2KKWA 1H8EG 4DW0A 4BW5A 1MNGA 4YXWG 1Q86W 3CYOA 4RQEA 1RH5B 1AILA 4I0XB 2KNCB 1GM7A 3HUSB 2YXRB 4TV9A 4W4KA 1EM1A 1WJZA 2UXNA 4I6MC 1SQQE 2FXOA 4FFKA 4DUYO 3P7KA 4TV8A 1JR9A 1EBOA 4KXRA 4JI0B 2QJKC 2K9JA 3B5NB 3ZMSA 1JY3O 5KA5A 1AI4A 2PAJA 2QSAA 4PA3A 2Q0AA 1M57B 3CCSV 4DV0B 1AI5A 5LA6B 4B3MB 1S5LX 4J7JA 5KLVG 3DSQA 1K5QA 4GX2A 1VP7A 3OA7A 4RWUA 5KLVD 5IJ9B 3HE4B 1T2KD 3CWBJ 5AG2A 1KILD 3JAWA 2Q7HA 4WFFA 4DUYB 3CP1A 2L91A 1VQ5V 1QLED 1IXMA 4WY4C 3ZX6A 2ZJSE 2Y0CA 1IBKO 3K59A 3OEEG 2R9AA 2KK7A 1KKCA 2IU3A 4B7KA 2ZVNB 1FXKB 3JALA 4X64O 2WPSA 3HE5A 3LNNA 2O1JA 5LA6A 2RMKB 3JARB 2FMLA 3HE5B 4E4EA 1JMMA 3ABKC 1PV3A 1QVGU 2R70A 3OT7A 1OJHA 2RH0A 3RL0C 4JTDB 1Q81W 2EJ7A 5CN0A 3H1JD 5A2QN 2BCCH 4UCVA 1OVUA 5AW2B 3JAWB 5KLVJ 3VBBA 1LTAC 4JBZA 1AQ5A 1QNMA 5GW7A 3OMAB 2Q0OC 2Q68A 1NYHA 2FY8A 2FFDB 3VMYA 5CA0A 3V4WA 2WTYA 1RE4A 4KHXA 1PGQA 1QVFO 1GZLA 1AVYA 4MTOA 2UXCO 3L75J 4IFDK 4QPKA 2JEUA 2EULA 5KAIH 2ETNA 5H2FH 2IH3C 1E79G 3J7AU 2DW3A 5L3CA 3JC22 1AJNA 1MUUA 5BVZA 2V7QH 1VQ4V 3AEEC 1S5HC 1XUQA 2B88A 3AE8C 3TGUE 5EZYB 3CCLP 4JASA 1M7LA 1SQQG 1J1DC 1ROPA 4D6TH 2OARA 4PA7A 1CXZB 1THZA 2AW9A 3EQ2A 3G9RA 3LW5J 1HUCA 1ZTEA 1VQNP 3WB1A 4LNUA 3VP8A 2ZIOA 3CJHB 1PKXA 1SQVH 5AVVB 4R50A 1R8EA 5KAIZ 1H0TA 1BS3A 4EKWA 1OCZB 5JQGB 1SF9A 1JA8A 2WA3A 2EX3A 3RYHB 4ZNCA 4PD4F 4J9YB 2GUZB 4EB6A 4DUZO 4JI1O 3P8CD 5K1PA 3K04A 3G6EP 1FZCA 4B3TB 1YITP 1A32A 3K08A 1FZEA 3VYIA 4TV9B 5APXA 3L35A 2F23A 3FWLA 2KQXA 1OCCC 2OYHB 1N73C 1OWAA 3A8TA 3A0BZ 4IIJA 3STLC 1BE3G 4GDOA 2WLHA 3D36A 1OCRB 2A0LA 2QM8A 1XREA 4UXNA 1E1QG 1IFIA 3MP7B 3JCUH 1K05A 3UO2A 2XTAA 1SZXA 2ZCEA 4ASUG 4JI5O 1NU1K 2LQTA 4MTXA 2NLJC 3WG7C 3HKCB 2HG5C 4I50B 3W7UA 2V4DA 2YIDA 4NR1A 4DZOA 4MVUA 2QKCA 3QG5A 5IYDO 1N7SC 3SWYA 4UB8H 2YXQB 4C46A 3I55P 4KJMA 1VF5D 2ITAA 1EDIA 3RL0B 2WLLA 3RFRA 1ZSPA 1FS0E 2CGNA 2EILC 4GX1A 4R8CA 5EYPB 1DF4A 2L6LA 3EWKA 1PM9A 2AXTE 3F7VC 1SS3A 3RYCB 2EIKC 4WF9V 2WT7A 4U3JA 1AVOA 1YHQP 4DR3B 2YO2A 3SWKA 2K1EA 2UUBO 1FDOA 1TAEA 1M56B 4NB5A 5IJ0B 4MVZA 1J2JB 1KC8Q 1VDFA 1NS1A 4DV6O 3BCCJ 3AEIA 1Y67A 1FZGA 3E8BA 5AVZB 1BCCD 1EZVE 1M1KW 4X20A 3H1KG 4F6RB 1ZL8B 2P5OA 5E79E 4D6TG 4LF6O 1LTSC 1BGYD 4U3FJ 2DYRB 3E89A 3C9IA 2DJVA 2OYIA 1JB0J 3D8CA 3B4SA 1QX8A 3QNEA 2XAHA 3H1HE 2QJ1A 4DR5O 5H6RA 4K8ZA 1I7FA 1ENVA 1V55B 1XNRB 3WU2E 5JQGA 1M5IA 2ZIMA 1S76D 2E42A 1E1RG 2PGGA 3B5NC 3Q5SA 1H2LA 4Z1MG 3CWBG 2W0XA 3O6QA 4IHJA 5IY5B 2WLKA 1LWUA 3A0BH 2ODMA 1JMKC 4KL1A 5K5GB 5H6QA 1FZAA 2KOGA 4DR6B 1W2BO 4HYOA 1XMOB 4PA4A 3F7YC 3TGUD 3H1HD 2KS1A 3CC7V 5J2TB 5TISH 3A0HH 1NTZK 5CBHA 5B5EZ 1ZW0A 3G4SV 4BIZA 1PIXA 4DR4O 3ABTA 4DR5B 3FB5C 1YSCA 2QA4V 1SS1A 1O9HA 4U7OA 2R9IA 1Q82Q 2YIBD 1R3LC 3P3PA 5LGNA 4LNUB 5KX5A 2QWQB 2KP8A 4BW9A 5AVWB 4KHPB 1YDXA 4DCKA 2Y0PA 2QA4P 5BR8O 1SQBE 1YEWA 3HR0A 1S72V 3E86A 4P30A 4C7UA 2FBWC 1H38A 3L73E 2WSEJ 2XU6A 2KIKA 2GUZA 2XASA 3MD0A 1TVKA 4NTXA 1I5YA 1MOFA 1IBLB 2KZIA 4OXSA 4ASVA 3HUSC 3R65A 3H1KJ 4GT1A 1PP9E 2KUBA 3L72E 2Q7GA 1HVVA 2RJZA 1JMBA 1U57A 1BSMA 1GL2C 2X7RB 1EDJA 4DV1B 1KYOH 1H2MA 4LFCO 4EI2A 1XHXA 3M0AA 1QHTA 4PV1B 2M5AA 5E79Z 4X1IB 4YY3O 3AECC 1N34O 1OZHA 5KX5B 2GHYA 1URQD 2ADQB 2QE7G 2QKAA 1VF5C 3K03A 2BEZF 3CRAA 1U97A 3CXHH 3WU2Z 1BDDA 2KSJA 1KYOI 1GM9A 1FOSE 1GK9A 1BGYE 1VQ9P 3RK3B 3KCYA 3C8VA 5KLIC 1FKAO 3FYEB 2K9PA 1SQQJ 3ZJZA 2FYUK 1VQMP 3AEAC 3P8MC 1KZUB 1HNWO 4BR6A 3AE3C 1ZX3A 1JOCA 1H8HG 1K8AW 2Y0IA 3N2GA 1M90W 4FLWA 2YICA 2LXCB 4HNAB 4X1KA 1L2PA 4ZI7B 1VQ5P 4I55A 3RW0A 3SGIA 4RQFA 1K4DC 1PL5A 3VQVA 1SQBJ 4ZMDA 2Q7EA 4Z1MH 1CI6B 3E1IA 2ZE8A 1SQPK 3G71P 1YXBA 4BRYA 1SQPE 4PD4E 4EFEA 1SQBK 4H44C 1WT6A 2W6JG 3FYIB 1VQPP 2XNDG 2F66C 2XZRA 3CX5E 3CXHE 3AG4B 4O2AA 1YI2P 1NOHA 2IJHA 3E35A 3P3NA 1ZRTD 4JI1B 4I0XA 3A0HZ 1JEKA 4X1YB 3GF7A 2P4KA 2QEXP 3HUSA 5EBWC 4NXNO 3FKSG 1FAFA 5JCOA 5GONB 3CCRV 1WP8A 2W8ZA 2QJKB 1HR0O 2ZNJA 4CC6A 4FZ1A 2IU0A 2UU9O 1PZQA 2WLNA 1QR9A 2GV9A 1GL2A 3BVOA 1SFCC 3H1KE 5J9PC 4LWSA 3SYOA 1JY3N 2Q67A 5CA1B 4DR2B 3A0BE 2AGAA 2I8DA 2HVJC 3CCMV 1FFXB 5LMUB 2OYHC 2Q7CA 5DN6G 1K04A 3K57A 1NH4A 4TT3H 4WVZA 3ML0A 1I94O 3SYQA 4YY3B 3H32A 1IBKB 1KP2A 3DXRB 3K06A 3A2FA 4YJ2B 1P84E 1MMMA 2KYVA 1TUBB 2KS1B 2KG7A 1JUNA 1OCOB 5EC1C 1BQ0A 2YIUC 4ZOLB 5IDJA 1ZR2A 3SJQC 2WSCJ 2Q5UA 3W7WA 2N1TA 4P9PA 1JCCA 5TISE 1XTGB 4UB6E 3UQ8A 4O4JA 2SPZA 1EZVH 3L74J 2EIJB 4DRXA 3ZHRA 1Y8AA 3K5BA 4C7NB 3E2EA 1K34A 1OMIA 4GX5A 1M57D 3AG4C 1NTKG 3VOPA 3ASOC 4KHPO 1SQXK 2FYNB 3L71G 3C1LA 2A45G 2M3EA 1XHZA 3AE4C 1M56C 4FM0A 1Q90D 2KSEA 3H1LE 3OAKA 2M6YA 2HEPA 3Q1MA 1PL0A 3BEHA 5BU5A 3JAKB 4JZ2A 2HR3A 4WBNA 4EDFA 2JP3A 2Q69A 3S3XA 1FS0G 2K9JB 3O9OA 3AE5C 3FAVA 3WUVA 5LP6C 4PJ0E 4KFMA 1LUVA 4ZHQB 4JI6O 2WQYC 5FNVA 1EFRG 3PHLA 1HGVA 3ZRWB 4E2LA 2YC0A 2LW7A 2XNDH 2YKPA 4LF4O 1V55C 1JM0A 2HJDA 1N7SB 5CCGA 2OYHA 2E74B 1EDKA 1F7YA 1IFNA 1IO4A 2PRRA 1YJWP 4JI2O 1EXIA 5BZBA 4LF8B 4MN4C 1WA8A 3JCUE 3W7XA 1D7MA 4N3YB 3OTFA 2CPSA 5CBNA 1DD3A 1D5AA 5BR8B 2R3CA 4RAIA 3AG3B 2RDCA 4DR6O 4RESB 5DM6V 5APUA 1FJPA 3K9SA 2Q3EA 3WUUA 2UXDB 1L0LE 3CE2A 5C8YA 5APSA 1L0NK 1M1JB 1VQKP 4TOIA 3II6A 4GZRB
chains in the Genus database with same CATH topology
1VL2A 1S5LX 4R4MA 1VF5B 2QIWA 2ZT9B 2D2CB 1PIXA 1ZMEC 1TU3F 1KMIZ 2H88C 2K9YA 3AE7C 4GDOA 2E74D 3H25A 1K04A 2IDBA 1MKMA 1ZRTE 2D2CC 3GMAA 4TT3H 3Q3DA 1OW8A 1EXJA 4PV1D 1K05A 4U7JA 3GF3A 2E75C 4Y28J 2JO1A 2FBWC 2WSEJ 3AE9C 3SFDC 1HF9A 3RK3E 4H44B 2QJPC 1ZOYC 2YIUC 3AEDC 4I7ZC 3IN6A 2FXPA 2WSCJ 3AE1C 4OGQC 4OGQD 1AJYA 2WSFJ 2YMKA 2E74C 1RQVA 4H44D 1U57A 2D2CD 2WPVB 1VF5D 4H13D 1PV3A 1S1CX 1ZP0C 4YXDC 1OMIA 3EWKA 3R4YA 2QJYC 2QSIA 1KORA 2E75D 2E76C 4PV1B 3AECC 2P10A 3D71A 3AE4C 3T97B 1RQUA 1VF5C 1Q90D 2E76B 2BEZF 2NZ2A 3ABVC 3SFEC 5L8RJ 1Y9BA 3Q1MA 1FDOA 1KTMA 1NYHA 4XFJA 3RL0g 3IAOA 2H89C 3C8VA 5KLIC 5KKZC 2JP3A 1DD4A 3AE5C 3AE2C 2E75B 1OW7A 3AEAC 3AE6C 1YQ3C 3AEFC 2WQYC 1HJ0A 3AE3C 1GMJA 4R4LA 1IK7A 2O01J 3FGAD 3GLMA 4H13B 1OW6A 2G8YA 4H0LD 3S9OA 1YQ4C 4I7ZB 3AEGC 1KQFB 5M1BA 1JB0J 4OGQB 3AEEC 4H13C 1UIXA 1PL5A 2G3AA 2E74B 3AE8C 4Z1MH 3D70A 4KT0J 3B71A 1EXIA 2OQQA 4H44C 4IL6X 3G9RA 3LW5J 4H0LC 3AEBC 1NGMB 3Q5RA 2BEQD 3D6ZA 1DD3A 3D6YA 2FYNC 2J5UA 3Q5SA 1FDIA 4H0LB 1R8EA 3O6QA 3Q5PA 2E76D 2QJKC 3GF7A 4YTPC 2MKVA 3Q2YA 1KQGB 2V7QJ 1DIPA 2ZT9D 2ZT9C 4PV1C 1WMKA 1KILE 4RKUJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT0 J;  1S5L X;  2WSC J;  1VF5 B;  2QIW A;  2ZT9 B;  2D2C B;  4IL6 X;  2WSF J;  3C8V A;  5KLI C;  5KKZ C;  2K9Y A;  3LW5 J;  5L8R J;  2WPV B;  2E75 B;  1ZRT E;  2FYN C;  4H0L B;  2QJK C;  2QJY C;  2QSI A;  2O01 J;  4H13 B;  4PV1 B;  4Y28 J;  4I7Z B;  2WSE J;  4OGQ B;  1JB0 J;  1Q90 D;  2E76 B;  4H44 B;  2QJP C;  4RKU J;  2E74 B;  2YIU C; 
#chains in the Genus database with same CATH topology
 3RYI B;  3SSU A;  4GKJ O;  2R32 A;  2DYS B;  4FK5 C;  1S2E A;  4DV3 O;  2XV5 A;  1BDC A;  2UUB B;  3AE7 C;  4JAU A;  3EFG A;  3O65 A;  1M93 A;  2A06 E;  3AK3 A;  4AQY O;  5CBF A;  1S77 D;  2IDB A;  5KHG A;  1MKM A;  1ZRT E;  3CCV V;  5APQ A;  1Z5W A;  4LF4 B;  3W67 A;  2H3O A;  5DEC A;  4ABM A;  5B3S C;  1JJ2 U;  1VQ7 V;  5CBO A;  2M0B A;  3D36 C;  4U3F H;  3C3S A;  1N33 B;  1W2B U;  4LF8 O;  4WBA A;  4LH7 A;  1FYJ A;  1VQ6 P;  4TUY A;  4O4J B;  4Y99 C;  1Q8I A;  1X22 A;  3AED C;  1VQ7 P;  4JI7 O;  1AI6 A;  3E7K A;  5CA1 A;  3L75 E;  5AVU B;  1MZE A;  3KKY A;  1KB9 I;  1SQV K;  3AE1 C;  1K5S A;  1M56 D;  1G2C A;  2E74 C;  5CB4 A;  4JI8 B;  1PNK A;  2WPV B;  5APT A;  2Q3I A;  1S1C X;  3QO7 A;  4DO2 A;  4JI5 B;  5J2U A;  1TUB A;  1B04 A;  1NBM G;  1KB9 H;  4B08 A;  2HOD B;  1G8M A;  2C2A A;  2EIL B;  2OIE A;  2KB7 P;  2B89 A;  2N74 A;  2W6A A;  2UUA B;  2Y0D A;  3ABV C;  3K9A A;  1ZL8 A;  3V2P A;  1SKV A;  1N32 O;  1W2E A;  1M57 C;  3LSU A;  3RWR D;  3BCC G;  5AVY B;  3S4R A;  3R2P A;  1WN7 A;  3UM7 A;  5GTI E;  1R3I C;  4JYA O;  4XBF A;  4NPD A;  5AW6 B;  3RVZ A;  3APQ A;  4QNH B;  5APW A;  1AJP A;  5FLX N;  4CH6 A;  5IYC O;  1FJK A;  1GMJ A;  2GDS A;  3ETD A;  1PP9 D;  3L72 D;  1SQX E;  3PLN A;  2CH7 A;  5B1B B;  1DK1 A;  2UXX A;  1PPJ E;  3UT5 A;  1YVW A;  3H9V A;  4PA9 A;  3VQX A;  4JI4 B;  1AV1 A;  1KQL A;  3G67 A;  1RPR A;  4UCU A;  4DV7 O;  1Q5O A;  2R3S A;  4XDL A;  4B3S O;  3JD4 A;  1M8O B;  1OFC X;  1ZV8 A;  1Z2G A;  3H1K D;  1I0H A;  1WP7 A;  2QM7 A;  3OTO O;  2JDI H;  3AEB C;  4DV5 O;  2KG7 B;  3D3I A;  1MFZ A;  2H94 A;  2Q8V A;  4A5U B;  4M3L A;  1K73 Q;  4LBE C;  1E5W A;  1W0J G;  5LOV A;  3B8N A;  2K37 A;  1EZJ A;  4TSF G;  3CD6 P;  2DQ0 A;  2A7W A;  1USD A;  3T1H O;  3MDS A;  3NXS A;  1R3K C;  3L73 D;  2WLM A;  2DYS C;  4X88 A;  4GKK B;  2ZE6 A;  1LGH B;  3HPL C;  1RF1 C;  2QTO A;  3MHV A;  4L75 A;  1LWU C;  5DJT B;  2W90 A;  4XDK A;  1MSD A;  4Z2W A;  1PGP A;  5AVX B;  4DV7 B;  2FTK A;  4DV4 O;  4IL6 E;  1L0N E;  1HTL C;  3D3Q A;  2IX7 C;  3MZW B;  3VQW A;  3CXC U;  1SA0 A;  2W6B A;  3GHG A;  2N9Y B;  3JYC A;  3K0D A;  3VOU A;  3L74 G;  1BHA A;  3OMI B;  2OYQ A;  2JO1 A;  2PFX A;  3U10 A;  4XE5 B;  2YEV A;  1FXK C;  4MVS A;  4H33 A;  1QQC A;  3E8G A;  3KXD A;  3RK3 E;  2E43 A;  5AVS B;  3JD3 A;  4LR3 A;  4IT5 A;  4K0K B;  5BMV B;  4YPC A;  4MW8 A;  2A06 G;  2Q5Z A;  3SYC A;  3OD4 A;  1OCO C;  3BAB A;  4BWN A;  4FM1 A;  1Q2N A;  1JFF A;  4HBN A;  1BE3 J;  1KUQ A;  1GN6 A;  2JEX A;  4LF9 B;  4PJ0 H;  2WLJ A;  1X0T A;  2N05 A;  3ZN0 A;  1OVV A;  2QJY C;  1Y4M A;  4NPF X;  3X2Q C;  3JSN A;  3N27 A;  2KI7 B;  1COW G;  1NU1 E;  2UXB O;  1KU9 A;  1NTK D;  5LXT B;  1OCZ C;  2E76 B;  3HKE A;  1K92 A;  1URF A;  1H89 A;  3VMZ A;  2UUC B;  5C8Y B;  1KTM A;  2CTR A;  3RK2 C;  1U7J A;  4JTC B;  3SYP A;  1VQN V;  1HJB A;  1DD4 A;  3N2K B;  5J2U B;  4LFA O;  5H2F E;  5CBG A;  1Y66 A;  1H2N A;  3B2E E;  1DEB A;  2VWJ A;  3DC6 A;  3CCM P;  1YTF D;  1IFP A;  1SVF A;  3CXH F;  5GTI H;  4QPJ A;  2KLV A;  2O01 J;  3JAT B;  4GOD A;  4CS3 A;  1YJ9 V;  1US6 A;  1GM8 A;  1NO4 A;  1IK9 A;  2N9B A;  4H0L D;  1KYO D;  1LR1 A;  1KQF B;  2ZR2 A;  3PN1 A;  4LH6 A;  3BVH A;  4TQD A;  2XAQ A;  2JIZ G;  2ZAE B;  4OVN F;  1JJO A;  5GON A;  3W7T A;  4DV3 B;  1HNX B;  4WFE A;  3GHG C;  1JNM A;  4J11 A;  1NH2 B;  1NTZ J;  2P7J A;  1NGM B;  2Y4U A;  4UCR A;  1FXH A;  1X59 A;  2WAM A;  3D6Z A;  4IYI A;  1XMO O;  1FXK A;  2AXT Z;  2FB5 A;  2HLD G;  2RN0 A;  3UT5 B;  5D5Q A;  1HNZ O;  2YSU B;  3JAK A;  4G28 B;  3G3Z A;  4EIJ A;  4YJ2 A;  4DR4 B;  3QO8 A;  1W0K G;  5L3B A;  4PD4 D;  4K35 A;  1NH2 D;  2C9N Y;  4R4M A;  4ZHQ A;  2ZT9 B;  2QIW A;  5EZY A;  4U3F E;  3TET A;  4FVM A;  1QU7 A;  4IL6 H;  3A3Y B;  4HB1 A;  2IM9 A;  2JKV A;  3RYF B;  2VWK A;  1GL2 D;  5JJJ B;  1P49 A;  3L71 E;  4LWS B;  3ZHQ A;  1SFC A;  1JO5 A;  3RBZ A;  1VPC A;  4JV5 O;  3SJB C;  1YCI A;  1LJ2 A;  3TGU G;  2ITD C;  1S0V A;  3E83 A;  1YTF B;  3BAT A;  5LGT A;  1GW4 A;  2WZ7 A;  1JTH A;  1EZV I;  4I4T B;  4PI0 A;  5FPR A;  5B66 H;  3V2R A;  2QWO B;  1DGS A;  2OCC B;  3IC7 A;  3T4D A;  2IH1 C;  4OGQ C;  3FFQ A;  2BE3 A;  5LMU O;  2YMK A;  3ABL C;  5B1N A;  1S9K E;  4UUJ C;  2CGO A;  2WPR A;  3MAQ A;  3CME P;  1R6N A;  2PF4 E;  4H13 D;  2YIB A;  3ASN C;  2CUG A;  2RCV A;  3RK2 D;  4YXD C;  3CWB H;  1KFN A;  2GTS A;  2NPS B;  2DW4 A;  1LTT C;  1KD1 Q;  1V54 C;  3OAA G;  1KOR A;  1M1J C;  3S3W A;  3P30 A;  4JI3 O;  1EQ7 A;  1L0N H;  1PPJ H;  4HKZ H;  3CJH A;  1N86 A;  1SLQ A;  3TK1 A;  5CA3 A;  2ZKO A;  4UCT A;  3TYY A;  2EIM B;  5GTI Z;  4XFJ A;  3B77 A;  1VQK V;  2I1J A;  3CCU P;  2H89 C;  4LGD E;  3TF5 A;  4DV5 B;  5IYZ B;  2ZXX A;  3CMA V;  1RM1 C;  1JFF B;  1SES A;  5LYJ A;  4X89 A;  5JCO C;  3TGU J;  3GG2 A;  1S5L Z;  4UCO A;  3EVK A;  2K3R A;  3AEF C;  3IFM A;  2JRI A;  5A9G A;  2NR5 A;  2P06 A;  1P84 H;  1NTZ E;  1LTJ C;  2Q6Q A;  2V4H A;  1XDC A;  4QIW F;  1RFY A;  1YQ4 C;  1S5J A;  1YIJ V;  1NVP D;  4MW3 A;  1GK4 A;  1RE3 C;  1EN5 A;  3OM3 B;  1AR5 A;  1KB9 E;  4L73 A;  2OWO A;  3RYI A;  2G3A A;  3D70 A;  3OTO B;  1ORQ C;  2JGD B;  2NNU A;  5B1B C;  3L73 H;  4I55 B;  4OPH A;  4I9W A;  1HWY A;  1R73 A;  4OX9 B;  2WWW A;  1NTM H;  2LGQ A;  3ABK B;  1SFC D;  2OQQ A;  2ILM A;  4H0L C;  4XDJ A;  5IY5 C;  1NTM J;  1WAZ A;  2IBZ D;  5CCG C;  3U59 A;  4I2L C;  3L75 H;  5JH7 A;  5B1O A;  1CZQ A;  1NTZ D;  2E3C A;  3MGN A;  1JY2 P;  1ZUQ A;  1P7G A;  3WB0 A;  1URQ B;  1K8A Q;  1GKF A;  4UB6 Z;  2V7Q J;  2N1T C;  4YIO A;  2QR4 A;  3QH9 A;  1NU1 H;  5CJ0 A;  1MG1 A;  3K0G A;  2P1J A;  1L4A C;  3RK3 D;  5KUK A;  1T8Z A;  2UU9 B;  1GH6 A;  1VF6 A;  4OH8 B;  3TXS A;  1Y6X A;  1FZC C;  1N32 B;  4TWK A;  3ZHT A;  3CXH D;  4O4I A;  1M1J A;  1SQP H;  4PD4 H;  3M9B A;  3AK1 A;  4P9O A;  3ITK A;  4ZBM A;  1QVF U;  4RO0 A;  5AVQ B;  1JTH B;  2GBO A;  3PJS K;  1IBL O;  4PV1 D;  1N4C A;  3OJA B;  3AG1 C;  4X62 B;  3K3W A;  5CHX A;  1L0L H;  1G1X B;  4YIP A;  4DV1 O;  5IJ9 A;  3HE4 A;  4NTY A;  3STZ C;  3K79 A;  2YS8 A;  1ZOY C;  3KQG A;  2A9H A;  4WY4 B;  3SYA A;  1BGY J;  4U3F D;  1NU1 D;  3AG3 C;  4DT0 A;  3TJT A;  4NYK A;  1LTJ A;  3VN0 A;  2P4V A;  2CK3 H;  2FYU D;  2R5B A;  3Q4H A;  1QCE A;  3LSQ A;  4NXM O;  1G2C B;  3GVM A;  3JAR A;  3MTU E;  4JPZ B;  2R9R B;  4P2Z A;  3SWF A;  3KYQ A;  3T4Z A;  2WLI B;  5B66 Z;  3H6P A;  1VMG A;  4K8X A;  1IFM A;  1EN4 A;  3H1I D;  3AG2 C;  1Z5V A;  3SJC C;  2ARH A;  2HLO A;  4MS2 A;  3CSX A;  2LR2 A;  4ZI7 A;  5KHK A;  5KLV K;  1IZN B;  1JPX A;  2LP7 A;  3ETG A;  2R5D A;  3CCR P;  1IK7 A;  4I1L A;  3H1L H;  3VMX A;  2NPS A;  2G8Y A;  2LXB A;  5L3G A;  3M0D C;  2HPC B;  3EXA A;  1BT8 A;  1SET A;  2BTO A;  1G1I A;  1S4X A;  3N4X A;  1VF6 C;  3H1L J;  3P8C E;  1BHB A;  4F4L A;  2EZO A;  1SQX H;  4LP8 A;  4KT0 J;  1N36 B;  3B71 A;  1B3Q A;  5TIS Z;  4FFB B;  4FLV A;  2WLL B;  1LTB C;  5H5N A;  4UB6 H;  5KTB A;  3GHG B;  1FFT B;  3HKD A;  1KYO E;  3SDL A;  2UXD O;  5D5P A;  1JCH A;  3CPW U;  1HBW A;  2Z5I A;  2MKV A;  3Q2Y A;  2RQ6 A;  2BSK B;  3TNU A;  1SQG A;  3CCL V;  5C93 A;  3M9H A;  2A45 H;  3N2G B;  2QWN B;  3B5N A;  2FYU E;  2IYP A;  2Y4T A;  1AJQ A;  2EBO A;  4EOT A;  1FFX A;  4PV1 C;  4WFG A;  4DV2 O;  1SQP D;  4PHZ A;  4UVB A;  2ZE5 A;  5GTH Z;  4O4L B;  4O2B B;  4GLX A;  1VF5 B;  3ZMU A;  1EC5 A;  2Q9I A;  3K5N A;  4JYC A;  4CC5 A;  3H1I G;  2E74 D;  1S9K D;  1QLN A;  1MZF A;  5EYP A;  1AP5 A;  1BCC J;  4D6T J;  4QE7 A;  4TQF A;  1QR8 A;  1OW8 A;  2BOC C;  1RM1 B;  2IBZ I;  3GF3 A;  5IWA B;  5CCH A;  1XMQ O;  5LP6 B;  1LT9 A;  4FPP A;  4TV8 B;  3M06 A;  1RSO B;  1F4N A;  4PI2 A;  3A0H E;  3H1J E;  1YJ9 P;  2D3O W;  4DR7 B;  3P32 A;  3TXQ A;  1IXB A;  1Q6H A;  2CK3 G;  3DC5 A;  2RN9 A;  4DK1 A;  2QJP C;  3H1J G;  1VAR A;  4LF5 O;  2FXP A;  3ZMT A;  3BA8 A;  4WY4 D;  1CI6 A;  1FZB A;  5C39 A;  3HKE B;  2IJK A;  5AW7 B;  1N8R Q;  2IFM A;  2NPS C;  4Z1V A;  5JWP A;  4CH5 A;  4X20 B;  3CC2 P;  5CJ4 A;  1HH0 A;  2O1K A;  2UXB B;  1GN3 A;  4LCU C;  4MVM A;  3H1I E;  3S1K A;  2E75 D;  2DOS A;  2YDE A;  2OTJ V;  1OVR A;  2X0L A;  4BXL A;  2W0F C;  3D71 A;  4CH3 A;  1I5X A;  5CMU A;  2QVA A;  3V6I A;  3T97 B;  3DTU B;  1LT1 A;  3J80 N;  1AVM A;  2NZ2 A;  1RF0 C;  1M9N A;  3I55 V;  1K7D A;  5L8R J;  3H1K H;  2PZS A;  1Y9B A;  1AB3 A;  3RYC A;  1OCR C;  1JX9 A;  3IAO A;  4DRX B;  2M8R A;  3L70 H;  1QLE C;  3B8M A;  4W4L A;  2QTS A;  2ZM6 B;  4CS4 A;  5JJE B;  1YTZ I;  3MIW A;  3HD7 B;  1HDJ A;  4GKG A;  5KLI B;  3H01 A;  1A02 J;  5KHH A;  3B09 A;  3JCZ A;  5CB4 B;  1HJ0 A;  2QWR B;  4B3R O;  3FGA D;  4IOI H;  2DE0 X;  4WB4 A;  1KV4 A;  3F5H A;  3KZI Z;  2A3Q A;  5B3S B;  1QL1 A;  4OGQ B;  3AG1 B;  1KC8 W;  1S5L H;  1RPO A;  1F51 A;  1AFO A;  1EZV D;  1U7M A;  1KQS U;  4ICG A;  1GU5 A;  2QWP B;  3CCS P;  1IZ3 A;  1J1E C;  4GKK O;  1EZV G;  2QJY B;  5AVT B;  2Z4E A;  3ETQ A;  3ABM B;  2A79 B;  4UV8 A;  4DUZ B;  2X6A A;  3KHU A;  3JSV C;  4GCZ A;  2ZYG A;  2OTK E;  4J42 A;  1WPB A;  4DV4 B;  2IW5 A;  1T3J A;  1L0N J;  1MAB G;  1DIP A;  3Q4H B;  1SQB H;  1KIL E;  1Q7Y Q;  2ZXW C;  3MUD C;  1BGY G;  4FFB A;  1KN7 A;  4IFF A;  1SRY A;  3E22 A;  2WLI A;  4G27 B;  3CL3 D;  3CRM A;  2AHY A;  2XAG A;  4JTA B;  2C0W A;  5GTH E;  3H25 A;  2LFR A;  4DW1 A;  4NXN B;  3GMA A;  1FBM A;  2KXP B;  1EN6 A;  3JD0 A;  3H1J H;  3LDD A;  1NJI W;  2XNX A;  3W68 A;  3OGC C;  4JI3 B;  5AW5 B;  1IX9 A;  3CXH I;  1BMF G;  4BWA A;  1NAY A;  5KLV H;  2NPS D;  3CC7 P;  3IJ4 A;  5IYB O;  4LF7 B;  3RGU A;  1HNW B;  3CEI A;  2JGD A;  5LBQ A;  5IWA O;  1GDT A;  3ZS8 C;  1KIL B;  1Y76 B;  4JI8 O;  1NTM K;  4N78 E;  3IN6 A;  1NTM E;  3IAY A;  1PV0 A;  4DR1 O;  4AQY B;  4IFM A;  4OGQ D;  3ZIA G;  1CP9 A;  2YIU B;  2FYU J;  3CRR A;  3U0Z A;  2OCC C;  2D2C D;  2WA4 A;  3WU2 H;  4PDV A;  3FD9 A;  4X8A A;  2UUA O;  2K1A A;  4BIU A;  1PNM A;  4DYL A;  3CRQ A;  1DX7 A;  3CPW O;  5LGU A;  4EFB A;  4NPE A;  3BY6 A;  2JR8 A;  4LFC B;  2FFD A;  2FXM A;  3B5N D;  1SQQ D;  1RQU A;  4MVO A;  3HKB B;  2ZDI A;  3OW2 U;  1VQ8 P;  1LTI C;  3M91 A;  1KQS O;  5KHJ A;  4JYY A;  1SQX D;  3H32 B;  3AG7 A;  4GYC B;  4I50 A;  2ZXW B;  3K58 A;  4JI7 B;  2Z0A A;  1FU1 A;  4TLF A;  5BMV A;  2E75 B;  3JAS B;  1TA8 A;  2WPQ A;  3AE6 C;  1GN2 A;  1KYO F;  4O2A B;  5JVD B;  3MUD A;  1XEQ A;  1OXZ A;  3S9O A;  1FD9 A;  1N2D C;  4I7Z B;  1VQ9 V;  5J2T A;  1L0L J;  2P7T C;  1URQ A;  2JEE A;  3AEG C;  3OE7 G;  1J1D B;  5LP6 A;  1LT9 B;  4X64 B;  2E5Y A;  2J58 A;  3RN4 A;  1PNL A;  2DMX A;  1BE3 D;  1XL4 A;  3BAS A;  4FLT A;  2A06 H;  4UVC A;  4YHH B;  2EIJ C;  4X1K B;  3G6E V;  4DR7 O;  2VQE O;  1SP4 A;  2BCC E;  3H1H G;  1R6K A;  5B66 E;  2O01 N;  1Q86 Q;  4J7Z A;  2P67 A;  2V7Q G;  1Y47 A;  3O6Q B;  3T1Y B;  1W5C E;  3VP9 A;  1QVG O;  1SQB G;  3E1R A;  2CH7 B;  4H0L B;  1JVM A;  2BOB C;  2JK5 C;  1PGO A;  2JJ2 G;  1D2D A;  2RMZ A;  4F6E A;  2GSM B;  2YKQ A;  3E22 B;  1K73 W;  2P22 C;  1GO3 F;  1VEW A;  2XKM A;  4J9Z B;  1N73 B;  1YJN V;  4MT8 A;  3JD1 A;  1RP3 B;  1VQP V;  2AEJ A;  2ZVO B;  3OW2 O;  1BL8 A;  4QE9 A;  3UO3 A;  5KAF H;  4HYT B;  3G80 A;  2N1T B;  2D2C B;  2XAJ A;  2JS3 A;  3RYF A;  1FJG B;  3KDP B;  2FYU G;  2OYO A;  3V5B A;  4ZOL A;  2HFE D;  4R7C A;  3ZHU A;  3FB8 C;  3E8H A;  2AXT H;  1GAX A;  1FZC B;  4DK0 A;  3ZRW A;  1J5E B;  1L4A A;  1PP9 H;  3L72 H;  3RYH A;  3THO A;  2XHB A;  1WB8 A;  4LF6 B;  2Y9Y A;  1T6A A;  2IBZ H;  3IR9 A;  4Y99 B;  4JI6 B;  1YBK A;  4X62 O;  5KJ7 C;  4CBC A;  4YHH O;  2G38 A;  1L0L K;  3EFF K;  4H44 B;  2PYL A;  1FAV A;  3T1C A;  4WBN B;  4YXW H;  1P84 F;  2GTA A;  3ZN1 A;  3L71 H;  1WB7 A;  2BSK A;  2M3B A;  3JAM N;  1N0J A;  2JVD A;  4JGS A;  4PDM A;  1YZB A;  1P84 D;  1URQ C;  3L71 J;  1XTC C;  4WCE V;  1XOU A;  4MVR A;  1ZP0 C;  1RE3 A;  2VRS A;  2JJL A;  4B86 A;  5BXZ A;  1Q3E A;  4GOE A;  2E76 C;  1DH3 A;  1AA0 A;  2OTL P;  3G6B A;  1IC2 A;  2YKO A;  3ZRS A;  1I94 B;  3RT3 C;  4JF7 A;  2MJZ A;  4FLX A;  1MSW D;  2FKX A;  3APO A;  4N23 A;  1BCC E;  1L4A B;  1RE4 C;  1USE A;  2ZIN A;  1N7L A;  4J7K A;  4PJ0 Z;  1NTM D;  5CCH D;  3PTZ A;  5EFW B;  3LSS A;  1IDS A;  2WSS G;  1I08 A;  3LW5 H;  1SER A;  4Q20 A;  4B3S B;  2LFS A;  4Q6G A;  1X4T A;  1YQ3 C;  4NXM B;  5KKZ B;  1M90 Q;  1SQV J;  1NKZ B;  4TUY B;  1SQF A;  2IJI A;  3ZBH A;  2YNY A;  3TSI A;  3L74 H;  2JS5 A;  2C9L Y;  3RL0 D;  4JQ0 D;  3H1H H;  1O9G A;  1RY3 A;  2P6J A;  1P4R A;  5LXT A;  2O57 A;  3SPH A;  3ZHV A;  4ZIB A;  3WMM 0;  4L8J A;  1SC5 B;  3H1H J;  3ABU A;  1WPX A;  2Q4P A;  4GOF A;  4RO2 A;  1JQ0 A;  1IBM B;  2MK3 A;  2VRZ A;  4O9B A;  5JJN B;  2PP6 A;  3HD7 D;  2UWJ E;  5AW4 B;  4FIP C;  2ZM6 O;  2PGD A;  4OX9 O;  3M0D A;  1HW7 A;  2Z3Y A;  2P90 A;  2A45 I;  1GTW A;  2AZ2 A;  3ABL B;  3SR2 C;  3LNM B;  4FMT A;  2YXY A;  5KLV E;  5KHI A;  2WSE H;  1NR7 A;  4YTP C;  3NMD A;  1BCC G;  3CCQ P;  2XT9 A;  1YJW V;  1IJD B;  3ABM C;  1L0N G;  1XBL A;  4I5S A;  3IC9 A;  2OTJ P;  3GW6 A;  1XQ8 A;  3FB7 C;  3MHS C;  4N6J A;  5L3E A;  1VL2 A;  1F23 A;  1K97 A;  2BCC D;  1XL6 A;  3CLQ A;  1JY2 N;  2J59 M;  5AVR B;  3WUT A;  3L75 D;  4A7P A;  1ZME C;  4BIO A;  2R44 A;  1LWU B;  4JAV A;  4IYH A;  2BTQ A;  2WVR A;  1N34 B;  4UB8 E;  1T5E A;  4W80 A;  3OFN G;  1PGJ A;  2HHH O;  4Y28 J;  1E79 H;  1RHZ B;  1OIP A;  4JV5 B;  2HFE C;  3K5O A;  1K33 A;  5EIB D;  5LHH A;  5L3D A;  3BCC D;  2DYR C;  3CCV P;  3LIE A;  1J1E B;  1CSB A;  1FPO A;  4C7R A;  1SQQ H;  1LT9 C;  3ASN B;  3CI9 A;  1BSN A;  1NHL A;  1PFI A;  1FJG O;  3UKM A;  1X8Y A;  4FLY A;  4MVQ A;  5FPO A;  2EZP A;  1KB9 D;  2ZYD A;  3ZRV A;  1V54 B;  1Q81 Q;  2CE4 A;  5EBL C;  5CA0 B;  2DN9 A;  3KG2 A;  1ZN5 A;  1SQV G;  1LP1 A;  1NWQ A;  1CPY A;  1OV9 A;  1P84 I;  1YIJ P;  2QSI A;  2H8P C;  1MA1 A;  2CTP A;  2P2U A;  3HTK A;  5L3F A;  2GA1 A;  4PEL A;  4AIL C;  1YTZ T;  3X2Q B;  1L0N D;  1NU1 G;  1TGO A;  1NTK K;  4OPA A;  3BFR A;  2EIK B;  1UFI A;  2KSD A;  5H2F Z;  3T1Y O;  3CCJ P;  4IGG A;  1ZLZ A;  1SQV E;  1BE3 H;  2Q9L A;  3SJA C;  1NJI Q;  2OIG A;  5KMG B;  1L8D A;  3GWO A;  5HFL A;  1XNR O;  5ITZ B;  1RF0 A;  3G71 V;  2ZQM A;  4W7Z A;  2YMY A;  5LOV B;  2AEF A;  1QLE B;  4MTG A;  3WG7 B;  2GUS A;  4H13 B;  2CPB A;  2BAS A;  2QJP B;  4AHC A;  2Y0E A;  1J95 A;  1MFT A;  2EIN C;  2B87 A;  1J5E O;  1YYC A;  5AW1 B;  2LW1 A;  1MV8 A;  5APV A;  4ZKU A;  4YJ3 B;  3PP5 A;  3QTC A;  5AW8 B;  2ITC C;  5EC2 C;  3CHX A;  5CMZ A;  3Q5R A;  3OUS A;  1JOY A;  5EK0 A;  3CWB D;  2L35 A;  3I5D A;  3FB6 C;  3CCE V;  4DV2 B;  2YIA A;  1WA8 B;  2OCH A;  1PPJ D;  2Y69 B;  5IE9 A;  1UJW B;  4PDL A;  1SQQ K;  4DJG A;  1Q43 A;  1IFJ A;  1GL2 B;  1Y74 B;  2ATK C;  3DGE A;  1VQL V;  4CS2 A;  2RKL A;  2YXL A;  1PPJ G;  3HKB A;  2Y48 A;  3AK2 A;  1GN4 A;  3JAL B;  2M7W A;  2ZT9 D;  2WSC H;  3L37 A;  1JY2 O;  4RKU J;  4DV6 B;  4UFZ A;  1YF2 A;  1KIL A;  3V2Q A;  3EHB B;  4KP4 A;  4NVP A;  4JPR A;  3HB3 B;  3I5C A;  4AYC A;  3A7O A;  5B1A C;  5TJH A;  3ZED A;  2H88 C;  1B6Q A;  2HKO A;  3QF7 A;  1H2K A;  1U96 A;  5JVD A;  2E5L O;  3T2M A;  3BPZ A;  3AG2 B;  2HOD A;  1HNZ B;  3BCC E;  3Q3D A;  4F6R A;  5IYZ A;  3K5M A;  2PUS A;  1EXJ A;  5KAF Z;  4CZZ A;  2Z5H A;  2F1M A;  1D5N A;  2FYZ A;  3ICX A;  5E79 H;  3GB7 C;  3AE9 C;  2VQE B;  2HHH B;  1AQT A;  3JD2 A;  1SQX G;  5GTH H;  1CW5 A;  2B1G A;  3I56 V;  5B5E H;  1Q6U A;  2NN4 A;  1CEZ A;  2ZE7 A;  3HKC A;  1WRG A;  4QGP A;  1T2K C;  1X9V A;  2B9Z A;  5EIB C;  2DWD C;  2ZXE B;  4AQR D;  4EEQ A;  3ZDM A;  1ARO P;  1Z56 A;  2H7H A;  2YUA A;  2X6B A;  1P7B A;  4N21 A;  4H37 A;  2LO1 A;  2YI8 A;  3M8A A;  3SFE C;  1PL4 A;  1X79 B;  4DR2 O;  1YJN P;  1K9M Q;  1R3J C;  3H1I J;  4WY4 A;  1GU4 A;  4X9Q A;  1FE6 A;  5KKZ C;  1XNQ B;  3KZI H;  4LLH A;  5LHG A;  3H1I H;  1SFC B;  3WB2 A;  2C0X A;  3PH0 A;  4UV9 A;  4C7N A;  5CCG D;  1IFD A;  1NTK E;  2PYJ A;  3OUF A;  1PP9 J;  3L72 J;  1N0N A;  2BTQ B;  2ZFC A;  3N2K A;  3ZRX A;  4LF9 O;  1KIL C;  1OW6 A;  1TVK B;  1L0L G;  2B9B A;  1Q7Y W;  2QG4 A;  3WFV A;  2KNC A;  4B3R B;  4JYB A;  1H2S B;  4DR1 B;  4K0K O;  3JAT A;  1YHQ V;  3L70 E;  2IJJ A;  2AHZ A;  1QEX A;  3PRJ A;  1Y74 A;  2L5G B;  2LKM A;  3D6Y A;  1M4U A;  3BRC A;  5DJU B;  1WLE A;  3L9D A;  3OMN B;  2F4V O;  1TUE B;  3Q5P A;  3T1H B;  1W59 A;  4RUF A;  2WIT A;  4HJG H;  1H0T B;  2H43 A;  2EIM C;  1IVS A;  3A2A A;  1NAF A;  2QE7 H;  3CRC A;  4JF3 A;  3ASO B;  4IHJ B;  3U11 A;  1WMK A;  3HTK B;  3A5T A;  4G2K A;  3W7S A;  2QRX A;  1V9P A;  4LC1 A;  4ZKI A;  2IPP A;  4AI8 A;  1DLB A;  1GMG A;  4QJF B;  2B1I A;  3CC2 V;  1VQ6 V;  3ZCC A;  3L70 G;  4I9Q A;  2POH A;  3H1L D;  3OR6 C;  2FFD C;  3OGI B;  1R5L A;  2D2C C;  2HYN A;  4U7N A;  3TNU B;  2W83 C;  2ZDI C;  2F4V B;  5KA6 A;  3H1L G;  1KB9 F;  2FKW B;  3U1C A;  1M1K Q;  5APY A;  4X65 O;  2R72 A;  3SFD C;  1F4M A;  5KAI E;  1HF9 A;  5KJ7 D;  3CX5 H;  3FXD A;  3OEH G;  1G6U A;  3RVY A;  2M5A B;  4WFB V;  2QGN A;  2EJR A;  3MHH C;  4JI4 O;  5IT9 N;  3JCU Z;  1XI1 A;  1VQO V;  3NFQ A;  2E5L B;  1AJY A;  4HZ3 A;  4FM2 A;  3FX0 A;  4U3F G;  2W6J H;  1SQP J;  4J80 A;  3G4S P;  3QWO C;  2V1D A;  1N33 O;  2QDO A;  3J81 N;  1HGZ A;  1KP3 A;  3FXE A;  3N7N A;  1VQO P;  5AW0 B;  2UXC B;  3IFX A;  1B06 A;  2PTM A;  4JYA B;  1VIB A;  2Q6A A;  1GRJ A;  2Y69 C;  2P10 A;  4PD4 I;  2MW2 B;  3C90 A;  4HNA A;  4D6T D;  4JI0 O;  2JWA A;  1S5L E;  3FX7 A;  1MZ9 A;  2PY5 A;  1BGY H;  4GX0 A;  4ZKP A;  3L36 A;  3SPJ A;  4BRY B;  1JCD A;  1BZK A;  3BAA A;  3L4F A;  2HVK C;  1Q82 W;  3C3T A;  1A02 F;  3L70 D;  1SZT A;  4TT3 G;  4X1Y A;  2F43 G;  2FL4 A;  4WFH A;  4RJT A;  3L73 G;  1T3U A;  3GLM A;  1NTM G;  3CWB E;  1NQT A;  3CCU V;  4CPG A;  2F95 B;  3VTP C;  1GTO A;  2B5U A;  1LTJ B;  1UIX A;  3L75 G;  1ZLL A;  3K5L A;  2ZYA A;  3CD6 V;  1LNQ A;  1K9M W;  4LFB O;  4O4H B;  4WWI A;  4O4I B;  4IL6 X;  2VQF O;  1ZWI C;  2DQ3 A;  1R1B A;  4B3M O;  5LMN O;  2CTQ A;  1H88 A;  1IUR A;  4HH2 A;  1H8A A;  3CX5 F;  2FYN C;  3VMA A;  2J5U A;  2VS0 A;  1FDI A;  3HD7 A;  2AXC A;  5KJ7 A;  3M99 B;  5EBM C;  2E76 D;  1OHH G;  1VQM V;  4L76 A;  4OWF A;  1N73 A;  2W6I G;  3TDK A;  4B7E A;  3LDC A;  1SQB D;  2BCC J;  1KFM A;  1SQV D;  5FL7 G;  1VF7 A;  1SQP G;  3L74 D;  3ZMV A;  5F2V O;  3LDE A;  4FLU A;  3FAV B;  1OZ0 A;  1AI7 A;  1FXV A;  4ASW A;  2WPD G;  1NVO A;  3B40 A;  2JJ1 G;  2AEM A;  2UUC O;  2OYI C;  1TU3 F;  3T97 A;  2IZ0 A;  2K9Y A;  1BSH A;  3A0R A;  3CCJ V;  4JAA A;  4DR3 O;  4UCS A;  1LTG C;  3U1A A;  4N78 D;  1DTO A;  1LP1 B;  4O4H A;  3OR7 C;  1L0L D;  2EIN B;  4FZ0 A;  1YI2 V;  3ZMZ A;  2E75 C;  2Y9Z A;  1VQ4 P;  1N7S A;  3FWN A;  3ZHS A;  2IFN A;  2QEX V;  1VQ8 V;  4YJ3 A;  2VQF B;  1EDL A;  2PI5 A;  2HG5 D;  4L74 A;  4LFB B;  1H2G A;  1UPG A;  4X66 B;  1R5S A;  3UIA A;  4JI2 B;  5HFM A;  4LFA B;  4I7Z C;  3NTN A;  5CCH C;  5LYJ B;  1N8R W;  5AW9 B;  1KD1 W;  4MSW C;  1N7S D;  1NU1 J;  4FJC C;  3B8E B;  1NKD A;  4QMA A;  1WNS A;  2O01 H;  2W27 A;  2IYO A;  1QBZ A;  5ITZ A;  4X1I A;  4LF7 O;  1GK6 A;  2Q1K A;  3CCE P;  5KMG A;  1SA0 B;  2I1K A;  1YIT V;  4WFA V;  4R6Z A;  4UVA A;  2XAF A;  3KCX A;  1GD2 E;  2JGU A;  1VQL P;  2HPC A;  4O2B A;  3V2N A;  3SPG A;  2KZJ A;  4DOJ A;  1NZ6 A;  5LL6 Y;  4PDR A;  3SPC A;  4JZG A;  2ZR3 A;  3HD7 C;  3TCU A;  2X6C A;  1XIL A;  1PD3 A;  1ZXG A;  1K3E A;  2RNB A;  2NRG A;  1OCC B;  4K3A A;  3KZI E;  3BHP A;  1RSO A;  2N04 A;  2Q73 A;  2OYI B;  2QM4 A;  4X65 B;  2XOK G;  3HKD B;  1G1J A;  1PP9 G;  3L72 G;  4MTF A;  2ADP A;  2K88 A;  3F5T A;  4U3J B;  2O3J A;  1NTZ G;  4NKG B;  3IGA C;  4H13 C;  4W7Y A;  2GM4 A;  5E1A C;  1NR1 A;  5LHI A;  2CAZ C;  1OX3 A;  2CTW A;  2KB1 A;  3RBX A;  4O4L A;  1NI8 A;  3CC4 V;  3I56 P;  3L70 J;  4GIF A;  3LID A;  3JAS A;  3CB2 A;  3USS A;  1Y76 A;  4RUE A;  5JH7 B;  2BEQ D;  3QVN A;  1QL2 A;  1FC2 C;  1QGK B;  4BAY A;  1RF1 A;  2AZ0 A;  2XDJ A;  3SPI A;  2H8P D;  3CC4 P;  1NTK H;  1KQG B;  1DF5 A;  4D7S A;  1L4A D;  5BU8 B;  1RF1 B;  2WMM A;  2KLU A;  2HJF C;  5KAF E;  1NTK J;  1FOS F;  3RGB A;  1ZAU A;  3CX5 I;  2ZT9 C;  2XUM A;  4PA6 A;  1AR4 A;  2OGU A;  1ZR4 A;  2Z5U A;  1HWT C;  1SQX J;  1HR0 B;  3BCC H;  4B3T O;  2WT7 B;  4AUW A;  1KMI Z;  2QKS A;  2WSS H;  3LUT B;  1IBM O;  5IJ0 A;  2LGW A;  1FZF A;  1R6T A;  3RK3 C;  5B1A B;  1NVP B;  2OTL V;  3GWK C;  3UCS C;  4X66 O;  4U7J A;  3R66 A;  5AW3 B;  2ZD9 A;  4UB8 Z;  4DXW A;  1JY3 P;  2GUV A;  3CME V;  4NTW A;  2DWE C;  5BY1 A;  1XMQ B;  4IL6 Z;  4EYY Q;  2E5T A;  2YO3 A;  3BA9 A;  1LUW A;  3CS5 A;  4D7T A;  2A06 D;  5B5E E;  2YXH A;  3VQY A;  4D6T E;  5H9C A;  1S3J A;  1XNQ O;  3KPE A;  1L1F A;  3BRT B;  4LF5 B;  3TGU H;  3M7M X;  2WSF J;  2JDI G;  5FNV B;  1RQV A;  4H44 D;  1DEE G;  3V4Q A;  4GKJ B;  2N1T D;  3L71 D;  2JWD A;  2WSF H;  3H1J J;  2B87 B;  3BRV B;  4EB6 B;  1HP8 A;  1Q6I A;  1KEC A;  4DV0 O;  3R4Y A;  1AP6 A;  3CMA P;  1BCC H;  4L87 A;  3ETE A;  1KKD A;  3CX5 D;  4GUN A;  4HAM A;  5K1X A;  4J10 A;  4IIJ B;  3L73 J;  3RK2 B;  2OT5 A;  3O8Z A;  4XA4 A;  4I4T A;  3DXR A;  4J41 A;  3IF4 A;  4KUM A;  3RL0 g;  3F89 A;  3HRN A;  5DED A;  2LJ2 A;  3E8F A;  3F5W C;  2FYU H;  1KBH A;  1BQZ A;  2BCC G;  1NTZ H;  1BE3 E;  3AE2 C;  3QO5 A;  3L74 E;  5KUM A;  1HNX O;  2CDY A;  4FLZ A;  2IZ1 A;  1OW7 A;  1N36 O;  1AR1 B;  3CCQ V;  1S72 P;  2HP8 A;  4R4L A;  2YEV B;  3NR7 A;  1K4C C;  2IBZ G;  4CH4 A;  2IBZ E;  3JSL A;  1UII A;  2YI9 A;  1G4Y B;  1GW3 A;  1NT2 B;  5M1B A;  5LMN B;  2ZNI A;  1NKN A;  2PI4 A;  2P58 A;  2F93 B;  1FDM A;  3M9Q A;  2KKW A;  1H8E G;  4DW0 A;  4BW5 A;  1MNG A;  4YXW G;  1Q86 W;  3CYO A;  4RQE A;  1RH5 B;  1AIL A;  4I0X B;  2KNC B;  1GM7 A;  3HUS B;  2YXR B;  4TV9 A;  4W4K A;  1EM1 A;  1WJZ A;  2UXN A;  4I6M C;  1SQQ E;  2FXO A;  4FFK A;  4DUY O;  3P7K A;  4TV8 A;  1JR9 A;  1EBO A;  4KXR A;  4JI0 B;  2QJK C;  2K9J A;  3B5N B;  3ZMS A;  1JY3 O;  5KA5 A;  1AI4 A;  2PAJ A;  2QSA A;  4PA3 A;  2Q0A A;  1M57 B;  3CCS V;  4DV0 B;  1AI5 A;  5LA6 B;  4B3M B;  1S5L X;  4J7J A;  5KLV G;  3DSQ A;  1K5Q A;  4GX2 A;  1VP7 A;  3OA7 A;  4RWU A;  5KLV D;  5IJ9 B;  3HE4 B;  1T2K D;  3CWB J;  5AG2 A;  1KIL D;  3JAW A;  2Q7H A;  4WFF A;  4DUY B;  3CP1 A;  2L91 A;  1VQ5 V;  1QLE D;  1IXM A;  4WY4 C;  3ZX6 A;  2ZJS E;  2Y0C A;  1IBK O;  3K59 A;  3OEE G;  2R9A A;  2KK7 A;  1KKC A;  2IU3 A;  4B7K A;  2ZVN B;  1FXK B;  3JAL A;  4X64 O;  2WPS A;  3HE5 A;  3LNN A;  2O1J A;  5LA6 A;  2RMK B;  3JAR B;  2FML A;  3HE5 B;  4E4E A;  1JMM A;  3ABK C;  1PV3 A;  1QVG U;  2R70 A;  3OT7 A;  1OJH A;  2RH0 A;  3RL0 C;  4JTD B;  1Q81 W;  2EJ7 A;  5CN0 A;  3H1J D;  5A2Q N;  2BCC H;  4UCV A;  1OVU A;  5AW2 B;  3JAW B;  5KLV J;  3VBB A;  1LTA C;  4JBZ A;  1AQ5 A;  1QNM A;  5GW7 A;  3OMA B;  2Q0O C;  2Q68 A;  1NYH A;  2FY8 A;  2FFD B;  3VMY A;  5CA0 A;  3V4W A;  2WTY A;  1RE4 A;  4KHX A;  1PGQ A;  1QVF O;  1GZL A;  1AVY A;  4MTO A;  2UXC O;  3L75 J;  4IFD K;  4QPK A;  2JEU A;  2EUL A;  5KAI H;  2ETN A;  5H2F H;  2IH3 C;  1E79 G;  3J7A U;  2DW3 A;  5L3C A;  3JC2 2;  1AJN A;  1MUU A;  5BVZ A;  2V7Q H;  1VQ4 V;  3AEE C;  1S5H C;  1XUQ A;  2B88 A;  3AE8 C;  3TGU E;  5EZY B;  3CCL P;  4JAS A;  1M7L A;  1SQQ G;  1J1D C;  1ROP A;  4D6T H;  2OAR A;  4PA7 A;  1CXZ B;  1THZ A;  2AW9 A;  3EQ2 A;  3G9R A;  3LW5 J;  1HUC A;  1ZTE A;  1VQN P;  3WB1 A;  4LNU A;  3VP8 A;  2ZIO A;  3CJH B;  1PKX A;  1SQV H;  5AVV B;  4R50 A;  1R8E A;  5KAI Z;  1H0T A;  1BS3 A;  4EKW A;  1OCZ B;  5JQG B;  1SF9 A;  1JA8 A;  2WA3 A;  2EX3 A;  3RYH B;  4ZNC A;  4PD4 F;  4J9Y B;  2GUZ B;  4EB6 A;  4DUZ O;  4JI1 O;  3P8C D;  5K1P A;  3K04 A;  3G6E P;  1FZC A;  4B3T B;  1YIT P;  1A32 A;  3K08 A;  1FZE A;  3VYI A;  4TV9 B;  5APX A;  3L35 A;  2F23 A;  3FWL A;  2KQX A;  1OCC C;  2OYH B;  1N73 C;  1OWA A;  3A8T A;  3A0B Z;  4IIJ A;  3STL C;  1BE3 G;  4GDO A;  2WLH A;  3D36 A;  1OCR B;  2A0L A;  2QM8 A;  1XRE A;  4UXN A;  1E1Q G;  1IFI A;  3MP7 B;  3JCU H;  1K05 A;  3UO2 A;  2XTA A;  1SZX A;  2ZCE A;  4ASU G;  4JI5 O;  1NU1 K;  2LQT A;  4MTX A;  2NLJ C;  3WG7 C;  3HKC B;  2HG5 C;  4I50 B;  3W7U A;  2V4D A;  2YID A;  4NR1 A;  4DZO A;  4MVU A;  2QKC A;  3QG5 A;  5IYD O;  1N7S C;  3SWY A;  4UB8 H;  2YXQ B;  4C46 A;  3I55 P;  4KJM A;  1VF5 D;  2ITA A;  1EDI A;  3RL0 B;  2WLL A;  3RFR A;  1ZSP A;  1FS0 E;  2CGN A;  2EIL C;  4GX1 A;  4R8C A;  5EYP B;  1DF4 A;  2L6L A;  3EWK A;  1PM9 A;  2AXT E;  3F7V C;  1SS3 A;  3RYC B;  2EIK C;  4WF9 V;  2WT7 A;  4U3J A;  1AVO A;  1YHQ P;  4DR3 B;  2YO2 A;  3SWK A;  2K1E A;  2UUB O;  1FDO A;  1TAE A;  1M56 B;  4NB5 A;  5IJ0 B;  4MVZ A;  1J2J B;  1KC8 Q;  1VDF A;  1NS1 A;  4DV6 O;  3BCC J;  3AEI A;  1Y67 A;  1FZG A;  3E8B A;  5AVZ B;  1BCC D;  1EZV E;  1M1K W;  4X20 A;  3H1K G;  4F6R B;  1ZL8 B;  2P5O A;  5E79 E;  4D6T G;  4LF6 O;  1LTS C;  1BGY D;  4U3F J;  2DYR B;  3E89 A;  3C9I A;  2DJV A;  2OYI A;  1JB0 J;  3D8C A;  3B4S A;  1QX8 A;  3QNE A;  2XAH A;  3H1H E;  2QJ1 A;  4DR5 O;  5H6R A;  4K8Z A;  1I7F A;  1ENV A;  1V55 B;  1XNR B;  3WU2 E;  5JQG A;  1M5I A;  2ZIM A;  1S76 D;  2E42 A;  1E1R G;  2PGG A;  3B5N C;  3Q5S A;  1H2L A;  4Z1M G;  3CWB G;  2W0X A;  3O6Q A;  4IHJ A;  5IY5 B;  2WLK A;  1LWU A;  3A0B H;  2ODM A;  1JMK C;  4KL1 A;  5K5G B;  5H6Q A;  1FZA A;  2KOG A;  4DR6 B;  1W2B O;  4HYO A;  1XMO B;  4PA4 A;  3F7Y C;  3TGU D;  3H1H D;  2KS1 A;  3CC7 V;  5J2T B;  5TIS H;  3A0H H;  1NTZ K;  5CBH A;  5B5E Z;  1ZW0 A;  3G4S V;  4BIZ A;  1PIX A;  4DR4 O;  3ABT A;  4DR5 B;  3FB5 C;  1YSC A;  2QA4 V;  1SS1 A;  1O9H A;  4U7O A;  2R9I A;  1Q82 Q;  2YIB D;  1R3L C;  3P3P A;  5LGN A;  4LNU B;  5KX5 A;  2QWQ B;  2KP8 A;  4BW9 A;  5AVW B;  4KHP B;  1YDX A;  4DCK A;  2Y0P A;  2QA4 P;  5BR8 O;  1SQB E;  1YEW A;  3HR0 A;  1S72 V;  3E86 A;  4P30 A;  4C7U A;  2FBW C;  1H38 A;  3L73 E;  2WSE J;  2XU6 A;  2KIK A;  2GUZ A;  2XAS A;  3MD0 A;  1TVK A;  4NTX A;  1I5Y A;  1MOF A;  1IBL B;  2KZI A;  4OXS A;  4ASV A;  3HUS C;  3R65 A;  3H1K J;  4GT1 A;  1PP9 E;  2KUB A;  3L72 E;  2Q7G A;  1HVV A;  2RJZ A;  1JMB A;  1U57 A;  1BSM A;  1GL2 C;  2X7R B;  1EDJ A;  4DV1 B;  1KYO H;  1H2M A;  4LFC O;  4EI2 A;  1XHX A;  3M0A A;  1QHT A;  4PV1 B;  2M5A A;  5E79 Z;  4X1I B;  4YY3 O;  3AEC C;  1N34 O;  1OZH A;  5KX5 B;  2GHY A;  1URQ D;  2ADQ B;  2QE7 G;  2QKA A;  1VF5 C;  3K03 A;  2BEZ F;  3CRA A;  1U97 A;  3CXH H;  3WU2 Z;  1BDD A;  2KSJ A;  1KYO I;  1GM9 A;  1FOS E;  1GK9 A;  1BGY E;  1VQ9 P;  3RK3 B;  3KCY A;  3C8V A;  5KLI C;  1FKA O;  3FYE B;  2K9P A;  1SQQ J;  3ZJZ A;  2FYU K;  1VQM P;  3AEA C;  3P8M C;  1KZU B;  1HNW O;  4BR6 A;  3AE3 C;  1ZX3 A;  1JOC A;  1H8H G;  1K8A W;  2Y0I A;  3N2G A;  1M90 W;  4FLW A;  2YIC A;  2LXC B;  4HNA B;  4X1K A;  1L2P A;  4ZI7 B;  1VQ5 P;  4I55 A;  3RW0 A;  3SGI A;  4RQF A;  1K4D C;  1PL5 A;  3VQV A;  1SQB J;  4ZMD A;  2Q7E A;  4Z1M H;  1CI6 B;  3E1I A;  2ZE8 A;  1SQP K;  3G71 P;  1YXB A;  4BRY A;  1SQP E;  4PD4 E;  4EFE A;  1SQB K;  4H44 C;  1WT6 A;  2W6J G;  3FYI B;  1VQP P;  2XND G;  2F66 C;  2XZR A;  3CX5 E;  3CXH E;  3AG4 B;  4O2A A;  1YI2 P;  1NOH A;  2IJH A;  3E35 A;  3P3N A;  1ZRT D;  4JI1 B;  4I0X A;  3A0H Z;  1JEK A;  4X1Y B;  3GF7 A;  2P4K A;  2QEX P;  3HUS A;  5EBW C;  4NXN O;  3FKS G;  1FAF A;  5JCO A;  5GON B;  3CCR V;  1WP8 A;  2W8Z A;  2QJK B;  1HR0 O;  2ZNJ A;  4CC6 A;  4FZ1 A;  2IU0 A;  2UU9 O;  1PZQ A;  2WLN A;  1QR9 A;  2GV9 A;  1GL2 A;  3BVO A;  1SFC C;  3H1K E;  5J9P C;  4LWS A;  3SYO A;  1JY3 N;  2Q67 A;  5CA1 B;  4DR2 B;  3A0B E;  2AGA A;  2I8D A;  2HVJ C;  3CCM V;  1FFX B;  5LMU B;  2OYH C;  2Q7C A;  5DN6 G;  1K04 A;  3K57 A;  1NH4 A;  4TT3 H;  4WVZ A;  3ML0 A;  1I94 O;  3SYQ A;  4YY3 B;  3H32 A;  1IBK B;  1KP2 A;  3DXR B;  3K06 A;  3A2F A;  4YJ2 B;  1P84 E;  1MMM A;  2KYV A;  1TUB B;  2KS1 B;  2KG7 A;  1JUN A;  1OCO B;  5EC1 C;  1BQ0 A;  2YIU C;  4ZOL B;  5IDJ A;  1ZR2 A;  3SJQ C;  2WSC J;  2Q5U A;  3W7W A;  2N1T A;  4P9P A;  1JCC A;  5TIS E;  1XTG B;  4UB6 E;  3UQ8 A;  4O4J A;  2SPZ A;  1EZV H;  3L74 J;  2EIJ B;  4DRX A;  3ZHR A;  1Y8A A;  3K5B A;  4C7N B;  3E2E A;  1K34 A;  1OMI A;  4GX5 A;  1M57 D;  3AG4 C;  1NTK G;  3VOP A;  3ASO C;  4KHP O;  1SQX K;  2FYN B;  3L71 G;  3C1L A;  2A45 G;  2M3E A;  1XHZ A;  3AE4 C;  1M56 C;  4FM0 A;  1Q90 D;  2KSE A;  3H1L E;  3OAK A;  2M6Y A;  2HEP A;  3Q1M A;  1PL0 A;  3BEH A;  5BU5 A;  3JAK B;  4JZ2 A;  2HR3 A;  4WBN A;  4EDF A;  2JP3 A;  2Q69 A;  3S3X A;  1FS0 G;  2K9J B;  3O9O A;  3AE5 C;  3FAV A;  3WUV A;  5LP6 C;  4PJ0 E;  4KFM A;  1LUV A;  4ZHQ B;  4JI6 O;  2WQY C;  5FNV A;  1EFR G;  3PHL A;  1HGV A;  3ZRW B;  4E2L A;  2YC0 A;  2LW7 A;  2XND H;  2YKP A;  4LF4 O;  1V55 C;  1JM0 A;  2HJD A;  1N7S B;  5CCG A;  2OYH A;  2E74 B;  1EDK A;  1F7Y A;  1IFN A;  1IO4 A;  2PRR A;  1YJW P;  4JI2 O;  1EXI A;  5BZB A;  4LF8 B;  4MN4 C;  1WA8 A;  3JCU E;  3W7X A;  1D7M A;  4N3Y B;  3OTF A;  2CPS A;  5CBN A;  1DD3 A;  1D5A A;  5BR8 B;  2R3C A;  4RAI A;  3AG3 B;  2RDC A;  4DR6 O;  4RES B;  5DM6 V;  5APU A;  1FJP A;  3K9S A;  2Q3E A;  3WUU A;  2UXD B;  1L0L E;  3CE2 A;  5C8Y A;  5APS A;  1L0N K;  1M1J B;  1VQK P;  4TOI A;  3II6 A;  4GZR B; 
#chains in the Genus database with same CATH homology
 1VL2 A;  1S5L X;  4R4M A;  1VF5 B;  2QIW A;  2ZT9 B;  2D2C B;  1PIX A;  1ZME C;  1TU3 F;  1KMI Z;  2H88 C;  2K9Y A;  3AE7 C;  4GDO A;  2E74 D;  3H25 A;  1K04 A;  2IDB A;  1MKM A;  1ZRT E;  2D2C C;  3GMA A;  4TT3 H;  3Q3D A;  1OW8 A;  1EXJ A;  4PV1 D;  1K05 A;  4U7J A;  3GF3 A;  2E75 C;  4Y28 J;  2JO1 A;  2FBW C;  2WSE J;  3AE9 C;  3SFD C;  1HF9 A;  3RK3 E;  4H44 B;  2QJP C;  1ZOY C;  2YIU C;  3AED C;  4I7Z C;  3IN6 A;  2FXP A;  2WSC J;  3AE1 C;  4OGQ C;  4OGQ D;  1AJY A;  2WSF J;  2YMK A;  2E74 C;  1RQV A;  4H44 D;  1U57 A;  2D2C D;  2WPV B;  1VF5 D;  4H13 D;  1PV3 A;  1S1C X;  1ZP0 C;  4YXD C;  1OMI A;  3EWK A;  3R4Y A;  2QJY C;  2QSI A;  1KOR A;  2E75 D;  2E76 C;  4PV1 B;  3AEC C;  2P10 A;  3D71 A;  3AE4 C;  3T97 B;  1RQU A;  1VF5 C;  1Q90 D;  2E76 B;  2BEZ F;  2NZ2 A;  3ABV C;  3SFE C;  5L8R J;  1Y9B A;  3Q1M A;  1FDO A;  1KTM A;  1NYH A;  4XFJ A;  3RL0 g;  3IAO A;  2H89 C;  3C8V A;  5KLI C;  5KKZ C;  2JP3 A;  1DD4 A;  3AE5 C;  3AE2 C;  2E75 B;  1OW7 A;  3AEA C;  3AE6 C;  1YQ3 C;  3AEF C;  2WQY C;  1HJ0 A;  3AE3 C;  1GMJ A;  4R4L A;  1IK7 A;  2O01 J;  3FGA D;  3GLM A;  4H13 B;  1OW6 A;  2G8Y A;  4H0L D;  3S9O A;  1YQ4 C;  4I7Z B;  3AEG C;  1KQF B;  5M1B A;  1JB0 J;  4OGQ B;  3AEE C;  4H13 C;  1UIX A;  1PL5 A;  2G3A A;  2E74 B;  3AE8 C;  4Z1M H;  3D70 A;  4KT0 J;  3B71 A;  1EXI A;  2OQQ A;  4H44 C;  4IL6 X;  3G9R A;  3LW5 J;  4H0L C;  3AEB C;  1NGM B;  3Q5R A;  2BEQ D;  3D6Z A;  1DD3 A;  3D6Y A;  2FYN C;  2J5U A;  3Q5S A;  1FDI A;  4H0L B;  1R8E A;  3O6Q A;  3Q5P A;  2E76 D;  2QJK C;  3GF7 A;  4YTP C;  2MKV A;  3Q2Y A;  1KQG B;  2V7Q J;  1DIP A;  2ZT9 D;  2ZT9 C;  4PV1 C;  1WMK A;  1KIL E;  4RKU J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...