2ZT9B

Crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
b'MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
pubmed doi rcsb
molecule tags Photosynthesis
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2008-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2zt9B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2zt9B01
1Q90D 2QSIA 2D2CB 4IL6X 4KT0J 2O01J 4H0LB 3LW5J 1S5LX 2ZT9B 4RKUJ 2WSCJ 2QJPC 4I7ZB 2E74B 5KKZC 1JB0J 4H44B 1VF5B 4H13B 1ZRTE 5L8RJ 2K9YA 2QIWA 4PV1B 4Y28J 2WSFJ 5KLIC 2WPVB 2E76B 2E75B 2QJYC 2FYNC 2WSEJ 3C8VA 2QJKC 2YIUC 4OGQB
chains in the Genus database with same CATH superfamily
4DW1A 3CMAV 1ZRTD 1NYHA 2YC0A 3AECC 2QRXA 1DF5A 1KILB 3H1JE 2FTKA 3JATA 1KQSO 5HFMA 1RF0A 1BCCE 3HPLC 3ZCCA 2ZE6A 1UFIA 3LIEA 1Y47A 3CX5D 2JJ1G 2DW4A 2JS3A 4OVNF 3HKCB 1SQXH 1YVWA 1DGSA 2GUZA 3KG2A 3WB2A 2OYHB 4EDFA 2IU0A 5L3GA 3AG4B 2B1GA 2OT5A 5JCOC 2HLOA 2IPPA 1URQC 1OVUA 3ZMVA 3U11A 1U7JA 5B1AC 5C8YA 2R32A 5APVA 2GBOA 1M57C 1FZGA 1BE3H 2EJRA 3CCLP 5APTA 4RUEA 1HGZA 2F23A 1GN3A 1PGOA 3H1HE 1LWUA 1VPCA 4D6TE 5IYZA 2V7QH 5DECA 3H1KE 1PNKA 4ZBMA 1FJGO 1BZKA 3F5HA 2F95B 2ADPA 4LF8B 3ZHSA 5A2QN 3CRQA 1PP9J 1NTKG 1WA8A 1M4UA 3H1JD 1NKZB 2WPSA 5CA1A 4GKKO 3OGIB 1E1QG 1BCCD 5H9CA 4NPDA 1R6KA 1IXMA 3OM3B 2QSIA 2FXOA 4GKGA 3P7KA 3P32A 5FLXN 2NPSA 1T6AA 4GODA 4UCRA 2E42A 2Y0PA 1JMMA 1QL1A 4TV8A 3L74D 5AW3B 3LDDA 1NO4A 2W90A 3AEFC 2GTAA 1AR1B 4LF8O 1BGYE 1VF5C 4I7ZB 2V4HA 3CHXA 2DN9A 1XI1A 1FAVA 1H0TA 1SRYA 3OUSA 2PAJA 2N9YB 2WITA 4DR6B 1K9MQ 5H5NA 1FPOA 5JQGA 3K5NA 4UB8Z 2KB7P 5KLVE 3S3WA 3W7UA 2F93B 4IFFA 2P6JA 2WTYA 1LGHB 4DR2B 2HR3A 1NTZE 2LQTA 1L8DA 2FYUH 1K97A 2EBOA 3LSSA 2E5LB 1IZ3A 1YJNV 5KJ7D 3L72J 1PKXA 4IYIA 1YCIA 3HD7D 1EZVE 3K03A 4TQDA 1CSBA 3H1HD 2RKLA 2MJZA 1EZVI 1USDA 4D6TD 4ICGA 3GLMA 3H1KD 4IFMA 2Y9ZA 1M90Q 3A0HH 1OCRC 2QIWA 2E5LO 1YJ9P 2QA4V 2OTJV 4J7ZA 2WSFJ 3II6A 1KP3A 2MKVA 3N27A 1R73A 2YKPA 1KU9A 4QPKA 2ZNJA 3CD6V 2Q1KA 3GG2A 2JS5A 3ABUA 1ENVA 1AJNA 1M5IA 3GHGC 1BGYD 1K8AW 4H37A 2QTOA 3VQYA 4GDOA 2OCHA 2UWJE 3SPHA 4QE9A 4DV5O 1K05A 1PZQA 1DIPA 5FL7G 4PELA 2K9JA 3ZN0A 4RQEA 4I50B 5B1AB 2G8YA 5KAIZ 1M57B 4RUFA 2WLIA 1YSCA 1Y74B 3QO5A 1KQLA 2DE0X 2EINB 1F4NA 1M1JC 2E5TA 1JY2P 3OTOB 3VP8A 5LMNB 1V55C 4H44D 3RVYA 2OIGA 1EZVD 2IZ1A 3K0DA 4JYAB 3HUSB 2HEPA 3L4FA 5KX5A 3QVNA 3CWBE 1AROP 1VIBA 2X6CA 3Q4HB 5AVRB 4PJ0Z 1LWUC 2JWDA 5GONA 4ZOLA 2IJKA 1COWG 2JEXA 1OVVA 2ZYDA 5LMNO 3WB0A 1ZLLA 1VQPV 4O4LA 1Y76A 4JYAO 1ZP0C 5FPOA 5LOVB 2R5DA 3R66A 3FGAD 1AJQA 3L75E 2AGAA 3WG7C 3W7XA 2HJFC 1K33A 4FZ0A 4BRYB 1KMIZ 2N74A 3C90A 1MKMA 3B8MA 1GO3F 2IZ0A 1EDLA 2Z0AA 4MTFA 2H89C 3SWYA 3Q3DA 2R5BA 4B3MO 1K04A 3UCSC 5BY1A 4I2LC 1QVFO 1JTHB 4OPHA 2Q4PA 2KP8A 4UB8E 1SVFA 1HTLC 3SYQA 4X62B 1WB7A 4KHPB 4X1YB 1J95A 4QGPA 1OWAA 1FFXA 4L76A 4O2AA 5L3DA 2O3JA 1TA8A 5CMZA 2XAHA 3K5LA 3CX5H 3DC6A 3M8AA 2QKCA 3TF5A 5KJ7C 3CWBD 4LNUB 3RL0D 2AZ0A 1OCRB 1FAFA 2IBZI 4I0XA 3HD7C 4X62O 1P49A 1SQXG 5BU8B 3TK1A 3G4SV 3ITKA 1EM1A 2P67A 5LYJB 2JP3A 3GHGB 1YI2V 4FLZA 3L75D 4ASVA 4JI5B 3J80N 4KL1A 1GW3A 2DQ0A 1MFZA 1JCHA 3VTPC 3M0DA 2OYQA 3N2KB 2VWJA 5LXTB 1VEWA 3MAQA 3QH9A 1BE3G 1XHXA 3V4WA 3HKEB 3TXQA 4J42A 4OWFA 1SQBJ 5L8RJ 3D36A 3DSQA 2YXYA 2M5AA 1IBMB 2XAJA 3BFRA 3PLNA 3S3XA 5L3FA 2BSKA 4ZKIA 2V7QG 4JI5O 4OH8B 1SQVK 1K8AQ 1R1BA 1M1JB 4C7RA 4D7SA 3H1JH 4YIPA 4MT8A 2Z5HA 1V55B 4L8JA 5KAIE 1BCCH 3ETGA 2Y69C 2YICA 4H0LC 2ZR2A 1IBMO 1L0LJ 2XNDG 4NPEA 3L74H 2BCCJ 3P8MC 1P84D 4EKWA 4JI8B 3KQGA 3ABMC 1Q81W 4H44C 5C39A 1PPJG 1ZN5A 1JX9A 1QU7A 4EYYQ 1KD1W 1X59A 4DR4B 3JSNA 4UVCA 4PJ0E 1H8AA 1AR5A 3V2NA 2FL4A 4JI2B 4IHJB 4HJGH 2XASA 3BASA 3A8TA 3K5MA 1SQPK 4LWSB 3WFVA 3EVKA 1MZFA 4K35A 3V5BA 1JQ0A 4DR4O 4UCUA 2FYUG 4JPRA 5EFWB 1H8EG 2PZSA 1K4CC 2NNUA 3H1HH 3SDLA 5AVQB 1I7FA 1F7YA 4D6TH 1E1RG 1WPBA 3H1KH 4JZGA 5F2VO 3A7OA 2HG5D 1AI4A 1LP1B 1LTBC 3T1YB 3VP9A 4Z1VA 1H2GA 5E1AC 2KB1A 4JASA 3VOUA 5DJTB 1OJHA 2XTAA 2ITDC 2LFSA 1LTJB 1ZLZA 1LUVA 3CJHA 1IFDA 1BL8A 2Y4UA 3VOPA 3K57A 2IJHA 3SPCA 3HD7B 1N7LA 3JARA 1BGYH 2P22C 3T1YO 3HE5B 3UT5B 4P9PA 2DJVA 3D6YA 2KSDA 2GSMB 5BXZA 4TV9B 1HNXB 5EYPB 3RL0C 2IH1C 1IBLB 1YTZT 2A06G 4HYOA 4MTXA 3JCUZ 2KZIA 2WAMA 2GV9A 4IIJA 2HLDG 1OCOC 3SPJA 3K79A 1HNXO 3ZHQA 1HBWA 4UFZA 1ZSPA 3M0DC 1PGQA 3BCCG 1SQVE 3HTKB 1GN2A 1R3JC 4YJ3B 2X0LA 1SA0B 3JD3A 3D36C 3IJ4A 3RYHA 1AJYA 5EBMC 1KORA 2KK7A 4MTOA 2Z4EA 2Y69B 2OTLP 1GRJA 4JYCA 2WT7B 2E74C 4FM1A 3D6ZA 3ABMB 4H44B 1S5HC 4NR1A 3OD4A 2K88A 2R3SA 1HWTC 1HUCA 4WVZA 4BWNA 3I55V 2P10A 4FLXA 3H1LJ 1AJPA 3B5ND 2ZXXA 4CS3A 5AW2B 2FYNC 3FXEA 3CCMP 1SQPE 2EIKC 2LJ2A 1FC2C 2AEFA 4JYYA 2ZR3A 1OW6A 4ZIBA 5TJHA 1JFFB 4IL6Z 1Q81Q 4NXNB 5HFLA 2R44A 3G71V 1GTOA 4OXSA 3ZRWB 4Y99C 1NT2B 1KD1Q 1KYOI 1ZL8B 2KNCA 4LF7B 3M9QA 1RP3B 1KKDA 4U3FE 4W80A 3RWRD 5CCHA 1SQVD 3CWBH 4WF9V 1JO5A 3IFXA 2QVAA 2A79B 2RMZA 1GU5A 5LMUB 2WSCH 4GX0A 4Q6GA 2W6JH 1RM1C 2DYRC 2HG5C 2M7WA 2UXXA 4TQFA 2N1TD 1N0NA 1GK4A 3NFQA 1VF6A 4WFFA 3L75H 2UXNA 3K59A 1J5EO 1BDDA 5LMUO 2O01J 3M9BA 5J2TA 2AXTZ 2B1IA 3RL0B 3Q5RA 1U57A 1JCDA 1OFCX 3FWLA 3DTUB 1N8RW 1SQPD 1UIXA 2W6BA 2BEQD 4O2BB 1DTOA 2KI7B 4UB8H 5AVSB 5EBLC 4AQYB 3JCUE 4K3AA 1JNMA 2QWPB 3QG5A 4B3SB 2B87A 1YQ4C 4I55A 1BCCG 3L71J 4U3FD 4JI1B 2GUVA 1F23A 3E2EA 1S5LZ 1S4XA 4RJTA 3KDPB 1P84H 3JAKB 2FFDA 1HJBA 3TXSA 4X20B 5K1XA 4DR3B 1GM9A 3T1HB 3O6QB 4O4IA 4B3SO 5CJ0A 2UU9O 1EDJA 3H32A 4FFBA 1BSMA 4MVOA 1NBMG 1KN7A 3TJTA 4O4JA 1IJDB 1KILA 4UCSA 4EFBA 3T1HO 3NTNA 4BW9A 1W5CE 2FYNB 1EC5A 2EIKB 4DUZO 4LF9B 2L6LA 4YY3B 2Z3YA 3C9IA 2ZINA 2OTKE 2PY5A 1RY3A 1K3EA 3FX7A 1TUBB 2ZXWB 1BQZA 2NLJC 3K9SA 4B3RB 1S5LX 1W59A 3HKCA 2XNXA 3AE7C 3OT7A 5LGNA 1BSNA 3B5NC 3CS5A 1Z5VA 3IF4A 2QWNB 1VQ8P 4IL6E 5KAIH 2K9PA 1FDIA 1S0VA 2OYHA 4YY3O 5LP6B 2IJIA 2ODMA 2Q68A 4F6EA 1Q86W 4B3RO 1HNZB 1SP4A 1PPJE 4LFBO 4UV9A 5AVYB 4L75A 1VQ9P 1AB3A 1QLEC 5IYDO 2CPSA 4FLTA 2XU6A 4PJ0H 1KTMA 3DXRB 4DV4O 1JR9A 2G3AA 5KLVG 3BVHA 4R4MA 1HNZO 2EILC 4PD4E 1TU3F 1PNMA 5ITZB 1PNLA 3TGUJ 1KYOF 1VF6C 4YJ2B 1XNQO 4G27B 1NTZG 2W0FC 3KKYA 1T2KC 3OTFA 5IY5C 4WFHA 3RN4A 2XKMA 3HKDB 4LFCB 2AXTE 1EZVG 3W68A 3LSUA 5EK0A 2BTOA 3T1CA 2QM4A 1H2NA 1NTMJ 1Q3EA 1OVRA 4NTXA 2GM4A 1N8RQ 1YIJV 2F4VB 4L74A 3P8CE 3SGIA 3CC2V 3O65A 4LFCO 2R3CA 1NZ6A 4FMTA 3GF3A 1WPXA 2WLKA 1PPJD 1TUEB 1HGVA 1S5LE 3AE2C 5LHIA 1VQ7P 2ZT9D 2FFDC 3FD9A 1LTGC 2A06E 2XT9A 4JI7B 5AVTB 3L35A 1YITP 3MD0A 3FAVB 3ZHVA 2CH7B 4PD4D 3HE4B 3T4DA 1AR4A 1KB9I 3LUTB 2JKVA 3M99B 1NAYA 1Y4MA 1H2SB 1KILC 2Q0OC 4TUYB 2IFMA 3BCCE 4MVZA 1JM0A 4JI7O 3ZDMA 1SQVH 1DD4A 1R6NA 1KFMA 3B5NB 2JRIA 2QKAA 3B8EB 1RF1B 3LW5H 4HYTB 1YEWA 3CCRP 2ZAEB 1NGMB 5AW4B 5KHGA 3CLQA 3P8CD 3L36A 4I50A 4YTPC 2GTSA 2OYHC 3JD0A 4KHXA 1Y74A 1HNWO 1NH2D 1LTSC 3L75G 1LTTC 3RBZA 4JQ0D 4DW0A 4CZZA 4DR7B 3HUSA 4JTDB 1SQPH 2A06D 5CBHA 5KAFZ 1L0NG 1Q86Q 3L73J 3Q4HA 4X1IB 1W2BU 1VQLP 5JH7B 4DV6B 2N1TB 1GU4A 4JI0B 3GMAA 1LTIC 3E1IA 3KHUA 3PHLA 1GK9A 4HKZH 2ZKOA 4DR7O 3BCCD 4XE5B 3BRTB 5LOVA 1DEBA 3OMIB 2YMYA 4GOEA 2IBZG 4BRYA 4JI0O 2H3OA 3RVZA 4DRXB 2FKWB 3I56P 3CCSV 4DUYO 5DM6V 2PUSA 1XMOB 1HWYA 3B09A 4FM0A 1JTHA 2J58A 4DR5B 4I9QA 5KLVK 3O8ZA 4PD4F 5K1PA 4HAMA 1FZEA 2ITAA 1NTZK 2X7RB 2P1JA 5J2UB 1THZA 4CS4A 1N33B 4LNUA 1L4AD 4GOFA 4AYCA 1J2JB 1DD3A 4CH4A 4QJFB 3U10A 4PDMA 4OGQD 3UIAA 5LL6Y 1OCCC 2HP8A 4EFEA 2HPCB 3STZC 1R6TA 3GWOA 5JJEB 5LYJA 3D3QA 3EFFK 3MHHC 3GHGA 2O1KA 2BASA 3AE1C 3T2MA 3RL0g 5APUA 1Z5WA 3N2KA 1OZHA 3H1IG 5LXTA 1RPRA 3HKEA 5AW0B 2XDJA 3G6BA 1VQ4V 3K9AA 5BZBA 3VYIA 2DMXA 4MS2A 3OGCC 3THOA 4CC6A 5CA0B 1DEEG 1M1JA 1SQBE 1KB9F 3OR7C 2EULA 4BWAA 2A45I 3AK3A 5IJ9B 3M0AA 4PA9A 3SYCA 2A3QA 2EZPA 4DV7B 2EINC 4A5UB 2PP6A 3AG3C 3VQVA 2HKOA 3HUSC 1RE4C 5KAFE 2JGDB 1D2DA 1R5LA 2QE7H 3OFNG 1L0LE 2PI5A 4IL6H 1KBHA 2BCCE 3K06A 2QKSA 1IURA 1MFTA 3UKMA 1S2EA 3JD1A 4IHJA 1SETA 2WPRA 2XNDH 2IJJA 1RHZB 4DT0A 4LWSA 2WZ7A 3W67A 2B9ZA 2PFXA 2Q0AA 2ZE7A 4K8ZA 1AQTA 1PPJH 4HZ3A 1MG1A 1V9PA 2FYUJ 4B86A 3RYFB 5CBNA 1L0NK 1LP1A 4PD4H 4MVRA 2Q6AA 4FZ1A 1NR7A 3WB1A 1AI7A 1SFCD 4PV1D 1HW7A 1LTJA 3JALB 1X22A 5KJ7A 4DR6O 4AUWA 2AXTH 1YBKA 5JVDB 2ZT9B 3B2EE 3HD7A 3IFMA 1S77D 1OHHG 1SQVG 3HE5A 4DR2O 3UT5A 1WP7A 2EJ7A 2C0WA 1OCCB 3AK1A 4TV9A 4J41A 1AA0A 2BCCD 5EYPA 4DR1B 1U7MA 4N78E 4GLXA 3E8GA 1VP7A 5FNVB 5GTHZ 4ZI7B 5J9PC 1G2CB 4GX1A 4O9BA 4BR6A 5AVWB 1SESA 1NVOA 2CPBA 5AW8B 4IOIH 3IC7A 3RYCB 3FYEB 5IYBO 3LSQA 3K08A 1F51A 1UJWB 2A06H 2XHBA 3A0RA 3HTKA 4RKUJ 2YDEA 4YJ3A 5KLVD 1SQPG 3V2QA 3CXCU 1SA0A 5GW7A 4WFEA 4JBZA 3AK2A 1NOHA 3D71A 4TWKA 2W6AA 5APWA 1FD9A 2RQ6A 2YKQA 1NTZD 4Y28J 2QGNA 3CC4V 2Y0DA 2WT7A 2YNYA 1NH2B 2KLVA 3BCCH 3ZHRA 3AG3B 2MK3A 3LNMB 2BE3A 3SPIA 4DV2B 2VQEB 3CCUP 4U3FG 1JY3N 4RO0A 2C2AA 2WLMA 2QEXP 1XUQA 1JEKA 4JTCB 1USEA 1M93A 2POHA 1N34B 2PRRA 2JJ2G 1S3JA 3CEIA 4QE7A 4BIZA 4AHCA 3KCYA 3OTOO 3OMAB 4DV2O 4N78D 1JOCA 3MGNA 5KKZC 2D2CD 3H1LE 1JFFA 2ZDIA 3BABA 1FE6A 1Z56A 2IU3A 3ZRWA 4J10A 4KFMA 1ZL8A 3CMEP 5CCGD 1LT9C 3SFDC 1GL2D 1L0NE 1DH3A 4UUJC 4DO2A 2P4VA 3SJCC 1S72V 2GDSA 1IC2A 3EFGA 1QBZA 5K5GB 1JVMA 5EBWC 2UXBB 1J1EB 2N9BA 4BW5A 3FFQA 2LR2A 2ZE8A 1CI6B 3AG1C 1CXZB 2OIEA 1EBOA 1GDTA 2GA1A 3JD4A 3D70A 1LTJC 1NJIW 1Q2NA 4Q20A 3UO3A 2IBZE 1ZAUA 3BHPA 5DN6G 2UXBO 1M56D 3MP7B 3V4QA 1VQKP 2WA4A 4CH6A 1L4AB 4RAIA 3SJAC 4KHPO 3FB7C 1KQFB 3A2AA 2Q7CA 2OQQA 1B06A 2P7JA 4OGQB 2ZD9A 3ZIAG 4O2BA 2HODB 4I6MC 1SZXA 3N4XA 4P9OA 2P5OA 3AEDC 3H1LD 2X6BA 1W0KG 3ZRVA 4ABMA 1Z2GA 2ATKC 4EEQA 5GTHE 1M9NA 3BY6A 3CE2A 2QWQB 4P2ZA 1AI6A 1YF2A 1W2BO 3H1JJ 4FVMA 3M7MX 1OMIA 1L0ND 4LLHA 4D6TG 2K9YA 3JAKA 1QX8A 4X20A 4TLFA 1N73C 3CCVV 3L71E 1QCEA 3O6QA 4LC1A 4C7NB 3L74J 1QR9A 1OV9A 2QE7G 3C3SA 1S5JA 1BSHA 4GX5A 3CCEP 4JI3B 2E3CA 5IT9N 3JCZA 2M3EA 1FS0G 2WQYC 2WSEH 2YUAA 2IBZD 1SQGA 3ZMUA 1XTCC 3H1IE 3JSVC 5CJ4A 3WU2Z 3R2PA 3E8BA 4B3TB 4RO2A 1IFPA 3GVMA 5KKZB 1MZEA 3VMXA 4JI3O 1P4RA 2RJZA 4J11A 4WWIA 1TUBA 2ZVNB 3H1HJ 1QGKB 3CCQP 1XMQB 1I5XA 3RK3E 5B3SC 4J7KA 3H1KJ 4JI8O 1YJWP 1WJZA 3ICXA 1LT9B 3J7AU 2FMLA 2ZDIC 1SQQJ 3A3YB 3A0BZ 2D2CC 4B3TO 5LP6A 4F6RB 1VARA 2YSUB 3T97B 1N7SD 4JI2O 5LA6B 3JAWA 1PP9G 1Y9BA 2IYPA 2P58A 2KIKA 1AILA 1XMQO 1WA8B 1GL2C 5KAFH 3Q2YA 3L71D 1DF4A 1O9GA 1OCZB 3AG1B 1BGYJ 5TISZ 2BCCH 2O01N 1SFCB 3DXRA 4PV1B 1FYJA 3G3ZA 1YITV 5KHHA 2Q7HA 1D5AA 1K5SA 1JY3P 2A0LA 4JTAB 4EI2A 3M9HA 2OYIC 5ITZA 3H1ID 1HDJA 1JOYA 2IDBA 4EIJA 2YXLA 3HKDA 3TGUE 2VRZA 3E22B 1M56C 5KLVH 1NJIQ 4XA4A 1NWQA 1G8MA 3RK3D 3L72G 5FPRA 3L70J 4HH2A 1NTZH 1NI8A 3CCRV 3CC7V 4UCTA 1T3JA 3JC22 1NKDA 4JV5B 3PJSK 1H89A 2R9IA 2YEVB 4K0KB 1EZVH 4X64B 4U3JA 1IBLO 1MABG 1N73B 4UVAA 3F5TA 4L87A 1PGPA 4W7ZA 1CZQA 2E76D 3K04A 4JV5O 3K5OA 3FAVA 3RBXA 2CH7A 2P4KA 3H01A 1VQLV 4R7CA 3KYQA 3HE4A 1T3UA 2KXPB 2W0XA 1A32A 3B4SA 3ZS8C 2RH0A 3AG7A 3G80A 4TUYA 4YHHB 1FFTB 2WSSG 3RFRA 1A02J 3SJBC 1XL4A 3WU2E 2Y4TA 2ZJSE 4H13D 4JI4B 3B5NA 3TGUD 1IFMA 2BOCC 1EN6A 5B3SB 1RF1A 4MW8A 3RYIB 2M6YA 1SS1A 2XUMA 2DW3A 4LFAB 5C93A 3CWBJ 2D2CB 4WY4D 1YJNP 1KYOE 3OAKA 2ZXWC 4IFDK 3APOA 3CB2A 4N23A 1NH4A 1N2DC 2C9NY 4YHHO 1P7BA 2PYJA 2AEMA 1NVPD 4LCUC 2ITCC 3AG2B 3A0BE 3ABTA 1NU1J 5EZYB 5LP6C 1GL2B 2V1DA 2BEZF 5AW7B 4LH7A 5AW5B 2MW2B 2ARHA 3KPEA 5GONB 4NXNO 2RN0A 4BXLA 2QA4P 3E89A 1K7DA 5EIBD 2OTJP 1N7SC 2ZM6B 1KC8W 1Y76B 3G6EV 2WWWA 4MW3A 4Z2WA 2AXCA 3CD6P 4LF7O 3MHSC 4I4TB 5TISE 1AQ5A 4X1IA 2PGGA 4F4LA 2OYIB 3H1LH 5JH7A 2OARA 2B5UA 2JJLA 1J1DB 2N1TA 2IH3C 3IR9A 2KZJA 4JYBA 3L73E 3OW2U 2R70A 4CH3A 2WLLB 3S1KA 4DV3B 1M56B 1IXBA 1L0NH 2ZIMA 4HNAB 5D5PA 5LHGA 2Q7GA 2PYLA 1KFNA 2B89A 4J80A 2JVDA 4WFGA 1B3QA 1LJ2A 4LF4B 1VQNP 4NTYA 1IO4A 4G2KA 2YXQB 3L9DA 1N0JA 2YIBD 4DRXA 2KKWA 1KYOD 1SZTA 1FJPA 5CBOA 1TVKB 3CPWU 3UO2A 1GAXA 3JYCA 5B66Z 5L3CA 3RK3C 3QF7A 2UXDB 1XREA 2IBZH 3BVOA 3B8NA 1QNMA 4AQYO 3CCLV 3CCJP 2CTRA 4ZHQB 2QJPB 2KS1B 5J2UA 3D3IA 3QO7A 2EZOA 1KP2A 3C1LA 4JI1O 5BU5A 1ZV8A 4DXWA 5KUMA 1IBKB 1SQBG 5GTHH 4DR3O 3ZEDA 5KMGB 5IWAB 3L73D 3FX0A 2HPCA 5JWPA 1KKCA 1Q82W 2I1KA 1MZ9A 4GZRB 1R8EA 4UXNA 5B1NA 3IN6A 1QHTA 3MUDC 4E2LA 1R3LC 5IJ0B 1IBKO 1RF1C 1UIIA 2L91A 1L0LG 4E4EA 4BAYA 1TAEA 3VMZA 4LF9O 2BCCG 3E8FA 2Q5UA 1FS0E 1H2MA 4ASUG 1PIXA 4WY4C 5CA0A 1XILA 4WFBV 3U59A 1N7SB 3H1IH 5IJ9A 3NMDA 3G4SP 2P7TC 1FZCB 4X8AA 4JAAA 4K8XA 3USSA 1FZAA 1M8OB 2E75D 1JUNA 1PGJA 4LBEC 3AE4C 3G67A 2ZCEA 3MZWB 3N2GB 1YI2P 3EXAA 5EIBC 2OYOA 2YS8A 3OAAG 1EN5A 4DYLA 2JGDA 1XOUA 4C46A 1KC8Q 1YJ9V 2H94A 1NTKJ 3B71A 2N1TC 4L73A 1LR1A 2AEJA 1PP9E 4ZKUA 3S9OA 5APSA 5CN0A 1SLQA 4NPFX 2KSEA 1MA1A 1K4DC 1I94B 4I5SA 2Q7EA 1PL4A 4PA3A 4FM2A 4IGGA 3RK3B 3SWFA 2AHZA 3TNUB 1SKVA 1ZUQA 3RYFA 3P3NA 2E43A 1G1JA 4JI6B 3OJAB 5B66E 1VMGA 1I94O 2PTMA 3JALA 3NR7A 1YQ3C 3AE9C 2E76B 3ABLC 5JVDA 3CCUV 3TGUH 4DV1B 2F4VO 3V2RA 4W4LA 1BMFG 1NQTA 3QO8A 4LR3A 4LH6A 2QEXV 3L72E 1ORQC 1KB9E 3TDKA 3RW0A 4I1LA 1E5WA 3F5WC 4U7NA 1AP6A 3ZN1A 1MMMA 4NVPA 4GX2A 4N6JA 3RK2D 3RGUA 3M91A 5FNVA 3VMAA 4ZI7A 1G2CA 1PP9D 1ZOYC 3DGEA 2Q6QA 2XZRA 4XFJA 2J5UA 3D8CA 2DYSB 4H13B 3S4RA 3IAOA 2JWAA 3P3PA 4PA6A 5AW1B 3GB7C 1Q82Q 4W4KA 4WBAA 5CHXA 4WY4B 3IC9A 2BTQB 2HVKC 3K3WA 5KUKA 2LKMA 3WUTA 3U1AA 2QJKC 1Y67A 3PP5A 1NVPB 4P30A 1XHZA 2H8PD 2ZXEB 3SYPA 2AHYA 1WAZA 1Q90D 2FXPA 3GF7A 3H1LG 1H88A 2PGDA 2VQFB 1KV4A 1QR8A 1SQBK 3AE8C 3WU2H 1RE4A 2QJ1A 3K0GA 5A9GA 4FJCC 5AG2A 1URQD 3L72D 2E75C 3ZRXA 1KB9D 1VQKV 1KYOH 2JDIH 3KCXA 3ASOC 1RSOB 4IT5A 1L0LK 4U3FH 2N04A 3A0BH 3E8HA 3F7YC 1VF7A 2CGOA 1GD2E 1VQ5P 4DV6O 3WMM0 1URFA 1FXKB 5KHIA 4OX9B 2WA3A 5CMUA 4CC5A 3N7NA 3SYAA 1KUQA 4X9QA 2F1MA 5TISH 1Y6XA 2UUBB 1GN6A 2PI4A 3G9RA 1FXHA 2F43G 1HJ0A 2ZYAA 2R9AA 1SQQK 3RGBA 1IVSA 1VF5D 3L73H 4OX9O 1CI6A 4PDLA 4X1YA 1G4YB 3ABLB 2UXCB 3CCEV 4YXWG 3R4YA 1P7GA 3CX5I 2YIUB 1XMOO 3ZMSA 2UUBO 4X88A 1E79H 4X1KB 5APQA 4R8CA 1XDCA 5IYCO 1WP8A 4DR5O 2ZT9C 5H2FZ 1L4AA 4XDJA 5EC1C 3L71G 3VQWA 1XL6A 1VL2A 1SF9A 2UXCO 3JCUH 1W2EA 4TT3G 5B5EZ 1SQXJ 3AE6C 2HODA 2VWKA 1H38A 4N3YB 5JJJB 1K5QA 1N33O 3GW6A 4X89A 1YJWV 2V4DA 1MSDA 1NS1A 1V54B 3RK2C 1GKFA 4WBNB 4PI0A 4DV0B 4YXDC 3SR2C 2JK5C 3E86A 2W8ZA 2QJKB 2B88A 3CRAA 1BE3J 1VQMP 1Q6HA 4O4JB 4MTGA 3OW2O 1K34A 4C7NA 3QTCA 2V7QJ 4DV0O 3CL3D 2DWDC 3E1RA 1GH6A 4X65B 2FXMA 2H8PC 3L74E 2AW9A 5BMVB 4QPJA 1S9KE 2E75B 3B77A 3CPWO 1G1IA 3AEIA 3W7SA 1GZLA 2WLNA 3MDSA 3ASOB 4LP8A 1VDFA 2Q9IA 3E35A 1FBMA 1JMKC 1FOSF 1FDMA 4X66B 4X65O 1FZBA 2WPQA 1ZR4A 4DV7O 3AEGC 2Y48A 1FJGB 4UB6Z 1R3IC 1PV0A 3KZIZ 1N4CA 1HP8A 1AVOA 4PHZA 1LT9A 3Q1MA 1PM9A 4GKKB 1HH0A 3QNEA 2YO2A 1BT8A 1LTAC 1IDSA 2R9RB 3ZMTA 4F6RA 4X66O 4R6ZA 1HF9A 3T97A 2JEUA 2Q3IA 5LA6A 2Y0IA 1SQQE 5APXA 3TGUG 2W6IG 2JEEA 5AVXB 2LW7A 4HBNA 5M1BA 1JJOA 1SQBD 2LO1A 2NPSD 3ABVC 1SFCA 2QWRB 1J1EC 4JAVA 2OTLV 1KZUB 4JF3A 3ZHTA 2NN4A 2KQXA 1NU1K 1I0HA 3GWKC 1PP9H 3H9VA 2L5GB 4Z1MG 2K1AA 1S9KD 1NTMG 2YI9A 4DK1A 2HFED 3I5CA 2YXHA 1XNRB 3SFEC 3ETEA 2EIJB 1L0LD 3U1CA 3MHVA 5H2FE 3CCMV 3E22A 3TETA 1L4AC 3F89A 1I5YA 3A5TA 2RMKB 2K37A 3JASB 4WCEV 5B5EE 5B66H 3RK2B 2EX3A 4OGQC 3ZBHA 4O4HB 2KOGA 1XNRO 3A2FA 1S5LH 2JR8A 2YEVA 1MUUA 2KG7B 1PD3A 2QM8A 3CX5F 5LGUA 3L70E 1X4TA 4DR1O 3IGAC 2JIZG 1N73A 3BCCJ 1SQQD 2ZVOB 2ZIOA 3L72H 1KB9H 4XDLA 3O9OA 5KHKA 2SPZA 4DV5B 2E5YA 4B7KA 2WPVB 1G1XB 1ROPA 2JDIG 4CH5A 1RF0C 1QVGU 4DJGA 4TOIA 3AEAC 5AW9B 2WSFH 1VQ6P 4JPZB 4EB6B 3OEEG 1WMKA 1URQB 2Q69A 1YIJP 1EDIA 1QL2A 3CC2P 1Q5OA 2H7HA 1RH5B 3M06A 1RFYA 2VQEO 1VQNV 1H2KA 3RYIA 4H0LD 1WLEA 1ZX3A 2QTSA 5BVZA 4UB6E 1YTFB 3KZIE 2QR4A 1N34O 2LXBA 4GT1A 2OWOA 2WSSH 3L73G 1OW8A 5IDJA 2D3OW 3AE3C 3HRNA 4ZNCA 3FKSG 3L70D 3P30A 5CCGA 1NHLA 5EZYA 4FLYA 5JJNB 2UUAB 4FFKA 1GL2A 1OXZA 3I5DA 1G6UA 1Q43A 2CTWA 1E79G 5CB4B 4A7PA 2ZNIA 2Y9YA 1JY2O 3CCJV 1NU1E 2RN9A 1OCZC 3SSUA 2XAQA 4I4TA 4UCVA 4B3MB 1VF5B 5D5QA 2OYIA 2WPDG 3CRCA 2UUAO 1SFCC 4PV1C 2LGQA 2NPSC 2ZE5A 4MVSA 3CI9A 2QG4A 1H8HG 3ZMZA 2CUGA 2WLLA 4HNAA 2IW5A 3OE7G 3H6PA 2Y0EA 3SPGA 2HFEC 1HR0B 3PTZA 2FYZA 3HKBB 1RQVA 1WB8A 2BOBC 4PDRA 2CDYA 1NTKK 4FLUA 1TVKA 1VQ8V 4FK5C 1YHQP 2EIMC 3B40A 1K73W 5BR8B 2CTQA 3TYYA 1AVYA 1HR0O 3ETQA 1P84E 1BCCJ 1S1CX 1P84I 4MVUA 2LP7A 3WUVA 2RDCA 1NTMK 2WSEJ 3EHBB 1XTGB 2KUBA 2AZ2A 4DOJA 3JATB 1NU1D 1VQ9V 4ZHQA 1OW7A 2XV5A 2KS1A 2ZFCA 2RCVA 5BR8O 4XDKA 3JD2A 2H88C 3W7TA 1DX7A 1RQUA 4KT0J 3RT3C 2KYVA 1GMGA 3SYOA 3BEHA 3U0ZA 3ZHUA 1T5EA 5KMGA 4FLVA 3CCSP 2Q67A 2GUZB 2LGWA 1VQOP 1EFRG 4WFAV 1ZW0A 2CGNA 2WLHA 1WT6A 4MN4C 1X79B 3LIDA 2JGUA 2E74D 5IJ0A 3MIWA 5C8YB 2A45H 1SQBH 2QDOA 4D6TJ 1WN7A 3Q5SA 1GN4A 2WMMA 1RPOA 5AW6B 4OPAA 4AQRD 1LWUB 4R4LA 5IYZB 5KA5A 1IX9A 4CBCA 3V6IA 3CMAP 1WRGA 4QMAA 1H2LA 3AG2C 2XAFA 1N7SA 1Q6UA 1R3KC 5CCGC 2XOKG 1FZFA 5H6QA 1JB0J 4R50A 5CA1B 5AVVB 1FZCA 1L0LH 5DEDA 1VQ7V 3WG7B 5LGTA 2HVJC 4JZ2A 3N2GA 2NPSB 1KECA 1B04A 4TV8B 4DCKA 2YXRB 5KLVJ 1A02F 1FKAO 3EQ2A 4YJ2A 3SWKA 3LDCA 1J1DC 1H0TB 1NTZJ 5GTIZ 3AEEC 3HR0A 5JQGB 3STLC 2CTPA 1VQ4P 5DJUB 4QIWF 1NTKE 1SQQH 2GUSA 2I8DA 3CXHE 4JF7A 3PN1A 3ML0A 2YIDA 5E79Z 2NZ2A 3CXHI 2EIMB 3NXSA 3X2QC 2HHHB 5KA6A 5H6RA 2JO1A 1ZR2A 2QM7A 3R65A 3J81N 5B1OA 3TNUA 3JAMN 1US6A 3H25A 5EC2C 3CRRA 1NTME 2ETNA 3FB5C 2A9HA 3W7WA 2HHHO 2IYOA 5LBQA 4ZMDA 4BIOA 1K73Q 1JY3O 5H2FH 4WB4A 1ZXGA 4K0KO 4NKGB 2KLUA 1R5SA 4X64O 2HYNA 2QJPC 5B5EH 1ZWIC 1FXVA 3V2PA 1Q7YW 1D5NA 1B6QA 1O9HA 1U96A 1GW4A 3AE5C 2QWOB 4UV8A 3L70H 3MUDA 4FPPA 2K9JB 2C9LY 1P84F 2IX7C 1NTKD 5B1BC 3CXHD 1X8YA 2W27A 1VQ5V 3LDEA 1PFIA 2WLIB 2ZQMA 1EXJA 2Q9LA 4KXRA 4H0LB 3I56V 4CS2A 1SQXK 4U7OA 4WY4A 2BTQA 1LT1A 2Q73A 2I1JA 4PDVA 1CEZA 2WSCJ 2Q8VA 3BA8A 5KX5B 4JI4O 1DLBA 4KP4A 1NTMD 2RNBA 3IAYA 3LNNA 3PH0A 3VQXA 4UCOA 2WLJA 4LFAO 4ZOLB 3L75J 4HB1A 4I9WA 4O4LB 1BHAA 5APYA 1QLNA 1FZCC 3KXDA 2ILMA 4PA7A 1L0NJ 1N32B 1AVMA 1AI5A 4AI8A 2CK3H 1JMBA 4UB6H 1OZ0A 3BPZA 2PF4E 3KZIH 5CCHD 1RSOA 1Q8IA 3CSXA 1YTZI 1SC5B 2ZM6O 2M0BA 2Y0CA 2OCCC 1QLED 1BDCA 3E83A 1KQSU 1FDOA 1J5EB 2FKXA 3FB6C 1MV8A 1HVVA 5GTIE 1N32O 4LF5B 3X2QB 2VRSA 3CC4P 1FXKA 3OUFA 1NU1H 3QWOC 1QVGO 1EZJA 1FFXB 5E79E 4O2AB 2YIBA 4MVQA 1KILE 1VQMV 1GM7A 4NXMB 4DV3O 1T2KD 2ADQB 1DK1A 3SJQC 2FBWC 4IL6X 4GUNA 4KUMA 4LF5O 4LF4O 1Y66A 4I0XB 2HJDA 1CPYA 4H33A 3K5BA 2FB5A 4J9YB 1IK9A 1RE3A 3BAAA 2FYUK 2K1EA 2M8RA 1VQPP 4NXMO 1SS3A 1YXBA 3A0HZ 2O01H 4X1KA 3ASNC 2Q3EA 2UXDO 2E76C 2J59M 1OCOB 2Z5UA 3CXHF 1N36B 3H1JG 4EOTA 1SERA 2X6AA 1NR1A 2A45G 2UU9B 3HB3B 4YXWH 4RQFA 1S72P 2YMKA 1GTWA 2H43A 5B1BB 2M5AB 3L74G 2BSKB 1N36O 1YDXA 1SQXE 1GK6A 1WNSA 1EDKA 4WBNA 5IE9A 1Q7YQ 3WUUA 3L71H 3ZX6A 2DYSC 4DUZB 1PV3A 2E74B 3UM7A 4H13C 5IWAO 3H1IJ 1ZTEA 3ETDA 4TT3H 1KILD 4YIOA 1XEQA 1L2PA 1M1KW 2Z5IA 1IZNB 3CRMA 2QJYC 4C7UA 4U7JA 3CYOA 1BE3E 5KTBA 1EXIA 5L3BA 1BS3A 3OEHG 3H1HG 1NKNA 5BMVA 2K3RA 2DQ3A 4B7EA 4GIFA 3H1KG 4Y99B 4LFBB 1XBLA 1SQQG 1ZMEC 5CBFA 3VMYA 2VS0A 2OCCB 4KJMA 3ZRSA 4DV4B 1GMJA 2GHYA 2QSAA 3JAWB 4D7TA 2UUCB 1D7MA 4JAUA 3OA7A 5CCHC 4CPGA 3CCVP 3UQ8A 3C8VA 1BGYG 1XNQB 1SQXD 4QNHB 1CW5A 3BRVB 1RM1B 2DYRB 1MSWD 1JCCA 4B08A 4YPCA 1PL0A 3EWKA 2A7WA 1FXKC 2P06A 3CJHB 2L35A 2UUCO 4N21A 2OGUA 3JARB 4PD4I 3VBBA 1BE3D 2FYUE 2NRGA 3FB8C 1LUWA 1CP9A 1JPXA 4MSWC 1QQCA 2C0XA 3ASNB 1T8ZA 3F7VC 4IYHA 3C3TA 3L70G 1NTKH 4LF6B 4G28B 1RE3C 4NB5A 3CXHH 1Q6IA 4JI6O 1VQ6V 1AV1A 2YIUC 1GM8A 3A0HE 1U97A 3JSLA 1SQVJ 3ABKC 4IIJB 2XAGA 1X9VA 3BATA 1JA8A 3LW5J 1IFNA 5AVUB 4ZKPA 4U3JB 2IM9A 2P90A 4Z1MH 2O1JA 3JASA 4XBFA 1NTMH 2Q5ZA 4DV1O 4LF6O 1MNGA 1M7LA 4DZOA 3RYHB 2YKOA 1BHBA 4O4HA 1L1FA 2O57A 2CE4A 1FOSE 1EN4A 2R72A 3CMEV 5KLIC 1EQ7A 2KG7A 1V54C 4MVMA 2ZYGA 3RYCA 4TSFG 1F4MA 1BQ0A 1QEXA 2QJYB 1X0TA 3OR6C 1XQ8A 3APQA 2N05A 2YO3A 4GYCB 3ZJZA 1SQPJ 5LHHA 3MTUE 2FYUD 2IFNA 2CK3G 2NR5A 2LW1A 1QVFU 4AILC 1AP5A 1NAFA 4M3LA 1K92A 1M1KQ 3TCUA 2WVRA 3CWBG 1HNWB 5CBGA 1S76D 1KQGB 1IFJA 4U3FJ 3FXDA 4EB6A 3CC7P 3BRCA 2W83C 2G38A 5JCOA 2DWEC 1YYCA 1URQA 2W6JG 2VQFO 1M57D 2KNCB 5KHJA 1NU1G 2FY8A 1UPGA 3TSIA 4PA4A 3AG4C 1YTFD 1YZBA 1IFIA 4LGDE 1LNQA 1QLEB 1OX3A 4NYKA 1TGOA 1PL5A 1AFOA 1YHQV 4RESB 2F66C 2DOSA 1JJ2U 1SQFA 4PI2A 1FU1A 2EILB 4ASWA 3OMNB 1FJKA 3FYIB 1ZRTE 3CP1A 5CB4A 4DK0A 1MOFA 1W0JG 5IY5B 2P2UA 3BA9A 5J2TB 4GKJB 3I55P 4DUYB 1OIPA 1K9MW 3CX5E 3FWNA 3K58A 2M3BA 4J7JA 3L37A 5L3EA 1IK7A 4NTWA 5GTIH 3ABKB 4FIPC 1I08A 3G71P 4UVBA 4I7ZC 1VQOV 4GKJO 2YI8A 4JGSA 2LFRA 2B9BA 5CA3A 5E79H 2B87B 4FLWA 4I55B 4J9ZB 2EIJC 3PRJA 3DC5A 3HKBA 2CAZC 3CCQV 2FFDB 1N86A 3AEBC 4BIUA 3E7KA 3VN0A 1M90W 1Y8AA 2LXCB 5KLIB 2KSJA 4W7YA 3Q5PA 3T4ZA 4O4IB 1JY2N 3G6EP 5AVZB 2YIAA 4RWUA 3H32B 4FFBB 4GCZA
chains in the Genus database with same CATH topology
2E76D 1Q90D 2FXPA 3AEDC 3GF7A 4H0LC 3AEGC 1NYHA 3AEEC 3AECC 3IN6A 4GDOA 4IL6X 1R8EA 3LW5J 2G3AA 1K05A 2ZT9B 4R4MA 4H44C 3AE8C 4Z1MH 1DIPA 1TU3F 3Q1MA 2G8YA 1VF5B 2NZ2A 1OMIA 4PV1C 2K9YA 2JO1A 1HF9A 2E75C 2E76C 5KLIC 1PIXA 4H44D 3O6QA 3H25A 4H13D 1KTMA 5M1BA 2YMKA 2E75D 3ABVC 2D2CB 3AE4C 1RQVA 2O01J 2WQYC 1DD3A 4RKUJ 4OGQD 1ZP0C 3Q5RA 1U57A 1PV3A 2QJPC 2E74B 4H13C 3GF3A 3FGAD 1UIXA 4TT3H 3D71A 1KQGB 2BEZF 3B71A 3SFEC 2BEQD 3AE2C 3G9RA 1S1CX 2ZT9D 4Y28J 1HJ0A 3AE5C 1KMIZ 2QJYC 4U7JA 3AE1C 1VF5D 1MKMA 2WSEJ 3RK3E 3RL0g 3S9OA 1EXIA 1OW7A 3R4YA 1YQ4C 4OGQC 2H88C 2H89C 3Q3DA 2D2CC 1K04A 3D6YA 1EXJA 2QSIA 1RQUA 4KT0J 3T97B 1PL5A 4H0LB 1Y9BA 2ZT9C 3AEFC 2WSCJ 1DD4A 1VL2A 1VF5C 1ZMEC 4I7ZB 3Q2YA 5KKZC 2D2CD 1ZRTE 3AE6C 1GMJA 4PV1B 1YQ3C 3AE9C 2WPVB 1NGMB 2E76B 2E74D 3SFDC 3C8VA 4YXDC 4YTPC 3Q5SA 3AEAC 1AJYA 1KORA 2JP3A 2IDBA 1IK7A 3EWKA 4R4LA 1WMKA 1S5LX 4I7ZC 3AE7C 2E74C 3GLMA 2V7QJ 1ZOYC 3D6ZA 1JB0J 4H44B 2J5UA 4XFJA 1FDIA 4H13B 3D70A 1FDOA 4H0LD 3IAOA 5L8RJ 2QIWA 2P10A 2WSFJ 3AEBC 2MKVA 2E75B 3GMAA 2FYNC 3Q5PA 1OW8A 3AE3C 2QJKC 1KQFB 1KILE 1OW6A 2YIUC 4PV1D 2OQQA 4OGQB 2FBWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 D;  2QSI A;  2D2C B;  4IL6 X;  4KT0 J;  2O01 J;  4H0L B;  3LW5 J;  1S5L X;  2ZT9 B;  4RKU J;  2WSC J;  2QJP C;  4I7Z B;  2E74 B;  5KKZ C;  1JB0 J;  4H44 B;  1VF5 B;  4H13 B;  1ZRT E;  5L8R J;  2K9Y A;  2QIW A;  4PV1 B;  4Y28 J;  2WSF J;  5KLI C;  2WPV B;  2E76 B;  2E75 B;  2QJY C;  2FYN C;  2WSE J;  3C8V A;  2QJK C;  2YIU C;  4OGQ B; 
#chains in the Genus database with same CATH topology
 4DW1 A;  3CMA V;  1ZRT D;  1NYH A;  2YC0 A;  3AEC C;  2QRX A;  1DF5 A;  1KIL B;  3H1J E;  2FTK A;  3JAT A;  1KQS O;  5HFM A;  1RF0 A;  1BCC E;  3HPL C;  3ZCC A;  2ZE6 A;  1UFI A;  3LIE A;  1Y47 A;  3CX5 D;  2JJ1 G;  2DW4 A;  2JS3 A;  4OVN F;  3HKC B;  1SQX H;  1YVW A;  1DGS A;  2GUZ A;  3KG2 A;  3WB2 A;  2OYH B;  4EDF A;  2IU0 A;  5L3G A;  3AG4 B;  2B1G A;  2OT5 A;  5JCO C;  2HLO A;  2IPP A;  1URQ C;  1OVU A;  3ZMV A;  3U11 A;  1U7J A;  5B1A C;  5C8Y A;  2R32 A;  5APV A;  2GBO A;  1M57 C;  1FZG A;  1BE3 H;  2EJR A;  3CCL P;  5APT A;  4RUE A;  1HGZ A;  2F23 A;  1GN3 A;  1PGO A;  3H1H E;  1LWU A;  1VPC A;  4D6T E;  5IYZ A;  2V7Q H;  5DEC A;  3H1K E;  1PNK A;  4ZBM A;  1FJG O;  1BZK A;  3F5H A;  2F95 B;  2ADP A;  4LF8 B;  3ZHS A;  5A2Q N;  3CRQ A;  1PP9 J;  1NTK G;  1WA8 A;  1M4U A;  3H1J D;  1NKZ B;  2WPS A;  5CA1 A;  4GKK O;  3OGI B;  1E1Q G;  1BCC D;  5H9C A;  4NPD A;  1R6K A;  1IXM A;  3OM3 B;  2QSI A;  2FXO A;  4GKG A;  3P7K A;  3P32 A;  5FLX N;  2NPS A;  1T6A A;  4GOD A;  4UCR A;  2E42 A;  2Y0P A;  1JMM A;  1QL1 A;  4TV8 A;  3L74 D;  5AW3 B;  3LDD A;  1NO4 A;  2W90 A;  3AEF C;  2GTA A;  1AR1 B;  4LF8 O;  1BGY E;  1VF5 C;  4I7Z B;  2V4H A;  3CHX A;  2DN9 A;  1XI1 A;  1FAV A;  1H0T A;  1SRY A;  3OUS A;  2PAJ A;  2N9Y B;  2WIT A;  4DR6 B;  1K9M Q;  5H5N A;  1FPO A;  5JQG A;  3K5N A;  4UB8 Z;  2KB7 P;  5KLV E;  3S3W A;  3W7U A;  2F93 B;  4IFF A;  2P6J A;  2WTY A;  1LGH B;  4DR2 B;  2HR3 A;  1NTZ E;  2LQT A;  1L8D A;  2FYU H;  1K97 A;  2EBO A;  3LSS A;  2E5L B;  1IZ3 A;  1YJN V;  5KJ7 D;  3L72 J;  1PKX A;  4IYI A;  1YCI A;  3HD7 D;  1EZV E;  3K03 A;  4TQD A;  1CSB A;  3H1H D;  2RKL A;  2MJZ A;  1EZV I;  1USD A;  4D6T D;  4ICG A;  3GLM A;  3H1K D;  4IFM A;  2Y9Z A;  1M90 Q;  3A0H H;  1OCR C;  2QIW A;  2E5L O;  1YJ9 P;  2QA4 V;  2OTJ V;  4J7Z A;  2WSF J;  3II6 A;  1KP3 A;  2MKV A;  3N27 A;  1R73 A;  2YKP A;  1KU9 A;  4QPK A;  2ZNJ A;  3CD6 V;  2Q1K A;  3GG2 A;  2JS5 A;  3ABU A;  1ENV A;  1AJN A;  1M5I A;  3GHG C;  1BGY D;  1K8A W;  4H37 A;  2QTO A;  3VQY A;  4GDO A;  2OCH A;  2UWJ E;  3SPH A;  4QE9 A;  4DV5 O;  1K05 A;  1PZQ A;  1DIP A;  5FL7 G;  4PEL A;  2K9J A;  3ZN0 A;  4RQE A;  4I50 B;  5B1A B;  2G8Y A;  5KAI Z;  1M57 B;  4RUF A;  2WLI A;  1YSC A;  1Y74 B;  3QO5 A;  1KQL A;  2DE0 X;  2EIN B;  1F4N A;  1M1J C;  2E5T A;  1JY2 P;  3OTO B;  3VP8 A;  5LMN B;  1V55 C;  4H44 D;  3RVY A;  2OIG A;  1EZV D;  2IZ1 A;  3K0D A;  4JYA B;  3HUS B;  2HEP A;  3L4F A;  5KX5 A;  3QVN A;  3CWB E;  1ARO P;  1VIB A;  2X6C A;  3Q4H B;  5AVR B;  4PJ0 Z;  1LWU C;  2JWD A;  5GON A;  4ZOL A;  2IJK A;  1COW G;  2JEX A;  1OVV A;  2ZYD A;  5LMN O;  3WB0 A;  1ZLL A;  1VQP V;  4O4L A;  1Y76 A;  4JYA O;  1ZP0 C;  5FPO A;  5LOV B;  2R5D A;  3R66 A;  3FGA D;  1AJQ A;  3L75 E;  2AGA A;  3WG7 C;  3W7X A;  2HJF C;  1K33 A;  4FZ0 A;  4BRY B;  1KMI Z;  2N74 A;  3C90 A;  1MKM A;  3B8M A;  1GO3 F;  2IZ0 A;  1EDL A;  2Z0A A;  4MTF A;  2H89 C;  3SWY A;  3Q3D A;  2R5B A;  4B3M O;  1K04 A;  3UCS C;  5BY1 A;  4I2L C;  1QVF O;  1JTH B;  4OPH A;  2Q4P A;  2KP8 A;  4UB8 E;  1SVF A;  1HTL C;  3SYQ A;  4X62 B;  1WB7 A;  4KHP B;  4X1Y B;  1J95 A;  4QGP A;  1OWA A;  1FFX A;  4L76 A;  4O2A A;  5L3D A;  2O3J A;  1TA8 A;  5CMZ A;  2XAH A;  3K5L A;  3CX5 H;  3DC6 A;  3M8A A;  2QKC A;  3TF5 A;  5KJ7 C;  3CWB D;  4LNU B;  3RL0 D;  2AZ0 A;  1OCR B;  1FAF A;  2IBZ I;  4I0X A;  3HD7 C;  4X62 O;  1P49 A;  1SQX G;  5BU8 B;  3TK1 A;  3G4S V;  3ITK A;  1EM1 A;  2P67 A;  5LYJ B;  2JP3 A;  3GHG B;  1YI2 V;  4FLZ A;  3L75 D;  4ASV A;  4JI5 B;  3J80 N;  4KL1 A;  1GW3 A;  2DQ0 A;  1MFZ A;  1JCH A;  3VTP C;  3M0D A;  2OYQ A;  3N2K B;  2VWJ A;  5LXT B;  1VEW A;  3MAQ A;  3QH9 A;  1BE3 G;  1XHX A;  3V4W A;  3HKE B;  3TXQ A;  4J42 A;  4OWF A;  1SQB J;  5L8R J;  3D36 A;  3DSQ A;  2YXY A;  2M5A A;  1IBM B;  2XAJ A;  3BFR A;  3PLN A;  3S3X A;  5L3F A;  2BSK A;  4ZKI A;  2V7Q G;  4JI5 O;  4OH8 B;  1SQV K;  1K8A Q;  1R1B A;  1M1J B;  4C7R A;  4D7S A;  3H1J H;  4YIP A;  4MT8 A;  2Z5H A;  1V55 B;  4L8J A;  5KAI E;  1BCC H;  3ETG A;  2Y69 C;  2YIC A;  4H0L C;  2ZR2 A;  1IBM O;  1L0L J;  2XND G;  4NPE A;  3L74 H;  2BCC J;  3P8M C;  1P84 D;  4EKW A;  4JI8 B;  3KQG A;  3ABM C;  1Q81 W;  4H44 C;  5C39 A;  1PPJ G;  1ZN5 A;  1JX9 A;  1QU7 A;  4EYY Q;  1KD1 W;  1X59 A;  4DR4 B;  3JSN A;  4UVC A;  4PJ0 E;  1H8A A;  1AR5 A;  3V2N A;  2FL4 A;  4JI2 B;  4IHJ B;  4HJG H;  2XAS A;  3BAS A;  3A8T A;  3K5M A;  1SQP K;  4LWS B;  3WFV A;  3EVK A;  1MZF A;  4K35 A;  3V5B A;  1JQ0 A;  4DR4 O;  4UCU A;  2FYU G;  4JPR A;  5EFW B;  1H8E G;  2PZS A;  1K4C C;  2NNU A;  3H1H H;  3SDL A;  5AVQ B;  1I7F A;  1F7Y A;  4D6T H;  1E1R G;  1WPB A;  3H1K H;  4JZG A;  5F2V O;  3A7O A;  2HG5 D;  1AI4 A;  1LP1 B;  1LTB C;  3T1Y B;  3VP9 A;  4Z1V A;  1H2G A;  5E1A C;  2KB1 A;  4JAS A;  3VOU A;  5DJT B;  1OJH A;  2XTA A;  2ITD C;  2LFS A;  1LTJ B;  1ZLZ A;  1LUV A;  3CJH A;  1IFD A;  1BL8 A;  2Y4U A;  3VOP A;  3K57 A;  2IJH A;  3SPC A;  3HD7 B;  1N7L A;  3JAR A;  1BGY H;  2P22 C;  3T1Y O;  3HE5 B;  3UT5 B;  4P9P A;  2DJV A;  3D6Y A;  2KSD A;  2GSM B;  5BXZ A;  4TV9 B;  1HNX B;  5EYP B;  3RL0 C;  2IH1 C;  1IBL B;  1YTZ T;  2A06 G;  4HYO A;  4MTX A;  3JCU Z;  2KZI A;  2WAM A;  2GV9 A;  4IIJ A;  2HLD G;  1OCO C;  3SPJ A;  3K79 A;  1HNX O;  3ZHQ A;  1HBW A;  4UFZ A;  1ZSP A;  3M0D C;  1PGQ A;  3BCC G;  1SQV E;  3HTK B;  1GN2 A;  1R3J C;  4YJ3 B;  2X0L A;  1SA0 B;  3JD3 A;  3D36 C;  3IJ4 A;  3RYH A;  1AJY A;  5EBM C;  1KOR A;  2KK7 A;  4MTO A;  2Z4E A;  2Y69 B;  2OTL P;  1GRJ A;  4JYC A;  2WT7 B;  2E74 C;  4FM1 A;  3D6Z A;  3ABM B;  4H44 B;  1S5H C;  4NR1 A;  3OD4 A;  2K88 A;  2R3S A;  1HWT C;  1HUC A;  4WVZ A;  4BWN A;  3I55 V;  2P10 A;  4FLX A;  3H1L J;  1AJP A;  3B5N D;  2ZXX A;  4CS3 A;  5AW2 B;  2FYN C;  3FXE A;  3CCM P;  1SQP E;  2EIK C;  2LJ2 A;  1FC2 C;  2AEF A;  4JYY A;  2ZR3 A;  1OW6 A;  4ZIB A;  5TJH A;  1JFF B;  4IL6 Z;  1Q81 Q;  4NXN B;  5HFL A;  2R44 A;  3G71 V;  1GTO A;  4OXS A;  3ZRW B;  4Y99 C;  1NT2 B;  1KD1 Q;  1KYO I;  1ZL8 B;  2KNC A;  4LF7 B;  3M9Q A;  1RP3 B;  1KKD A;  4U3F E;  4W80 A;  3RWR D;  5CCH A;  1SQV D;  3CWB H;  4WF9 V;  1JO5 A;  3IFX A;  2QVA A;  2A79 B;  2RMZ A;  1GU5 A;  5LMU B;  2WSC H;  4GX0 A;  4Q6G A;  2W6J H;  1RM1 C;  2DYR C;  2HG5 C;  2M7W A;  2UXX A;  4TQF A;  2N1T D;  1N0N A;  1GK4 A;  3NFQ A;  1VF6 A;  4WFF A;  3L75 H;  2UXN A;  3K59 A;  1J5E O;  1BDD A;  5LMU O;  2O01 J;  3M9B A;  5J2T A;  2AXT Z;  2B1I A;  3RL0 B;  3Q5R A;  1U57 A;  1JCD A;  1OFC X;  3FWL A;  3DTU B;  1N8R W;  1SQP D;  1UIX A;  2W6B A;  2BEQ D;  4O2B B;  1DTO A;  2KI7 B;  4UB8 H;  5AVS B;  5EBL C;  4AQY B;  3JCU E;  4K3A A;  1JNM A;  2QWP B;  3QG5 A;  4B3S B;  2B87 A;  1YQ4 C;  4I55 A;  1BCC G;  3L71 J;  4U3F D;  4JI1 B;  2GUV A;  1F23 A;  3E2E A;  1S5L Z;  1S4X A;  4RJT A;  3KDP B;  1P84 H;  3JAK B;  2FFD A;  1HJB A;  3TXS A;  4X20 B;  5K1X A;  4DR3 B;  1GM9 A;  3T1H B;  3O6Q B;  4O4I A;  4B3S O;  5CJ0 A;  2UU9 O;  1EDJ A;  3H32 A;  4FFB A;  1BSM A;  4MVO A;  1NBM G;  1KN7 A;  3TJT A;  4O4J A;  1IJD B;  1KIL A;  4UCS A;  4EFB A;  3T1H O;  3NTN A;  4BW9 A;  1W5C E;  2FYN B;  1EC5 A;  2EIK B;  4DUZ O;  4LF9 B;  2L6L A;  4YY3 B;  2Z3Y A;  3C9I A;  2ZIN A;  2OTK E;  2PY5 A;  1RY3 A;  1K3E A;  3FX7 A;  1TUB B;  2ZXW B;  1BQZ A;  2NLJ C;  3K9S A;  4B3R B;  1S5L X;  1W59 A;  3HKC A;  2XNX A;  3AE7 C;  3OT7 A;  5LGN A;  1BSN A;  3B5N C;  3CS5 A;  1Z5V A;  3IF4 A;  2QWN B;  1VQ8 P;  4IL6 E;  5KAI H;  2K9P A;  1FDI A;  1S0V A;  2OYH A;  4YY3 O;  5LP6 B;  2IJI A;  2ODM A;  2Q68 A;  4F6E A;  1Q86 W;  4B3R O;  1HNZ B;  1SP4 A;  1PPJ E;  4LFB O;  4UV9 A;  5AVY B;  4L75 A;  1VQ9 P;  1AB3 A;  1QLE C;  5IYD O;  2CPS A;  4FLT A;  2XU6 A;  4PJ0 H;  1KTM A;  3DXR B;  4DV4 O;  1JR9 A;  2G3A A;  5KLV G;  3BVH A;  4R4M A;  1HNZ O;  2EIL C;  4PD4 E;  1TU3 F;  1PNM A;  5ITZ B;  1PNL A;  3TGU J;  1KYO F;  1VF6 C;  4YJ2 B;  1XNQ O;  4G27 B;  1NTZ G;  2W0F C;  3KKY A;  1T2K C;  3OTF A;  5IY5 C;  4WFH A;  3RN4 A;  2XKM A;  3HKD B;  4LFC B;  2AXT E;  1EZV G;  3W68 A;  3LSU A;  5EK0 A;  2BTO A;  3T1C A;  2QM4 A;  1H2N A;  1NTM J;  1Q3E A;  1OVR A;  4NTX A;  2GM4 A;  1N8R Q;  1YIJ V;  2F4V B;  4L74 A;  3P8C E;  3SGI A;  3CC2 V;  3O65 A;  4LFC O;  2R3C A;  1NZ6 A;  4FMT A;  3GF3 A;  1WPX A;  2WLK A;  1PPJ D;  1TUE B;  1HGV A;  1S5L E;  3AE2 C;  5LHI A;  1VQ7 P;  2ZT9 D;  2FFD C;  3FD9 A;  1LTG C;  2A06 E;  2XT9 A;  4JI7 B;  5AVT B;  3L35 A;  1YIT P;  3MD0 A;  3FAV B;  3ZHV A;  2CH7 B;  4PD4 D;  3HE4 B;  3T4D A;  1AR4 A;  1KB9 I;  3LUT B;  2JKV A;  3M99 B;  1NAY A;  1Y4M A;  1H2S B;  1KIL C;  2Q0O C;  4TUY B;  2IFM A;  3BCC E;  4MVZ A;  1JM0 A;  4JI7 O;  3ZDM A;  1SQV H;  1DD4 A;  1R6N A;  1KFM A;  3B5N B;  2JRI A;  2QKA A;  3B8E B;  1RF1 B;  3LW5 H;  4HYT B;  1YEW A;  3CCR P;  2ZAE B;  1NGM B;  5AW4 B;  5KHG A;  3CLQ A;  3P8C D;  3L36 A;  4I50 A;  4YTP C;  2GTS A;  2OYH C;  3JD0 A;  4KHX A;  1Y74 A;  1HNW O;  1NH2 D;  1LTS C;  3L75 G;  1LTT C;  3RBZ A;  4JQ0 D;  4DW0 A;  4CZZ A;  4DR7 B;  3HUS A;  4JTD B;  1SQP H;  2A06 D;  5CBH A;  5KAF Z;  1L0N G;  1Q86 Q;  3L73 J;  3Q4H A;  4X1I B;  1W2B U;  1VQL P;  5JH7 B;  4DV6 B;  2N1T B;  1GU4 A;  4JI0 B;  3GMA A;  1LTI C;  3E1I A;  3KHU A;  3PHL A;  1GK9 A;  4HKZ H;  2ZKO A;  4DR7 O;  3BCC D;  4XE5 B;  3BRT B;  5LOV A;  1DEB A;  3OMI B;  2YMY A;  4GOE A;  2IBZ G;  4BRY A;  4JI0 O;  2H3O A;  3RVZ A;  4DRX B;  2FKW B;  3I56 P;  3CCS V;  4DUY O;  5DM6 V;  2PUS A;  1XMO B;  1HWY A;  3B09 A;  4FM0 A;  1JTH A;  2J58 A;  4DR5 B;  4I9Q A;  5KLV K;  3O8Z A;  4PD4 F;  5K1P A;  4HAM A;  1FZE A;  2ITA A;  1NTZ K;  2X7R B;  2P1J A;  5J2U B;  1THZ A;  4CS4 A;  1N33 B;  4LNU A;  1L4A D;  4GOF A;  4AYC A;  1J2J B;  1DD3 A;  4CH4 A;  4QJF B;  3U10 A;  4PDM A;  4OGQ D;  3UIA A;  5LL6 Y;  1OCC C;  2HP8 A;  4EFE A;  2HPC B;  3STZ C;  1R6T A;  3GWO A;  5JJE B;  5LYJ A;  3D3Q A;  3EFF K;  3MHH C;  3GHG A;  2O1K A;  2BAS A;  3AE1 C;  3T2M A;  3RL0 g;  5APU A;  1Z5W A;  3N2K A;  1OZH A;  3H1I G;  5LXT A;  1RPR A;  3HKE A;  5AW0 B;  2XDJ A;  3G6B A;  1VQ4 V;  3K9A A;  5BZB A;  3VYI A;  2DMX A;  4MS2 A;  3OGC C;  3THO A;  4CC6 A;  5CA0 B;  1DEE G;  1M1J A;  1SQB E;  1KB9 F;  3OR7 C;  2EUL A;  4BWA A;  2A45 I;  3AK3 A;  5IJ9 B;  3M0A A;  4PA9 A;  3SYC A;  2A3Q A;  2EZP A;  4DV7 B;  2EIN C;  4A5U B;  2PP6 A;  3AG3 C;  3VQV A;  2HKO A;  3HUS C;  1RE4 C;  5KAF E;  2JGD B;  1D2D A;  1R5L A;  2QE7 H;  3OFN G;  1L0L E;  2PI5 A;  4IL6 H;  1KBH A;  2BCC E;  3K06 A;  2QKS A;  1IUR A;  1MFT A;  3UKM A;  1S2E A;  3JD1 A;  4IHJ A;  1SET A;  2WPR A;  2XND H;  2IJJ A;  1RHZ B;  4DT0 A;  4LWS A;  2WZ7 A;  3W67 A;  2B9Z A;  2PFX A;  2Q0A A;  2ZE7 A;  4K8Z A;  1AQT A;  1PPJ H;  4HZ3 A;  1MG1 A;  1V9P A;  2FYU J;  4B86 A;  3RYF B;  5CBN A;  1L0N K;  1LP1 A;  4PD4 H;  4MVR A;  2Q6A A;  4FZ1 A;  1NR7 A;  3WB1 A;  1AI7 A;  1SFC D;  4PV1 D;  1HW7 A;  1LTJ A;  3JAL B;  1X22 A;  5KJ7 A;  4DR6 O;  4AUW A;  2AXT H;  1YBK A;  5JVD B;  2ZT9 B;  3B2E E;  3HD7 A;  3IFM A;  1S77 D;  1OHH G;  1SQV G;  3HE5 A;  4DR2 O;  3UT5 A;  1WP7 A;  2EJ7 A;  2C0W A;  1OCC B;  3AK1 A;  4TV9 A;  4J41 A;  1AA0 A;  2BCC D;  5EYP A;  4DR1 B;  1U7M A;  4N78 E;  4GLX A;  3E8G A;  1VP7 A;  5FNV B;  5GTH Z;  4ZI7 B;  5J9P C;  1G2C B;  4GX1 A;  4O9B A;  4BR6 A;  5AVW B;  1SES A;  1NVO A;  2CPB A;  5AW8 B;  4IOI H;  3IC7 A;  3RYC B;  3FYE B;  5IYB O;  3LSQ A;  3K08 A;  1F51 A;  1UJW B;  2A06 H;  2XHB A;  3A0R A;  3HTK A;  4RKU J;  2YDE A;  4YJ3 A;  5KLV D;  1SQP G;  3V2Q A;  3CXC U;  1SA0 A;  5GW7 A;  4WFE A;  4JBZ A;  3AK2 A;  1NOH A;  3D71 A;  4TWK A;  2W6A A;  5APW A;  1FD9 A;  2RQ6 A;  2YKQ A;  1NTZ D;  4Y28 J;  2QGN A;  3CC4 V;  2Y0D A;  2WT7 A;  2YNY A;  1NH2 B;  2KLV A;  3BCC H;  3ZHR A;  3AG3 B;  2MK3 A;  3LNM B;  2BE3 A;  3SPI A;  4DV2 B;  2VQE B;  3CCU P;  4U3F G;  1JY3 N;  4RO0 A;  2C2A A;  2WLM A;  2QEX P;  1XUQ A;  1JEK A;  4JTC B;  1USE A;  1M93 A;  2POH A;  1N34 B;  2PRR A;  2JJ2 G;  1S3J A;  3CEI A;  4QE7 A;  4BIZ A;  4AHC A;  3KCY A;  3OTO O;  3OMA B;  4DV2 O;  4N78 D;  1JOC A;  3MGN A;  5KKZ C;  2D2C D;  3H1L E;  1JFF A;  2ZDI A;  3BAB A;  1FE6 A;  1Z56 A;  2IU3 A;  3ZRW A;  4J10 A;  4KFM A;  1ZL8 A;  3CME P;  5CCG D;  1LT9 C;  3SFD C;  1GL2 D;  1L0N E;  1DH3 A;  4UUJ C;  4DO2 A;  2P4V A;  3SJC C;  1S72 V;  2GDS A;  1IC2 A;  3EFG A;  1QBZ A;  5K5G B;  1JVM A;  5EBW C;  2UXB B;  1J1E B;  2N9B A;  4BW5 A;  3FFQ A;  2LR2 A;  2ZE8 A;  1CI6 B;  3AG1 C;  1CXZ B;  2OIE A;  1EBO A;  1GDT A;  2GA1 A;  3JD4 A;  3D70 A;  1LTJ C;  1NJI W;  1Q2N A;  4Q20 A;  3UO3 A;  2IBZ E;  1ZAU A;  3BHP A;  5DN6 G;  2UXB O;  1M56 D;  3MP7 B;  3V4Q A;  1VQK P;  2WA4 A;  4CH6 A;  1L4A B;  4RAI A;  3SJA C;  4KHP O;  3FB7 C;  1KQF B;  3A2A A;  2Q7C A;  2OQQ A;  1B06 A;  2P7J A;  4OGQ B;  2ZD9 A;  3ZIA G;  4O2B A;  2HOD B;  4I6M C;  1SZX A;  3N4X A;  4P9O A;  2P5O A;  3AED C;  3H1L D;  2X6B A;  1W0K G;  3ZRV A;  4ABM A;  1Z2G A;  2ATK C;  4EEQ A;  5GTH E;  1M9N A;  3BY6 A;  3CE2 A;  2QWQ B;  4P2Z A;  1AI6 A;  1YF2 A;  1W2B O;  3H1J J;  4FVM A;  3M7M X;  1OMI A;  1L0N D;  4LLH A;  4D6T G;  2K9Y A;  3JAK A;  1QX8 A;  4X20 A;  4TLF A;  1N73 C;  3CCV V;  3L71 E;  1QCE A;  3O6Q A;  4LC1 A;  4C7N B;  3L74 J;  1QR9 A;  1OV9 A;  2QE7 G;  3C3S A;  1S5J A;  1BSH A;  4GX5 A;  3CCE P;  4JI3 B;  2E3C A;  5IT9 N;  3JCZ A;  2M3E A;  1FS0 G;  2WQY C;  2WSE H;  2YUA A;  2IBZ D;  1SQG A;  3ZMU A;  1XTC C;  3H1I E;  3JSV C;  5CJ4 A;  3WU2 Z;  3R2P A;  3E8B A;  4B3T B;  4RO2 A;  1IFP A;  3GVM A;  5KKZ B;  1MZE A;  3VMX A;  4JI3 O;  1P4R A;  2RJZ A;  4J11 A;  4WWI A;  1TUB A;  2ZVN B;  3H1H J;  1QGK B;  3CCQ P;  1XMQ B;  1I5X A;  3RK3 E;  5B3S C;  4J7K A;  3H1K J;  4JI8 O;  1YJW P;  1WJZ A;  3ICX A;  1LT9 B;  3J7A U;  2FML A;  2ZDI C;  1SQQ J;  3A3Y B;  3A0B Z;  2D2C C;  4B3T O;  5LP6 A;  4F6R B;  1VAR A;  2YSU B;  3T97 B;  1N7S D;  4JI2 O;  5LA6 B;  3JAW A;  1PP9 G;  1Y9B A;  2IYP A;  2P58 A;  2KIK A;  1AIL A;  1XMQ O;  1WA8 B;  1GL2 C;  5KAF H;  3Q2Y A;  3L71 D;  1DF4 A;  1O9G A;  1OCZ B;  3AG1 B;  1BGY J;  5TIS Z;  2BCC H;  2O01 N;  1SFC B;  3DXR A;  4PV1 B;  1FYJ A;  3G3Z A;  1YIT V;  5KHH A;  2Q7H A;  1D5A A;  1K5S A;  1JY3 P;  2A0L A;  4JTA B;  4EI2 A;  3M9H A;  2OYI C;  5ITZ A;  3H1I D;  1HDJ A;  1JOY A;  2IDB A;  4EIJ A;  2YXL A;  3HKD A;  3TGU E;  2VRZ A;  3E22 B;  1M56 C;  5KLV H;  1NJI Q;  4XA4 A;  1NWQ A;  1G8M A;  3RK3 D;  3L72 G;  5FPR A;  3L70 J;  4HH2 A;  1NTZ H;  1NI8 A;  3CCR V;  3CC7 V;  4UCT A;  1T3J A;  3JC2 2;  1NKD A;  4JV5 B;  3PJS K;  1H89 A;  2R9I A;  2YEV B;  4K0K B;  1EZV H;  4X64 B;  4U3J A;  1IBL O;  1MAB G;  1N73 B;  4UVA A;  3F5T A;  4L87 A;  1PGP A;  4W7Z A;  1CZQ A;  2E76 D;  3K04 A;  4JV5 O;  3K5O A;  3FAV A;  3RBX A;  2CH7 A;  2P4K A;  3H01 A;  1VQL V;  4R7C A;  3KYQ A;  3HE4 A;  1T3U A;  2KXP B;  2W0X A;  1A32 A;  3B4S A;  3ZS8 C;  2RH0 A;  3AG7 A;  3G80 A;  4TUY A;  4YHH B;  1FFT B;  2WSS G;  3RFR A;  1A02 J;  3SJB C;  1XL4 A;  3WU2 E;  2Y4T A;  2ZJS E;  4H13 D;  4JI4 B;  3B5N A;  3TGU D;  1IFM A;  2BOC C;  1EN6 A;  5B3S B;  1RF1 A;  4MW8 A;  3RYI B;  2M6Y A;  1SS1 A;  2XUM A;  2DW3 A;  4LFA B;  5C93 A;  3CWB J;  2D2C B;  4WY4 D;  1YJN P;  1KYO E;  3OAK A;  2ZXW C;  4IFD K;  3APO A;  3CB2 A;  4N23 A;  1NH4 A;  1N2D C;  2C9N Y;  4YHH O;  1P7B A;  2PYJ A;  2AEM A;  1NVP D;  4LCU C;  2ITC C;  3AG2 B;  3A0B E;  3ABT A;  1NU1 J;  5EZY B;  5LP6 C;  1GL2 B;  2V1D A;  2BEZ F;  5AW7 B;  4LH7 A;  5AW5 B;  2MW2 B;  2ARH A;  3KPE A;  5GON B;  4NXN O;  2RN0 A;  4BXL A;  2QA4 P;  3E89 A;  1K7D A;  5EIB D;  2OTJ P;  1N7S C;  2ZM6 B;  1KC8 W;  1Y76 B;  3G6E V;  2WWW A;  4MW3 A;  4Z2W A;  2AXC A;  3CD6 P;  4LF7 O;  3MHS C;  4I4T B;  5TIS E;  1AQ5 A;  4X1I A;  2PGG A;  4F4L A;  2OYI B;  3H1L H;  5JH7 A;  2OAR A;  2B5U A;  2JJL A;  1J1D B;  2N1T A;  2IH3 C;  3IR9 A;  2KZJ A;  4JYB A;  3L73 E;  3OW2 U;  2R70 A;  4CH3 A;  2WLL B;  3S1K A;  4DV3 B;  1M56 B;  1IXB A;  1L0N H;  2ZIM A;  4HNA B;  5D5P A;  5LHG A;  2Q7G A;  2PYL A;  1KFN A;  2B89 A;  4J80 A;  2JVD A;  4WFG A;  1B3Q A;  1LJ2 A;  4LF4 B;  1VQN P;  4NTY A;  1IO4 A;  4G2K A;  2YXQ B;  3L9D A;  1N0J A;  2YIB D;  4DRX A;  2KKW A;  1KYO D;  1SZT A;  1FJP A;  5CBO A;  1TVK B;  3CPW U;  3UO2 A;  1GAX A;  3JYC A;  5B66 Z;  5L3C A;  3RK3 C;  3QF7 A;  2UXD B;  1XRE A;  2IBZ H;  3BVO A;  3B8N A;  1QNM A;  4AQY O;  3CCL V;  3CCJ P;  2CTR A;  4ZHQ B;  2QJP B;  2KS1 B;  5J2U A;  3D3I A;  3QO7 A;  2EZO A;  1KP2 A;  3C1L A;  4JI1 O;  5BU5 A;  1ZV8 A;  4DXW A;  5KUM A;  1IBK B;  1SQB G;  5GTH H;  4DR3 O;  3ZED A;  5KMG B;  5IWA B;  3L73 D;  3FX0 A;  2HPC A;  5JWP A;  1KKC A;  1Q82 W;  2I1K A;  1MZ9 A;  4GZR B;  1R8E A;  4UXN A;  5B1N A;  3IN6 A;  1QHT A;  3MUD C;  4E2L A;  1R3L C;  5IJ0 B;  1IBK O;  1RF1 C;  1UII A;  2L91 A;  1L0L G;  4E4E A;  4BAY A;  1TAE A;  3VMZ A;  4LF9 O;  2BCC G;  3E8F A;  2Q5U A;  1FS0 E;  1H2M A;  4ASU G;  1PIX A;  4WY4 C;  5CA0 A;  1XIL A;  4WFB V;  3U59 A;  1N7S B;  3H1I H;  5IJ9 A;  3NMD A;  3G4S P;  2P7T C;  1FZC B;  4X8A A;  4JAA A;  4K8X A;  3USS A;  1FZA A;  1M8O B;  2E75 D;  1JUN A;  1PGJ A;  4LBE C;  3AE4 C;  3G67 A;  2ZCE A;  3MZW B;  3N2G B;  1YI2 P;  3EXA A;  5EIB C;  2OYO A;  2YS8 A;  3OAA G;  1EN5 A;  4DYL A;  2JGD A;  1XOU A;  4C46 A;  1KC8 Q;  1YJ9 V;  2H94 A;  1NTK J;  3B71 A;  2N1T C;  4L73 A;  1LR1 A;  2AEJ A;  1PP9 E;  4ZKU A;  3S9O A;  5APS A;  5CN0 A;  1SLQ A;  4NPF X;  2KSE A;  1MA1 A;  1K4D C;  1I94 B;  4I5S A;  2Q7E A;  1PL4 A;  4PA3 A;  4FM2 A;  4IGG A;  3RK3 B;  3SWF A;  2AHZ A;  3TNU B;  1SKV A;  1ZUQ A;  3RYF A;  3P3N A;  2E43 A;  1G1J A;  4JI6 B;  3OJA B;  5B66 E;  1VMG A;  1I94 O;  2PTM A;  3JAL A;  3NR7 A;  1YQ3 C;  3AE9 C;  2E76 B;  3ABL C;  5JVD A;  3CCU V;  3TGU H;  4DV1 B;  2F4V O;  3V2R A;  4W4L A;  1BMF G;  1NQT A;  3QO8 A;  4LR3 A;  4LH6 A;  2QEX V;  3L72 E;  1ORQ C;  1KB9 E;  3TDK A;  3RW0 A;  4I1L A;  1E5W A;  3F5W C;  4U7N A;  1AP6 A;  3ZN1 A;  1MMM A;  4NVP A;  4GX2 A;  4N6J A;  3RK2 D;  3RGU A;  3M91 A;  5FNV A;  3VMA A;  4ZI7 A;  1G2C A;  1PP9 D;  1ZOY C;  3DGE A;  2Q6Q A;  2XZR A;  4XFJ A;  2J5U A;  3D8C A;  2DYS B;  4H13 B;  3S4R A;  3IAO A;  2JWA A;  3P3P A;  4PA6 A;  5AW1 B;  3GB7 C;  1Q82 Q;  4W4K A;  4WBA A;  5CHX A;  4WY4 B;  3IC9 A;  2BTQ B;  2HVK C;  3K3W A;  5KUK A;  2LKM A;  3WUT A;  3U1A A;  2QJK C;  1Y67 A;  3PP5 A;  1NVP B;  4P30 A;  1XHZ A;  2H8P D;  2ZXE B;  3SYP A;  2AHY A;  1WAZ A;  1Q90 D;  2FXP A;  3GF7 A;  3H1L G;  1H88 A;  2PGD A;  2VQF B;  1KV4 A;  1QR8 A;  1SQB K;  3AE8 C;  3WU2 H;  1RE4 A;  2QJ1 A;  3K0G A;  5A9G A;  4FJC C;  5AG2 A;  1URQ D;  3L72 D;  2E75 C;  3ZRX A;  1KB9 D;  1VQK V;  1KYO H;  2JDI H;  3KCX A;  3ASO C;  1RSO B;  4IT5 A;  1L0L K;  4U3F H;  2N04 A;  3A0B H;  3E8H A;  3F7Y C;  1VF7 A;  2CGO A;  1GD2 E;  1VQ5 P;  4DV6 O;  3WMM 0;  1URF A;  1FXK B;  5KHI A;  4OX9 B;  2WA3 A;  5CMU A;  4CC5 A;  3N7N A;  3SYA A;  1KUQ A;  4X9Q A;  2F1M A;  5TIS H;  1Y6X A;  2UUB B;  1GN6 A;  2PI4 A;  3G9R A;  1FXH A;  2F43 G;  1HJ0 A;  2ZYA A;  2R9A A;  1SQQ K;  3RGB A;  1IVS A;  1VF5 D;  3L73 H;  4OX9 O;  1CI6 A;  4PDL A;  4X1Y A;  1G4Y B;  3ABL B;  2UXC B;  3CCE V;  4YXW G;  3R4Y A;  1P7G A;  3CX5 I;  2YIU B;  1XMO O;  3ZMS A;  2UUB O;  4X88 A;  1E79 H;  4X1K B;  5APQ A;  4R8C A;  1XDC A;  5IYC O;  1WP8 A;  4DR5 O;  2ZT9 C;  5H2F Z;  1L4A A;  4XDJ A;  5EC1 C;  3L71 G;  3VQW A;  1XL6 A;  1VL2 A;  1SF9 A;  2UXC O;  3JCU H;  1W2E A;  4TT3 G;  5B5E Z;  1SQX J;  3AE6 C;  2HOD A;  2VWK A;  1H38 A;  4N3Y B;  5JJJ B;  1K5Q A;  1N33 O;  3GW6 A;  4X89 A;  1YJW V;  2V4D A;  1MSD A;  1NS1 A;  1V54 B;  3RK2 C;  1GKF A;  4WBN B;  4PI0 A;  4DV0 B;  4YXD C;  3SR2 C;  2JK5 C;  3E86 A;  2W8Z A;  2QJK B;  2B88 A;  3CRA A;  1BE3 J;  1VQM P;  1Q6H A;  4O4J B;  4MTG A;  3OW2 O;  1K34 A;  4C7N A;  3QTC A;  2V7Q J;  4DV0 O;  3CL3 D;  2DWD C;  3E1R A;  1GH6 A;  4X65 B;  2FXM A;  2H8P C;  3L74 E;  2AW9 A;  5BMV B;  4QPJ A;  1S9K E;  2E75 B;  3B77 A;  3CPW O;  1G1I A;  3AEI A;  3W7S A;  1GZL A;  2WLN A;  3MDS A;  3ASO B;  4LP8 A;  1VDF A;  2Q9I A;  3E35 A;  1FBM A;  1JMK C;  1FOS F;  1FDM A;  4X66 B;  4X65 O;  1FZB A;  2WPQ A;  1ZR4 A;  4DV7 O;  3AEG C;  2Y48 A;  1FJG B;  4UB6 Z;  1R3I C;  1PV0 A;  3KZI Z;  1N4C A;  1HP8 A;  1AVO A;  4PHZ A;  1LT9 A;  3Q1M A;  1PM9 A;  4GKK B;  1HH0 A;  3QNE A;  2YO2 A;  1BT8 A;  1LTA C;  1IDS A;  2R9R B;  3ZMT A;  4F6R A;  4X66 O;  4R6Z A;  1HF9 A;  3T97 A;  2JEU A;  2Q3I A;  5LA6 A;  2Y0I A;  1SQQ E;  5APX A;  3TGU G;  2W6I G;  2JEE A;  5AVX B;  2LW7 A;  4HBN A;  5M1B A;  1JJO A;  1SQB D;  2LO1 A;  2NPS D;  3ABV C;  1SFC A;  2QWR B;  1J1E C;  4JAV A;  2OTL V;  1KZU B;  4JF3 A;  3ZHT A;  2NN4 A;  2KQX A;  1NU1 K;  1I0H A;  3GWK C;  1PP9 H;  3H9V A;  2L5G B;  4Z1M G;  2K1A A;  1S9K D;  1NTM G;  2YI9 A;  4DK1 A;  2HFE D;  3I5C A;  2YXH A;  1XNR B;  3SFE C;  3ETE A;  2EIJ B;  1L0L D;  3U1C A;  3MHV A;  5H2F E;  3CCM V;  3E22 A;  3TET A;  1L4A C;  3F89 A;  1I5Y A;  3A5T A;  2RMK B;  2K37 A;  3JAS B;  4WCE V;  5B5E E;  5B66 H;  3RK2 B;  2EX3 A;  4OGQ C;  3ZBH A;  4O4H B;  2KOG A;  1XNR O;  3A2F A;  1S5L H;  2JR8 A;  2YEV A;  1MUU A;  2KG7 B;  1PD3 A;  2QM8 A;  3CX5 F;  5LGU A;  3L70 E;  1X4T A;  4DR1 O;  3IGA C;  2JIZ G;  1N73 A;  3BCC J;  1SQQ D;  2ZVO B;  2ZIO A;  3L72 H;  1KB9 H;  4XDL A;  3O9O A;  5KHK A;  2SPZ A;  4DV5 B;  2E5Y A;  4B7K A;  2WPV B;  1G1X B;  1ROP A;  2JDI G;  4CH5 A;  1RF0 C;  1QVG U;  4DJG A;  4TOI A;  3AEA C;  5AW9 B;  2WSF H;  1VQ6 P;  4JPZ B;  4EB6 B;  3OEE G;  1WMK A;  1URQ B;  2Q69 A;  1YIJ P;  1EDI A;  1QL2 A;  3CC2 P;  1Q5O A;  2H7H A;  1RH5 B;  3M06 A;  1RFY A;  2VQE O;  1VQN V;  1H2K A;  3RYI A;  4H0L D;  1WLE A;  1ZX3 A;  2QTS A;  5BVZ A;  4UB6 E;  1YTF B;  3KZI E;  2QR4 A;  1N34 O;  2LXB A;  4GT1 A;  2OWO A;  2WSS H;  3L73 G;  1OW8 A;  5IDJ A;  2D3O W;  3AE3 C;  3HRN A;  4ZNC A;  3FKS G;  3L70 D;  3P30 A;  5CCG A;  1NHL A;  5EZY A;  4FLY A;  5JJN B;  2UUA B;  4FFK A;  1GL2 A;  1OXZ A;  3I5D A;  1G6U A;  1Q43 A;  2CTW A;  1E79 G;  5CB4 B;  4A7P A;  2ZNI A;  2Y9Y A;  1JY2 O;  3CCJ V;  1NU1 E;  2RN9 A;  1OCZ C;  3SSU A;  2XAQ A;  4I4T A;  4UCV A;  4B3M B;  1VF5 B;  5D5Q A;  2OYI A;  2WPD G;  3CRC A;  2UUA O;  1SFC C;  4PV1 C;  2LGQ A;  2NPS C;  2ZE5 A;  4MVS A;  3CI9 A;  2QG4 A;  1H8H G;  3ZMZ A;  2CUG A;  2WLL A;  4HNA A;  2IW5 A;  3OE7 G;  3H6P A;  2Y0E A;  3SPG A;  2HFE C;  1HR0 B;  3PTZ A;  2FYZ A;  3HKB B;  1RQV A;  1WB8 A;  2BOB C;  4PDR A;  2CDY A;  1NTK K;  4FLU A;  1TVK A;  1VQ8 V;  4FK5 C;  1YHQ P;  2EIM C;  3B40 A;  1K73 W;  5BR8 B;  2CTQ A;  3TYY A;  1AVY A;  1HR0 O;  3ETQ A;  1P84 E;  1BCC J;  1S1C X;  1P84 I;  4MVU A;  2LP7 A;  3WUV A;  2RDC A;  1NTM K;  2WSE J;  3EHB B;  1XTG B;  2KUB A;  2AZ2 A;  4DOJ A;  3JAT B;  1NU1 D;  1VQ9 V;  4ZHQ A;  1OW7 A;  2XV5 A;  2KS1 A;  2ZFC A;  2RCV A;  5BR8 O;  4XDK A;  3JD2 A;  2H88 C;  3W7T A;  1DX7 A;  1RQU A;  4KT0 J;  3RT3 C;  2KYV A;  1GMG A;  3SYO A;  3BEH A;  3U0Z A;  3ZHU A;  1T5E A;  5KMG A;  4FLV A;  3CCS P;  2Q67 A;  2GUZ B;  2LGW A;  1VQO P;  1EFR G;  4WFA V;  1ZW0 A;  2CGN A;  2WLH A;  1WT6 A;  4MN4 C;  1X79 B;  3LID A;  2JGU A;  2E74 D;  5IJ0 A;  3MIW A;  5C8Y B;  2A45 H;  1SQB H;  2QDO A;  4D6T J;  1WN7 A;  3Q5S A;  1GN4 A;  2WMM A;  1RPO A;  5AW6 B;  4OPA A;  4AQR D;  1LWU B;  4R4L A;  5IYZ B;  5KA5 A;  1IX9 A;  4CBC A;  3V6I A;  3CMA P;  1WRG A;  4QMA A;  1H2L A;  3AG2 C;  2XAF A;  1N7S A;  1Q6U A;  1R3K C;  5CCG C;  2XOK G;  1FZF A;  5H6Q A;  1JB0 J;  4R50 A;  5CA1 B;  5AVV B;  1FZC A;  1L0L H;  5DED A;  1VQ7 V;  3WG7 B;  5LGT A;  2HVJ C;  4JZ2 A;  3N2G A;  2NPS B;  1KEC A;  1B04 A;  4TV8 B;  4DCK A;  2YXR B;  5KLV J;  1A02 F;  1FKA O;  3EQ2 A;  4YJ2 A;  3SWK A;  3LDC A;  1J1D C;  1H0T B;  1NTZ J;  5GTI Z;  3AEE C;  3HR0 A;  5JQG B;  3STL C;  2CTP A;  1VQ4 P;  5DJU B;  4QIW F;  1NTK E;  1SQQ H;  2GUS A;  2I8D A;  3CXH E;  4JF7 A;  3PN1 A;  3ML0 A;  2YID A;  5E79 Z;  2NZ2 A;  3CXH I;  2EIM B;  3NXS A;  3X2Q C;  2HHH B;  5KA6 A;  5H6R A;  2JO1 A;  1ZR2 A;  2QM7 A;  3R65 A;  3J81 N;  5B1O A;  3TNU A;  3JAM N;  1US6 A;  3H25 A;  5EC2 C;  3CRR A;  1NTM E;  2ETN A;  3FB5 C;  2A9H A;  3W7W A;  2HHH O;  2IYO A;  5LBQ A;  4ZMD A;  4BIO A;  1K73 Q;  1JY3 O;  5H2F H;  4WB4 A;  1ZXG A;  4K0K O;  4NKG B;  2KLU A;  1R5S A;  4X64 O;  2HYN A;  2QJP C;  5B5E H;  1ZWI C;  1FXV A;  3V2P A;  1Q7Y W;  1D5N A;  1B6Q A;  1O9H A;  1U96 A;  1GW4 A;  3AE5 C;  2QWO B;  4UV8 A;  3L70 H;  3MUD A;  4FPP A;  2K9J B;  2C9L Y;  1P84 F;  2IX7 C;  1NTK D;  5B1B C;  3CXH D;  1X8Y A;  2W27 A;  1VQ5 V;  3LDE A;  1PFI A;  2WLI B;  2ZQM A;  1EXJ A;  2Q9L A;  4KXR A;  4H0L B;  3I56 V;  4CS2 A;  1SQX K;  4U7O A;  4WY4 A;  2BTQ A;  1LT1 A;  2Q73 A;  2I1J A;  4PDV A;  1CEZ A;  2WSC J;  2Q8V A;  3BA8 A;  5KX5 B;  4JI4 O;  1DLB A;  4KP4 A;  1NTM D;  2RNB A;  3IAY A;  3LNN A;  3PH0 A;  3VQX A;  4UCO A;  2WLJ A;  4LFA O;  4ZOL B;  3L75 J;  4HB1 A;  4I9W A;  4O4L B;  1BHA A;  5APY A;  1QLN A;  1FZC C;  3KXD A;  2ILM A;  4PA7 A;  1L0N J;  1N32 B;  1AVM A;  1AI5 A;  4AI8 A;  2CK3 H;  1JMB A;  4UB6 H;  1OZ0 A;  3BPZ A;  2PF4 E;  3KZI H;  5CCH D;  1RSO A;  1Q8I A;  3CSX A;  1YTZ I;  1SC5 B;  2ZM6 O;  2M0B A;  2Y0C A;  2OCC C;  1QLE D;  1BDC A;  3E83 A;  1KQS U;  1FDO A;  1J5E B;  2FKX A;  3FB6 C;  1MV8 A;  1HVV A;  5GTI E;  1N32 O;  4LF5 B;  3X2Q B;  2VRS A;  3CC4 P;  1FXK A;  3OUF A;  1NU1 H;  3QWO C;  1QVG O;  1EZJ A;  1FFX B;  5E79 E;  4O2A B;  2YIB A;  4MVQ A;  1KIL E;  1VQM V;  1GM7 A;  4NXM B;  4DV3 O;  1T2K D;  2ADQ B;  1DK1 A;  3SJQ C;  2FBW C;  4IL6 X;  4GUN A;  4KUM A;  4LF5 O;  4LF4 O;  1Y66 A;  4I0X B;  2HJD A;  1CPY A;  4H33 A;  3K5B A;  2FB5 A;  4J9Y B;  1IK9 A;  1RE3 A;  3BAA A;  2FYU K;  2K1E A;  2M8R A;  1VQP P;  4NXM O;  1SS3 A;  1YXB A;  3A0H Z;  2O01 H;  4X1K A;  3ASN C;  2Q3E A;  2UXD O;  2E76 C;  2J59 M;  1OCO B;  2Z5U A;  3CXH F;  1N36 B;  3H1J G;  4EOT A;  1SER A;  2X6A A;  1NR1 A;  2A45 G;  2UU9 B;  3HB3 B;  4YXW H;  4RQF A;  1S72 P;  2YMK A;  1GTW A;  2H43 A;  5B1B B;  2M5A B;  3L74 G;  2BSK B;  1N36 O;  1YDX A;  1SQX E;  1GK6 A;  1WNS A;  1EDK A;  4WBN A;  5IE9 A;  1Q7Y Q;  3WUU A;  3L71 H;  3ZX6 A;  2DYS C;  4DUZ B;  1PV3 A;  2E74 B;  3UM7 A;  4H13 C;  5IWA O;  3H1I J;  1ZTE A;  3ETD A;  4TT3 H;  1KIL D;  4YIO A;  1XEQ A;  1L2P A;  1M1K W;  2Z5I A;  1IZN B;  3CRM A;  2QJY C;  4C7U A;  4U7J A;  3CYO A;  1BE3 E;  5KTB A;  1EXI A;  5L3B A;  1BS3 A;  3OEH G;  3H1H G;  1NKN A;  5BMV A;  2K3R A;  2DQ3 A;  4B7E A;  4GIF A;  3H1K G;  4Y99 B;  4LFB B;  1XBL A;  1SQQ G;  1ZME C;  5CBF A;  3VMY A;  2VS0 A;  2OCC B;  4KJM A;  3ZRS A;  4DV4 B;  1GMJ A;  2GHY A;  2QSA A;  3JAW B;  4D7T A;  2UUC B;  1D7M A;  4JAU A;  3OA7 A;  5CCH C;  4CPG A;  3CCV P;  3UQ8 A;  3C8V A;  1BGY G;  1XNQ B;  1SQX D;  4QNH B;  1CW5 A;  3BRV B;  1RM1 B;  2DYR B;  1MSW D;  1JCC A;  4B08 A;  4YPC A;  1PL0 A;  3EWK A;  2A7W A;  1FXK C;  2P06 A;  3CJH B;  2L35 A;  2UUC O;  4N21 A;  2OGU A;  3JAR B;  4PD4 I;  3VBB A;  1BE3 D;  2FYU E;  2NRG A;  3FB8 C;  1LUW A;  1CP9 A;  1JPX A;  4MSW C;  1QQC A;  2C0X A;  3ASN B;  1T8Z A;  3F7V C;  4IYH A;  3C3T A;  3L70 G;  1NTK H;  4LF6 B;  4G28 B;  1RE3 C;  4NB5 A;  3CXH H;  1Q6I A;  4JI6 O;  1VQ6 V;  1AV1 A;  2YIU C;  1GM8 A;  3A0H E;  1U97 A;  3JSL A;  1SQV J;  3ABK C;  4IIJ B;  2XAG A;  1X9V A;  3BAT A;  1JA8 A;  3LW5 J;  1IFN A;  5AVU B;  4ZKP A;  4U3J B;  2IM9 A;  2P90 A;  4Z1M H;  2O1J A;  3JAS A;  4XBF A;  1NTM H;  2Q5Z A;  4DV1 O;  4LF6 O;  1MNG A;  1M7L A;  4DZO A;  3RYH B;  2YKO A;  1BHB A;  4O4H A;  1L1F A;  2O57 A;  2CE4 A;  1FOS E;  1EN4 A;  2R72 A;  3CME V;  5KLI C;  1EQ7 A;  2KG7 A;  1V54 C;  4MVM A;  2ZYG A;  3RYC A;  4TSF G;  1F4M A;  1BQ0 A;  1QEX A;  2QJY B;  1X0T A;  3OR6 C;  1XQ8 A;  3APQ A;  2N05 A;  2YO3 A;  4GYC B;  3ZJZ A;  1SQP J;  5LHH A;  3MTU E;  2FYU D;  2IFN A;  2CK3 G;  2NR5 A;  2LW1 A;  1QVF U;  4AIL C;  1AP5 A;  1NAF A;  4M3L A;  1K92 A;  1M1K Q;  3TCU A;  2WVR A;  3CWB G;  1HNW B;  5CBG A;  1S76 D;  1KQG B;  1IFJ A;  4U3F J;  3FXD A;  4EB6 A;  3CC7 P;  3BRC A;  2W83 C;  2G38 A;  5JCO A;  2DWE C;  1YYC A;  1URQ A;  2W6J G;  2VQF O;  1M57 D;  2KNC B;  5KHJ A;  1NU1 G;  2FY8 A;  1UPG A;  3TSI A;  4PA4 A;  3AG4 C;  1YTF D;  1YZB A;  1IFI A;  4LGD E;  1LNQ A;  1QLE B;  1OX3 A;  4NYK A;  1TGO A;  1PL5 A;  1AFO A;  1YHQ V;  4RES B;  2F66 C;  2DOS A;  1JJ2 U;  1SQF A;  4PI2 A;  1FU1 A;  2EIL B;  4ASW A;  3OMN B;  1FJK A;  3FYI B;  1ZRT E;  3CP1 A;  5CB4 A;  4DK0 A;  1MOF A;  1W0J G;  5IY5 B;  2P2U A;  3BA9 A;  5J2T B;  4GKJ B;  3I55 P;  4DUY B;  1OIP A;  1K9M W;  3CX5 E;  3FWN A;  3K58 A;  2M3B A;  4J7J A;  3L37 A;  5L3E A;  1IK7 A;  4NTW A;  5GTI H;  3ABK B;  4FIP C;  1I08 A;  3G71 P;  4UVB A;  4I7Z C;  1VQO V;  4GKJ O;  2YI8 A;  4JGS A;  2LFR A;  2B9B A;  5CA3 A;  5E79 H;  2B87 B;  4FLW A;  4I55 B;  4J9Z B;  2EIJ C;  3PRJ A;  3DC5 A;  3HKB A;  2CAZ C;  3CCQ V;  2FFD B;  1N86 A;  3AEB C;  4BIU A;  3E7K A;  3VN0 A;  1M90 W;  1Y8A A;  2LXC B;  5KLI B;  2KSJ A;  4W7Y A;  3Q5P A;  3T4Z A;  4O4I B;  1JY2 N;  3G6E P;  5AVZ B;  2YIA A;  4RWU A;  3H32 B;  4FFB B;  4GCZ A; 
#chains in the Genus database with same CATH homology
 2E76 D;  1Q90 D;  2FXP A;  3AED C;  3GF7 A;  4H0L C;  3AEG C;  1NYH A;  3AEE C;  3AEC C;  3IN6 A;  4GDO A;  4IL6 X;  1R8E A;  3LW5 J;  2G3A A;  1K05 A;  2ZT9 B;  4R4M A;  4H44 C;  3AE8 C;  4Z1M H;  1DIP A;  1TU3 F;  3Q1M A;  2G8Y A;  1VF5 B;  2NZ2 A;  1OMI A;  4PV1 C;  2K9Y A;  2JO1 A;  1HF9 A;  2E75 C;  2E76 C;  5KLI C;  1PIX A;  4H44 D;  3O6Q A;  3H25 A;  4H13 D;  1KTM A;  5M1B A;  2YMK A;  2E75 D;  3ABV C;  2D2C B;  3AE4 C;  1RQV A;  2O01 J;  2WQY C;  1DD3 A;  4RKU J;  4OGQ D;  1ZP0 C;  3Q5R A;  1U57 A;  1PV3 A;  2QJP C;  2E74 B;  4H13 C;  3GF3 A;  3FGA D;  1UIX A;  4TT3 H;  3D71 A;  1KQG B;  2BEZ F;  3B71 A;  3SFE C;  2BEQ D;  3AE2 C;  3G9R A;  1S1C X;  2ZT9 D;  4Y28 J;  1HJ0 A;  3AE5 C;  1KMI Z;  2QJY C;  4U7J A;  3AE1 C;  1VF5 D;  1MKM A;  2WSE J;  3RK3 E;  3RL0 g;  3S9O A;  1EXI A;  1OW7 A;  3R4Y A;  1YQ4 C;  4OGQ C;  2H88 C;  2H89 C;  3Q3D A;  2D2C C;  1K04 A;  3D6Y A;  1EXJ A;  2QSI A;  1RQU A;  4KT0 J;  3T97 B;  1PL5 A;  4H0L B;  1Y9B A;  2ZT9 C;  3AEF C;  2WSC J;  1DD4 A;  1VL2 A;  1VF5 C;  1ZME C;  4I7Z B;  3Q2Y A;  5KKZ C;  2D2C D;  1ZRT E;  3AE6 C;  1GMJ A;  4PV1 B;  1YQ3 C;  3AE9 C;  2WPV B;  1NGM B;  2E76 B;  2E74 D;  3SFD C;  3C8V A;  4YXD C;  4YTP C;  3Q5S A;  3AEA C;  1AJY A;  1KOR A;  2JP3 A;  2IDB A;  1IK7 A;  3EWK A;  4R4L A;  1WMK A;  1S5L X;  4I7Z C;  3AE7 C;  2E74 C;  3GLM A;  2V7Q J;  1ZOY C;  3D6Z A;  1JB0 J;  4H44 B;  2J5U A;  4XFJ A;  1FDI A;  4H13 B;  3D70 A;  1FDO A;  4H0L D;  3IAO A;  5L8R J;  2QIW A;  2P10 A;  2WSF J;  3AEB C;  2MKV A;  2E75 B;  3GMA A;  2FYN C;  3Q5P A;  1OW8 A;  3AE3 C;  2QJK C;  1KQF B;  1KIL E;  1OW6 A;  2YIU C;  4PV1 D;  2OQQ A;  4OGQ B;  2FBW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...