2ZT9B

Crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2008-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2zt9B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2zt9B01
4H0LB 1ZRTE 2WPVB 2WSEJ 4RKUJ 4Y28J 4OGQB 4I7ZB 1JB0J 2K9YA 4H13B 2QJKC 1S5LX 5L8RJ 4H44B 4KT0J 1VF5B 3C8VA 2QJYC 2QJPC 5KKZC 2E75B 4PV1B 2D2CB 3LW5J 5KLIC 2E74B 1Q90D 2WSFJ 2O01J 2YIUC 2QIWA 2QSIA 2WSCJ 2E76B 2ZT9B 4IL6X 2FYNC
chains in the Genus database with same CATH superfamily
2WTYA 4AILC 2E76D 2V1DA 2IU3A 4LP8A 4H13D 4JI0B 1PP9D 2R3CA 1DF4A 1XNQB 5APUA 5B5EE 3BCCJ 5JQGB 3HUSB 4ZI7A 3L71D 4DOJA 3SYQA 1KYOI 2NLJC 5LOVA 4EYYQ 5BY1A 1GTOA 3AE9C 4LWSB 4Q6GA 1PP9E 1FXKB 3ZMSA 1ZW0A 5KMGB 1ZXGA 3TETA 4DCKA 4JZ2A 1NTZE 1H2SB 2GM4A 2JGDA 5IDJA 3R4YA 2B5UA 5B5EH 1G1IA 1Q43A 1YXBA 1H88A 1U96A 1IFPA 4LWSA 3IAYA 2Z4EA 3L72J 3KQGA 4XA4A 2C0XA 1YCIA 3BABA 3T1YB 3E89A 1VQ7V 4MVSA 1SQXD 3S3WA 4F6RA 4ASVA 2HJDA 2ZAEB 3V2RA 2ZNJA 1G2CB 4YJ2A 2GUZA 4DR3B 3CL3D 5CBOA 5B5EZ 3CCEP 2HODB 1NU1G 4GIFA 4TUYB 1EN4A 1THZA 1SA0A 2QIWA 2R3SA 1L4AD 1YEWA 3JALA 4P2ZA 2EZPA 4UCUA 2QSIA 3OGIB 1URFA 2P4KA 4DK1A 2EZOA 2F23A 3SPIA 1XTGB 1WP8A 1MABG 4JAUA 1XOUA 2GTAA 1L4AA 3OA7A 4FFKA 4LNUB 2A06H 1ZL8B 1EZVI 3WUUA 3SWKA 3CMEP 3FB6C 4DV1O 2ZKOA 2KOGA 2WPDG 1MG1A 3CCUP 1ZP0C 1Q6UA 1VQKP 3ZCCA 2CTRA 2ZE6A 2DW3A 1RH5B 2M5AA 2Y9ZA 3AE6C 1R1BA 3Q3DA 5KHKA 3DXRA 3OW2U 5J2UA 1FZCC 1XL6A 5KLIB 1QQCA 5CB4A 3M9QA 1PV0A 3WUVA 4NTWA 1BZKA 1K73W 5AW4B 1SKVA 2M5AB 3SWYA 5CCGD 4H37A 2NPSD 4GKJO 2RMZA 4PELA 1LWUA 5BZBA 1Q90D 5CCGA 4KHXA 4I9QA 1A02F 2VQFB 1DD4A 3AEAC 2B1IA 4TQFA 4IFMA 1J5EB 4O4IA 4DV7O 2LR2A 3O65A 2YXHA 2KIKA 5KJ7A 1JMKC 2EULA 2Q3IA 2X0LA 2YNYA 3CXHH 3A7OA 3BRCA 3JAMN 1KB9I 2MW2B 3D8CA 3HKBA 1L0LH 3H1IJ 4NYKA 1NTZD 5B66E 1M93A 4DV4O 1SQQJ 3E1IA 4O9BA 5AW1B 5FLXN 3AK3A 1VQ6V 2KI7B 3BHPA 3QNEA 1K97A 1VEWA 4U3JA 3AK2A 1GN4A 4DR4O 3Q1MA 4X65B 4FLUA 5C93A 5L3CA 5LA6B 3AG3C 3IFXA 4AHCA 4IFFA 1YTFD 3FX7A 4EI2A 3LUTB 4LF4O 3SPJA 1QHTA 3IC9A 5IYZA 2RN9A 3M9HA 1WPBA 1N36O 1PV3A 1XEQA 4QPKA 1LGHB 4BIOA 3CWBH 4QMAA 3RW0A 3G6BA 3ZDMA 4L74A 2I8DA 3KZIH 2ZQMA 3HE5B 5KKZB 3ICXA 4DV6O 2W8ZA 3EQ2A 1H0TA 5CA1A 3L72E 1GTWA 5GTIH 3SJCC 4DW1A 2AHYA 1IC2A 4KP4A 4C7NB 1ZTEA 1O9GA 5BR8O 4LF6B 2FBWC 1KUQA 4X62O 3ZMVA 1SVFA 5CJ4A 1RF0A 1OCOC 3LIDA 1YTZI 4X1KB 2AZ0A 1Y6XA 2WLLA 2EILC 1YYCA 2YS8A 3CJHA 3GHGC 2PAJA 3OMNB 1FE6A 2WPVB 1LJ2A 5LMUB 3V4QA 5CJ0A 4KL1A 1DLBA 5KAIE 5A2QN 1S0VA 5EBLC 5KLVH 3ZEDA 2K3RA 4O4JA 4PA4A 1JM0A 1NTKE 1X8YA 2M0BA 1USEA 1FXVA 1BCCD 3KHUA 3A0BH 1GRJA 1HVVA 4GX1A 3LSSA 1XQ8A 2OIGA 4N23A 3CC2P 1VIBA 1NKNA 1KORA 1OV9A 1VF6A 3TCUA 1ENVA 5IWAB 1NJIW 1HDJA 2FYUJ 3V6IA 3TYYA 1K5SA 1M8OB 2E5YA 4FM0A 1X0TA 2R9IA 1ZOYC 1P84E 2E5LB 2XAFA 4U3FH 1RF1B 2N1TA 3ITKA 1SQVH 4R4LA 1BCCH 4ZOLA 2ZDIA 5AVVB 4CPGA 3KZIE 4LF9B 4D6TJ 4DR1B 2MKVA 1N32B 1SZTA 1GDTA 3RYCA 3BCCG 3Q5PA 1OW8A 2Q7GA 1V54B 4WVZA 4OGQC 2EIMC 2ZD9A 1VQPV 1SFCB 3L70D 4I7ZC 3PH0A 2JJ1G 1M1KW 3CHXA 3CX5D 3A0HZ 3AG3B 1N2DC 2FYUH 4JI3B 1AR4A 1MZFA 5E1AC 3FXEA 4GODA 1CXZB 2IBZH 3L74J 1CI6A 5JH7A 5IJ9A 1TUBB 4TV8A 5LXTB 1RP3B 5CBNA 1H8EG 4UB8Z 4O4HB 3CC2V 1BHBA 3A5TA 1FDOA 3IR9A 5KKZC 4P30A 4X1YA 1URQB 1ZLLA 2KS1B 1K9MW 4DV3B 1L0NK 3I56V 1AP5A 3EVKA 4DV0O 1OW6A 2QTOA 1AR1B 5KUKA 1FS0E 1NVOA 1JO5A 1QX8A 3WFVA 2Q5ZA 1U7JA 1GM9A 1FOSE 1P84D 3U1AA 1BE3D 3L37A 5AVSB 2RDCA 1NH4A 1KP2A 1PPJE 1IFIA 1ZMEC 2QSAA 1H8HG 1N0NA 4PDRA 5L3DA 3HKCA 1IX9A 2FYNB 1IBLB 1VF5B 2AXTH 5LGTA 2YMKA 3FB5C 4FMTA 4J7KA 2QWRB 4MT8A 4EFBA 1J5EO 4MN4C 1NTKK 5AW9B 4AQYO 5AW7B 4I0XB 4WFEA 1PNMA 3KCYA 2QWPB 5KLVJ 1SS3A 5HFMA 2BCCG 3LDDA 1K05A 1RQUA 4J10A 2XZRA 1Q8IA 3FXDA 3P8CE 4JI6O 1SQQH 5AVXB 3K9SA 1LT9C 1SESA 2HG5D 3K5NA 2LJ2A 3OUSA 2A06G 4DV5O 2WLJA 1KBHA 2H94A 4B3MO 2BOCC 2QTSA 2IBZI 1BGYE 1R73A 4PDMA 4Z2WA 4DR5B 1RF1C 1EDKA 2KYVA 2ZXXA 1K34A 1KZUB 2ILMA 2Q7CA 3OMIB 2IPPA 2CH7A 1D5AA 5LMNO 4JTCB 4XDLA 2QEXV 1RFYA 1JJ2U 4A5UB 1SA0B 2K88A 1CI6B 1SQXK 3U59A 3H1JJ 1FXHA 4KJMA 2Q4PA 2EIMB 4I9WA 1SQPK 1Y47A 1PM9A 3OFNG 3T1HB 3TK1A 3MGNA 4PJ0H 4I4TB 4DO2A 1VQ8V 1Y74B 4LGDE 4F6EA 3ETDA 2JDIH 2DQ0A 1EM1A 3CCJV 1VF5D 1SQGA 3CC4V 2XDJA 1RHZB 2HR3A 1KQFB 3QTCA 1MFTA 4J7JA 3R66A 2VRZA 1LTJA 3P3PA 1KQSU 1P84H 3RK3C 1KYOF 1MA1A 2OCHA 1FZBA 1L1FA 2ZT9D 5J2UB 1BCCE 3UT5B 1NTMG 1Q7YW 3OJAB 4PI2A 1AR5A 3HKCB 5EFWB 3CRCA 2O3JA 2ZXWC 1NT2B 3K57A 4B3SB 1RF0C 1S4XA 2N9YB 4N3YB 2KSDA 2L91A 3ZHSA 1KP3A 2RNBA 3VMZA 3RVZA 4RJTA 2PF4E 2SPZA 3D3IA 4YJ2B 1JMBA 2A45H 2A0LA 1EBOA 3G67A 2BCCD 1N4CA 1SRYA 2FYNC 2CPBA 2CUGA 2QDOA 1LWUB 4B3RB 4A7PA 3NXSA 1YHQV 1CEZA 2IX7C 1M56D 3JAWA 3L74D 2FFDA 4B3TB 1Q82W 4RESB 4QNHB 4K3AA 1WRGA 2JK5C 3L73H 5FPRA 2KNCA 5GONA 1SQBG 1L0ND 3H1JD 4UVAA 2Q73A 2LGQA 1LT9B 2NNUA 2E5LO 2VQEO 1MSDA 2NRGA 2L5GB 1IFMA 4Y99B 3SYPA 1LT9A 4O2BA 1DEBA 1HWTC 4EFEA 3QO5A 1JCDA 2UXNA 2YSUB 4PD4H 2E74C 4IFDK 3FWNA 1K92A 1GO3F 2OTJV 4HB1A 1X22A 1JY3P 4WWIA 3S9OA 1A02J 1FKAO 2WWWA 4CS3A 1GN2A 3E83A 1PPJG 5KMGA 2QM8A 2VQFO 2HKOA 3HB3B 3WG7B 1W0KG 3VMXA 5DN6G 3L36A 1NTZJ 1ZR4A 2K37A 4AUWA 3THOA 4FLVA 1N73C 1M57B 1GD2E 3TGUG 3ETEA 1JNMA 3JYCA 5LHHA 1SQPG 2YXLA 1NKZB 2ZVOB 1VQLP 3PRJA 1NAYA 2XHBA 2Y0PA 1KTMA 3F89A 2UUAB 1D7MA 2UU9B 2ZT9C 2OYQA 1YQ3C 1WA8B 2G8YA 2YDEA 4GKKO 2JP3A 2Q0OC 1FZCA 3DGEA 5KTBA 3E22A 2O01J 1M90W 1QEXA 3B8NA 2RH0A 2FYUE 3C1LA 1K3EA 3OTOB 1HGZA 2YXQB 4LLHA 4JYAB 2OTJP 2YUAA 1T2KD 2CTWA 1NU1H 3B5ND 4I7ZB 3L73J 4LF4B 3RL0g 4X64B 5JQGA 5B66H 3CPWU 4AQYB 2BCCJ 1BDDA 5H2FE 1FJPA 2FXOA 2DQ3A 5CN0A 2JO1A 4B08A 4OPAA 1EXIA 4PHZA 3H25A 4IIJA 3Q4HA 1R6KA 1BE3E 3UO2A 4PA7A 3ZHTA 1LUWA 1KC8W 2QKSA 3II6A 1SZXA 4L76A 4IIJB 2JVDA 2Z5UA 3TXSA 5CBHA 3H1KG 5CB4B 4JTAB 4X66O 2YO2A 4L75A 1M56B 2JS3A 2D2CC 4ZHQA 4EOTA 4KHPO 3CRAA 3FWLA 3L73D 4D7TA 2YXYA 1OZ0A 4MTGA 5H6RA 1GH6A 1EZVH 2LFSA 2M6YA 4YHHO 1KQLA 1YITV 3H1HG 4NXMB 3UO3A 2YIAA 3A2FA 4LFBO 4GOEA 5LMNB 2P06A 3VN0A 3JCUH 1Q3EA 1N8RW 3S3XA 1W5CE 2KB7P 2N74A 4BW5A 4GT1A 2IJKA 1XDCA 2HEPA 2RN0A 5KHHA 3VMAA 2P5OA 2KSJA 3L71J 1VQ7P 2ZE5A 2ITAA 1UJWB 1ROPA 3BCCE 4MVMA 2WMMA 1UFIA 3L74G 2WQYC 4B7KA 1RQVA 1SQXE 5TISH 1AJQA 1NHLA 5LGUA 3W67A 2OTLP 1YJ9V 1JX9A 4LF8B 1AB3A 2YIBA 4Q20A 4TUYA 4DR6O 2HFED 3SJQC 3F7YC 2NPSA 2WITA 1HTLC 3QF7A 4OVNF 4G27B 1FC2C 3H1KE 3MIWA 4U3FD 4I4TA 1QL2A 2RJZA 1K8AQ 2R72A 3HTKA 1ZL8A 3GG2A 1HW7A 1KU9A 2DYRC 1N7SC 3ZHRA 1QVFU 2IYPA 2OTKE 3K08A 3MAQA 1EZVG 4N78D 3UQ8A 2KSEA 3T4ZA 3K5LA 1SQBK 3H1KJ 1HNZB 1J1EC 1NR7A 4EKWA 5BMVA 1JJOA 2BOBC 3DC5A 4LBEC 5B3SC 2XAJA 3AG1B 2J59M 3BVOA 2QJKC 1BSMA 4JYBA 5AG2A 2FFDC 3H1ID 2RQ6A 1T2KC 1Q7YQ 2HVJC 3R65A 3UT5A 1VQNV 4WY4B 2LGWA 4JPRA 1Z56A 1BGYJ 3TXQA 2Z5IA 1YI2P 4YXWH 1VP7A 4GKJB 5LOVB 1G2CA 4GX2A 3H1LJ 2RCVA 2QG4A 5IE9A 3LDCA 4OXSA 4JI7O 3W7UA 1M57D 3M91A 1T6AA 2PI4A 3IF4A 2YEVB 2DYSC 4R6ZA 3RFRA 4UCRA 2WA4A 3V2QA 3NR7A 3MD0A 3QWOC 1HR0O 3ZMZA 4DK0A 2GBOA 3HKEB 2E76C 4AYCA 1FPOA 5JCOC 2ITCC 4DXWA 2X6BA 2VQEB 1ORQC 3SYCA 5E79E 3NFQA 3L70H 2K1EA 3L9DA 4FZ1A 1HJ0A 2DJVA 3JD1A 3ZS8C 3PTZA 3RL0C 1BQZA 2ZDIC 3ZX6A 3ABVC 3CRRA 1PL0A 4J7ZA 5LXTA 2P1JA 5LP6C 2C9LY 4LF7B 4J11A 1RE4C 3TSIA 1YIJP 5KX5A 4K8ZA 3SJBC 3TF5A 2ODMA 4AI8A 2DN9A 4NTYA 4DR4B 2IYOA 2IU0A 1NTME 3JAKB 1WLEA 3C90A 5GW7A 1P4RA 2EX3A 1SQBD 3H1JG 2R32A 4F4LA 1VQ6P 3GF7A 4NPFX 1NVPB 3AE4C 1NJIQ 3APQA 4XE5B 3M0AA 1Z5VA 4KXRA 4ZOLB 1SFCD 2V4HA 4J42A 1NTKD 1P7GA 1Y66A 4WFHA 2I1KA 1YSCA 2OCCC 1WN7A 2H8PD 4NB5A 2Q68A 1S2EA 3FGAD 3X2QC 1SFCA 4GDOA 1I94B 4K8XA 2PY5A 3AK1A 2HP8A 5KHJA 4H0LC 2P7TC 1Y8AA 3CC7V 1AVOA 3SYAA 3ASOC 5APXA 1VQ9P 1PD3A 3G71V 3BPZA 1WB7A 5BR8B 1BSNA 4LF6O 2POHA 1I0HA 1PGPA 3L72G 3TDKA 4JI2B 1NTMK 1CW5A 2ZM6B 1DTOA 4X62B 1YIJV 1K04A 5APQA 3GF3A 1E1QG 3ASNC 2YC0A 1EDLA 1CPYA 4X64O 4DUYB 1S5JA 1GL2C 4WY4C 5BU8B 2IZ1A 1FDMA 3K58A 3P8CD 1GK9A 1YZBA 1KQGB 2Q8VA 5B1NA 4MSWC 1JB0J 4HAMA 4K0KB 3S4RA 1GKFA 1M57C 3RL0D 3F7VC 3MHHC 5AW8B 4JV5O 2NN4A 3RWRD 5LMUO 1S77D 1JY2O 1JTHA 2YKOA 2ZINA 3H6PA 4N6JA 5E79Z 1VQMP 5AW5B 3ZMTA 3DTUB 4PD4E 2WZ7A 2PTMA 3HD7D 1AJYA 1PNKA 4IHJB 3EFFK 2ETNA 1NH2B 1OJHA 1GM8A 4DUZB 1NWQA 1US6A 4GUNA 4W7YA 4UCSA 2EBOA 4NTXA 5LHGA 5CMZA 2W6IG 1FFXA 3CCQP 3UCSC 2LXBA 4LFBB 2QKAA 1LTJB 2FXPA 3MUDA 3MZWB 1OVVA 3CRMA 3T97A 1XNRB 1JY3N 2LQTA 1JY2N 1FAVA 3VP9A 1H2GA 4B3RO 2WSSH 5HFLA 4X20A 2Y0EA 2ZYAA 2HYNA 1HNWO 3AEIA 4Z1MH 2F95B 4XDKA 2Y0IA 4GCZA 1NR1A 3BATA 3HE5A 4JI3O 1IBMB 3L75G 2BTOA 2MJZA 4LC1A 1M90Q 2A06E 5EIBD 1SC5B 1XL4A 2JIZG 3OD4A 4X89A 1EQ7A 2D2CB 1Y76A 3H01A 3L73E 3LNNA 4KFMA 5GTHH 1YJNP 3H32A 1AI4A 1U97A 1NU1K 1KKDA 1MUUA 3RGUA 1TVKB 3X2QB 4X1KA 1LTBC 3JCZA 1SQQK 1BHAA 3JARA 3P8MC 3AEEC 2A9HA 2JEUA 4YXWG 4RKUJ 1PPJH 5DJUB 1TGOA 2ZE8A 2JWDA 2W83C 4FVMA 3H1IH 1L0LJ 4ZIBA 5ITZA 2YKQA 3H1KD 4ZNCA 2Y9YA 1GK6A 3SYOA 3VBBA 1QLEB 3U0ZA 1EXJA 3I55P 3NMDA 1R3LC 3ASNB 1L4AB 2YICA 2J58A 2QRXA 3SWFA 3EWKA 2QM4A 2WVRA 4I1LA 4WCEV 3T4DA 5APYA 5JJNB 4MTXA 1S72V 5AVQB 2A3QA 1IZ3A 3GB7C 5B1BC 3SPGA 2UUBB 5BMVB 3M8AA 3L74E 1PL4A 1BCCJ 1OCCB 4YXDC 3CCSP 1Y67A 4JI6B 4GKKB 4UB6E 2KKWA 1YHQP 3TNUB 3SDLA 1BGYH 1SETA 2CAZC 4CH6A 4LCUC 3H1HH 4UV8A 3RN4A 3RYFA 2O01N 2Q6AA 2Z0AA 3VOUA 1S5LH 4C46A 1D5NA 3AG1C 4O4HA 3HUSC 4PDVA 2QJKB 1L0NG 4CS4A 1NYHA 2KLVA 2BEQD 1KQSO 1VARA 5GTHE 4RUEA 2W0FC 1PP9G 4CH3A 5M1BA 1XBLA 3DSQA 3VQYA 3JD4A 5CCHA 2IBZG 1GN3A 4OX9O 4BW9A 1XMOO 2Z5HA 1X59A 3B77A 2UXXA 5EBMC 3EFGA 1NQTA 2L35A 3NTNA 1SQVD 1M4UA 4D6TH 1FBMA 1HNXB 4U3FG 4CH5A 4U7NA 2KB1A 4H44D 1S72P 1VQOP 2IFNA 4LF5B 3SGIA 1Q81W 1F23A 1VQ4P 3CS5A 1P84F 4LNUA 1PZQA 1J1DC 1ZLZA 3H1LE 4JI4B 2FB5A 3G6EV 4LH7A 2QA4V 1FOSF 3L4FA 1VMGA 2ZIOA 3L71H 1K33A 2IJHA 1BCCG 2JDIG 1SP4A 2KXPB 1OCOB 1OCRB 2CK3H 3A3YB 2K1AA 4IL6H 2UXBO 2LFRA 3JD3A 1NGMB 3G80A 3Q4HB 3OW2O 1TA8A 5CCHC 2A06D 4GOFA 2QJYC 3ZBHA 2LKMA 2CGOA 1JOYA 3R2PA 5FPOA 4B3SO 3L75J 4DV1B 3CCMV 1LP1B 4DUYO 1GM7A 4ZKUA 1KV4A 4FIPC 3HRNA 4WB4A 4P9OA 4LH6A 4YIPA 4LFAO 4UCTA 1V9PA 2QWOB 3TJTA 4JI5O 2YKPA 3BCCD 4HZ3A 2H88C 1PP9J 2Q5UA 3GMAA 2Q7HA 1F7YA 5IY5B 3K0DA 2DWDC 1FZCB 2KG7B 3OGCC 2OCCB 3CYOA 2GUVA 4JI8B 5AW2B 2Y4TA 4DRXB 5FNVA 1L0NJ 4FK5C 4D6TE 2GA1A 2B9ZA 5L3EA 3CB2A 4FLWA 4NVPA 3FX0A 1FYJA 2Y48A 2UXDO 2LXCB 4OGQB 3PN1A 1KD1Q 4R4MA 1KYOH 3D3QA 1SQBH 2P6JA 2GV9A 4H13B 1H38A 4JQ0D 1KMIZ 2BTQA 1Q6HA 5DEDA 1AQ5A 1R3JC 4DRXA 4KUMA 1LP1A 1KYOD 2WLIA 1NBMG 3FB8C 3BA8A 4UUJC 4JI7B 1GL2A 2EJ7A 4G28B 4CBCA 1HNWB 1S1CX 5CA3A 3A0HH 2GTSA 2JGDB 4X88A 1PNLA 1R5SA 1YDXA 1PKXA 1BT8A 1VF6C 1KYOE 3N2GB 4X8AA 1P7BA 2VS0A 1SQBE 1T5EA 4H44C 3CPWO 4XFJA 2JWAA 1L0LG 2P58A 1I7FA 4HKZH 2VWKA 1XHXA 3FD9A 1QCEA 5KUMA 1WA8A 2IH3C 4GX5A 2AGAA 4C7NA 5LGNA 1MKMA 2OYOA 2H89C 1YJWP 4HBNA 1SQPD 1J1DB 5IJ0B 2W27A 3SSUA 5GONB 2MK3A 2OTLV 2AXCA 2JR8A 1YJ9P 1LTIC 2DWEC 2GDSA 4MTOA 1KILC 3CCRP 1KKCA 3QG5A 1LTJC 3K3WA 2XTAA 3BFRA 5IT9N 1FZFA 1H2KA 1OWAA 1VF5C 1YQ4C 2QJYB 4YIOA 2HPCA 1OHHG 3UIAA 2ZNIA 3V2PA 1SQXJ 3L75D 1K73Q 4DV6B 5KLVE 3ZN0A 1QLED 5IYBO 2Q3EA 1ZV8A 1NTMH 2JJLA 1VQ5V 1M1JB 3ZIAG 3STLC 4RO2A 1Q86Q 2NR5A 1S76D 4E4EA 5KA6A 3AG2C 1NTZG 1RE3C 4I6MC 2QJPB 4FFBB 2E75C 3CCVP 1FXKA 3U10A 4WY4A 3AG7A 3DXRB 1MZ9A 4JTDB 2YO3A 3IFMA 2JEXA 3CE2A 3CCEV 4X66B 3VQVA 3ZRWA 1O9HA 4KHPB 5K1XA 4RQFA 2JGUA 3ZHQA 1HJBA 3JCUE 1Q5OA 3S1KA 3CCRV 2P10A 3GW6A 1MFZA 2KZIA 5B1OA 4NXMO 1JUNA 2B1GA 4O4IB 2GUZB 5EZYB 3L75E 4X9QA 2IW5A 2OYIA 2W0XA 4I5SA 5AW0B 5IWAO 3RT3C 4GX0A 4PA9A 3AEBC 4EB6A 4GLXA 4RQEA 3JD0A 1HNXO 1YITP 2CH7B 4UCVA 1AFOA 2K9YA 1SQXG 3K04A 5B1BB 2BCCE 2RMKB 3CXHF 3O9OA 3CRQA 3WB2A 4DV2O 3RK3B 4TV9A 5BVZA 4JYYA 1VQKV 1OCCC 1VQ5P 1KN7A 3CX5F 1N86A 2FMLA 2WLNA 1Y76B 1N32O 5GTHZ 1XILA 3L72D 4M3LA 1HP8A 1RPOA 4NPDA 3IGAC 3J7AU 1AI6A 5KAIH 5ITZB 3FYIB 2ZXWB 3CCVV 1AA0A 1KC8Q 3QO8A 1AQTA 2ATKC 5APTA 3ZRSA 1V54C 1D2DA 4OWFA 4HYOA 5AVWB 3E86A 5LL6Y 3K5MA 1K5QA 3V4WA 2O1KA 4EEQA 1KILB 1DX7A 1FJGO 2W90A 1QGKB 2YXRB 3AE7C 4PA3A 4O4LA 1PP9H 4H33A 4ZHQB 3HD7A 1VF7A 5EYPB 4PD4I 1RF1A 2HHHO 2OYHB 2QR4A 3RK2B 3Q5SA 3STZC 1FS0G 1SQVE 2OARA 3CC7P 3KZIZ 3PJSK 1K8AW 1NH2D 2IM9A 4J9ZB 1VQ9V 5CBFA 2M8RA 2B88A 5L3BA 4DV0B 1IDSA 4TWKA 5IJ9B 1URQC 2LO1A 4X1IA 4BIZA 1SQQE 4Y28J 2PGDA 3CXCU 4TT3H 1OCZC 4Z1VA 4N21A 2V7QG 5B1AC 1SLQA 2JKVA 3CWBE 2Q7EA 3ZRXA 2E75D 2QJPC 4CZZA 5L3FA 1IJDB 1NKDA 4W4KA 4GYCB 1HR0B 2FY8A 2E74B 1OCRC 2FYUD 4ASUG 2CTQA 2PUSA 4QIWF 2UXDB 3A0RA 1TUBA 1W59A 3CI9A 1RPRA 1S3JA 3WG7C 3E8BA 2O1JA 3B8MA 1SQVK 3HPLC 2N9BA 4FM2A 1Y74A 2V7QH 3D6YA 1YVWA 3JATA 3G4SV 4BAYA 1S5HC 2AEJA 5KA5A 3CCQV 2VRSA 4FZ0A 5LYJB 4LFCB 2W6JH 4BRYB 1Q81Q 2P22C 2X7RB 2F4VB 4TSFG 3H1LD 4RUFA 1S9KE 1SQFA 2OGUA 3GLMA 5K5GB 4DV7B 4NKGB 5KLVG 2CE4A 3TGUE 2N1TD 4BRYA 2YIDA 1IK7A 2Q6QA 1P84I 5CMUA 4MTFA 1NZ6A 1IK9A 2ZT9B 3B40A 4JI1B 4JF7A 1QNMA 1OX3A 2G38A 3BAAA 3C3TA 5IYZB 3H1IG 3T97B 1T8ZA 3OUFA 3GHGA 4CC6A 2P67A 1FU1A 4O4LB 3RK3D 2KK7A 1RSOA 1OMIA 3BRVB 3DC6A 1Q82Q 5GTIZ 2UUCO 4DV4B 2V7QJ 2IBZE 2I1JA 3CP1A 2Q9LA 1XHZA 3T1HO 2ZR2A 2PGGA 1USDA 5APSA 5EC2C 2OIEA 2XNDH 3ABKB 1R5LA 2BE3A 2ZR3A 3TNUA 4ASWA 4ICGA 1WP7A 1YBKA 2P90A 1SERA 1Z2GA 4XBFA 3N2KB 1QU7A 3J80N 2ZXEB 1RY3A 2FXMA 1JTHB 1HWYA 2ZM6O 1KILE 3OR7C 3HKBB 1RE4A 3CWBG 1BGYD 3RYIB 2XNDG 4CH4A 4IGGA 1X4TA 4YTPC 1S5LE 4OH8B 4I55A 1PFIA 1GW4A 2WSSG 5KAFE 2WA3A 3ML0A 1BQ0A 2O57A 3MHVA 1M56C 3E1RA 1N0JA 3L71G 1NTKH 2G3AA 4FLTA 2QWNB 3HTKB 5B1AB 4U7JA 1KILA 4L8JA 5LA6A 3RBXA 1IBKB 3SPHA 5EK0A 3LNMB 3AE8C 1AVYA 4QE9A 3VOPA 3TGUH 2OWOA 1H8AA 3E8HA 4QPJA 1LUVA 3WMM0 3OAAG 4RWUA 4G2KA 1LR1A 1JPXA 2FTKA 4DUZO 1SQBJ 1JFFB 5APVA 1CP9A 2EILB 1BS3A 5CBGA 3RYHB 1AROP 3QVNA 2W6JG 2VWJA 2PZSA 1JQ0A 4JF3A 1R3KC 1IZNB 2AEMA 4MVRA 1JMMA 3HD7B 3ZN1A 3VTPC 4LFAB 4FFBA 4NXNB 3RYHA 3RK2D 4JI5B 3AE2C 3O6QA 1L0NH 1A32A 2Y69B 2XNXA 2M3EA 3I5CA 5DECA 1U7MA 1M9NA 1GAXA 3ABMB 1W2EA 3M9BA 1M1JC 2IZ0A 3CX5I 1XMQO 3L74H 5J9PC 4HJGH 4DV2B 2OQQA 3CCLP 1N7SA 1KB9E 3H32B 2XAHA 2Y4UA 1S5LX 1AJPA 5KX5B 2C9NY 2BSKA 2E75B 5KLIC 2QKCA 1URQA 2KS1A 1XTCC 5JVDA 3A8TA 1R6NA 2QE7G 1MZEA 4J80A 4I55B 4O2AA 5B3SB 2D3OW 3OEEG 3K5BA 5KAFH 2EJRA 1VQOV 3AE3C 2ZYDA 5JWPA 1MMMA 3RYIA 2ZVNB 1BE3G 4IL6X 3J81N 1DEEG 3L70E 2R9RB 4LF9O 3KPEA 3D36A 1EZVD 4DR2B 3CD6P 1N33B 4BWAA 3M7MX 3C3SA 1ZN5A 1MOFA 2QM7A 5LYJA 3K0GA 1N73B 4FPPA 3ABKC 1JR9A 1JY2P 2HHHB 1SFCC 4UB8E 1G8MA 3MTUE 1RM1B 1T3JA 4DJGA 3SFEC 2LW7A 4U3JB 3CSXA 2QVAA 4PD4F 3M0DA 4WFGA 2FKXA 5LBQA 4PD4D 3LSUA 3RYCB 1X79B 4MW3A 1HUCA 3TGUD 4H0LD 1FFXB 5DM6V 4W4LA 2HLDG 2IFMA 1XUQA 1GZLA 4YY3O 1ZX3A 4QJFB 1NOHA 1WNSA 1FZEA 3E35A 3ZRVA 1HBWA 3P30A 4JYAO 1OIPA 3H9VA 4K35A 1G1XB 2ADPA 2L6LA 4DV3O 1LTSC 3HUSA 3W68A 2B87A 1H2LA 4IL6E 3JALB 3L75H 1G1JA 1GL2D 2D2CD 3A2AA 3ABTA 4QGPA 3O8ZA 3L70G 3ZHUA 2KQXA 4J41A 1NO4A 3CD6V 5KHGA 2WLMA 1OFCX 4HYTB 4JBZA 3CCSV 3Q5RA 1ZRTE 2NPSC 3HE4A 1NTMJ 3RK2C 3HD7C 5J2TA 4AQRD 3BVHA 2R70A 3RGBA 3CLQA 1VQ8P 1SQPH 2F4VO 1PGJA 1AI7A 2EIKC 2WPSA 3CCJP 4OPHA 4TV8B 1EN5A 1SQXH 2JJ2G 2Y69C 3JASA 3UKMA 4DR7O 1ZRTD 5TISE 1WMKA 5JJJB 2HODA 3USSA 1R6TA 4WFAV 1OCZB 4O2BB 4L73A 2IJIA 2P7JA 1WJZA 2FL4A 1XNQO 5K1PA 5AW3B 3OMAB 3CMAV 4LF5O 2E3CA 3IN6A 1ZR2A 4B3MB 3UM7A 4JI4O 5LHIA 1J95A 2DW4A 1FJKA 3APOA 2WLKA 1B6QA 1BE3H 1EN6A 1CSBA 3MHSC 3GHGB 4W80A 3N27A 2UWJE 1IFDA 5IYCO 2UXBB 5KLVD 1VQ4V 4BIUA 3KCXA 3CWBJ 1NVPD 2HG5C 4QE7A 1H89A 1NTZH 4MVOA 3L72H 1QL1A 5AVTB 3HKDA 2WSEJ 1PGOA 1FDIA 2YIUB 2W6BA 1KB9H 3PHLA 1WB8A 2EIJB 5H2FZ 1QBZA 4YJ3A 2B87B 4ZKPA 5FNVB 1BE3J 4KT0J 4GZRB 1KFNA 1HNZO 1KB9D 1K7DA 2DE0X 1NU1E 2XU6A 1QVGO 1BMFG 3HKEA 2YI8A 4TT3G 3EHBB 4JZGA 1IVSA 1WT6A 3MUDC 2R9AA 3CCUV 2FFDB 1RE3A 1QVGU 5TJHA 2KZJA 1UIIA 4JI8O 3E22B 1NU1J 5AW6B 5B66Z 5FL7G 1JVMA 5EBWC 1L8DA 2WLIB 3U11A 2ITDC 5CHXA 4RAIA 1W2BU 2QGNA 3H1LG 3WB1A 2GHYA 2WSFH 3OEHG 4NXNO 3PP5A 1L0LK 4PA6A 3WU2E 4GKGA 2XT9A 1N34B 4PI0A 2FYUK 3F5HA 5DJTB 2NPSB 3JSLA 4JASA 3PLNA 2GSMB 1LWUC 3H1IE 3HKDB 4U3FE 1EZVE 5LP6A 1KFMA 1OVRA 1SQVG 2PI5A 4HH2A 4U7OA 3IC7A 3JSNA 2ZIMA 1VQLV 1PL5A 2OYHA 1Z5WA 3F5TA 4UV9A 5EYPA 1P49A 2KUBA 5H2FH 3D70A 2HVKC 1TU3F 3ABUA 3BEHA 4D6TD 5IJ0A 3L35A 3B5NB 4LF7O 1QR9A 4R7CA 2YMYA 1I5XA 1EC5A 4IYIA 2WPRA 1TUEB 4JAAA 2PRRA 3BY6A 2H8PC 3AECC 1JOCA 4CC5A 3RYFB 2XUMA 1CZQA 1MV8A 4UCOA 1L0NE 1VQNP 1ZWIC 5H9CA 3U1CA 2A45I 1G6UA 1Q6IA 1YI2V 3N4XA 1FZAA 3EXAA 1B06A 4PV1B 2KP8A 2Z3YA 4FJCC 4TV9B 3W7XA 4LFCO 3ZMUA 4OGQD 2BTQB 1N7LA 4YPCA 3CXHE 3M0DC 1NAFA 2ADQB 3SPCA 3ABMC 3OR6C 4R50A 5H5NA 2N05A 2YIUC 4JI1O 4B86A 2EIJC 4YY3B 2P2UA 5KJ7D 3WU2H 4ZBMA 1EFRG 3F5WC 3K9AA 4H0LB 2BEZF 1PGQA 2HPCB 5A9GA 2OT5A 3H1HJ 2UU9O 1GW3A 2E42A 1W2BO 3HR0A 3N7NA 2A7WA 2XAGA 2WSEH 3CMEV 4TQDA 2EINB 3H1LH 1E79G 3AEDC 1S9KD 3K5OA 2ZYGA 3L71E 4I0XA 1BL8A 1COWG 1NTKJ 3W7WA 1F4MA 1GL2B 4FM1A 2CDYA 3H1JE 5KLVK 4IL6Z 1HGVA 3E7KA 4WBNA 1VDFA 2ZJSE 3BRTB 3B09A 2F1MA 5AVRB 1TAEA 1RM1C 2ARHA 3GWKC 3KG2A 1HH0A 3L70J 4HNAA 5AVUB 2Y0CA 2KNCB 2J5UA 2V4DA 1IXBA 2A79B 3N2GA 2FYZA 3JD2A 2IBZD 4DYLA 4IT5A 1N73A 5L8RJ 1I08A 3JSVC 3B4SA 3RK3E 2C2AA 5J2TB 3G4SP 3CX5H 1GU5A 1IBKO 2M3BA 2UXCB 4L87A 2LP7A 1SQQD 3WU2Z 3B5NC 1XNRO 4MVUA 4O2AB 3BA9A 3G71P 2Q67A 2KLUA 4PJ0Z 4RO0A 1SQPJ 1IXMA 1H2MA 3CWBD 3VQXA 2XV5A 4YHHB 2JS5A 3FFQA 5E79H 1I5YA 3G9RA 1B04A 1EDIA 1S5LZ 1LT1A 4O4JB 1ZAUA 1E79H 5F2VO 3GVMA 1K4DC 3FAVB 2RKLA 4FLZA 1IBMO 3TGUJ 1FJGB 2X6CA 5BXZA 1K4CC 2EIKB 2LW1A 1MNGA 2WSCJ 1XMQB 2WAMA 2YIBD 1NTMD 3I5DA 3H1JH 4JAVA 4JYCA 4UXNA 2WT7B 4DR1O 2XOKG 1HF9A 4LF8O 4NPEA 1E5WA 1F51A 4MVZA 3HE4B 5KJ7C 3MP7B 2Q9IA 3P3NA 2XASA 1LTAC 4DR6B 4UB6Z 3AG4C 1KB9F 1FD9A 4Y99C 5CA1B 4UB6H 4IOIH 3D6ZA 3FYEB 3CXHD 1Y9BA 1AP6A 1VPCA 1KD1W 4BWNA 2ZCEA 1SQQG 4X1IB 2BCCH 3JASB 1J1EB 3ABLC 4DW0A 5CA0B 2XAQA 1DD3A 2EINC 1QLEC 3W7TA 4Z1MG 3RVYA 2E43A 1FZGA 1IFJA 1B3QA 1GK4A 1AI5A 4EIJA 3CEIA 1DK1A 4WFFA 2H3OA 2BSKB 2UUBO 4FLXA 1N34O 1FAFA 2AZ2A 5CA0A 3A0BE 5D5QA 1OZHA 3SFDC 3C8VA 2QJ1A 1X9VA 3MDSA 1N7SD 4MVQA 4W7ZA 1LTGC 3E8FA 3AE5C 2DYSB 2HLOA 2OYIC 3SR2C 1DIPA 2CK3G 2B9BA 4JPZB 1DGSA 4PV1D 4WFBV 1TVKA 3JATB 3A0HE 3AEGC 1XREA 4UVCA 3AE1C 3T2MA 1YJNV 4UB8H 2ZFCA 3VP8A 3WUTA 1ZUQA 1NS1A 2NZ2A 3ZJZA 2AW9A 4BR6A 3LIEA 2YI9A 2CTPA 4PDLA 2PP6A 1N8RQ 5C39A 5L3GA 2WPQA 2XKMA 4JI0O 4R8CA 4MW8A 1WAZA 4UFZA 1NTZK 2N1TB 4OX9B 1XMOB 2AXTE 5D5PA 3B8EB 1Q2NA 1WPXA 3I55V 5GTIE 2UUCB 3KXDA 3OT7A 2E74D 1E1RG 4X20B 1SF9A 1SS1A 3LSQA 5CCHD 2QE7H 1H0TB 1IFNA 2A45G 4D7SA 2AEFA 4DV5B 4DZOA 1BSHA 4HNAB 1GMGA 1AVMA 4I50B 1VQMV 1ZSPA 3AG2B 3H1HD 1PIXA 5JVDB 4JGSA 3CX5E 3VYIA 3K06A 5JH7B 3T1YO 5KAIZ 3G3ZA 1VQPP 1BGYG 3KYQA 3K59A 3ETQA 5C8YA 4C7RA 3BASA 4DR3O 3VMYA 2K9JB 2Q69A 4I50A 4IHJA 3AG4B 3A0BZ 1YTZT 3B2EE 1NI8A 3OTFA 5BU5A 2DMXA 4U3FJ 2CGNA 1I94O 3JARB 3JAKA 3ASOB 3OAKA 1R3IC 3ETGA 1RSOB 3ABLB 3C9IA 1V55C 3GWOA 3O6QB 3B71A 1URQD 2K9JA 2QWQB 3B5NA 4PV1C 1EDJA 3KKYA 1VL2A 2O01H 3I56P 1QVFO 2F93B 5KHIA 2FKWB 4JI2O 3LW5J 3H1KH 2PYLA 1GU4A 1T3UA 1AILA 1GN6A 1PPJD 5IY5C 1NTKG 3ZRWB 1BDCA 4J9YB 3KDPB 3T1CA 3IJ4A 3ZHVA 4K0KO 2H7HA 1QR8A 3W7SA 1U57A 3JCUZ 4TLFA 4JV5B 2AXTZ 3JC22 2ZE7A 1Y4MA 2R5BA 3G6EP 2Q1KA 2QA4P 1OXZA 5JCOA 1F4NA 1L0LD 4FLYA 1W0JG 2PYJA 3E2EA 2OYIB 3FKSG 5EZYA 3CXHI 2DYRB 4XDJA 1GMJA 1N7SB 4B7EA 4BXLA 1EZJA 2UXCO 1UIXA 2Q0AA 4IYHA 1M1KQ 1M7LA 1DF5A 2PFXA 2R5DA 5AVZB 1DH3A 3RBZA 2B89A 2AHZA 5AVYB 1L0LE 4E2LA 2F43G 4WY4D 4MS2A 1IO4A 4H13C 5JJEB 1XI1A 2F66C 2WLLB 3QO7A 4WBNB 1AJNA 1G4YB 3CCMP 4WBAA 3M99B 1M5IA 5H6QA 5C8YB 4CS2A 1FXKC 3CCLV 2N1TC 1KILD 1KECA 4B3TO 3H1HE 2H43A 2OYHC 3N2KA 3CMAP 4PJ0E 1JFFA 3K79A 4DR2O 1N33O 1SQVJ 4P9PA 3WB0A 4ZMDA 4H44B 1JCHA 1M1JA 3QH9A 3VQWA 4EB6B 1JA8A 2IJJA 2CPSA 5KAFZ 1H2NA 2QEXP 3P32A 4DT0A 1J2JB 2BASA 1FFTB 2WSCH 2P4VA 2E76B 3AEFC 4D6TG 4EDFA 1R8EA 3M06A 4N78E 4TOIA 4X1YB 2HJFC 3E8GA 4ABMA 3RL0B 2M7WA 2HFEC 2W6AA 2Y0DA 1YF2A 4ZKIA 2C0WA 5LP6B 3OM3B 3D71A 4X65O 4NR1A 3CC4P 2N04A 1MSWD 1NU1D 3SJAC 4I2LC 3Q2YA 2JRIA 3LDEA 1LTTC 2YEVA 5EC1C 1OVUA 3FAVA 2E5TA 3V2NA 1QLNA 1IBLO 2FYUG 2X6AA 1Q86W 2IH1C 4F6RB 1V55B 1OW7A 3P7KA 1N36B 1LNQA 1AV1A 5EIBC 1UPGA 2UUAO 3L73G 3V5BA 1L4AC 1SQPE 3LW5H 2WT7A 3D36C 3OE7G 3CJHB 1L2PA 2JEEA 3BCCH 5IYDO 5APWA 3JAWB 1JCCA 2IDBA 4LR3A 1YJWV 1YTFB 2WLHA 2DOSA 3OTOO 2WSFJ 2K9PA 2KG7A 3K03A 5TISZ 4C7UA 4DR7B 3IAOA 1K9MQ 1IURA 1JY3O 2R44A 4ZI7B 3FB7C 4UVBA 4YJ3B 2GUSA 1JEKA 4DR5O 5CCGC 4WF9V
chains in the Genus database with same CATH topology
2BEZF 4H0LB 1ZOYC 2E76D 2WSEJ 1U57A 3AEBC 3T97B 4H13D 1FDIA 1KQGB 4YXDC 4OGQB 4R4LA 4R4MA 1JB0J 2K9YA 1KTMA 4H13B 3AEDC 1GMJA 2MKVA 2QJKC 1KMIZ 1OMIA 2ZT9C 1YQ3C 4KT0J 1UIXA 3SFDC 3C8VA 3Q5PA 2V7QJ 2G8YA 3AE9C 3SFEC 2JP3A 1OW8A 3AE5C 1VF5D 4OGQC 2O01J 1S1CX 1KQFB 1DIPA 4H13C 4I7ZC 1AJYA 4PV1D 3AEGC 3R4YA 4H0LD 3AE1C 4H44C 1NYHA 2ZT9D 4XFJA 2BEQD 2NZ2A 5M1BA 2J5UA 1KILE 3Q1MA 4I7ZB 4YTPC 1MKMA 3RL0g 2FXPA 2H89C 3AE7C 2E76C 5L8RJ 4H44B 2D2CD 3RK3E 1FDOA 5KKZC 4H44D 2JO1A 1OW6A 1HJ0A 3Q5SA 1EXIA 1PV3A 2E74D 2QIWA 3H25A 2QSIA 2G3AA 1R8EA 3AEFC 2E76B 4U7JA 3ABVC 2FYNC 3AE8C 1PL5A 1VF5C 3Q5RA 1YQ4C 1ZRTE 4Z1MH 2D2CC 3D70A 4Y28J 1TU3F 4TT3H 3G9RA 1ZMEC 1NGMB 1PIXA 3D71A 2E75D 1VF5B 2YMKA 2QJYC 1WMKA 2QJPC 3Q2YA 3AECC 2D2CB 2FBWC 2E74B 1ZP0C 3GF7A 3AE4C 3AE2C 3O6QA 2WSCJ 3AE6C 1OW7A 1RQUA 1K05A 3Q3DA 4PV1B 3AEEC 2WPVB 2E75C 1HF9A 2E74C 4RKUJ 3IN6A 2OQQA 2H88C 2WQYC 4IL6X 3GMAA 4OGQD 1RQVA 3FGAD 3S9OA 3D6YA 4GDOA 1S5LX 3B71A 4PV1C 2IDBA 3D6ZA 1EXJA 1VL2A 1Y9BA 2E75B 4H0LC 3LW5J 2P10A 5KLIC 3GLMA 1KORA 1Q90D 2WSFJ 3EWKA 3IAOA 2YIUC 1IK7A 1DD4A 3AEAC 1DD3A 3AE3C 1K04A 2ZT9B 3GF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0L B;  1ZRT E;  2WPV B;  2WSE J;  4RKU J;  4Y28 J;  4OGQ B;  4I7Z B;  1JB0 J;  2K9Y A;  4H13 B;  2QJK C;  1S5L X;  5L8R J;  4H44 B;  4KT0 J;  1VF5 B;  3C8V A;  2QJY C;  2QJP C;  5KKZ C;  2E75 B;  4PV1 B;  2D2C B;  3LW5 J;  5KLI C;  2E74 B;  1Q90 D;  2WSF J;  2O01 J;  2YIU C;  2QIW A;  2QSI A;  2WSC J;  2E76 B;  2ZT9 B;  4IL6 X;  2FYN C; 
#chains in the Genus database with same CATH topology
 2WTY A;  4AIL C;  2E76 D;  2V1D A;  2IU3 A;  4LP8 A;  4H13 D;  4JI0 B;  1PP9 D;  2R3C A;  1DF4 A;  1XNQ B;  5APU A;  5B5E E;  3BCC J;  5JQG B;  3HUS B;  4ZI7 A;  3L71 D;  4DOJ A;  3SYQ A;  1KYO I;  2NLJ C;  5LOV A;  4EYY Q;  5BY1 A;  1GTO A;  3AE9 C;  4LWS B;  4Q6G A;  1PP9 E;  1FXK B;  3ZMS A;  1ZW0 A;  5KMG B;  1ZXG A;  3TET A;  4DCK A;  4JZ2 A;  1NTZ E;  1H2S B;  2GM4 A;  2JGD A;  5IDJ A;  3R4Y A;  2B5U A;  5B5E H;  1G1I A;  1Q43 A;  1YXB A;  1H88 A;  1U96 A;  1IFP A;  4LWS A;  3IAY A;  2Z4E A;  3L72 J;  3KQG A;  4XA4 A;  2C0X A;  1YCI A;  3BAB A;  3T1Y B;  3E89 A;  1VQ7 V;  4MVS A;  1SQX D;  3S3W A;  4F6R A;  4ASV A;  2HJD A;  2ZAE B;  3V2R A;  2ZNJ A;  1G2C B;  4YJ2 A;  2GUZ A;  4DR3 B;  3CL3 D;  5CBO A;  5B5E Z;  3CCE P;  2HOD B;  1NU1 G;  4GIF A;  4TUY B;  1EN4 A;  1THZ A;  1SA0 A;  2QIW A;  2R3S A;  1L4A D;  1YEW A;  3JAL A;  4P2Z A;  2EZP A;  4UCU A;  2QSI A;  3OGI B;  1URF A;  2P4K A;  4DK1 A;  2EZO A;  2F23 A;  3SPI A;  1XTG B;  1WP8 A;  1MAB G;  4JAU A;  1XOU A;  2GTA A;  1L4A A;  3OA7 A;  4FFK A;  4LNU B;  2A06 H;  1ZL8 B;  1EZV I;  3WUU A;  3SWK A;  3CME P;  3FB6 C;  4DV1 O;  2ZKO A;  2KOG A;  2WPD G;  1MG1 A;  3CCU P;  1ZP0 C;  1Q6U A;  1VQK P;  3ZCC A;  2CTR A;  2ZE6 A;  2DW3 A;  1RH5 B;  2M5A A;  2Y9Z A;  3AE6 C;  1R1B A;  3Q3D A;  5KHK A;  3DXR A;  3OW2 U;  5J2U A;  1FZC C;  1XL6 A;  5KLI B;  1QQC A;  5CB4 A;  3M9Q A;  1PV0 A;  3WUV A;  4NTW A;  1BZK A;  1K73 W;  5AW4 B;  1SKV A;  2M5A B;  3SWY A;  5CCG D;  4H37 A;  2NPS D;  4GKJ O;  2RMZ A;  4PEL A;  1LWU A;  5BZB A;  1Q90 D;  5CCG A;  4KHX A;  4I9Q A;  1A02 F;  2VQF B;  1DD4 A;  3AEA C;  2B1I A;  4TQF A;  4IFM A;  1J5E B;  4O4I A;  4DV7 O;  2LR2 A;  3O65 A;  2YXH A;  2KIK A;  5KJ7 A;  1JMK C;  2EUL A;  2Q3I A;  2X0L A;  2YNY A;  3CXH H;  3A7O A;  3BRC A;  3JAM N;  1KB9 I;  2MW2 B;  3D8C A;  3HKB A;  1L0L H;  3H1I J;  4NYK A;  1NTZ D;  5B66 E;  1M93 A;  4DV4 O;  1SQQ J;  3E1I A;  4O9B A;  5AW1 B;  5FLX N;  3AK3 A;  1VQ6 V;  2KI7 B;  3BHP A;  3QNE A;  1K97 A;  1VEW A;  4U3J A;  3AK2 A;  1GN4 A;  4DR4 O;  3Q1M A;  4X65 B;  4FLU A;  5C93 A;  5L3C A;  5LA6 B;  3AG3 C;  3IFX A;  4AHC A;  4IFF A;  1YTF D;  3FX7 A;  4EI2 A;  3LUT B;  4LF4 O;  3SPJ A;  1QHT A;  3IC9 A;  5IYZ A;  2RN9 A;  3M9H A;  1WPB A;  1N36 O;  1PV3 A;  1XEQ A;  4QPK A;  1LGH B;  4BIO A;  3CWB H;  4QMA A;  3RW0 A;  3G6B A;  3ZDM A;  4L74 A;  2I8D A;  3KZI H;  2ZQM A;  3HE5 B;  5KKZ B;  3ICX A;  4DV6 O;  2W8Z A;  3EQ2 A;  1H0T A;  5CA1 A;  3L72 E;  1GTW A;  5GTI H;  3SJC C;  4DW1 A;  2AHY A;  1IC2 A;  4KP4 A;  4C7N B;  1ZTE A;  1O9G A;  5BR8 O;  4LF6 B;  2FBW C;  1KUQ A;  4X62 O;  3ZMV A;  1SVF A;  5CJ4 A;  1RF0 A;  1OCO C;  3LID A;  1YTZ I;  4X1K B;  2AZ0 A;  1Y6X A;  2WLL A;  2EIL C;  1YYC A;  2YS8 A;  3CJH A;  3GHG C;  2PAJ A;  3OMN B;  1FE6 A;  2WPV B;  1LJ2 A;  5LMU B;  3V4Q A;  5CJ0 A;  4KL1 A;  1DLB A;  5KAI E;  5A2Q N;  1S0V A;  5EBL C;  5KLV H;  3ZED A;  2K3R A;  4O4J A;  4PA4 A;  1JM0 A;  1NTK E;  1X8Y A;  2M0B A;  1USE A;  1FXV A;  1BCC D;  3KHU A;  3A0B H;  1GRJ A;  1HVV A;  4GX1 A;  3LSS A;  1XQ8 A;  2OIG A;  4N23 A;  3CC2 P;  1VIB A;  1NKN A;  1KOR A;  1OV9 A;  1VF6 A;  3TCU A;  1ENV A;  5IWA B;  1NJI W;  1HDJ A;  2FYU J;  3V6I A;  3TYY A;  1K5S A;  1M8O B;  2E5Y A;  4FM0 A;  1X0T A;  2R9I A;  1ZOY C;  1P84 E;  2E5L B;  2XAF A;  4U3F H;  1RF1 B;  2N1T A;  3ITK A;  1SQV H;  4R4L A;  1BCC H;  4ZOL A;  2ZDI A;  5AVV B;  4CPG A;  3KZI E;  4LF9 B;  4D6T J;  4DR1 B;  2MKV A;  1N32 B;  1SZT A;  1GDT A;  3RYC A;  3BCC G;  3Q5P A;  1OW8 A;  2Q7G A;  1V54 B;  4WVZ A;  4OGQ C;  2EIM C;  2ZD9 A;  1VQP V;  1SFC B;  3L70 D;  4I7Z C;  3PH0 A;  2JJ1 G;  1M1K W;  3CHX A;  3CX5 D;  3A0H Z;  3AG3 B;  1N2D C;  2FYU H;  4JI3 B;  1AR4 A;  1MZF A;  5E1A C;  3FXE A;  4GOD A;  1CXZ B;  2IBZ H;  3L74 J;  1CI6 A;  5JH7 A;  5IJ9 A;  1TUB B;  4TV8 A;  5LXT B;  1RP3 B;  5CBN A;  1H8E G;  4UB8 Z;  4O4H B;  3CC2 V;  1BHB A;  3A5T A;  1FDO A;  3IR9 A;  5KKZ C;  4P30 A;  4X1Y A;  1URQ B;  1ZLL A;  2KS1 B;  1K9M W;  4DV3 B;  1L0N K;  3I56 V;  1AP5 A;  3EVK A;  4DV0 O;  1OW6 A;  2QTO A;  1AR1 B;  5KUK A;  1FS0 E;  1NVO A;  1JO5 A;  1QX8 A;  3WFV A;  2Q5Z A;  1U7J A;  1GM9 A;  1FOS E;  1P84 D;  3U1A A;  1BE3 D;  3L37 A;  5AVS B;  2RDC A;  1NH4 A;  1KP2 A;  1PPJ E;  1IFI A;  1ZME C;  2QSA A;  1H8H G;  1N0N A;  4PDR A;  5L3D A;  3HKC A;  1IX9 A;  2FYN B;  1IBL B;  1VF5 B;  2AXT H;  5LGT A;  2YMK A;  3FB5 C;  4FMT A;  4J7K A;  2QWR B;  4MT8 A;  4EFB A;  1J5E O;  4MN4 C;  1NTK K;  5AW9 B;  4AQY O;  5AW7 B;  4I0X B;  4WFE A;  1PNM A;  3KCY A;  2QWP B;  5KLV J;  1SS3 A;  5HFM A;  2BCC G;  3LDD A;  1K05 A;  1RQU A;  4J10 A;  2XZR A;  1Q8I A;  3FXD A;  3P8C E;  4JI6 O;  1SQQ H;  5AVX B;  3K9S A;  1LT9 C;  1SES A;  2HG5 D;  3K5N A;  2LJ2 A;  3OUS A;  2A06 G;  4DV5 O;  2WLJ A;  1KBH A;  2H94 A;  4B3M O;  2BOC C;  2QTS A;  2IBZ I;  1BGY E;  1R73 A;  4PDM A;  4Z2W A;  4DR5 B;  1RF1 C;  1EDK A;  2KYV A;  2ZXX A;  1K34 A;  1KZU B;  2ILM A;  2Q7C A;  3OMI B;  2IPP A;  2CH7 A;  1D5A A;  5LMN O;  4JTC B;  4XDL A;  2QEX V;  1RFY A;  1JJ2 U;  4A5U B;  1SA0 B;  2K88 A;  1CI6 B;  1SQX K;  3U59 A;  3H1J J;  1FXH A;  4KJM A;  2Q4P A;  2EIM B;  4I9W A;  1SQP K;  1Y47 A;  1PM9 A;  3OFN G;  3T1H B;  3TK1 A;  3MGN A;  4PJ0 H;  4I4T B;  4DO2 A;  1VQ8 V;  1Y74 B;  4LGD E;  4F6E A;  3ETD A;  2JDI H;  2DQ0 A;  1EM1 A;  3CCJ V;  1VF5 D;  1SQG A;  3CC4 V;  2XDJ A;  1RHZ B;  2HR3 A;  1KQF B;  3QTC A;  1MFT A;  4J7J A;  3R66 A;  2VRZ A;  1LTJ A;  3P3P A;  1KQS U;  1P84 H;  3RK3 C;  1KYO F;  1MA1 A;  2OCH A;  1FZB A;  1L1F A;  2ZT9 D;  5J2U B;  1BCC E;  3UT5 B;  1NTM G;  1Q7Y W;  3OJA B;  4PI2 A;  1AR5 A;  3HKC B;  5EFW B;  3CRC A;  2O3J A;  2ZXW C;  1NT2 B;  3K57 A;  4B3S B;  1RF0 C;  1S4X A;  2N9Y B;  4N3Y B;  2KSD A;  2L91 A;  3ZHS A;  1KP3 A;  2RNB A;  3VMZ A;  3RVZ A;  4RJT A;  2PF4 E;  2SPZ A;  3D3I A;  4YJ2 B;  1JMB A;  2A45 H;  2A0L A;  1EBO A;  3G67 A;  2BCC D;  1N4C A;  1SRY A;  2FYN C;  2CPB A;  2CUG A;  2QDO A;  1LWU B;  4B3R B;  4A7P A;  3NXS A;  1YHQ V;  1CEZ A;  2IX7 C;  1M56 D;  3JAW A;  3L74 D;  2FFD A;  4B3T B;  1Q82 W;  4RES B;  4QNH B;  4K3A A;  1WRG A;  2JK5 C;  3L73 H;  5FPR A;  2KNC A;  5GON A;  1SQB G;  1L0N D;  3H1J D;  4UVA A;  2Q73 A;  2LGQ A;  1LT9 B;  2NNU A;  2E5L O;  2VQE O;  1MSD A;  2NRG A;  2L5G B;  1IFM A;  4Y99 B;  3SYP A;  1LT9 A;  4O2B A;  1DEB A;  1HWT C;  4EFE A;  3QO5 A;  1JCD A;  2UXN A;  2YSU B;  4PD4 H;  2E74 C;  4IFD K;  3FWN A;  1K92 A;  1GO3 F;  2OTJ V;  4HB1 A;  1X22 A;  1JY3 P;  4WWI A;  3S9O A;  1A02 J;  1FKA O;  2WWW A;  4CS3 A;  1GN2 A;  3E83 A;  1PPJ G;  5KMG A;  2QM8 A;  2VQF O;  2HKO A;  3HB3 B;  3WG7 B;  1W0K G;  3VMX A;  5DN6 G;  3L36 A;  1NTZ J;  1ZR4 A;  2K37 A;  4AUW A;  3THO A;  4FLV A;  1N73 C;  1M57 B;  1GD2 E;  3TGU G;  3ETE A;  1JNM A;  3JYC A;  5LHH A;  1SQP G;  2YXL A;  1NKZ B;  2ZVO B;  1VQL P;  3PRJ A;  1NAY A;  2XHB A;  2Y0P A;  1KTM A;  3F89 A;  2UUA B;  1D7M A;  2UU9 B;  2ZT9 C;  2OYQ A;  1YQ3 C;  1WA8 B;  2G8Y A;  2YDE A;  4GKK O;  2JP3 A;  2Q0O C;  1FZC A;  3DGE A;  5KTB A;  3E22 A;  2O01 J;  1M90 W;  1QEX A;  3B8N A;  2RH0 A;  2FYU E;  3C1L A;  1K3E A;  3OTO B;  1HGZ A;  2YXQ B;  4LLH A;  4JYA B;  2OTJ P;  2YUA A;  1T2K D;  2CTW A;  1NU1 H;  3B5N D;  4I7Z B;  3L73 J;  4LF4 B;  3RL0 g;  4X64 B;  5JQG A;  5B66 H;  3CPW U;  4AQY B;  2BCC J;  1BDD A;  5H2F E;  1FJP A;  2FXO A;  2DQ3 A;  5CN0 A;  2JO1 A;  4B08 A;  4OPA A;  1EXI A;  4PHZ A;  3H25 A;  4IIJ A;  3Q4H A;  1R6K A;  1BE3 E;  3UO2 A;  4PA7 A;  3ZHT A;  1LUW A;  1KC8 W;  2QKS A;  3II6 A;  1SZX A;  4L76 A;  4IIJ B;  2JVD A;  2Z5U A;  3TXS A;  5CBH A;  3H1K G;  5CB4 B;  4JTA B;  4X66 O;  2YO2 A;  4L75 A;  1M56 B;  2JS3 A;  2D2C C;  4ZHQ A;  4EOT A;  4KHP O;  3CRA A;  3FWL A;  3L73 D;  4D7T A;  2YXY A;  1OZ0 A;  4MTG A;  5H6R A;  1GH6 A;  1EZV H;  2LFS A;  2M6Y A;  4YHH O;  1KQL A;  1YIT V;  3H1H G;  4NXM B;  3UO3 A;  2YIA A;  3A2F A;  4LFB O;  4GOE A;  5LMN B;  2P06 A;  3VN0 A;  3JCU H;  1Q3E A;  1N8R W;  3S3X A;  1W5C E;  2KB7 P;  2N74 A;  4BW5 A;  4GT1 A;  2IJK A;  1XDC A;  2HEP A;  2RN0 A;  5KHH A;  3VMA A;  2P5O A;  2KSJ A;  3L71 J;  1VQ7 P;  2ZE5 A;  2ITA A;  1UJW B;  1ROP A;  3BCC E;  4MVM A;  2WMM A;  1UFI A;  3L74 G;  2WQY C;  4B7K A;  1RQV A;  1SQX E;  5TIS H;  1AJQ A;  1NHL A;  5LGU A;  3W67 A;  2OTL P;  1YJ9 V;  1JX9 A;  4LF8 B;  1AB3 A;  2YIB A;  4Q20 A;  4TUY A;  4DR6 O;  2HFE D;  3SJQ C;  3F7Y C;  2NPS A;  2WIT A;  1HTL C;  3QF7 A;  4OVN F;  4G27 B;  1FC2 C;  3H1K E;  3MIW A;  4U3F D;  4I4T A;  1QL2 A;  2RJZ A;  1K8A Q;  2R72 A;  3HTK A;  1ZL8 A;  3GG2 A;  1HW7 A;  1KU9 A;  2DYR C;  1N7S C;  3ZHR A;  1QVF U;  2IYP A;  2OTK E;  3K08 A;  3MAQ A;  1EZV G;  4N78 D;  3UQ8 A;  2KSE A;  3T4Z A;  3K5L A;  1SQB K;  3H1K J;  1HNZ B;  1J1E C;  1NR7 A;  4EKW A;  5BMV A;  1JJO A;  2BOB C;  3DC5 A;  4LBE C;  5B3S C;  2XAJ A;  3AG1 B;  2J59 M;  3BVO A;  2QJK C;  1BSM A;  4JYB A;  5AG2 A;  2FFD C;  3H1I D;  2RQ6 A;  1T2K C;  1Q7Y Q;  2HVJ C;  3R65 A;  3UT5 A;  1VQN V;  4WY4 B;  2LGW A;  4JPR A;  1Z56 A;  1BGY J;  3TXQ A;  2Z5I A;  1YI2 P;  4YXW H;  1VP7 A;  4GKJ B;  5LOV B;  1G2C A;  4GX2 A;  3H1L J;  2RCV A;  2QG4 A;  5IE9 A;  3LDC A;  4OXS A;  4JI7 O;  3W7U A;  1M57 D;  3M91 A;  1T6A A;  2PI4 A;  3IF4 A;  2YEV B;  2DYS C;  4R6Z A;  3RFR A;  4UCR A;  2WA4 A;  3V2Q A;  3NR7 A;  3MD0 A;  3QWO C;  1HR0 O;  3ZMZ A;  4DK0 A;  2GBO A;  3HKE B;  2E76 C;  4AYC A;  1FPO A;  5JCO C;  2ITC C;  4DXW A;  2X6B A;  2VQE B;  1ORQ C;  3SYC A;  5E79 E;  3NFQ A;  3L70 H;  2K1E A;  3L9D A;  4FZ1 A;  1HJ0 A;  2DJV A;  3JD1 A;  3ZS8 C;  3PTZ A;  3RL0 C;  1BQZ A;  2ZDI C;  3ZX6 A;  3ABV C;  3CRR A;  1PL0 A;  4J7Z A;  5LXT A;  2P1J A;  5LP6 C;  2C9L Y;  4LF7 B;  4J11 A;  1RE4 C;  3TSI A;  1YIJ P;  5KX5 A;  4K8Z A;  3SJB C;  3TF5 A;  2ODM A;  4AI8 A;  2DN9 A;  4NTY A;  4DR4 B;  2IYO A;  2IU0 A;  1NTM E;  3JAK B;  1WLE A;  3C90 A;  5GW7 A;  1P4R A;  2EX3 A;  1SQB D;  3H1J G;  2R32 A;  4F4L A;  1VQ6 P;  3GF7 A;  4NPF X;  1NVP B;  3AE4 C;  1NJI Q;  3APQ A;  4XE5 B;  3M0A A;  1Z5V A;  4KXR A;  4ZOL B;  1SFC D;  2V4H A;  4J42 A;  1NTK D;  1P7G A;  1Y66 A;  4WFH A;  2I1K A;  1YSC A;  2OCC C;  1WN7 A;  2H8P D;  4NB5 A;  2Q68 A;  1S2E A;  3FGA D;  3X2Q C;  1SFC A;  4GDO A;  1I94 B;  4K8X A;  2PY5 A;  3AK1 A;  2HP8 A;  5KHJ A;  4H0L C;  2P7T C;  1Y8A A;  3CC7 V;  1AVO A;  3SYA A;  3ASO C;  5APX A;  1VQ9 P;  1PD3 A;  3G71 V;  3BPZ A;  1WB7 A;  5BR8 B;  1BSN A;  4LF6 O;  2POH A;  1I0H A;  1PGP A;  3L72 G;  3TDK A;  4JI2 B;  1NTM K;  1CW5 A;  2ZM6 B;  1DTO A;  4X62 B;  1YIJ V;  1K04 A;  5APQ A;  3GF3 A;  1E1Q G;  3ASN C;  2YC0 A;  1EDL A;  1CPY A;  4X64 O;  4DUY B;  1S5J A;  1GL2 C;  4WY4 C;  5BU8 B;  2IZ1 A;  1FDM A;  3K58 A;  3P8C D;  1GK9 A;  1YZB A;  1KQG B;  2Q8V A;  5B1N A;  4MSW C;  1JB0 J;  4HAM A;  4K0K B;  3S4R A;  1GKF A;  1M57 C;  3RL0 D;  3F7V C;  3MHH C;  5AW8 B;  4JV5 O;  2NN4 A;  3RWR D;  5LMU O;  1S77 D;  1JY2 O;  1JTH A;  2YKO A;  2ZIN A;  3H6P A;  4N6J A;  5E79 Z;  1VQM P;  5AW5 B;  3ZMT A;  3DTU B;  4PD4 E;  2WZ7 A;  2PTM A;  3HD7 D;  1AJY A;  1PNK A;  4IHJ B;  3EFF K;  2ETN A;  1NH2 B;  1OJH A;  1GM8 A;  4DUZ B;  1NWQ A;  1US6 A;  4GUN A;  4W7Y A;  4UCS A;  2EBO A;  4NTX A;  5LHG A;  5CMZ A;  2W6I G;  1FFX A;  3CCQ P;  3UCS C;  2LXB A;  4LFB B;  2QKA A;  1LTJ B;  2FXP A;  3MUD A;  3MZW B;  1OVV A;  3CRM A;  3T97 A;  1XNR B;  1JY3 N;  2LQT A;  1JY2 N;  1FAV A;  3VP9 A;  1H2G A;  4B3R O;  2WSS H;  5HFL A;  4X20 A;  2Y0E A;  2ZYA A;  2HYN A;  1HNW O;  3AEI A;  4Z1M H;  2F95 B;  4XDK A;  2Y0I A;  4GCZ A;  1NR1 A;  3BAT A;  3HE5 A;  4JI3 O;  1IBM B;  3L75 G;  2BTO A;  2MJZ A;  4LC1 A;  1M90 Q;  2A06 E;  5EIB D;  1SC5 B;  1XL4 A;  2JIZ G;  3OD4 A;  4X89 A;  1EQ7 A;  2D2C B;  1Y76 A;  3H01 A;  3L73 E;  3LNN A;  4KFM A;  5GTH H;  1YJN P;  3H32 A;  1AI4 A;  1U97 A;  1NU1 K;  1KKD A;  1MUU A;  3RGU A;  1TVK B;  3X2Q B;  4X1K A;  1LTB C;  3JCZ A;  1SQQ K;  1BHA A;  3JAR A;  3P8M C;  3AEE C;  2A9H A;  2JEU A;  4YXW G;  4RKU J;  1PPJ H;  5DJU B;  1TGO A;  2ZE8 A;  2JWD A;  2W83 C;  4FVM A;  3H1I H;  1L0L J;  4ZIB A;  5ITZ A;  2YKQ A;  3H1K D;  4ZNC A;  2Y9Y A;  1GK6 A;  3SYO A;  3VBB A;  1QLE B;  3U0Z A;  1EXJ A;  3I55 P;  3NMD A;  1R3L C;  3ASN B;  1L4A B;  2YIC A;  2J58 A;  2QRX A;  3SWF A;  3EWK A;  2QM4 A;  2WVR A;  4I1L A;  4WCE V;  3T4D A;  5APY A;  5JJN B;  4MTX A;  1S72 V;  5AVQ B;  2A3Q A;  1IZ3 A;  3GB7 C;  5B1B C;  3SPG A;  2UUB B;  5BMV B;  3M8A A;  3L74 E;  1PL4 A;  1BCC J;  1OCC B;  4YXD C;  3CCS P;  1Y67 A;  4JI6 B;  4GKK B;  4UB6 E;  2KKW A;  1YHQ P;  3TNU B;  3SDL A;  1BGY H;  1SET A;  2CAZ C;  4CH6 A;  4LCU C;  3H1H H;  4UV8 A;  3RN4 A;  3RYF A;  2O01 N;  2Q6A A;  2Z0A A;  3VOU A;  1S5L H;  4C46 A;  1D5N A;  3AG1 C;  4O4H A;  3HUS C;  4PDV A;  2QJK B;  1L0N G;  4CS4 A;  1NYH A;  2KLV A;  2BEQ D;  1KQS O;  1VAR A;  5GTH E;  4RUE A;  2W0F C;  1PP9 G;  4CH3 A;  5M1B A;  1XBL A;  3DSQ A;  3VQY A;  3JD4 A;  5CCH A;  2IBZ G;  1GN3 A;  4OX9 O;  4BW9 A;  1XMO O;  2Z5H A;  1X59 A;  3B77 A;  2UXX A;  5EBM C;  3EFG A;  1NQT A;  2L35 A;  3NTN A;  1SQV D;  1M4U A;  4D6T H;  1FBM A;  1HNX B;  4U3F G;  4CH5 A;  4U7N A;  2KB1 A;  4H44 D;  1S72 P;  1VQO P;  2IFN A;  4LF5 B;  3SGI A;  1Q81 W;  1F23 A;  1VQ4 P;  3CS5 A;  1P84 F;  4LNU A;  1PZQ A;  1J1D C;  1ZLZ A;  3H1L E;  4JI4 B;  2FB5 A;  3G6E V;  4LH7 A;  2QA4 V;  1FOS F;  3L4F A;  1VMG A;  2ZIO A;  3L71 H;  1K33 A;  2IJH A;  1BCC G;  2JDI G;  1SP4 A;  2KXP B;  1OCO B;  1OCR B;  2CK3 H;  3A3Y B;  2K1A A;  4IL6 H;  2UXB O;  2LFR A;  3JD3 A;  1NGM B;  3G80 A;  3Q4H B;  3OW2 O;  1TA8 A;  5CCH C;  2A06 D;  4GOF A;  2QJY C;  3ZBH A;  2LKM A;  2CGO A;  1JOY A;  3R2P A;  5FPO A;  4B3S O;  3L75 J;  4DV1 B;  3CCM V;  1LP1 B;  4DUY O;  1GM7 A;  4ZKU A;  1KV4 A;  4FIP C;  3HRN A;  4WB4 A;  4P9O A;  4LH6 A;  4YIP A;  4LFA O;  4UCT A;  1V9P A;  2QWO B;  3TJT A;  4JI5 O;  2YKP A;  3BCC D;  4HZ3 A;  2H88 C;  1PP9 J;  2Q5U A;  3GMA A;  2Q7H A;  1F7Y A;  5IY5 B;  3K0D A;  2DWD C;  1FZC B;  2KG7 B;  3OGC C;  2OCC B;  3CYO A;  2GUV A;  4JI8 B;  5AW2 B;  2Y4T A;  4DRX B;  5FNV A;  1L0N J;  4FK5 C;  4D6T E;  2GA1 A;  2B9Z A;  5L3E A;  3CB2 A;  4FLW A;  4NVP A;  3FX0 A;  1FYJ A;  2Y48 A;  2UXD O;  2LXC B;  4OGQ B;  3PN1 A;  1KD1 Q;  4R4M A;  1KYO H;  3D3Q A;  1SQB H;  2P6J A;  2GV9 A;  4H13 B;  1H38 A;  4JQ0 D;  1KMI Z;  2BTQ A;  1Q6H A;  5DED A;  1AQ5 A;  1R3J C;  4DRX A;  4KUM A;  1LP1 A;  1KYO D;  2WLI A;  1NBM G;  3FB8 C;  3BA8 A;  4UUJ C;  4JI7 B;  1GL2 A;  2EJ7 A;  4G28 B;  4CBC A;  1HNW B;  1S1C X;  5CA3 A;  3A0H H;  2GTS A;  2JGD B;  4X88 A;  1PNL A;  1R5S A;  1YDX A;  1PKX A;  1BT8 A;  1VF6 C;  1KYO E;  3N2G B;  4X8A A;  1P7B A;  2VS0 A;  1SQB E;  1T5E A;  4H44 C;  3CPW O;  4XFJ A;  2JWA A;  1L0L G;  2P58 A;  1I7F A;  4HKZ H;  2VWK A;  1XHX A;  3FD9 A;  1QCE A;  5KUM A;  1WA8 A;  2IH3 C;  4GX5 A;  2AGA A;  4C7N A;  5LGN A;  1MKM A;  2OYO A;  2H89 C;  1YJW P;  4HBN A;  1SQP D;  1J1D B;  5IJ0 B;  2W27 A;  3SSU A;  5GON B;  2MK3 A;  2OTL V;  2AXC A;  2JR8 A;  1YJ9 P;  1LTI C;  2DWE C;  2GDS A;  4MTO A;  1KIL C;  3CCR P;  1KKC A;  3QG5 A;  1LTJ C;  3K3W A;  2XTA A;  3BFR A;  5IT9 N;  1FZF A;  1H2K A;  1OWA A;  1VF5 C;  1YQ4 C;  2QJY B;  4YIO A;  2HPC A;  1OHH G;  3UIA A;  2ZNI A;  3V2P A;  1SQX J;  3L75 D;  1K73 Q;  4DV6 B;  5KLV E;  3ZN0 A;  1QLE D;  5IYB O;  2Q3E A;  1ZV8 A;  1NTM H;  2JJL A;  1VQ5 V;  1M1J B;  3ZIA G;  3STL C;  4RO2 A;  1Q86 Q;  2NR5 A;  1S76 D;  4E4E A;  5KA6 A;  3AG2 C;  1NTZ G;  1RE3 C;  4I6M C;  2QJP B;  4FFB B;  2E75 C;  3CCV P;  1FXK A;  3U10 A;  4WY4 A;  3AG7 A;  3DXR B;  1MZ9 A;  4JTD B;  2YO3 A;  3IFM A;  2JEX A;  3CE2 A;  3CCE V;  4X66 B;  3VQV A;  3ZRW A;  1O9H A;  4KHP B;  5K1X A;  4RQF A;  2JGU A;  3ZHQ A;  1HJB A;  3JCU E;  1Q5O A;  3S1K A;  3CCR V;  2P10 A;  3GW6 A;  1MFZ A;  2KZI A;  5B1O A;  4NXM O;  1JUN A;  2B1G A;  4O4I B;  2GUZ B;  5EZY B;  3L75 E;  4X9Q A;  2IW5 A;  2OYI A;  2W0X A;  4I5S A;  5AW0 B;  5IWA O;  3RT3 C;  4GX0 A;  4PA9 A;  3AEB C;  4EB6 A;  4GLX A;  4RQE A;  3JD0 A;  1HNX O;  1YIT P;  2CH7 B;  4UCV A;  1AFO A;  2K9Y A;  1SQX G;  3K04 A;  5B1B B;  2BCC E;  2RMK B;  3CXH F;  3O9O A;  3CRQ A;  3WB2 A;  4DV2 O;  3RK3 B;  4TV9 A;  5BVZ A;  4JYY A;  1VQK V;  1OCC C;  1VQ5 P;  1KN7 A;  3CX5 F;  1N86 A;  2FML A;  2WLN A;  1Y76 B;  1N32 O;  5GTH Z;  1XIL A;  3L72 D;  4M3L A;  1HP8 A;  1RPO A;  4NPD A;  3IGA C;  3J7A U;  1AI6 A;  5KAI H;  5ITZ B;  3FYI B;  2ZXW B;  3CCV V;  1AA0 A;  1KC8 Q;  3QO8 A;  1AQT A;  2ATK C;  5APT A;  3ZRS A;  1V54 C;  1D2D A;  4OWF A;  4HYO A;  5AVW B;  3E86 A;  5LL6 Y;  3K5M A;  1K5Q A;  3V4W A;  2O1K A;  4EEQ A;  1KIL B;  1DX7 A;  1FJG O;  2W90 A;  1QGK B;  2YXR B;  3AE7 C;  4PA3 A;  4O4L A;  1PP9 H;  4H33 A;  4ZHQ B;  3HD7 A;  1VF7 A;  5EYP B;  4PD4 I;  1RF1 A;  2HHH O;  2OYH B;  2QR4 A;  3RK2 B;  3Q5S A;  3STZ C;  1FS0 G;  1SQV E;  2OAR A;  3CC7 P;  3KZI Z;  3PJS K;  1K8A W;  1NH2 D;  2IM9 A;  4J9Z B;  1VQ9 V;  5CBF A;  2M8R A;  2B88 A;  5L3B A;  4DV0 B;  1IDS A;  4TWK A;  5IJ9 B;  1URQ C;  2LO1 A;  4X1I A;  4BIZ A;  1SQQ E;  4Y28 J;  2PGD A;  3CXC U;  4TT3 H;  1OCZ C;  4Z1V A;  4N21 A;  2V7Q G;  5B1A C;  1SLQ A;  2JKV A;  3CWB E;  2Q7E A;  3ZRX A;  2E75 D;  2QJP C;  4CZZ A;  5L3F A;  1IJD B;  1NKD A;  4W4K A;  4GYC B;  1HR0 B;  2FY8 A;  2E74 B;  1OCR C;  2FYU D;  4ASU G;  2CTQ A;  2PUS A;  4QIW F;  2UXD B;  3A0R A;  1TUB A;  1W59 A;  3CI9 A;  1RPR A;  1S3J A;  3WG7 C;  3E8B A;  2O1J A;  3B8M A;  1SQV K;  3HPL C;  2N9B A;  4FM2 A;  1Y74 A;  2V7Q H;  3D6Y A;  1YVW A;  3JAT A;  3G4S V;  4BAY A;  1S5H C;  2AEJ A;  5KA5 A;  3CCQ V;  2VRS A;  4FZ0 A;  5LYJ B;  4LFC B;  2W6J H;  4BRY B;  1Q81 Q;  2P22 C;  2X7R B;  2F4V B;  4TSF G;  3H1L D;  4RUF A;  1S9K E;  1SQF A;  2OGU A;  3GLM A;  5K5G B;  4DV7 B;  4NKG B;  5KLV G;  2CE4 A;  3TGU E;  2N1T D;  4BRY A;  2YID A;  1IK7 A;  2Q6Q A;  1P84 I;  5CMU A;  4MTF A;  1NZ6 A;  1IK9 A;  2ZT9 B;  3B40 A;  4JI1 B;  4JF7 A;  1QNM A;  1OX3 A;  2G38 A;  3BAA A;  3C3T A;  5IYZ B;  3H1I G;  3T97 B;  1T8Z A;  3OUF A;  3GHG A;  4CC6 A;  2P67 A;  1FU1 A;  4O4L B;  3RK3 D;  2KK7 A;  1RSO A;  1OMI A;  3BRV B;  3DC6 A;  1Q82 Q;  5GTI Z;  2UUC O;  4DV4 B;  2V7Q J;  2IBZ E;  2I1J A;  3CP1 A;  2Q9L A;  1XHZ A;  3T1H O;  2ZR2 A;  2PGG A;  1USD A;  5APS A;  5EC2 C;  2OIE A;  2XND H;  3ABK B;  1R5L A;  2BE3 A;  2ZR3 A;  3TNU A;  4ASW A;  4ICG A;  1WP7 A;  1YBK A;  2P90 A;  1SER A;  1Z2G A;  4XBF A;  3N2K B;  1QU7 A;  3J80 N;  2ZXE B;  1RY3 A;  2FXM A;  1JTH B;  1HWY A;  2ZM6 O;  1KIL E;  3OR7 C;  3HKB B;  1RE4 A;  3CWB G;  1BGY D;  3RYI B;  2XND G;  4CH4 A;  4IGG A;  1X4T A;  4YTP C;  1S5L E;  4OH8 B;  4I55 A;  1PFI A;  1GW4 A;  2WSS G;  5KAF E;  2WA3 A;  3ML0 A;  1BQ0 A;  2O57 A;  3MHV A;  1M56 C;  3E1R A;  1N0J A;  3L71 G;  1NTK H;  2G3A A;  4FLT A;  2QWN B;  3HTK B;  5B1A B;  4U7J A;  1KIL A;  4L8J A;  5LA6 A;  3RBX A;  1IBK B;  3SPH A;  5EK0 A;  3LNM B;  3AE8 C;  1AVY A;  4QE9 A;  3VOP A;  3TGU H;  2OWO A;  1H8A A;  3E8H A;  4QPJ A;  1LUV A;  3WMM 0;  3OAA G;  4RWU A;  4G2K A;  1LR1 A;  1JPX A;  2FTK A;  4DUZ O;  1SQB J;  1JFF B;  5APV A;  1CP9 A;  2EIL B;  1BS3 A;  5CBG A;  3RYH B;  1ARO P;  3QVN A;  2W6J G;  2VWJ A;  2PZS A;  1JQ0 A;  4JF3 A;  1R3K C;  1IZN B;  2AEM A;  4MVR A;  1JMM A;  3HD7 B;  3ZN1 A;  3VTP C;  4LFA B;  4FFB A;  4NXN B;  3RYH A;  3RK2 D;  4JI5 B;  3AE2 C;  3O6Q A;  1L0N H;  1A32 A;  2Y69 B;  2XNX A;  2M3E A;  3I5C A;  5DEC A;  1U7M A;  1M9N A;  1GAX A;  3ABM B;  1W2E A;  3M9B A;  1M1J C;  2IZ0 A;  3CX5 I;  1XMQ O;  3L74 H;  5J9P C;  4HJG H;  4DV2 B;  2OQQ A;  3CCL P;  1N7S A;  1KB9 E;  3H32 B;  2XAH A;  2Y4U A;  1S5L X;  1AJP A;  5KX5 B;  2C9N Y;  2BSK A;  2E75 B;  5KLI C;  2QKC A;  1URQ A;  2KS1 A;  1XTC C;  5JVD A;  3A8T A;  1R6N A;  2QE7 G;  1MZE A;  4J80 A;  4I55 B;  4O2A A;  5B3S B;  2D3O W;  3OEE G;  3K5B A;  5KAF H;  2EJR A;  1VQO V;  3AE3 C;  2ZYD A;  5JWP A;  1MMM A;  3RYI A;  2ZVN B;  1BE3 G;  4IL6 X;  3J81 N;  1DEE G;  3L70 E;  2R9R B;  4LF9 O;  3KPE A;  3D36 A;  1EZV D;  4DR2 B;  3CD6 P;  1N33 B;  4BWA A;  3M7M X;  3C3S A;  1ZN5 A;  1MOF A;  2QM7 A;  5LYJ A;  3K0G A;  1N73 B;  4FPP A;  3ABK C;  1JR9 A;  1JY2 P;  2HHH B;  1SFC C;  4UB8 E;  1G8M A;  3MTU E;  1RM1 B;  1T3J A;  4DJG A;  3SFE C;  2LW7 A;  4U3J B;  3CSX A;  2QVA A;  4PD4 F;  3M0D A;  4WFG A;  2FKX A;  5LBQ A;  4PD4 D;  3LSU A;  3RYC B;  1X79 B;  4MW3 A;  1HUC A;  3TGU D;  4H0L D;  1FFX B;  5DM6 V;  4W4L A;  2HLD G;  2IFM A;  1XUQ A;  1GZL A;  4YY3 O;  1ZX3 A;  4QJF B;  1NOH A;  1WNS A;  1FZE A;  3E35 A;  3ZRV A;  1HBW A;  3P30 A;  4JYA O;  1OIP A;  3H9V A;  4K35 A;  1G1X B;  2ADP A;  2L6L A;  4DV3 O;  1LTS C;  3HUS A;  3W68 A;  2B87 A;  1H2L A;  4IL6 E;  3JAL B;  3L75 H;  1G1J A;  1GL2 D;  2D2C D;  3A2A A;  3ABT A;  4QGP A;  3O8Z A;  3L70 G;  3ZHU A;  2KQX A;  4J41 A;  1NO4 A;  3CD6 V;  5KHG A;  2WLM A;  1OFC X;  4HYT B;  4JBZ A;  3CCS V;  3Q5R A;  1ZRT E;  2NPS C;  3HE4 A;  1NTM J;  3RK2 C;  3HD7 C;  5J2T A;  4AQR D;  3BVH A;  2R70 A;  3RGB A;  3CLQ A;  1VQ8 P;  1SQP H;  2F4V O;  1PGJ A;  1AI7 A;  2EIK C;  2WPS A;  3CCJ P;  4OPH A;  4TV8 B;  1EN5 A;  1SQX H;  2JJ2 G;  2Y69 C;  3JAS A;  3UKM A;  4DR7 O;  1ZRT D;  5TIS E;  1WMK A;  5JJJ B;  2HOD A;  3USS A;  1R6T A;  4WFA V;  1OCZ B;  4O2B B;  4L73 A;  2IJI A;  2P7J A;  1WJZ A;  2FL4 A;  1XNQ O;  5K1P A;  5AW3 B;  3OMA B;  3CMA V;  4LF5 O;  2E3C A;  3IN6 A;  1ZR2 A;  4B3M B;  3UM7 A;  4JI4 O;  5LHI A;  1J95 A;  2DW4 A;  1FJK A;  3APO A;  2WLK A;  1B6Q A;  1BE3 H;  1EN6 A;  1CSB A;  3MHS C;  3GHG B;  4W80 A;  3N27 A;  2UWJ E;  1IFD A;  5IYC O;  2UXB B;  5KLV D;  1VQ4 V;  4BIU A;  3KCX A;  3CWB J;  1NVP D;  2HG5 C;  4QE7 A;  1H89 A;  1NTZ H;  4MVO A;  3L72 H;  1QL1 A;  5AVT B;  3HKD A;  2WSE J;  1PGO A;  1FDI A;  2YIU B;  2W6B A;  1KB9 H;  3PHL A;  1WB8 A;  2EIJ B;  5H2F Z;  1QBZ A;  4YJ3 A;  2B87 B;  4ZKP A;  5FNV B;  1BE3 J;  4KT0 J;  4GZR B;  1KFN A;  1HNZ O;  1KB9 D;  1K7D A;  2DE0 X;  1NU1 E;  2XU6 A;  1QVG O;  1BMF G;  3HKE A;  2YI8 A;  4TT3 G;  3EHB B;  4JZG A;  1IVS A;  1WT6 A;  3MUD C;  2R9A A;  3CCU V;  2FFD B;  1RE3 A;  1QVG U;  5TJH A;  2KZJ A;  1UII A;  4JI8 O;  3E22 B;  1NU1 J;  5AW6 B;  5B66 Z;  5FL7 G;  1JVM A;  5EBW C;  1L8D A;  2WLI B;  3U11 A;  2ITD C;  5CHX A;  4RAI A;  1W2B U;  2QGN A;  3H1L G;  3WB1 A;  2GHY A;  2WSF H;  3OEH G;  4NXN O;  3PP5 A;  1L0L K;  4PA6 A;  3WU2 E;  4GKG A;  2XT9 A;  1N34 B;  4PI0 A;  2FYU K;  3F5H A;  5DJT B;  2NPS B;  3JSL A;  4JAS A;  3PLN A;  2GSM B;  1LWU C;  3H1I E;  3HKD B;  4U3F E;  1EZV E;  5LP6 A;  1KFM A;  1OVR A;  1SQV G;  2PI5 A;  4HH2 A;  4U7O A;  3IC7 A;  3JSN A;  2ZIM A;  1VQL V;  1PL5 A;  2OYH A;  1Z5W A;  3F5T A;  4UV9 A;  5EYP A;  1P49 A;  2KUB A;  5H2F H;  3D70 A;  2HVK C;  1TU3 F;  3ABU A;  3BEH A;  4D6T D;  5IJ0 A;  3L35 A;  3B5N B;  4LF7 O;  1QR9 A;  4R7C A;  2YMY A;  1I5X A;  1EC5 A;  4IYI A;  2WPR A;  1TUE B;  4JAA A;  2PRR A;  3BY6 A;  2H8P C;  3AEC C;  1JOC A;  4CC5 A;  3RYF B;  2XUM A;  1CZQ A;  1MV8 A;  4UCO A;  1L0N E;  1VQN P;  1ZWI C;  5H9C A;  3U1C A;  2A45 I;  1G6U A;  1Q6I A;  1YI2 V;  3N4X A;  1FZA A;  3EXA A;  1B06 A;  4PV1 B;  2KP8 A;  2Z3Y A;  4FJC C;  4TV9 B;  3W7X A;  4LFC O;  3ZMU A;  4OGQ D;  2BTQ B;  1N7L A;  4YPC A;  3CXH E;  3M0D C;  1NAF A;  2ADQ B;  3SPC A;  3ABM C;  3OR6 C;  4R50 A;  5H5N A;  2N05 A;  2YIU C;  4JI1 O;  4B86 A;  2EIJ C;  4YY3 B;  2P2U A;  5KJ7 D;  3WU2 H;  4ZBM A;  1EFR G;  3F5W C;  3K9A A;  4H0L B;  2BEZ F;  1PGQ A;  2HPC B;  5A9G A;  2OT5 A;  3H1H J;  2UU9 O;  1GW3 A;  2E42 A;  1W2B O;  3HR0 A;  3N7N A;  2A7W A;  2XAG A;  2WSE H;  3CME V;  4TQD A;  2EIN B;  3H1L H;  1E79 G;  3AED C;  1S9K D;  3K5O A;  2ZYG A;  3L71 E;  4I0X A;  1BL8 A;  1COW G;  1NTK J;  3W7W A;  1F4M A;  1GL2 B;  4FM1 A;  2CDY A;  3H1J E;  5KLV K;  4IL6 Z;  1HGV A;  3E7K A;  4WBN A;  1VDF A;  2ZJS E;  3BRT B;  3B09 A;  2F1M A;  5AVR B;  1TAE A;  1RM1 C;  2ARH A;  3GWK C;  3KG2 A;  1HH0 A;  3L70 J;  4HNA A;  5AVU B;  2Y0C A;  2KNC B;  2J5U A;  2V4D A;  1IXB A;  2A79 B;  3N2G A;  2FYZ A;  3JD2 A;  2IBZ D;  4DYL A;  4IT5 A;  1N73 A;  5L8R J;  1I08 A;  3JSV C;  3B4S A;  3RK3 E;  2C2A A;  5J2T B;  3G4S P;  3CX5 H;  1GU5 A;  1IBK O;  2M3B A;  2UXC B;  4L87 A;  2LP7 A;  1SQQ D;  3WU2 Z;  3B5N C;  1XNR O;  4MVU A;  4O2A B;  3BA9 A;  3G71 P;  2Q67 A;  2KLU A;  4PJ0 Z;  4RO0 A;  1SQP J;  1IXM A;  1H2M A;  3CWB D;  3VQX A;  2XV5 A;  4YHH B;  2JS5 A;  3FFQ A;  5E79 H;  1I5Y A;  3G9R A;  1B04 A;  1EDI A;  1S5L Z;  1LT1 A;  4O4J B;  1ZAU A;  1E79 H;  5F2V O;  3GVM A;  1K4D C;  3FAV B;  2RKL A;  4FLZ A;  1IBM O;  3TGU J;  1FJG B;  2X6C A;  5BXZ A;  1K4C C;  2EIK B;  2LW1 A;  1MNG A;  2WSC J;  1XMQ B;  2WAM A;  2YIB D;  1NTM D;  3I5D A;  3H1J H;  4JAV A;  4JYC A;  4UXN A;  2WT7 B;  4DR1 O;  2XOK G;  1HF9 A;  4LF8 O;  4NPE A;  1E5W A;  1F51 A;  4MVZ A;  3HE4 B;  5KJ7 C;  3MP7 B;  2Q9I A;  3P3N A;  2XAS A;  1LTA C;  4DR6 B;  4UB6 Z;  3AG4 C;  1KB9 F;  1FD9 A;  4Y99 C;  5CA1 B;  4UB6 H;  4IOI H;  3D6Z A;  3FYE B;  3CXH D;  1Y9B A;  1AP6 A;  1VPC A;  1KD1 W;  4BWN A;  2ZCE A;  1SQQ G;  4X1I B;  2BCC H;  3JAS B;  1J1E B;  3ABL C;  4DW0 A;  5CA0 B;  2XAQ A;  1DD3 A;  2EIN C;  1QLE C;  3W7T A;  4Z1M G;  3RVY A;  2E43 A;  1FZG A;  1IFJ A;  1B3Q A;  1GK4 A;  1AI5 A;  4EIJ A;  3CEI A;  1DK1 A;  4WFF A;  2H3O A;  2BSK B;  2UUB O;  4FLX A;  1N34 O;  1FAF A;  2AZ2 A;  5CA0 A;  3A0B E;  5D5Q A;  1OZH A;  3SFD C;  3C8V A;  2QJ1 A;  1X9V A;  3MDS A;  1N7S D;  4MVQ A;  4W7Z A;  1LTG C;  3E8F A;  3AE5 C;  2DYS B;  2HLO A;  2OYI C;  3SR2 C;  1DIP A;  2CK3 G;  2B9B A;  4JPZ B;  1DGS A;  4PV1 D;  4WFB V;  1TVK A;  3JAT B;  3A0H E;  3AEG C;  1XRE A;  4UVC A;  3AE1 C;  3T2M A;  1YJN V;  4UB8 H;  2ZFC A;  3VP8 A;  3WUT A;  1ZUQ A;  1NS1 A;  2NZ2 A;  3ZJZ A;  2AW9 A;  4BR6 A;  3LIE A;  2YI9 A;  2CTP A;  4PDL A;  2PP6 A;  1N8R Q;  5C39 A;  5L3G A;  2WPQ A;  2XKM A;  4JI0 O;  4R8C A;  4MW8 A;  1WAZ A;  4UFZ A;  1NTZ K;  2N1T B;  4OX9 B;  1XMO B;  2AXT E;  5D5P A;  3B8E B;  1Q2N A;  1WPX A;  3I55 V;  5GTI E;  2UUC B;  3KXD A;  3OT7 A;  2E74 D;  1E1R G;  4X20 B;  1SF9 A;  1SS1 A;  3LSQ A;  5CCH D;  2QE7 H;  1H0T B;  1IFN A;  2A45 G;  4D7S A;  2AEF A;  4DV5 B;  4DZO A;  1BSH A;  4HNA B;  1GMG A;  1AVM A;  4I50 B;  1VQM V;  1ZSP A;  3AG2 B;  3H1H D;  1PIX A;  5JVD B;  4JGS A;  3CX5 E;  3VYI A;  3K06 A;  5JH7 B;  3T1Y O;  5KAI Z;  3G3Z A;  1VQP P;  1BGY G;  3KYQ A;  3K59 A;  3ETQ A;  5C8Y A;  4C7R A;  3BAS A;  4DR3 O;  3VMY A;  2K9J B;  2Q69 A;  4I50 A;  4IHJ A;  3AG4 B;  3A0B Z;  1YTZ T;  3B2E E;  1NI8 A;  3OTF A;  5BU5 A;  2DMX A;  4U3F J;  2CGN A;  1I94 O;  3JAR B;  3JAK A;  3ASO B;  3OAK A;  1R3I C;  3ETG A;  1RSO B;  3ABL B;  3C9I A;  1V55 C;  3GWO A;  3O6Q B;  3B71 A;  1URQ D;  2K9J A;  2QWQ B;  3B5N A;  4PV1 C;  1EDJ A;  3KKY A;  1VL2 A;  2O01 H;  3I56 P;  1QVF O;  2F93 B;  5KHI A;  2FKW B;  4JI2 O;  3LW5 J;  3H1K H;  2PYL A;  1GU4 A;  1T3U A;  1AIL A;  1GN6 A;  1PPJ D;  5IY5 C;  1NTK G;  3ZRW B;  1BDC A;  4J9Y B;  3KDP B;  3T1C A;  3IJ4 A;  3ZHV A;  4K0K O;  2H7H A;  1QR8 A;  3W7S A;  1U57 A;  3JCU Z;  4TLF A;  4JV5 B;  2AXT Z;  3JC2 2;  2ZE7 A;  1Y4M A;  2R5B A;  3G6E P;  2Q1K A;  2QA4 P;  1OXZ A;  5JCO A;  1F4N A;  1L0L D;  4FLY A;  1W0J G;  2PYJ A;  3E2E A;  2OYI B;  3FKS G;  5EZY A;  3CXH I;  2DYR B;  4XDJ A;  1GMJ A;  1N7S B;  4B7E A;  4BXL A;  1EZJ A;  2UXC O;  1UIX A;  2Q0A A;  4IYH A;  1M1K Q;  1M7L A;  1DF5 A;  2PFX A;  2R5D A;  5AVZ B;  1DH3 A;  3RBZ A;  2B89 A;  2AHZ A;  5AVY B;  1L0L E;  4E2L A;  2F43 G;  4WY4 D;  4MS2 A;  1IO4 A;  4H13 C;  5JJE B;  1XI1 A;  2F66 C;  2WLL B;  3QO7 A;  4WBN B;  1AJN A;  1G4Y B;  3CCM P;  4WBA A;  3M99 B;  1M5I A;  5H6Q A;  5C8Y B;  4CS2 A;  1FXK C;  3CCL V;  2N1T C;  1KIL D;  1KEC A;  4B3T O;  3H1H E;  2H43 A;  2OYH C;  3N2K A;  3CMA P;  4PJ0 E;  1JFF A;  3K79 A;  4DR2 O;  1N33 O;  1SQV J;  4P9P A;  3WB0 A;  4ZMD A;  4H44 B;  1JCH A;  1M1J A;  3QH9 A;  3VQW A;  4EB6 B;  1JA8 A;  2IJJ A;  2CPS A;  5KAF Z;  1H2N A;  2QEX P;  3P32 A;  4DT0 A;  1J2J B;  2BAS A;  1FFT B;  2WSC H;  2P4V A;  2E76 B;  3AEF C;  4D6T G;  4EDF A;  1R8E A;  3M06 A;  4N78 E;  4TOI A;  4X1Y B;  2HJF C;  3E8G A;  4ABM A;  3RL0 B;  2M7W A;  2HFE C;  2W6A A;  2Y0D A;  1YF2 A;  4ZKI A;  2C0W A;  5LP6 B;  3OM3 B;  3D71 A;  4X65 O;  4NR1 A;  3CC4 P;  2N04 A;  1MSW D;  1NU1 D;  3SJA C;  4I2L C;  3Q2Y A;  2JRI A;  3LDE A;  1LTT C;  2YEV A;  5EC1 C;  1OVU A;  3FAV A;  2E5T A;  3V2N A;  1QLN A;  1IBL O;  2FYU G;  2X6A A;  1Q86 W;  2IH1 C;  4F6R B;  1V55 B;  1OW7 A;  3P7K A;  1N36 B;  1LNQ A;  1AV1 A;  5EIB C;  1UPG A;  2UUA O;  3L73 G;  3V5B A;  1L4A C;  1SQP E;  3LW5 H;  2WT7 A;  3D36 C;  3OE7 G;  3CJH B;  1L2P A;  2JEE A;  3BCC H;  5IYD O;  5APW A;  3JAW B;  1JCC A;  2IDB A;  4LR3 A;  1YJW V;  1YTF B;  2WLH A;  2DOS A;  3OTO O;  2WSF J;  2K9P A;  2KG7 A;  3K03 A;  5TIS Z;  4C7U A;  4DR7 B;  3IAO A;  1K9M Q;  1IUR A;  1JY3 O;  2R44 A;  4ZI7 B;  3FB7 C;  4UVB A;  4YJ3 B;  2GUS A;  1JEK A;  4DR5 O;  5CCG C;  4WF9 V; 
#chains in the Genus database with same CATH homology
 2BEZ F;  4H0L B;  1ZOY C;  2E76 D;  2WSE J;  1U57 A;  3AEB C;  3T97 B;  4H13 D;  1FDI A;  1KQG B;  4YXD C;  4OGQ B;  4R4L A;  4R4M A;  1JB0 J;  2K9Y A;  1KTM A;  4H13 B;  3AED C;  1GMJ A;  2MKV A;  2QJK C;  1KMI Z;  1OMI A;  2ZT9 C;  1YQ3 C;  4KT0 J;  1UIX A;  3SFD C;  3C8V A;  3Q5P A;  2V7Q J;  2G8Y A;  3AE9 C;  3SFE C;  2JP3 A;  1OW8 A;  3AE5 C;  1VF5 D;  4OGQ C;  2O01 J;  1S1C X;  1KQF B;  1DIP A;  4H13 C;  4I7Z C;  1AJY A;  4PV1 D;  3AEG C;  3R4Y A;  4H0L D;  3AE1 C;  4H44 C;  1NYH A;  2ZT9 D;  4XFJ A;  2BEQ D;  2NZ2 A;  5M1B A;  2J5U A;  1KIL E;  3Q1M A;  4I7Z B;  4YTP C;  1MKM A;  3RL0 g;  2FXP A;  2H89 C;  3AE7 C;  2E76 C;  5L8R J;  4H44 B;  2D2C D;  3RK3 E;  1FDO A;  5KKZ C;  4H44 D;  2JO1 A;  1OW6 A;  1HJ0 A;  3Q5S A;  1EXI A;  1PV3 A;  2E74 D;  2QIW A;  3H25 A;  2QSI A;  2G3A A;  1R8E A;  3AEF C;  2E76 B;  4U7J A;  3ABV C;  2FYN C;  3AE8 C;  1PL5 A;  1VF5 C;  3Q5R A;  1YQ4 C;  1ZRT E;  4Z1M H;  2D2C C;  3D70 A;  4Y28 J;  1TU3 F;  4TT3 H;  3G9R A;  1ZME C;  1NGM B;  1PIX A;  3D71 A;  2E75 D;  1VF5 B;  2YMK A;  2QJY C;  1WMK A;  2QJP C;  3Q2Y A;  3AEC C;  2D2C B;  2FBW C;  2E74 B;  1ZP0 C;  3GF7 A;  3AE4 C;  3AE2 C;  3O6Q A;  2WSC J;  3AE6 C;  1OW7 A;  1RQU A;  1K05 A;  3Q3D A;  4PV1 B;  3AEE C;  2WPV B;  2E75 C;  1HF9 A;  2E74 C;  4RKU J;  3IN6 A;  2OQQ A;  2H88 C;  2WQY C;  4IL6 X;  3GMA A;  4OGQ D;  1RQV A;  3FGA D;  3S9O A;  3D6Y A;  4GDO A;  1S5L X;  3B71 A;  4PV1 C;  2IDB A;  3D6Z A;  1EXJ A;  1VL2 A;  1Y9B A;  2E75 B;  4H0L C;  3LW5 J;  2P10 A;  5KLI C;  3GLM A;  1KOR A;  1Q90 D;  2WSF J;  3EWK A;  3IAO A;  2YIU C;  1IK7 A;  1DD4 A;  3AEA C;  1DD3 A;  3AE3 C;  1K04 A;  2ZT9 B;  3GF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...