2ZT9B

Crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
pubmed doi rcsb
molecule tags Photosynthesis
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2008-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2zt9B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2zt9B01
2QIWA 1Q90D 1S5LX 2ZT9B 4I7ZB 2QSIA 4H44B 4KT0J 4H0LB 2E75B 4OGQB 2D2CB 5KKZC 2WSEJ 1JB0J 4Y28J 5KLIC 2QJYC 1ZRTE 2K9YA 2WSFJ 4H13B 2WPVB 2YIUC 3C8VA 2WSCJ 2E76B 2E74B 5L8RJ 4PV1B 1VF5B 2FYNC 2QJKC 4RKUJ 4IL6X 2O01J 2QJPC 3LW5J
chains in the Genus database with same CATH superfamily
2IH1C 3DGEA 3W67A 2EINC 1Q82W 3TETA 4X8AA 2R9IA 2GUZA 1A02J 1AP6A 3H01A 2WSEJ 1JB0J 2A45G 3LW5H 1JUNA 1OV9A 3AG2C 4UFZA 5EYPB 2KP8A 2ZE7A 3FB6C 4LF7O 1H0TB 3L72G 2RDCA 1OXZA 1SVFA 3JASA 4PJ0E 5AVXB 3L74H 5D5QA 4G27B 2E74D 1M56C 5B66Z 3R66A 4PDRA 1WT6A 3I56P 3APQA 4DK0A 4W7YA 2X7RB 3VYIA 1Y47A 1F23A 2PGGA 1KTMA 4WBNA 3GHGC 2KSJA 1SQFA 2BE3A 3CWBE 5KLIB 3U10A 4J10A 4CS4A 5KLVH 2UUCO 2R5BA 1PD3A 4PI2A 1HNXB 2Q7CA 4OGQB 1NVPD 1EDIA 4O4LB 3BA9A 3FYEB 1GL2C 1NHLA 4WY4C 2XNDG 5JJNB 2NPSC 3TJTA 2FXPA 1IBKO 5AVRB 1N7SA 1NTKG 2XAFA 1NTKD 3JSLA 3ZN1A 3G6EV 4DV2O 1IDSA 3G3ZA 1Y66A 4B3RB 5JJJB 3KQGA 1FS0G 1URQA 2BEQD 2FMLA 5CB4B 2JWDA 3T4ZA 5BVZA 4J9YB 2L91A 1B6QA 3H1LJ 1SQXE 2W6IG 2GBOA 4B7EA 2EIMB 1UIIA 5C39A 4TV8A 2HR3A 1VF6A 3C3TA 1M4UA 1TU3F 3ZRSA 2A06E 3ZIAG 4GKGA 1QVGO 3CC2V 4JI4O 3CE2A 3KZIE 2YO3A 1SQQG 1M57B 2CAZC 4B08A 5EBWC 1S72V 4PA7A 1FAFA 4LC1A 1SQVG 3TSIA 1I7FA 1SQVD 2WWWA 1ROPA 1NTMD 3CCSP 4ZBMA 1FAVA 2QJPC 1L0LE 4OWFA 5L3CA 2YIDA 4XDLA 3CCRP 4LNUA 3TGUG 2N04A 1OVRA 1EN4A 2FYUG 1Q6UA 2FYUD 5KAFE 2AGAA 2R9RB 4LWSA 3CCVV 3L70H 5FPRA 2JVDA 4RQEA 3OAAG 2KNCA 3B5ND 5KJ7C 4FFBA 3ZHTA 4LF9O 3BA8A 1PP9H 1Q82Q 3ZCCA 1JY3O 2R3CA 2AHYA 1RHZB 3F5TA 2JEXA 4MW3A 1V55C 4M3LA 3ZMUA 5GTIZ 3OTOB 1NU1H 4X1IB 5LMNB 2YUAA 4DR1O 1JM0A 1NO4A 3GB7C 1KV4A 2CUGA 2DQ0A 2BTQB 5C93A 2Q9IA 3CMEP 4PA3A 1NKNA 3J81N 1OCOC 4OX9B 3O6QB 4U3FG 3IAYA 2B9ZA 4U3FD 4ZKUA 1KC8W 1AR5A 3D8CA 1M1KW 2CTRA 3ETQA 1KYOI 2XAGA 1GN3A 1LNQA 4Z2WA 2PF4E 4AYCA 1TVKB 2W6AA 3PP5A 5EC2C 2K9YA 1XI1A 2CK3H 5KAIH 1NAYA 1P7BA 1DEEG 1W59A 2RCVA 3ZN0A 1UIXA 5H6RA 4KXRA 1KORA 2BOCC 5CBHA 3L74G 1SFCA 5APUA 2A45I 2IPPA 4JPZB 4N6JA 3D70A 1UPGA 2LGQA 2B89A 1VQLP 3GHGA 1YEWA 3JYCA 2ZQMA 1L8DA 2Q68A 5KLVG 3JASB 1BGYJ 5KLVD 1NH4A 4A5UB 2HVJC 2MW2B 3BVOA 3M7MX 2IH3C 3AEDC 2KB7P 3IR9A 3F7YC 1ENVA 4PDVA 1P4RA 3V6IA 4IFDK 1GL2A 1WPBA 5CCHD 4WBNB 3RL0B 5KX5A 4N78D 2NN4A 1KILA 1HNWB 1S5LE 4DV4B 1KU9A 2AHZA 2DYRB 1PGOA 3IJ4A 1QL1A 5EZYA 2EIKB 4ASWA 1L4AC 4PHZA 1RF0C 4ZKIA 2MKVA 4HJGH 1YITP 1K5QA 4MW8A 2ITAA 5DJUB 1N7SB 1SESA 1SQXK 2D3OW 2OTLV 5H5NA 3DC6A 3CSXA 2F1MA 4AUWA 3CC7V 4PDMA 2CGOA 3RVZA 3THOA 1FDMA 4N21A 2YIUC 3H1JH 2DE0X 4IT5A 1YTFD 3H1IH 4UCTA 2Q0AA 3AE1C 4IL6X 3K0DA 3VN0A 3TCUA 4JI0B 1K34A 1L0LK 2KYVA 3MHSC 4TV8B 1MSWD 1Q6HA 4DK1A 1F4NA 3L75J 3U1CA 3EFFK 1JTHA 3B8NA 5FNVA 2WLMA 4P30A 1EC5A 4RO2A 4HAMA 1FE6A 3L70G 4JI5B 1AJPA 2Y4TA 2ZT9C 1XL4A 1GW4A 3L70D 1KP3A 2KZIA 4I1LA 3CYOA 1AILA 1KC8Q 5KJ7A 2B1GA 1M1KQ 1ZUQA 1IVSA 1JCHA 1THZA 1SQXJ 3IFXA 3SPCA 3CXCU 3CCJV 2F43G 1GN2A 1EM1A 4LNUB 3L71J 1VQMV 5AW0B 3ITKA 3CXHD 4FJCC 1ZMEC 2QE7H 4IIJA 1NH2B 3WG7C 1LTGC 3FKSG 3GF7A 1VF5D 1FJPA 1FOSF 1T8ZA 3A7OA 2GM4A 3OM3B 1J5EB 3NFQA 2WSCH 1QHTA 5GTHZ 3L73J 4GZRB 1L0LJ 4EB6B 3Q1MA 1LWUC 3WMM0 1H8EG 2O57A 2GSMB 3CD6P 1N0JA 4RWUA 3ZRVA 2WPDG 4HNAA 1VQKV 4UCVA 3MD0A 1L0NJ 3W7SA 3OTOO 1HGVA 1VQ8V 3OMIB 1VPCA 5GONA 2BSKA 3JCUE 3TNUA 3CPWO 4WFFA 3LIEA 2W0FC 1KB9D 3M99B 2Y0PA 2CDYA 2RJZA 2EINB 4YXWH 5AVTB 5BY1A 4I9QA 1CI6B 1ZAUA 1KYOE 3AE2C 1YQ4C 4XFJA 3VP9A 1AA0A 2P5OA 2UUAB 1BCCJ 2O1KA 3AG2B 5J2UA 4AQYB 4YHHB 3HKEB 1RPOA 4DV7B 2ADQB 1PNLA 3G9RA 3FFQA 2HP8A 4JPRA 5JH7A 4X1KB 5A9GA 4AILC 4JBZA 4UB8H 1M56B 2IJKA 1J2JB 1U7MA 2AXTH 3E1IA 3BVHA 3A0BH 1EZVH 4B86A 2HYNA 2OT5A 2JO1A 4LBEC 1IK9A 4AI8A 4YTPC 3GHGB 3L72E 1M57D 1RF1A 3UQ8A 4KUMA 1LTBC 1BHAA 1ZV8A 3CCUV 3RVYA 1YJWV 5CN0A 2P1JA 1S5LX 2IBZG 2IBZD 1KFNA 1L4AA 3PJSK 1RF0A 1GL2B 4PA6A 3ETGA 4WY4B 2Y0EA 3V5BA 1XMQO 2NPSB 3N2GA 4IL6H 3OUSA 4K8ZA 2Y0CA 3J7AU 1BMFG 3A0RA 5EBLC 5EZYB 5AVWB 1HNWO 4JYCA 3OD4A 3W7UA 5JQGB 4DV4O 2Q7EA 2K1EA 4U7JA 2OIEA 2HFEC 1NTKE 1U7JA 4NR1A 4J41A 3SR2C 1BE3H 3L36A 3OW2O 1WB7A 4O4JA 1VMGA 4NB5A 1FS0E 1QNMA 4JASA 1SA0A 3E8FA 2P58A 3OMNB 4X66O 3HPLC 3FWNA 3Q4HA 4F6RA 1AR1B 5CJ0A 2ZD9A 1R3JC 2ZNIA 3SWYA 4JAVA 3JD1A 2QJPB 2LO1A 4BRYA 2EIJC 2KB1A 3RK2C 1TAEA 2V7QJ 1JY2P 1JTHB 3RL0g 4JI0O 1AVMA 5FNVB 1MFZA 4MTFA 4FK5C 2QE7G 4CH6A 1SQQE 4GT1A 3HKBA 1FZFA 3E22B 1SQVE 1XUQA 2VRSA 1GU4A 2JEEA 2QJ1A 4D7SA 2HEPA 5AVSB 2RQ6A 1A32A 4JI5O 1VQ4V 4LF8B 3TGUE 3LUTB 4KJMA 1V55B 1LWUA 2FYUE 2KZJA 5L3BA 4XDKA 2XV5A 2QKSA 1KQGB 4R8CA 5JJEB 3CX5F 2KOGA 3E8BA 5IY5C 1IZ3A 3WB1A 3E2EA 5LOVA 5AVQB 3R2PA 3GWOA 4LR3A 3A0HH 5B1BC 3GLMA 5L8RJ 1OCOB 2K9PA 1PL4A 4OXSA 4ZNCA 2JK5C 1J5EO 1GN4A 2IJIA 4YXWG 1NBMG 1M9NA 2VS0A 1GK4A 4IHJA 1VQ5P 3CWBG 1KZUB 2CGNA 1HNZB 3CWBD 1ZR2A 3FB5C 3G71V 4YJ3A 1KMIZ 3VMAA 1H2GA 1IFNA 3SSUA 5IJ0A 3H1HE 1KB9I 1QVGU 4U3FE 1X22A 4MVMA 3ABUA 1SQBH 1GU5A 4L87A 5BMVA 1MKMA 1YBKA 1FXKC 2F23A 1IX9A 4PJ0Z 4JTCB 5AW3B 1Z5WA 1KQSO 4O2BB 1WA8A 3OEEG 1QU7A 3H25A 4BW5A 2Z5UA 1FJGB 1QCEA 3L74E 5JH7B 4P2ZA 2AEJA 1YSCA 3A5TA 3U0ZA 1SQXD 4LFCB 1XREA 1KQFB 4JTAB 3OR7C 2PYLA 2Z3YA 3HKDB 1MNGA 2ITDC 1KUQA 1FFTB 5CHXA 1SQGA 1XDCA 2OCHA 1IZNB 4DR6B 5LYJA 2DWEC 3ABVC 5KLVE 2DW3A 4B3SB 2R44A 3P8CE 1EFRG 2DWDC 2XU6A 3BABA 1DH3A 1N0NA 5KHIA 1SERA 1L4AB 3BFRA 2GHYA 3E8HA 2Y69C 2W83C 3ZMVA 2O01J 4N78E 1HF9A 4KHXA 2L35A 2E76C 5APVA 1I94B 4WB4A 2ZVNB 3S9OA 4GCZA 1BE3G 2P67A 1IBMO 1BE3D 3R4YA 4TLFA 3I55P 1N73A 5LMUB 1YJ9P 2YIUB 2YXYA 4JYAO 5CBNA 3AEGC 4DR4B 1CZQA 3N2KB 1FFXA 4ASUG 1SQPH 4I4TB 2IFMA 1N86A 3WFVA 2WSSH 4C7NA 3SFDC 1KKCA 5L3DA 5LA6A 4PA4A 2QEXV 3GW6A 2LXCB 5AVYB 4CC6A 3C90A 4B3MB 1SQQK 2HODB 4WBAA 3AG1C 3Q4HB 2ZT9B 3G4SP 1HTLC 5LGTA 1NTKJ 5BU5A 4YIOA 1RM1C 1SS3A 2ZE5A 2J5UA 4BIUA 4BRYB 4EFEA 2XAQA 3MUDC 1R6KA 1Z56A 4ZOLB 5IWAB 3RYIA 2P7TC 3HKBB 3L70E 4TWKA 3WG7B 1M56D 5EIBC 2B9BA 4UV9A 1H89A 4LF7B 1EN5A 1PP9E 1R3LC 2YMKA 4NVPA 1N32O 1NTZK 2GUVA 3LSUA 3QWOC 3OE7G 2PI5A 1OFCX 1LWUB 4O4IA 2YMYA 1NU1E 3VMYA 1SLQA 4X9QA 3VMXA 5FPOA 2LXBA 1SQQJ 3SPIA 3I56V 5LOVB 2V4HA 3RK3C 1SQVJ 1YHQP 4WY4D 1ZRTD 2NPSD 4DV6B 4MVRA 1VQOV 2ZCEA 3FYIB 4MTOA 1L1FA 1SQBG 4WF9V 2QTSA 2KUBA 4I0XA 4CPGA 1JJ2U 1D5NA 2UU9O 2IW5A 1OIPA 2FYUJ 1D5AA 5AW4B 2JJLA 4YJ3B 1FXKA 2FB5A 1IBKB 2KLUA 3E1RA 2FFDC 5IJ0B 4DV3O 5KAIE 1QBZA 3OAKA 5EBMC 4DV2B 3K58A 3S4RA 2CTPA 4MVOA 1FD9A 4X88A 2CH7A 4UV8A 4CS3A 5BMVB 2Q69A 1EXIA 4OVNF 4Q20A 3B4SA 1R3KC 4CBCA 2J59M 4GX2A 2QA4V 4LLHA 4E2LA 1DK1A 3CCEP 2D2CD 4U3FJ 5KLVK 5H6QA 2UXCB 3NTNA 2WVRA 2KI7B 1I08A 1N33B 2H43A 3W7XA 2HLOA 3KCYA 5AW2B 5KA5A 2PFXA 1FJGO 3CX5H 3UKMA 3LW5J 1URQC 2HJDA 2JKVA 5LYJB 3K5NA 1FZAA 5KJ7D 3CCSV 3K9SA 2PYJA 2FXMA 2WA4A 3L74J 4DR6O 3CCRV 5CJ4A 3CPWU 3UO2A 5HFLA 2W8ZA 3B8MA 5GW7A 5KA6A 2R5DA 1Y6XA 1YTZI 4HYOA 2AEFA 4FLXA 1SQPG 4LF9B 4YJ2B 2H89C 1S4XA 5B1OA 5KLVJ 1WPXA 3TXSA 3U1AA 3ZHVA 3H1JE 2P06A 4DR1B 3QH9A 2JRIA 4MS2A 4RUEA 1IXBA 3CCLP 3H1IE 1FFXB 1N36O 1NGMB 5LMUO 1QR9A 3APOA 1AV1A 1YQ3C 2CTWA 2EULA 1GN6A 2L6LA 4C7NB 3WUTA 5GTIH 1E79H 2EIJB 3F89A 3RK2B 2WPQA 3MUDA 1XEQA 3P30A 3KYQA 2PTMA 2OYHA 1NTZH 4DUYO 2W90A 2NR5A 2O01N 2QM4A 2DQ3A 2KK7A 4DCKA 4PDLA 3TYYA 3BEHA 3O65A 4MTGA 4JI6B 3GWKC 4L73A 1NU1K 2X6BA 2ZKOA 3RK3E 2HKOA 5IY5B 5IWAO 3V2NA 1NAFA 4C7RA 2XNXA 2KKWA 5B1BB 1VQLV 3II6A 3QO8A 3OFNG 2X6AA 4FLVA 3L72D 2ITCC 1JX9A 3AE9C 1Y4MA 3E8GA 5KUMA 2ZYAA 2YIBD 3K5OA 4BWAA 1SFCC 1AP5A 1L4AD 3L70J 4GDOA 2XZRA 1USDA 4RUFA 2M5AA 2OTJV 2FFDA 4NXMB 2P4VA 4EYYQ 2WTYA 1N4CA 1VQOP 2G3AA 4I0XB 5CCGA 4DV6O 3M9BA 4GKKO 5AVVB 2YKQA 3QNEA 4F4LA 1FXKB 3M0DC 1YITV 1GAXA 2LFSA 4X65O 4NPFX 3FGAD 2XUMA 1GMJA 4EFBA 1GO3F 3L37A 4W7ZA 1KILC 3F7VC 2CH7B 2PUSA 4FLTA 4UB8E 2AXTE 3A0BE 1NVOA 1EZVE 2ZM6B 4GX0A 3ZS8C 1UJWB 2QDOA 2WPSA 2JS5A 4C7UA 1AJNA 2P90A 3AK2A 2JIZG 3SYCA 2IFNA 2ZT9D 2QA4P 3Q5RA 1HDJA 1X79B 3CCMP 1H2MA 4U7NA 1JPXA 3CC4P 2UXCO 2P2UA 3HR0A 3Q5SA 3USSA 2PP6A 2M0BA 1JFFA 3CHXA 2Y69B 1N33O 3PLNA 5AW6B 4X20B 2YI8A 4IL6E 1BT8A 2WLNA 1GW3A 2E76B 3W7WA 2VQEO 3P8MC 2UXBO 1VQ7P 1SQQD 1BZKA 3JALA 3K57A 4JI7O 2PRRA 5TISZ 4F6EA 2WLJA 3K5MA 1XTGB 1J1EC 3TF5A 4LCUC 4TUYA 2EX3A 3KPEA 3TGUD 1T6AA 1CXZB 4LP8A 4XDJA 1VARA 3L9DA 4UVAA 2P10A 5KTBA 3Q5PA 4BR6A 3MTUE 2R9AA 1ZN5A 3ML0A 1BE3E 2FBWC 2FYZA 2JDIH 1KQSU 3FXEA 1IFMA 2YKPA 3T4DA 1MZ9A 4H0LC 2F95B 3CD6V 3C8VA 1U96A 1NTZG 5DECA 1NTZD 3AG1B 5GTHH 2Y9ZA 3MHHC 1LTIC 2WSEH 1N34O 5KHKA 4FLUA 2AZ2A 1JJOA 1Z2GA 3JSNA 1RM1B 2A9HA 2LJ2A 5LGNA 5K1PA 5BR8B 2JGDA 3H1HG 3LNNA 3H1HD 1QVFO 4CC5A 4EOTA 4K3AA 4TV9A 3SPHA 5C8YA 2H88C 1OCCC 3AECC 3BCCH 5LXTA 4UCUA 3BAAA 2CPSA 2WZ7A 2RNBA 2PI4A 2ZIMA 4PELA 3QO7A 5KUKA 4U3JA 4AHCA 4ZMDA 4UUJC 2QJKC 1YCIA 5B5EZ 3JAWA 4JI6O 3L74D 2ARHA 3A0HE 2GUZB 4DZOA 3RK3B 4IYIA 1JY3N 2QWQB 3SGIA 3L4FA 1KFMA 1ZWIC 4RO0A 2FY8A 3LDCA 5E79Z 3W7TA 2WMMA 1VDFA 4NPEA 1NS1A 4C46A 2C9NY 3P8CD 1XMQB 2Y0DA 2M5AB 3M0DA 4BAYA 2OYQA 3SPGA 1ZRTE 2FFDB 4CZZA 2Q3IA 2OARA 1KILE 2WPRA 2OTJP 3H1LH 4NTYA 2HFED 2JR8A 3ETEA 4YXDC 1P7GA 1LTJA 1SQBE 4GX5A 2RMZA 4WFGA 4B7KA 1RF1C 3G6BA 1DGSA 4NXMO 3FWLA 3HTKA 5CBFA 1YVWA 2ZR3A 3P7KA 4FLYA 1V54C 2VRZA 4JI2O 1S1CX 3T1YB 3FX0A 4HB1A 3CX5I 2HG5C 3RK2D 3CWBJ 1P84F 1FOSE 1IBLO 1XNQO 4GKJB 4X66B 4FFKA 3JARA 3AK1A 2ZYDA 1URQB 4YPCA 3JAKA 1GK9A 2QR4A 1IFPA 2KS1B 4JI8O 1I5YA 1FC2C 2ZM6O 3CJHA 1QLNA 1X8YA 3AEBC 4H13C 2E43A 5CA1A 2ETNA 3EVKA 2I1JA 2A79B 1HWYA 4Z1MH 4L75A 1HH0A 5IT9N 2N1TA 3AE6C 4TT3H 1JFFB 2Q1KA 3M91A 4NTXA 2P7JA 1R8EA 1IJDB 1BSMA 3A2FA 2DN9A 2JDIG 1N7LA 3K5BA 1PP9G 1PP9D 3LDEA 1FJKA 2M3BA 4H33A 3OT7A 3OMAB 4TUYB 1DIPA 4QIWF 1SQPE 3RN4A 1NU1G 1NU1D 4FVMA 4LWSB 1OZHA 3BATA 3E86A 1TUBA 2KNCB 3LSQA 4FFBB 3N4XA 1RFYA 1RPRA 2ZXWC 2W6BA 5L3FA 1RP3B 5LHIA 1IFIA 5L3EA 4MVSA 2Y0IA 1VQ5V 2YXHA 3RYHA 5L3GA 1T2KC 3BCCG 2QRXA 4UCOA 4OGQD 1LT9A 1HBWA 3F5WC 3ABMC 3H9VA 2WPVB 4W80A 2HPCA 1BE3J 3QVNA 1BGYH 2JGDB 2CK3G 1S5JA 3WU2Z 1KP2A 5CBGA 2LGWA 2QWPB 1XTCC 1VQ9P 1NJIW 5BR8O 4TV9B 3K9AA 5C8YB 1AROP 1ZLLA 5KHGA 3CRAA 1SC5B 3RYFA 4RESB 4HZ3A 3CCQP 3JATA 2A0LA 3ZRXA 2RH0A 3Q3DA 3ABLC 1DTOA 4U7OA 2FKWB 2CE4A 1OHHG 2YDEA 1OWAA 1SFCB 1PGPA 1FKAO 2HVKC 3CRRA 3UCSC 2B88A 2PY5A 2OYIC 1SQBK 1YI2P 2E76D 1XQ8A 2LQTA 4DRXA 3K59A 4LFBO 5D5PA 4BW9A 1J1DC 3SYAA 4R4LA 4QGPA 1AI7A 3JAMN 3IAOA 2NRGA 3CP1A 3U11A 2ZVOB 5LL6Y 3E89A 3AG7A 1AR4A 3QF7A 5TJHA 1S77D 2WLLA 5KX5B 1IBMB 1KILB 2MJZA 1HW7A 3RYCA 3L75H 4I5SA 3I55V 4JYAB 3HTKB 1YJ9V 1JCDA 4LF6B 3H1JG 2ATKC 4ZIBA 3H1JD 3SWKA 1KBHA 2ADPA 3H1IG 3H1ID 5KHHA 2F93B 1SQBJ 3ASNC 4O2AA 1JQ0A 1LTSC 3HB3B 4HKZH 3L71H 3CX5E 3T1YO 3JARB 3ZHQA 2IZ1A 1N73C 1OZ0A 3HKCA 2H3OA 4GKJO 5EIBD 3DSQA 3G4SV 2JWAA 3AE7C 1VQ6P 3CJHB 2FTKA 2BOBC 1US6A 3L73H 1UFIA 1ZW0A 2ILMA 3W68A 1YJNP 4UXNA 1JVMA 4E4EA 3E7KA 3QG5A 1J1EB 3M9HA 2XAHA 3K79A 4UB6Z 3SPJA 2IU3A 1SQPK 1GM9A 4DR3B 2O1JA 1L0NH 1EDKA 1GM8A 1N32B 4X64B 4WCEV 4N23A 3RK3D 1R6NA 5B1NA 4ZHQA 1NJIQ 3OGCC 4P9OA 1YYCA 4H0LB 4JAUA 2P4KA 1ZL8A 3HUSA 1GTOA 4IIJB 4JI1B 1BCCH 1YHQV 5GTIE 5EC1C 1TUBB 3RW0A 3V2PA 2NLJC 1M1JA 4UVCA 3VQVA 1P84H 2BEZF 4YY3O 2UU9B 3RL0D 2N05A 2LFRA 2QSAA 2ZINA 1N8RW 1G1XB 1NTZE 1S9KE 4DUZO 3BPZA 2GTSA 4DV3B 1OCCB 1FDOA 4HNAB 1ZLZA 2ZDIC 2HPCB 4KFMA 1LUVA 5GONB 2BSKB 3EQ2A 4QMAA 3TNUB 5J2TA 1N7SD 4JAAA 4X1YA 2DJVA 1MMMA 1JEKA 1EBOA 2W6JH 5AG2A 4D6TH 4XBFA 2QJKB 2JP3A 3B5NA 1ZSPA 3OJAB 1FZGA 1Q86W 3EXAA 1ZXGA 3JSVC 1URQD 1Q5OA 1EZVG 3CCEV 1EZVD 5H2FH 2OYIA 4MSWC 3JATB 4NTWA 5J2UB 2QVAA 2GV9A 3V4QA 3B09A 4Z1VA 1RE3A 1COWG 4NKGB 3M0AA 1G4YB 1X4TA 1VF5C 2XKMA 4W4LA 1G1JA 3HD7C 1Z5VA 2POHA 2AXCA 5AVUB 4MVZA 3SFEC 1RF1B 3ZDMA 1DEBA 4O9BA 2QJYC 4I2LC 5IDJA 1LP1A 3G80A 2QWRB 2E75C 3QO5A 1S76D 1MUUA 1SZXA 2J58A 1QVFU 2Z4EA 2FYNC 1K97A 5BXZA 1BHBA 5APTA 2QWOB 1QLEC 4G2KA 1V54B 1NH2D 1VEWA 1QGKB 2KIKA 3N2GB 2QIWA 1VF7A 2QWNB 3L72J 5KMGA 4UCRA 4DW1A 3P3NA 4DV1B 2E3CA 1NR1A 1N36B 1BQ0A 3FX7A 3CCLV 1T5EA 2BASA 1ZOYC 1PNKA 3SYQA 1XNRB 4LF6O 4H13B 4O2AB 4IL6Z 3KZIZ 2YEVA 3ICXA 1AJQA 1K05A 4DUYB 1B04A 4O4JB 2BTOA 5CCHA 3ZRWA 2CPBA 1SA0B 1N2DC 2DW4A 1Q90D 1V9PA 2ZFCA 4F6RB 1SETA 1NKZB 4JZ2A 2HHHB 1N8RQ 2NZ2A 1M8OB 4KT0J 1IFJA 5KAFZ 1KN7A 1K73W 4MTXA 3FD9A 3KDPB 2RKLA 1VQPV 1X59A 2R70A 3ZHRA 1OVUA 2OYHC 1SFCD 1BCCG 1BS3A 4BIZA 2KG7A 1EDJA 2Q4PA 1GH6A 3FAVA 2XHBA 4DR3O 2YC0A 4ZHQB 2ZXWB 4X64O 4J7KA 1JR9A 4EEQA 2B87A 1ZL8B 2LR2A 5GTHE 3JD3A 1Q86Q 4NYKA 2Q0OC 4R50A 1FDIA 5AW8B 2KS1A 2H7HA 2ZDIA 3ABMB 1GL2D 4JI1O 3K08A 2YXLA 3VQXA 2DMXA 4GKKB 2QKAA 5B66H 1KILD 1EN6A 2W6JG 4WWIA 1SQBD 4D6TG 1JO5A 5FL7G 3T1HO 3TGUJ 4IHJB 3BCCE 3GVMA 2YIAA 2PZSA 4X65B 1PPJH 2JS3A 4LGDE 5AVZB 2QM8A 3ZEDA 1H0TA 1VIBA 1QQCA 3RGUA 5J2TB 2E5TA 3D6ZA 1HGZA 2WSFH 4X1YB 1WNSA 2RN0A 2K9JA 3KXDA 3ABLB 3CRMA 1NTZJ 5CCGC 1RQVA 1JY3P 3NMDA 1O9GA 1F7YA 3O8ZA 1EZVI 3HD7A 5CA0A 1DLBA 3MDSA 2OYIB 2Z0AA 3OA7A 1A02F 1NZ6A 2Q6AA 1FBMA 1WA8B 3H1HJ 3D6YA 3IN6A 1J1DB 1CEZA 3CCMV 4DW0A 3EFGA 3CC4V 4EI2A 1SZTA 2QGNA 2X0LA 1YTZT 1K92A 1S5LZ 2VQEB 3K04A 3IC9A 3H1LE 2UXBB 3MP7B 2IYOA 2YKOA 1B06A 1HR0B 2IX7C 2QTOA 1JY2O 1VQ7V 4JI7B 1NT2B 1PNMA 2DOSA 3LNMB 1LP1B 4PD4F 4CH4A 3V4WA 3CXHF 2KXPB 3AEIA 4H0LD 2XASA 3K06A 1NYHA 4UVBA 1AI4A 2V1DA 3AE4C 2Q9LA 3M8AA 5TISH 5K5GB 1GRJA 4X62O 1HVVA 1SQPD 3ASNB 2LKMA 1K73Q 3D71A 2B5UA 2WSSG 4GODA 1NQTA 1JMKC 3IC7A 4FPPA 1XILA 3IGAC 1N73B 1OW8A 1RE4C 5DJTB 1N34B 4DV1O 2N74A 3DXRA 3U59A 5AW7B 3K03A 1KB9F 1QEXA 2YEVB 4DYLA 5LA6B 1XNRO 4LF5B 2RMKB 4H44C 4KP4A 3ZRWB 1EZJA 4PI0A 1MV8A 2P22C 3FB7C 2E42A 4GLXA 1NTMH 1F51A 1GZLA 4NPDA 3GG2A 4DV5B 4J80A 2EZOA 1Q7YW 4LF4B 1M7LA 3MGNA 1Q2NA 3KCXA 4X1IA 1W0JG 2HHHO 1PL5A 3RYIB 1R5LA 1VQPP 3N7NA 1OW6A 3A2AA 2KG7B 2DYSC 1W2BO 3FAVB 1P84I 5KHJA 4DV0B 3Q2YA 5B5EH 5DEDA 3ZBHA 1OMIA 2WITA 2VQFB 4O4IB 3D3IA 3X2QC 3HE4A 3JCUZ 3AG4C 1Y76A 1ZX3A 5E79H 4DR2O 3OW2U 1IK7A 4W4KA 1Q6IA 4J7JA 2SPZA 1IXMA 1BGYE 5BU8B 1PP9J 1HUCA 5F2VO 1VQNP 1PKXA 2HG5D 2UXDB 3HE5A 4DR5O 3S3XA 1LTTC 1NU1J 3BRCA 1M93A 1H8HG 4JI2B 4GX1A 3ASOC 4I9WA 2JGUA 3AG3C 3HRNA 1LTJC 4H13D 1PZQA 1R3IC 4I50A 1IBLB 1XNQB 2K1AA 2K9JB 3K5LA 4CH5A 1VF5B 3FXDA 2QKCA 2JEUA 3BCCJ 3HD7B 3CX5D 5CA0B 5ITZA 4JI8B 3RBXA 4JQ0D 1MZFA 2BCCH 3UT5A 1AI5A 3G67A 3LIDA 4IFFA 2QJYB 2Q3EA 1SP4A 3C1LA 3C3SA 2A3QA 2E75B 4JI3O 4JF7A 3VQWA 4GOFA 2AW9A 3IFMA 4Y28J 3E35A 1R5SA 2FYNB 2ZR2A 1QLEB 2V4DA 2ZE8A 5E1AC 3L75E 2AZ0A 1HR0O 5IYDO 2F4VO 2OCCC 2ZXEB 4PV1C 3RGBA 3B8EB 1RE4A 2N1TC 5IJ9A 1BSNA 1T2KD 2N9BA 3SYPA 3H1KH 4EKWA 1PIXA 2E5LB 1Q7YQ 2ZIOA 3L35A 3L71E 4RJTA 1H2LA 3VQYA 1E79G 3B71A 4FM0A 3AEAC 2L5GB 4OPHA 4TQDA 2D2CC 3VBBA 1YDXA 1Q81W 3DXRB 4QE7A 1NTMG 1NWQA 4JTDB 1S9KD 3L73E 4LFAB 4IFMA 2C0XA 2GTAA 3R65A 1ZP0C 1PV3A 1YIJV 4JYYA 4IGGA 3SJQC 1VQ9V 4RQFA 3H1JJ 2EILC 1WP8A 4NXNO 1L0NE 1AB3A 3CMAP 2OYHB 2I1KA 4LF5O 3H1IJ 1XOUA 3WU2H 2IYPA 3T97A 4A7PA 2WT7A 2EBOA 1LT9C 4B3TO 3CI9A 3ZMTA 3CCQV 2OQQA 4PD4H 4EB6A 1AQTA 1BDDA 4DO2A 3CXHH 1MG1A 4DV5O 2WLHA 5A2QN 3VP8A 4DOJA 3SJBC 3T1CA 3OUFA 2UUBO 5JCOC 4LF4O 1BCCE 1G1IA 1D7MA 3SDLA 1T3JA 4LFBB 1YI2V 1P84E 1LJ2A 3OR6C 4AQRD 1W0KG 1Q43A 2P6JA 4DV0O 4L8JA 1CI6A 2K3RA 3HE4B 1Y76B 5IE9A 1PGJA 2H8PC 3C9IA 3EWKA 3PTZA 2VQFO 1KB9H 3HKEA 3KKYA 2PAJA 1E1QG 4MVUA 3PHLA 2WSCJ 4ZKPA 1ZTEA 2HJFC 3RWRD 3ZHUA 4X1KA 4D6TE 1KECA 5AW5B 2LP7A 3HE5B 1K4CC 5H9CA 3AE3C 1M90W 1R6TA 1G8MA 2UXDO 2K37A 4CS2A 5H2FE 1G6UA 2BCCG 2ODMA 2BCCD 4G28B 4DXWA 1FZEA 1FZBA 1SRYA 1PL0A 2HLDG 4DR7B 4I50B 3BASA 1OX3A 2YO2A 5FLXN 1K3EA 1WN7A 1GMGA 4DJGA 3T2MA 1MA1A 4WY4A 3MIWA 3JCZA 3ABTA 5ITZB 2NPSA 1E5WA 3IF4A 1OVVA 1CP9A 4J9ZB 2FKXA 1MOFA 3I5DA 3E83A 2UXNA 1VQ6V 3UT5B 1TGOA 5LHHA 2WA3A 3O9OA 2IBZH 4L74A 2E74C 1YJNV 4Q6GA 5JQGA 1Q81Q 2YI9A 1HNXO 5IYZA 3ZMZA 1L2PA 4ZI7A 3H1KG 1IURA 4YIPA 3H1KD 4TSFG 5KKZC 2Q5UA 4MVQA 4WFHA 4UB6H 2PGDA 3G6EP 3JALB 5B1AC 5CA3A 2Y4UA 1FYJA 1DD3A 4GIFA 2WLIA 2F66C 3D3QA 1RH5B 4B3RO 2IM9A 1YZBA 5IJ9B 3CRCA 5CMUA 2XTAA 1PM9A 3VMZA 1FXVA 3CRQA 1W5CE 2OWOA 1JOCA 2QG4A 4R6ZA 1IFDA 3TDKA 5DN6G 2Q6QA 4YY3B 3PH0A 2AEMA 1VP7A 3RFRA 2IJJA 3STZC 3AEEC 2E5LO 4DUZB 2C0WA 4H44B 3VOUA 4QJFB 1L0NK 3E22A 2EZPA 5LP6C 3HUSC 4J7ZA 4I7ZC 2N9YB 1H2SB 1S72P 2WLKA 3GMAA 3BCCD 3JD2A 3OEHG 4PD4D 5JWPA 1M1JC 1WJZA 1NKDA 4JZGA 2GDSA 4XA4A 4WFEA 4LFAO 1YIJP 1QR8A 3A3YB 5JCOA 5APSA 3CCVP 3CC2P 3QTCA 4P9PA 2Y48A 3T97B 2DYSB 3HD7D 2Q7GA 2WT7B 2ZYGA 5LXTB 2YSUB 1Y9BA 3B40A 1BSHA 1AFOA 4K35A 1XMOB 2YNYA 4IYHA 5LGUA 1M90Q 1I0HA 4PJ0H 1K7DA 1MZEA 4U3JB 3X2QB 1FU1A 2E75D 1Q3EA 3AG4B 4D7TA 3JD4A 4O4HA 4MN4C 1GM7A 3JAWB 3B5NC 1MSDA 1ORQC 5LMNO 1S3JA 1FZCC 4LH7A 1QLED 3MZWB 2CTQA 3H1LG 5B66E 3H1LD 4Y99C 1K33A 1SF9A 4OX9O 1BDCA 1R1BA 3CWBH 4GYCB 1DF5A 1RE3C 3WUVA 5KAIZ 1PPJE 2Z5IA 3KHUA 4EDFA 4O2BA 2W0XA 5B3SC 4I6MC 3ASOB 1WLEA 1YXBA 3CEIA 3AG3B 1LTJB 3DTUB 4FLZA 1W2EA 5EFWB 5EK0A 3DC5A 1JOYA 2IU0A 1DX7A 3HKDA 4BWNA 1JMMA 2IDBA 3PN1A 3VTPC 4R4MA 3CL3D 3ABKC 1OCRC 1WRGA 2XOKG 3S3WA 1CPYA 2WAMA 1SQXH 1W2BU 2YIBA 3RT3C 3K0GA 3CS5A 5CMZA 1USEA 4D6TJ 1JA8A 1WAZA 4DR7O 4JYBA 1LGHB 1ZR4A 4Z1MG 1G2CA 1H2NA 3A8TA 1EXJA 2A06H 4TT3G 1F4MA 3M06A 3KZIH 1K4DC 2EJ7A 3JAKB 5APQA 1KYOF 1Y67A 4PA9A 1BL8A 1PGQA 1EQ7A 1OW7A 3VOPA 4K0KB 4HBNA 5CA1B 1L0LH 2E5YA 4OH8B 2M8RA 3UIAA 2OCCB 4PV1B 2OYOA 3N27A 3N2KA 1CSBA 2N1TB 4IOIH 1HWTC 5IYZB 5CCHC 1LTAC 4ZI7B 5TISE 1OCZC 4KL1A 3H6PA 4I4TA 1Y74A 2X6CA 5KAFH 3WB0A 2Q5ZA 2OTLP 4QPJA 4HH2A 2KLVA 3V2RA 1EDLA 1AI6A 3CC7P 1AVYA 4JV5B 4R7CA 2HODA 2WLIB 1H88A 5HFMA 2D2CB 3WUUA 2Q7HA 1K8AW 4LH6A 5LP6A 3EHBB 1KKDA 1SKVA 1GTWA 3I5CA 2GA1A 3AEFC 3TK1A 4ZOLA 1BGYG 3T1HB 2RN9A 1BGYD 2MK3A 3SWFA 2EILB 5JVDA 4FM2A 5CCGD 1NTME 1KQLA 1H38A 2Q8VA 3RYHB 1DF4A 3JD0A 4PD4I 2KSEA 4J11A 1SQPJ 1LT9B 3CXHI 2QSIA 3BRVB 4FLWA 2C2AA 3STLC 1X0TA 3CCJP 1T3UA 1NI8A 2I8DA 4ASVA 1VQMP 2Z5HA 5BZBA 5APWA 1NOHA 2OGUA 3OGIB 3P32A 5B5EE 3RYFB 1FZCA 2NNUA 4UCSA 4FZ0A 1XHXA 5E79E 2OIGA 3CLQA 4O4HB 2M7WA 1VQKP 3ZMSA 1XMOO 1R73A 1LR1A 1VQ8P 2IZ0A 1LT1A 2K88A 4BIOA 2JJ2G 3SJCC 5APXA 4DRXB 5KLIC 5CBOA 3LDDA 1S5LH 1S2EA 1PV0A 1K04A 3S1KA 1IC2A 4DT0A 3L75G 3L75D 4OGQC 4L76A 3H32A 1XHZA 3V2QA 1PFIA 2JJ1G 2C9LY 4X62B 1MABG 4UB8Z 1HP8A 2AXTZ 5LBQA 2UUAO 2WLLB 1BQZA 3A0BZ 2ZJSE 4AQYO 1SQXG 1FPOA 4WFBV 4YHHO 4DV7O 2V7QH 3RYCB 2Y9YA 4H37A 4KHPB 2OTKE 3L71G 3L71D 3B77A 4BXLA 4H44D 2W27A 2A06G 2A06D 1JNMA 2M6YA 2BCCE 1KD1W 2IBZI 1DD4A 2WSFJ 3CCUP 1YJWP 2EIMC 2UWJE 2GUSA 3L73G 1GDTA 2E74B 1L0LG 3L73D 1L0LD 1K8AQ 5IYCO 1HJBA 1J95A 1G2CB 1NTKK 2LW1A 3B2EE 3HKCB 2FXOA 3WB2A 4YJ2A 1M57C 4OPAA 2VWKA 4I55A 3RBZA 1L0NG 1L0ND 5KKZB 5B1AB 1X9VA 1NVPB 3ZX6A 1Q8IA 1RQUA 4FMTA 4K0KO 5K1XA 3BHPA 2ZAEB 2YS8A 1Y74B 3H1KE 2FL4A 1I5XA 2ZNJA 1D2DA 1MFTA 3UM7A 1HJ0A 2XAJA 1BCCD 4RAIA 1AQ5A 4RKUJ 2ZXXA 1RSOA 1P84D 2EJRA 1SQVK 1NTMK 2QM7A 5LP6B 4DR2B 3HUSB 5M1BA 3K3WA 3KG2A 1FXHA 4I7ZB 2VWJA 4JV5O 1GK6A 4GUNA 5IYBO 1B3QA 4QPKA 3JCUH 1M1JB 2FYUK 3AK3A 1QL2A 3ETDA 4DR5B 1VQNV 1O9HA 3D36C 2M3EA 5JVDB 4D6TD 3WU2E 3NR7A 3BY6A 1KYOH 4PD4E 5EYPA 3MAQA 3CXHE 5AW1B 1VQ4P 4TOIA 1WB8A 4EIJA 3OTFA 5DM6V 1WP7A 3A0HZ 1AVOA 3ZHSA 1Y8AA 2XDJA 4JF3A 4LF8O 4WFAV 3LSSA 3P3PA 1NTMJ 2KQXA 3B5NB 2UUCB 2A45H 2O01H 4HYTB 1TA8A 1URFA 4X89A 1H2KA 1FZCB 1YF2A 1IO4A 3TXQA 3L72H 1K9MW 4Y99B 2A7WA 4JI3B 2UXXA 1LUWA 2G38A 2WQYC 3NXSA 5APYA 4FIPC 3JC22 3M9QA 3G71P 1KD1Q 4PV1D 1HNZO 4O4LA 1WMKA 2N1TD 1KB9E 5B3SB 3RL0C 1K5SA 5J9PC 4N3YB 2F4VB 3GF3A 5H2FZ 2DYRC 2YXQB 2V7QG 1E1RG 2XT9A 4WVZA 2EIKC 3AE5C 2ZE6A 1S0VA 3H32B 5CB4A 2R72A 2R32A 2XNDH 2LW7A 1VL2A 4JGSA 1N7SC 3UO3A 2B1IA 1NTKH 3ABKB 1OCRB 1H8AA 4CH3A 1TUEB 4J42A 3J80N 3BRTB 4JI4B 5KMGB 1RY3A 4FZ1A 4LFCO 4X20A 2YXRB 4KHPO 4ABMA 2IBZE 4QNHB 2R3SA 1VF6C 4B3SO 4XE5B 4NXNB 1QX8A 3AE8C 1JMBA 4ICGA 3F5HA 1P49A 1JY2N 1SS1A 3CMAV 1XBLA 1OCZB 1SQQH 3FB8C 2BCCJ 3PRJA 4B3TB 4I55B 1SQVH 4UB6E 2KSDA 3CB2A 1GKFA 4TQFA 4MT8A 1I94O 2UUBB 2Q73A 2G8YA 3TGUH 1OJHA 5AW9B 2FYUH 4FM1A 4GOEA 3CMEV 4DR4O 2H8PD 4QE9A 2BTQA 1AJYA 2O3JA 5LHGA 1NR7A 1S5HC 3O6QA 2IJHA 1U97A 2QEXP 1RSOB 2Q67A 1GD2E 1XL6A 1JCCA 1M5IA 3D36A 1YTFB 2B87B 1CW5A 3SYOA 2YICA 4B3MO 3ZJZA 3SJAC 3H1KJ 1KYOD 1PPJG 1K9MQ 1TVKA 1PPJD 3MHVA 2H94A 3H1HH 1U57A 4K8XA 4U3FH
chains in the Genus database with same CATH topology
2QIWA 4Z1MH 2ZT9B 1NGMB 3AE6C 4TT3H 1YQ3C 2J5UA 2P10A 3Q1MA 3Q5PA 2E75B 1R8EA 2WSEJ 1JB0J 4H0LD 2FBWC 3AE7C 1NYHA 4Y28J 5KLIC 1KQGB 1ZOYC 3AE4C 1K04A 2K9YA 4H13B 4H0LC 3C8VA 4OGQC 2WQYC 1UIXA 3GLMA 5L8RJ 2IDBA 4R4MA 3D71A 1KORA 2E74D 2YMKA 1K05A 4PV1D 1DIPA 1WMKA 1KTMA 1OW8A 2E74C 3D70A 4PV1C 3AE2C 1Q90D 1YQ4C 4XFJA 1KMIZ 3GF3A 3RK3E 1EXJA 3AE5C 2NZ2A 4H44D 1PIXA 4H0LB 4KT0J 2H88C 3AECC 4OGQB 3G9RA 5KKZC 3AEDC 3B71A 1VL2A 4H44C 4OGQD 1OW7A 1DD4A 2FXPA 2WSFJ 3AEAC 2WPVB 1MKMA 1DD3A 2D2CC 3AE9C 2E74B 2JO1A 4PV1B 4YTPC 2BEZF 2QJKC 4GDOA 3H25A 2BEQD 1S5LX 1PV3A 1ZP0C 2MKVA 1FDOA 3AEEC 2G3AA 1PL5A 1KQFB 4H44B 1FDIA 1OW6A 1EXIA 2D2CB 4I7ZC 1RQUA 3Q3DA 3Q2YA 3GMAA 3ABVC 3AE8C 1TU3F 2D2CD 2OQQA 1ZRTE 2JP3A 3FGAD 1OMIA 2YIUC 1GMJA 1KILE 3AEFC 4YXDC 1HJ0A 2E76D 4RKUJ 3AE1C 4IL6X 4U7JA 1IK7A 2O01J 2QJPC 1HF9A 4R4LA 2G8YA 3LW5J 2E76C 3D6ZA 3T97B 1VF5C 5M1BA 4I7ZB 3IAOA 3S9OA 1Y9BA 2ZT9D 2QSIA 1RQVA 3R4YA 3Q5RA 1S1CX 1AJYA 2ZT9C 2E75D 3AEGC 3O6QA 3SFEC 3EWKA 3Q5SA 2QJYC 3D6YA 2E75C 3IN6A 2H89C 2WSCJ 4H13D 2E76B 2V7QJ 3SFDC 3RL0g 1VF5B 2FYNC 1ZMEC 3AEBC 4H13C 3AE3C 3GF7A 1VF5D 1U57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIW A;  1Q90 D;  1S5L X;  2ZT9 B;  4I7Z B;  2QSI A;  4H44 B;  4KT0 J;  4H0L B;  2E75 B;  4OGQ B;  2D2C B;  5KKZ C;  2WSE J;  1JB0 J;  4Y28 J;  5KLI C;  2QJY C;  1ZRT E;  2K9Y A;  2WSF J;  4H13 B;  2WPV B;  2YIU C;  3C8V A;  2WSC J;  2E76 B;  2E74 B;  5L8R J;  4PV1 B;  1VF5 B;  2FYN C;  2QJK C;  4RKU J;  4IL6 X;  2O01 J;  2QJP C;  3LW5 J; 
#chains in the Genus database with same CATH topology
 2IH1 C;  3DGE A;  3W67 A;  2EIN C;  1Q82 W;  3TET A;  4X8A A;  2R9I A;  2GUZ A;  1A02 J;  1AP6 A;  3H01 A;  2WSE J;  1JB0 J;  2A45 G;  3LW5 H;  1JUN A;  1OV9 A;  3AG2 C;  4UFZ A;  5EYP B;  2KP8 A;  2ZE7 A;  3FB6 C;  4LF7 O;  1H0T B;  3L72 G;  2RDC A;  1OXZ A;  1SVF A;  3JAS A;  4PJ0 E;  5AVX B;  3L74 H;  5D5Q A;  4G27 B;  2E74 D;  1M56 C;  5B66 Z;  3R66 A;  4PDR A;  1WT6 A;  3I56 P;  3APQ A;  4DK0 A;  4W7Y A;  2X7R B;  3VYI A;  1Y47 A;  1F23 A;  2PGG A;  1KTM A;  4WBN A;  3GHG C;  2KSJ A;  1SQF A;  2BE3 A;  3CWB E;  5KLI B;  3U10 A;  4J10 A;  4CS4 A;  5KLV H;  2UUC O;  2R5B A;  1PD3 A;  4PI2 A;  1HNX B;  2Q7C A;  4OGQ B;  1NVP D;  1EDI A;  4O4L B;  3BA9 A;  3FYE B;  1GL2 C;  1NHL A;  4WY4 C;  2XND G;  5JJN B;  2NPS C;  3TJT A;  2FXP A;  1IBK O;  5AVR B;  1N7S A;  1NTK G;  2XAF A;  1NTK D;  3JSL A;  3ZN1 A;  3G6E V;  4DV2 O;  1IDS A;  3G3Z A;  1Y66 A;  4B3R B;  5JJJ B;  3KQG A;  1FS0 G;  1URQ A;  2BEQ D;  2FML A;  5CB4 B;  2JWD A;  3T4Z A;  5BVZ A;  4J9Y B;  2L91 A;  1B6Q A;  3H1L J;  1SQX E;  2W6I G;  2GBO A;  4B7E A;  2EIM B;  1UII A;  5C39 A;  4TV8 A;  2HR3 A;  1VF6 A;  3C3T A;  1M4U A;  1TU3 F;  3ZRS A;  2A06 E;  3ZIA G;  4GKG A;  1QVG O;  3CC2 V;  4JI4 O;  3CE2 A;  3KZI E;  2YO3 A;  1SQQ G;  1M57 B;  2CAZ C;  4B08 A;  5EBW C;  1S72 V;  4PA7 A;  1FAF A;  4LC1 A;  1SQV G;  3TSI A;  1I7F A;  1SQV D;  2WWW A;  1ROP A;  1NTM D;  3CCS P;  4ZBM A;  1FAV A;  2QJP C;  1L0L E;  4OWF A;  5L3C A;  2YID A;  4XDL A;  3CCR P;  4LNU A;  3TGU G;  2N04 A;  1OVR A;  1EN4 A;  2FYU G;  1Q6U A;  2FYU D;  5KAF E;  2AGA A;  2R9R B;  4LWS A;  3CCV V;  3L70 H;  5FPR A;  2JVD A;  4RQE A;  3OAA G;  2KNC A;  3B5N D;  5KJ7 C;  4FFB A;  3ZHT A;  4LF9 O;  3BA8 A;  1PP9 H;  1Q82 Q;  3ZCC A;  1JY3 O;  2R3C A;  2AHY A;  1RHZ B;  3F5T A;  2JEX A;  4MW3 A;  1V55 C;  4M3L A;  3ZMU A;  5GTI Z;  3OTO B;  1NU1 H;  4X1I B;  5LMN B;  2YUA A;  4DR1 O;  1JM0 A;  1NO4 A;  3GB7 C;  1KV4 A;  2CUG A;  2DQ0 A;  2BTQ B;  5C93 A;  2Q9I A;  3CME P;  4PA3 A;  1NKN A;  3J81 N;  1OCO C;  4OX9 B;  3O6Q B;  4U3F G;  3IAY A;  2B9Z A;  4U3F D;  4ZKU A;  1KC8 W;  1AR5 A;  3D8C A;  1M1K W;  2CTR A;  3ETQ A;  1KYO I;  2XAG A;  1GN3 A;  1LNQ A;  4Z2W A;  2PF4 E;  4AYC A;  1TVK B;  2W6A A;  3PP5 A;  5EC2 C;  2K9Y A;  1XI1 A;  2CK3 H;  5KAI H;  1NAY A;  1P7B A;  1DEE G;  1W59 A;  2RCV A;  3ZN0 A;  1UIX A;  5H6R A;  4KXR A;  1KOR A;  2BOC C;  5CBH A;  3L74 G;  1SFC A;  5APU A;  2A45 I;  2IPP A;  4JPZ B;  4N6J A;  3D70 A;  1UPG A;  2LGQ A;  2B89 A;  1VQL P;  3GHG A;  1YEW A;  3JYC A;  2ZQM A;  1L8D A;  2Q68 A;  5KLV G;  3JAS B;  1BGY J;  5KLV D;  1NH4 A;  4A5U B;  2HVJ C;  2MW2 B;  3BVO A;  3M7M X;  2IH3 C;  3AED C;  2KB7 P;  3IR9 A;  3F7Y C;  1ENV A;  4PDV A;  1P4R A;  3V6I A;  4IFD K;  1GL2 A;  1WPB A;  5CCH D;  4WBN B;  3RL0 B;  5KX5 A;  4N78 D;  2NN4 A;  1KIL A;  1HNW B;  1S5L E;  4DV4 B;  1KU9 A;  2AHZ A;  2DYR B;  1PGO A;  3IJ4 A;  1QL1 A;  5EZY A;  2EIK B;  4ASW A;  1L4A C;  4PHZ A;  1RF0 C;  4ZKI A;  2MKV A;  4HJG H;  1YIT P;  1K5Q A;  4MW8 A;  2ITA A;  5DJU B;  1N7S B;  1SES A;  1SQX K;  2D3O W;  2OTL V;  5H5N A;  3DC6 A;  3CSX A;  2F1M A;  4AUW A;  3CC7 V;  4PDM A;  2CGO A;  3RVZ A;  3THO A;  1FDM A;  4N21 A;  2YIU C;  3H1J H;  2DE0 X;  4IT5 A;  1YTF D;  3H1I H;  4UCT A;  2Q0A A;  3AE1 C;  4IL6 X;  3K0D A;  3VN0 A;  3TCU A;  4JI0 B;  1K34 A;  1L0L K;  2KYV A;  3MHS C;  4TV8 B;  1MSW D;  1Q6H A;  4DK1 A;  1F4N A;  3L75 J;  3U1C A;  3EFF K;  1JTH A;  3B8N A;  5FNV A;  2WLM A;  4P30 A;  1EC5 A;  4RO2 A;  4HAM A;  1FE6 A;  3L70 G;  4JI5 B;  1AJP A;  2Y4T A;  2ZT9 C;  1XL4 A;  1GW4 A;  3L70 D;  1KP3 A;  2KZI A;  4I1L A;  3CYO A;  1AIL A;  1KC8 Q;  5KJ7 A;  2B1G A;  1M1K Q;  1ZUQ A;  1IVS A;  1JCH A;  1THZ A;  1SQX J;  3IFX A;  3SPC A;  3CXC U;  3CCJ V;  2F43 G;  1GN2 A;  1EM1 A;  4LNU B;  3L71 J;  1VQM V;  5AW0 B;  3ITK A;  3CXH D;  4FJC C;  1ZME C;  2QE7 H;  4IIJ A;  1NH2 B;  3WG7 C;  1LTG C;  3FKS G;  3GF7 A;  1VF5 D;  1FJP A;  1FOS F;  1T8Z A;  3A7O A;  2GM4 A;  3OM3 B;  1J5E B;  3NFQ A;  2WSC H;  1QHT A;  5GTH Z;  3L73 J;  4GZR B;  1L0L J;  4EB6 B;  3Q1M A;  1LWU C;  3WMM 0;  1H8E G;  2O57 A;  2GSM B;  3CD6 P;  1N0J A;  4RWU A;  3ZRV A;  2WPD G;  4HNA A;  1VQK V;  4UCV A;  3MD0 A;  1L0N J;  3W7S A;  3OTO O;  1HGV A;  1VQ8 V;  3OMI B;  1VPC A;  5GON A;  2BSK A;  3JCU E;  3TNU A;  3CPW O;  4WFF A;  3LIE A;  2W0F C;  1KB9 D;  3M99 B;  2Y0P A;  2CDY A;  2RJZ A;  2EIN B;  4YXW H;  5AVT B;  5BY1 A;  4I9Q A;  1CI6 B;  1ZAU A;  1KYO E;  3AE2 C;  1YQ4 C;  4XFJ A;  3VP9 A;  1AA0 A;  2P5O A;  2UUA B;  1BCC J;  2O1K A;  3AG2 B;  5J2U A;  4AQY B;  4YHH B;  3HKE B;  1RPO A;  4DV7 B;  2ADQ B;  1PNL A;  3G9R A;  3FFQ A;  2HP8 A;  4JPR A;  5JH7 A;  4X1K B;  5A9G A;  4AIL C;  4JBZ A;  4UB8 H;  1M56 B;  2IJK A;  1J2J B;  1U7M A;  2AXT H;  3E1I A;  3BVH A;  3A0B H;  1EZV H;  4B86 A;  2HYN A;  2OT5 A;  2JO1 A;  4LBE C;  1IK9 A;  4AI8 A;  4YTP C;  3GHG B;  3L72 E;  1M57 D;  1RF1 A;  3UQ8 A;  4KUM A;  1LTB C;  1BHA A;  1ZV8 A;  3CCU V;  3RVY A;  1YJW V;  5CN0 A;  2P1J A;  1S5L X;  2IBZ G;  2IBZ D;  1KFN A;  1L4A A;  3PJS K;  1RF0 A;  1GL2 B;  4PA6 A;  3ETG A;  4WY4 B;  2Y0E A;  3V5B A;  1XMQ O;  2NPS B;  3N2G A;  4IL6 H;  3OUS A;  4K8Z A;  2Y0C A;  3J7A U;  1BMF G;  3A0R A;  5EBL C;  5EZY B;  5AVW B;  1HNW O;  4JYC A;  3OD4 A;  3W7U A;  5JQG B;  4DV4 O;  2Q7E A;  2K1E A;  4U7J A;  2OIE A;  2HFE C;  1NTK E;  1U7J A;  4NR1 A;  4J41 A;  3SR2 C;  1BE3 H;  3L36 A;  3OW2 O;  1WB7 A;  4O4J A;  1VMG A;  4NB5 A;  1FS0 E;  1QNM A;  4JAS A;  1SA0 A;  3E8F A;  2P58 A;  3OMN B;  4X66 O;  3HPL C;  3FWN A;  3Q4H A;  4F6R A;  1AR1 B;  5CJ0 A;  2ZD9 A;  1R3J C;  2ZNI A;  3SWY A;  4JAV A;  3JD1 A;  2QJP B;  2LO1 A;  4BRY A;  2EIJ C;  2KB1 A;  3RK2 C;  1TAE A;  2V7Q J;  1JY2 P;  1JTH B;  3RL0 g;  4JI0 O;  1AVM A;  5FNV B;  1MFZ A;  4MTF A;  4FK5 C;  2QE7 G;  4CH6 A;  1SQQ E;  4GT1 A;  3HKB A;  1FZF A;  3E22 B;  1SQV E;  1XUQ A;  2VRS A;  1GU4 A;  2JEE A;  2QJ1 A;  4D7S A;  2HEP A;  5AVS B;  2RQ6 A;  1A32 A;  4JI5 O;  1VQ4 V;  4LF8 B;  3TGU E;  3LUT B;  4KJM A;  1V55 B;  1LWU A;  2FYU E;  2KZJ A;  5L3B A;  4XDK A;  2XV5 A;  2QKS A;  1KQG B;  4R8C A;  5JJE B;  3CX5 F;  2KOG A;  3E8B A;  5IY5 C;  1IZ3 A;  3WB1 A;  3E2E A;  5LOV A;  5AVQ B;  3R2P A;  3GWO A;  4LR3 A;  3A0H H;  5B1B C;  3GLM A;  5L8R J;  1OCO B;  2K9P A;  1PL4 A;  4OXS A;  4ZNC A;  2JK5 C;  1J5E O;  1GN4 A;  2IJI A;  4YXW G;  1NBM G;  1M9N A;  2VS0 A;  1GK4 A;  4IHJ A;  1VQ5 P;  3CWB G;  1KZU B;  2CGN A;  1HNZ B;  3CWB D;  1ZR2 A;  3FB5 C;  3G71 V;  4YJ3 A;  1KMI Z;  3VMA A;  1H2G A;  1IFN A;  3SSU A;  5IJ0 A;  3H1H E;  1KB9 I;  1QVG U;  4U3F E;  1X22 A;  4MVM A;  3ABU A;  1SQB H;  1GU5 A;  4L87 A;  5BMV A;  1MKM A;  1YBK A;  1FXK C;  2F23 A;  1IX9 A;  4PJ0 Z;  4JTC B;  5AW3 B;  1Z5W A;  1KQS O;  4O2B B;  1WA8 A;  3OEE G;  1QU7 A;  3H25 A;  4BW5 A;  2Z5U A;  1FJG B;  1QCE A;  3L74 E;  5JH7 B;  4P2Z A;  2AEJ A;  1YSC A;  3A5T A;  3U0Z A;  1SQX D;  4LFC B;  1XRE A;  1KQF B;  4JTA B;  3OR7 C;  2PYL A;  2Z3Y A;  3HKD B;  1MNG A;  2ITD C;  1KUQ A;  1FFT B;  5CHX A;  1SQG A;  1XDC A;  2OCH A;  1IZN B;  4DR6 B;  5LYJ A;  2DWE C;  3ABV C;  5KLV E;  2DW3 A;  4B3S B;  2R44 A;  3P8C E;  1EFR G;  2DWD C;  2XU6 A;  3BAB A;  1DH3 A;  1N0N A;  5KHI A;  1SER A;  1L4A B;  3BFR A;  2GHY A;  3E8H A;  2Y69 C;  2W83 C;  3ZMV A;  2O01 J;  4N78 E;  1HF9 A;  4KHX A;  2L35 A;  2E76 C;  5APV A;  1I94 B;  4WB4 A;  2ZVN B;  3S9O A;  4GCZ A;  1BE3 G;  2P67 A;  1IBM O;  1BE3 D;  3R4Y A;  4TLF A;  3I55 P;  1N73 A;  5LMU B;  1YJ9 P;  2YIU B;  2YXY A;  4JYA O;  5CBN A;  3AEG C;  4DR4 B;  1CZQ A;  3N2K B;  1FFX A;  4ASU G;  1SQP H;  4I4T B;  2IFM A;  1N86 A;  3WFV A;  2WSS H;  4C7N A;  3SFD C;  1KKC A;  5L3D A;  5LA6 A;  4PA4 A;  2QEX V;  3GW6 A;  2LXC B;  5AVY B;  4CC6 A;  3C90 A;  4B3M B;  1SQQ K;  2HOD B;  4WBA A;  3AG1 C;  3Q4H B;  2ZT9 B;  3G4S P;  1HTL C;  5LGT A;  1NTK J;  5BU5 A;  4YIO A;  1RM1 C;  1SS3 A;  2ZE5 A;  2J5U A;  4BIU A;  4BRY B;  4EFE A;  2XAQ A;  3MUD C;  1R6K A;  1Z56 A;  4ZOL B;  5IWA B;  3RYI A;  2P7T C;  3HKB B;  3L70 E;  4TWK A;  3WG7 B;  1M56 D;  5EIB C;  2B9B A;  4UV9 A;  1H89 A;  4LF7 B;  1EN5 A;  1PP9 E;  1R3L C;  2YMK A;  4NVP A;  1N32 O;  1NTZ K;  2GUV A;  3LSU A;  3QWO C;  3OE7 G;  2PI5 A;  1OFC X;  1LWU B;  4O4I A;  2YMY A;  1NU1 E;  3VMY A;  1SLQ A;  4X9Q A;  3VMX A;  5FPO A;  2LXB A;  1SQQ J;  3SPI A;  3I56 V;  5LOV B;  2V4H A;  3RK3 C;  1SQV J;  1YHQ P;  4WY4 D;  1ZRT D;  2NPS D;  4DV6 B;  4MVR A;  1VQO V;  2ZCE A;  3FYI B;  4MTO A;  1L1F A;  1SQB G;  4WF9 V;  2QTS A;  2KUB A;  4I0X A;  4CPG A;  1JJ2 U;  1D5N A;  2UU9 O;  2IW5 A;  1OIP A;  2FYU J;  1D5A A;  5AW4 B;  2JJL A;  4YJ3 B;  1FXK A;  2FB5 A;  1IBK B;  2KLU A;  3E1R A;  2FFD C;  5IJ0 B;  4DV3 O;  5KAI E;  1QBZ A;  3OAK A;  5EBM C;  4DV2 B;  3K58 A;  3S4R A;  2CTP A;  4MVO A;  1FD9 A;  4X88 A;  2CH7 A;  4UV8 A;  4CS3 A;  5BMV B;  2Q69 A;  1EXI A;  4OVN F;  4Q20 A;  3B4S A;  1R3K C;  4CBC A;  2J59 M;  4GX2 A;  2QA4 V;  4LLH A;  4E2L A;  1DK1 A;  3CCE P;  2D2C D;  4U3F J;  5KLV K;  5H6Q A;  2UXC B;  3NTN A;  2WVR A;  2KI7 B;  1I08 A;  1N33 B;  2H43 A;  3W7X A;  2HLO A;  3KCY A;  5AW2 B;  5KA5 A;  2PFX A;  1FJG O;  3CX5 H;  3UKM A;  3LW5 J;  1URQ C;  2HJD A;  2JKV A;  5LYJ B;  3K5N A;  1FZA A;  5KJ7 D;  3CCS V;  3K9S A;  2PYJ A;  2FXM A;  2WA4 A;  3L74 J;  4DR6 O;  3CCR V;  5CJ4 A;  3CPW U;  3UO2 A;  5HFL A;  2W8Z A;  3B8M A;  5GW7 A;  5KA6 A;  2R5D A;  1Y6X A;  1YTZ I;  4HYO A;  2AEF A;  4FLX A;  1SQP G;  4LF9 B;  4YJ2 B;  2H89 C;  1S4X A;  5B1O A;  5KLV J;  1WPX A;  3TXS A;  3U1A A;  3ZHV A;  3H1J E;  2P06 A;  4DR1 B;  3QH9 A;  2JRI A;  4MS2 A;  4RUE A;  1IXB A;  3CCL P;  3H1I E;  1FFX B;  1N36 O;  1NGM B;  5LMU O;  1QR9 A;  3APO A;  1AV1 A;  1YQ3 C;  2CTW A;  2EUL A;  1GN6 A;  2L6L A;  4C7N B;  3WUT A;  5GTI H;  1E79 H;  2EIJ B;  3F89 A;  3RK2 B;  2WPQ A;  3MUD A;  1XEQ A;  3P30 A;  3KYQ A;  2PTM A;  2OYH A;  1NTZ H;  4DUY O;  2W90 A;  2NR5 A;  2O01 N;  2QM4 A;  2DQ3 A;  2KK7 A;  4DCK A;  4PDL A;  3TYY A;  3BEH A;  3O65 A;  4MTG A;  4JI6 B;  3GWK C;  4L73 A;  1NU1 K;  2X6B A;  2ZKO A;  3RK3 E;  2HKO A;  5IY5 B;  5IWA O;  3V2N A;  1NAF A;  4C7R A;  2XNX A;  2KKW A;  5B1B B;  1VQL V;  3II6 A;  3QO8 A;  3OFN G;  2X6A A;  4FLV A;  3L72 D;  2ITC C;  1JX9 A;  3AE9 C;  1Y4M A;  3E8G A;  5KUM A;  2ZYA A;  2YIB D;  3K5O A;  4BWA A;  1SFC C;  1AP5 A;  1L4A D;  3L70 J;  4GDO A;  2XZR A;  1USD A;  4RUF A;  2M5A A;  2OTJ V;  2FFD A;  4NXM B;  2P4V A;  4EYY Q;  2WTY A;  1N4C A;  1VQO P;  2G3A A;  4I0X B;  5CCG A;  4DV6 O;  3M9B A;  4GKK O;  5AVV B;  2YKQ A;  3QNE A;  4F4L A;  1FXK B;  3M0D C;  1YIT V;  1GAX A;  2LFS A;  4X65 O;  4NPF X;  3FGA D;  2XUM A;  1GMJ A;  4EFB A;  1GO3 F;  3L37 A;  4W7Z A;  1KIL C;  3F7V C;  2CH7 B;  2PUS A;  4FLT A;  4UB8 E;  2AXT E;  3A0B E;  1NVO A;  1EZV E;  2ZM6 B;  4GX0 A;  3ZS8 C;  1UJW B;  2QDO A;  2WPS A;  2JS5 A;  4C7U A;  1AJN A;  2P90 A;  3AK2 A;  2JIZ G;  3SYC A;  2IFN A;  2ZT9 D;  2QA4 P;  3Q5R A;  1HDJ A;  1X79 B;  3CCM P;  1H2M A;  4U7N A;  1JPX A;  3CC4 P;  2UXC O;  2P2U A;  3HR0 A;  3Q5S A;  3USS A;  2PP6 A;  2M0B A;  1JFF A;  3CHX A;  2Y69 B;  1N33 O;  3PLN A;  5AW6 B;  4X20 B;  2YI8 A;  4IL6 E;  1BT8 A;  2WLN A;  1GW3 A;  2E76 B;  3W7W A;  2VQE O;  3P8M C;  2UXB O;  1VQ7 P;  1SQQ D;  1BZK A;  3JAL A;  3K57 A;  4JI7 O;  2PRR A;  5TIS Z;  4F6E A;  2WLJ A;  3K5M A;  1XTG B;  1J1E C;  3TF5 A;  4LCU C;  4TUY A;  2EX3 A;  3KPE A;  3TGU D;  1T6A A;  1CXZ B;  4LP8 A;  4XDJ A;  1VAR A;  3L9D A;  4UVA A;  2P10 A;  5KTB A;  3Q5P A;  4BR6 A;  3MTU E;  2R9A A;  1ZN5 A;  3ML0 A;  1BE3 E;  2FBW C;  2FYZ A;  2JDI H;  1KQS U;  3FXE A;  1IFM A;  2YKP A;  3T4D A;  1MZ9 A;  4H0L C;  2F95 B;  3CD6 V;  3C8V A;  1U96 A;  1NTZ G;  5DEC A;  1NTZ D;  3AG1 B;  5GTH H;  2Y9Z A;  3MHH C;  1LTI C;  2WSE H;  1N34 O;  5KHK A;  4FLU A;  2AZ2 A;  1JJO A;  1Z2G A;  3JSN A;  1RM1 B;  2A9H A;  2LJ2 A;  5LGN A;  5K1P A;  5BR8 B;  2JGD A;  3H1H G;  3LNN A;  3H1H D;  1QVF O;  4CC5 A;  4EOT A;  4K3A A;  4TV9 A;  3SPH A;  5C8Y A;  2H88 C;  1OCC C;  3AEC C;  3BCC H;  5LXT A;  4UCU A;  3BAA A;  2CPS A;  2WZ7 A;  2RNB A;  2PI4 A;  2ZIM A;  4PEL A;  3QO7 A;  5KUK A;  4U3J A;  4AHC A;  4ZMD A;  4UUJ C;  2QJK C;  1YCI A;  5B5E Z;  3JAW A;  4JI6 O;  3L74 D;  2ARH A;  3A0H E;  2GUZ B;  4DZO A;  3RK3 B;  4IYI A;  1JY3 N;  2QWQ B;  3SGI A;  3L4F A;  1KFM A;  1ZWI C;  4RO0 A;  2FY8 A;  3LDC A;  5E79 Z;  3W7T A;  2WMM A;  1VDF A;  4NPE A;  1NS1 A;  4C46 A;  2C9N Y;  3P8C D;  1XMQ B;  2Y0D A;  2M5A B;  3M0D A;  4BAY A;  2OYQ A;  3SPG A;  1ZRT E;  2FFD B;  4CZZ A;  2Q3I A;  2OAR A;  1KIL E;  2WPR A;  2OTJ P;  3H1L H;  4NTY A;  2HFE D;  2JR8 A;  3ETE A;  4YXD C;  1P7G A;  1LTJ A;  1SQB E;  4GX5 A;  2RMZ A;  4WFG A;  4B7K A;  1RF1 C;  3G6B A;  1DGS A;  4NXM O;  3FWL A;  3HTK A;  5CBF A;  1YVW A;  2ZR3 A;  3P7K A;  4FLY A;  1V54 C;  2VRZ A;  4JI2 O;  1S1C X;  3T1Y B;  3FX0 A;  4HB1 A;  3CX5 I;  2HG5 C;  3RK2 D;  3CWB J;  1P84 F;  1FOS E;  1IBL O;  1XNQ O;  4GKJ B;  4X66 B;  4FFK A;  3JAR A;  3AK1 A;  2ZYD A;  1URQ B;  4YPC A;  3JAK A;  1GK9 A;  2QR4 A;  1IFP A;  2KS1 B;  4JI8 O;  1I5Y A;  1FC2 C;  2ZM6 O;  3CJH A;  1QLN A;  1X8Y A;  3AEB C;  4H13 C;  2E43 A;  5CA1 A;  2ETN A;  3EVK A;  2I1J A;  2A79 B;  1HWY A;  4Z1M H;  4L75 A;  1HH0 A;  5IT9 N;  2N1T A;  3AE6 C;  4TT3 H;  1JFF B;  2Q1K A;  3M91 A;  4NTX A;  2P7J A;  1R8E A;  1IJD B;  1BSM A;  3A2F A;  2DN9 A;  2JDI G;  1N7L A;  3K5B A;  1PP9 G;  1PP9 D;  3LDE A;  1FJK A;  2M3B A;  4H33 A;  3OT7 A;  3OMA B;  4TUY B;  1DIP A;  4QIW F;  1SQP E;  3RN4 A;  1NU1 G;  1NU1 D;  4FVM A;  4LWS B;  1OZH A;  3BAT A;  3E86 A;  1TUB A;  2KNC B;  3LSQ A;  4FFB B;  3N4X A;  1RFY A;  1RPR A;  2ZXW C;  2W6B A;  5L3F A;  1RP3 B;  5LHI A;  1IFI A;  5L3E A;  4MVS A;  2Y0I A;  1VQ5 V;  2YXH A;  3RYH A;  5L3G A;  1T2K C;  3BCC G;  2QRX A;  4UCO A;  4OGQ D;  1LT9 A;  1HBW A;  3F5W C;  3ABM C;  3H9V A;  2WPV B;  4W80 A;  2HPC A;  1BE3 J;  3QVN A;  1BGY H;  2JGD B;  2CK3 G;  1S5J A;  3WU2 Z;  1KP2 A;  5CBG A;  2LGW A;  2QWP B;  1XTC C;  1VQ9 P;  1NJI W;  5BR8 O;  4TV9 B;  3K9A A;  5C8Y B;  1ARO P;  1ZLL A;  5KHG A;  3CRA A;  1SC5 B;  3RYF A;  4RES B;  4HZ3 A;  3CCQ P;  3JAT A;  2A0L A;  3ZRX A;  2RH0 A;  3Q3D A;  3ABL C;  1DTO A;  4U7O A;  2FKW B;  2CE4 A;  1OHH G;  2YDE A;  1OWA A;  1SFC B;  1PGP A;  1FKA O;  2HVK C;  3CRR A;  3UCS C;  2B88 A;  2PY5 A;  2OYI C;  1SQB K;  1YI2 P;  2E76 D;  1XQ8 A;  2LQT A;  4DRX A;  3K59 A;  4LFB O;  5D5P A;  4BW9 A;  1J1D C;  3SYA A;  4R4L A;  4QGP A;  1AI7 A;  3JAM N;  3IAO A;  2NRG A;  3CP1 A;  3U11 A;  2ZVO B;  5LL6 Y;  3E89 A;  3AG7 A;  1AR4 A;  3QF7 A;  5TJH A;  1S77 D;  2WLL A;  5KX5 B;  1IBM B;  1KIL B;  2MJZ A;  1HW7 A;  3RYC A;  3L75 H;  4I5S A;  3I55 V;  4JYA B;  3HTK B;  1YJ9 V;  1JCD A;  4LF6 B;  3H1J G;  2ATK C;  4ZIB A;  3H1J D;  3SWK A;  1KBH A;  2ADP A;  3H1I G;  3H1I D;  5KHH A;  2F93 B;  1SQB J;  3ASN C;  4O2A A;  1JQ0 A;  1LTS C;  3HB3 B;  4HKZ H;  3L71 H;  3CX5 E;  3T1Y O;  3JAR B;  3ZHQ A;  2IZ1 A;  1N73 C;  1OZ0 A;  3HKC A;  2H3O A;  4GKJ O;  5EIB D;  3DSQ A;  3G4S V;  2JWA A;  3AE7 C;  1VQ6 P;  3CJH B;  2FTK A;  2BOB C;  1US6 A;  3L73 H;  1UFI A;  1ZW0 A;  2ILM A;  3W68 A;  1YJN P;  4UXN A;  1JVM A;  4E4E A;  3E7K A;  3QG5 A;  1J1E B;  3M9H A;  2XAH A;  3K79 A;  4UB6 Z;  3SPJ A;  2IU3 A;  1SQP K;  1GM9 A;  4DR3 B;  2O1J A;  1L0N H;  1EDK A;  1GM8 A;  1N32 B;  4X64 B;  4WCE V;  4N23 A;  3RK3 D;  1R6N A;  5B1N A;  4ZHQ A;  1NJI Q;  3OGC C;  4P9O A;  1YYC A;  4H0L B;  4JAU A;  2P4K A;  1ZL8 A;  3HUS A;  1GTO A;  4IIJ B;  4JI1 B;  1BCC H;  1YHQ V;  5GTI E;  5EC1 C;  1TUB B;  3RW0 A;  3V2P A;  2NLJ C;  1M1J A;  4UVC A;  3VQV A;  1P84 H;  2BEZ F;  4YY3 O;  2UU9 B;  3RL0 D;  2N05 A;  2LFR A;  2QSA A;  2ZIN A;  1N8R W;  1G1X B;  1NTZ E;  1S9K E;  4DUZ O;  3BPZ A;  2GTS A;  4DV3 B;  1OCC B;  1FDO A;  4HNA B;  1ZLZ A;  2ZDI C;  2HPC B;  4KFM A;  1LUV A;  5GON B;  2BSK B;  3EQ2 A;  4QMA A;  3TNU B;  5J2T A;  1N7S D;  4JAA A;  4X1Y A;  2DJV A;  1MMM A;  1JEK A;  1EBO A;  2W6J H;  5AG2 A;  4D6T H;  4XBF A;  2QJK B;  2JP3 A;  3B5N A;  1ZSP A;  3OJA B;  1FZG A;  1Q86 W;  3EXA A;  1ZXG A;  3JSV C;  1URQ D;  1Q5O A;  1EZV G;  3CCE V;  1EZV D;  5H2F H;  2OYI A;  4MSW C;  3JAT B;  4NTW A;  5J2U B;  2QVA A;  2GV9 A;  3V4Q A;  3B09 A;  4Z1V A;  1RE3 A;  1COW G;  4NKG B;  3M0A A;  1G4Y B;  1X4T A;  1VF5 C;  2XKM A;  4W4L A;  1G1J A;  3HD7 C;  1Z5V A;  2POH A;  2AXC A;  5AVU B;  4MVZ A;  3SFE C;  1RF1 B;  3ZDM A;  1DEB A;  4O9B A;  2QJY C;  4I2L C;  5IDJ A;  1LP1 A;  3G80 A;  2QWR B;  2E75 C;  3QO5 A;  1S76 D;  1MUU A;  1SZX A;  2J58 A;  1QVF U;  2Z4E A;  2FYN C;  1K97 A;  5BXZ A;  1BHB A;  5APT A;  2QWO B;  1QLE C;  4G2K A;  1V54 B;  1NH2 D;  1VEW A;  1QGK B;  2KIK A;  3N2G B;  2QIW A;  1VF7 A;  2QWN B;  3L72 J;  5KMG A;  4UCR A;  4DW1 A;  3P3N A;  4DV1 B;  2E3C A;  1NR1 A;  1N36 B;  1BQ0 A;  3FX7 A;  3CCL V;  1T5E A;  2BAS A;  1ZOY C;  1PNK A;  3SYQ A;  1XNR B;  4LF6 O;  4H13 B;  4O2A B;  4IL6 Z;  3KZI Z;  2YEV A;  3ICX A;  1AJQ A;  1K05 A;  4DUY B;  1B04 A;  4O4J B;  2BTO A;  5CCH A;  3ZRW A;  2CPB A;  1SA0 B;  1N2D C;  2DW4 A;  1Q90 D;  1V9P A;  2ZFC A;  4F6R B;  1SET A;  1NKZ B;  4JZ2 A;  2HHH B;  1N8R Q;  2NZ2 A;  1M8O B;  4KT0 J;  1IFJ A;  5KAF Z;  1KN7 A;  1K73 W;  4MTX A;  3FD9 A;  3KDP B;  2RKL A;  1VQP V;  1X59 A;  2R70 A;  3ZHR A;  1OVU A;  2OYH C;  1SFC D;  1BCC G;  1BS3 A;  4BIZ A;  2KG7 A;  1EDJ A;  2Q4P A;  1GH6 A;  3FAV A;  2XHB A;  4DR3 O;  2YC0 A;  4ZHQ B;  2ZXW B;  4X64 O;  4J7K A;  1JR9 A;  4EEQ A;  2B87 A;  1ZL8 B;  2LR2 A;  5GTH E;  3JD3 A;  1Q86 Q;  4NYK A;  2Q0O C;  4R50 A;  1FDI A;  5AW8 B;  2KS1 A;  2H7H A;  2ZDI A;  3ABM B;  1GL2 D;  4JI1 O;  3K08 A;  2YXL A;  3VQX A;  2DMX A;  4GKK B;  2QKA A;  5B66 H;  1KIL D;  1EN6 A;  2W6J G;  4WWI A;  1SQB D;  4D6T G;  1JO5 A;  5FL7 G;  3T1H O;  3TGU J;  4IHJ B;  3BCC E;  3GVM A;  2YIA A;  2PZS A;  4X65 B;  1PPJ H;  2JS3 A;  4LGD E;  5AVZ B;  2QM8 A;  3ZED A;  1H0T A;  1VIB A;  1QQC A;  3RGU A;  5J2T B;  2E5T A;  3D6Z A;  1HGZ A;  2WSF H;  4X1Y B;  1WNS A;  2RN0 A;  2K9J A;  3KXD A;  3ABL B;  3CRM A;  1NTZ J;  5CCG C;  1RQV A;  1JY3 P;  3NMD A;  1O9G A;  1F7Y A;  3O8Z A;  1EZV I;  3HD7 A;  5CA0 A;  1DLB A;  3MDS A;  2OYI B;  2Z0A A;  3OA7 A;  1A02 F;  1NZ6 A;  2Q6A A;  1FBM A;  1WA8 B;  3H1H J;  3D6Y A;  3IN6 A;  1J1D B;  1CEZ A;  3CCM V;  4DW0 A;  3EFG A;  3CC4 V;  4EI2 A;  1SZT A;  2QGN A;  2X0L A;  1YTZ T;  1K92 A;  1S5L Z;  2VQE B;  3K04 A;  3IC9 A;  3H1L E;  2UXB B;  3MP7 B;  2IYO A;  2YKO A;  1B06 A;  1HR0 B;  2IX7 C;  2QTO A;  1JY2 O;  1VQ7 V;  4JI7 B;  1NT2 B;  1PNM A;  2DOS A;  3LNM B;  1LP1 B;  4PD4 F;  4CH4 A;  3V4W A;  3CXH F;  2KXP B;  3AEI A;  4H0L D;  2XAS A;  3K06 A;  1NYH A;  4UVB A;  1AI4 A;  2V1D A;  3AE4 C;  2Q9L A;  3M8A A;  5TIS H;  5K5G B;  1GRJ A;  4X62 O;  1HVV A;  1SQP D;  3ASN B;  2LKM A;  1K73 Q;  3D71 A;  2B5U A;  2WSS G;  4GOD A;  1NQT A;  1JMK C;  3IC7 A;  4FPP A;  1XIL A;  3IGA C;  1N73 B;  1OW8 A;  1RE4 C;  5DJT B;  1N34 B;  4DV1 O;  2N74 A;  3DXR A;  3U59 A;  5AW7 B;  3K03 A;  1KB9 F;  1QEX A;  2YEV B;  4DYL A;  5LA6 B;  1XNR O;  4LF5 B;  2RMK B;  4H44 C;  4KP4 A;  3ZRW B;  1EZJ A;  4PI0 A;  1MV8 A;  2P22 C;  3FB7 C;  2E42 A;  4GLX A;  1NTM H;  1F51 A;  1GZL A;  4NPD A;  3GG2 A;  4DV5 B;  4J80 A;  2EZO A;  1Q7Y W;  4LF4 B;  1M7L A;  3MGN A;  1Q2N A;  3KCX A;  4X1I A;  1W0J G;  2HHH O;  1PL5 A;  3RYI B;  1R5L A;  1VQP P;  3N7N A;  1OW6 A;  3A2A A;  2KG7 B;  2DYS C;  1W2B O;  3FAV B;  1P84 I;  5KHJ A;  4DV0 B;  3Q2Y A;  5B5E H;  5DED A;  3ZBH A;  1OMI A;  2WIT A;  2VQF B;  4O4I B;  3D3I A;  3X2Q C;  3HE4 A;  3JCU Z;  3AG4 C;  1Y76 A;  1ZX3 A;  5E79 H;  4DR2 O;  3OW2 U;  1IK7 A;  4W4K A;  1Q6I A;  4J7J A;  2SPZ A;  1IXM A;  1BGY E;  5BU8 B;  1PP9 J;  1HUC A;  5F2V O;  1VQN P;  1PKX A;  2HG5 D;  2UXD B;  3HE5 A;  4DR5 O;  3S3X A;  1LTT C;  1NU1 J;  3BRC A;  1M93 A;  1H8H G;  4JI2 B;  4GX1 A;  3ASO C;  4I9W A;  2JGU A;  3AG3 C;  3HRN A;  1LTJ C;  4H13 D;  1PZQ A;  1R3I C;  4I50 A;  1IBL B;  1XNQ B;  2K1A A;  2K9J B;  3K5L A;  4CH5 A;  1VF5 B;  3FXD A;  2QKC A;  2JEU A;  3BCC J;  3HD7 B;  3CX5 D;  5CA0 B;  5ITZ A;  4JI8 B;  3RBX A;  4JQ0 D;  1MZF A;  2BCC H;  3UT5 A;  1AI5 A;  3G67 A;  3LID A;  4IFF A;  2QJY B;  2Q3E A;  1SP4 A;  3C1L A;  3C3S A;  2A3Q A;  2E75 B;  4JI3 O;  4JF7 A;  3VQW A;  4GOF A;  2AW9 A;  3IFM A;  4Y28 J;  3E35 A;  1R5S A;  2FYN B;  2ZR2 A;  1QLE B;  2V4D A;  2ZE8 A;  5E1A C;  3L75 E;  2AZ0 A;  1HR0 O;  5IYD O;  2F4V O;  2OCC C;  2ZXE B;  4PV1 C;  3RGB A;  3B8E B;  1RE4 A;  2N1T C;  5IJ9 A;  1BSN A;  1T2K D;  2N9B A;  3SYP A;  3H1K H;  4EKW A;  1PIX A;  2E5L B;  1Q7Y Q;  2ZIO A;  3L35 A;  3L71 E;  4RJT A;  1H2L A;  3VQY A;  1E79 G;  3B71 A;  4FM0 A;  3AEA C;  2L5G B;  4OPH A;  4TQD A;  2D2C C;  3VBB A;  1YDX A;  1Q81 W;  3DXR B;  4QE7 A;  1NTM G;  1NWQ A;  4JTD B;  1S9K D;  3L73 E;  4LFA B;  4IFM A;  2C0X A;  2GTA A;  3R65 A;  1ZP0 C;  1PV3 A;  1YIJ V;  4JYY A;  4IGG A;  3SJQ C;  1VQ9 V;  4RQF A;  3H1J J;  2EIL C;  1WP8 A;  4NXN O;  1L0N E;  1AB3 A;  3CMA P;  2OYH B;  2I1K A;  4LF5 O;  3H1I J;  1XOU A;  3WU2 H;  2IYP A;  3T97 A;  4A7P A;  2WT7 A;  2EBO A;  1LT9 C;  4B3T O;  3CI9 A;  3ZMT A;  3CCQ V;  2OQQ A;  4PD4 H;  4EB6 A;  1AQT A;  1BDD A;  4DO2 A;  3CXH H;  1MG1 A;  4DV5 O;  2WLH A;  5A2Q N;  3VP8 A;  4DOJ A;  3SJB C;  3T1C A;  3OUF A;  2UUB O;  5JCO C;  4LF4 O;  1BCC E;  1G1I A;  1D7M A;  3SDL A;  1T3J A;  4LFB B;  1YI2 V;  1P84 E;  1LJ2 A;  3OR6 C;  4AQR D;  1W0K G;  1Q43 A;  2P6J A;  4DV0 O;  4L8J A;  1CI6 A;  2K3R A;  3HE4 B;  1Y76 B;  5IE9 A;  1PGJ A;  2H8P C;  3C9I A;  3EWK A;  3PTZ A;  2VQF O;  1KB9 H;  3HKE A;  3KKY A;  2PAJ A;  1E1Q G;  4MVU A;  3PHL A;  2WSC J;  4ZKP A;  1ZTE A;  2HJF C;  3RWR D;  3ZHU A;  4X1K A;  4D6T E;  1KEC A;  5AW5 B;  2LP7 A;  3HE5 B;  1K4C C;  5H9C A;  3AE3 C;  1M90 W;  1R6T A;  1G8M A;  2UXD O;  2K37 A;  4CS2 A;  5H2F E;  1G6U A;  2BCC G;  2ODM A;  2BCC D;  4G28 B;  4DXW A;  1FZE A;  1FZB A;  1SRY A;  1PL0 A;  2HLD G;  4DR7 B;  4I50 B;  3BAS A;  1OX3 A;  2YO2 A;  5FLX N;  1K3E A;  1WN7 A;  1GMG A;  4DJG A;  3T2M A;  1MA1 A;  4WY4 A;  3MIW A;  3JCZ A;  3ABT A;  5ITZ B;  2NPS A;  1E5W A;  3IF4 A;  1OVV A;  1CP9 A;  4J9Z B;  2FKX A;  1MOF A;  3I5D A;  3E83 A;  2UXN A;  1VQ6 V;  3UT5 B;  1TGO A;  5LHH A;  2WA3 A;  3O9O A;  2IBZ H;  4L74 A;  2E74 C;  1YJN V;  4Q6G A;  5JQG A;  1Q81 Q;  2YI9 A;  1HNX O;  5IYZ A;  3ZMZ A;  1L2P A;  4ZI7 A;  3H1K G;  1IUR A;  4YIP A;  3H1K D;  4TSF G;  5KKZ C;  2Q5U A;  4MVQ A;  4WFH A;  4UB6 H;  2PGD A;  3G6E P;  3JAL B;  5B1A C;  5CA3 A;  2Y4U A;  1FYJ A;  1DD3 A;  4GIF A;  2WLI A;  2F66 C;  3D3Q A;  1RH5 B;  4B3R O;  2IM9 A;  1YZB A;  5IJ9 B;  3CRC A;  5CMU A;  2XTA A;  1PM9 A;  3VMZ A;  1FXV A;  3CRQ A;  1W5C E;  2OWO A;  1JOC A;  2QG4 A;  4R6Z A;  1IFD A;  3TDK A;  5DN6 G;  2Q6Q A;  4YY3 B;  3PH0 A;  2AEM A;  1VP7 A;  3RFR A;  2IJJ A;  3STZ C;  3AEE C;  2E5L O;  4DUZ B;  2C0W A;  4H44 B;  3VOU A;  4QJF B;  1L0N K;  3E22 A;  2EZP A;  5LP6 C;  3HUS C;  4J7Z A;  4I7Z C;  2N9Y B;  1H2S B;  1S72 P;  2WLK A;  3GMA A;  3BCC D;  3JD2 A;  3OEH G;  4PD4 D;  5JWP A;  1M1J C;  1WJZ A;  1NKD A;  4JZG A;  2GDS A;  4XA4 A;  4WFE A;  4LFA O;  1YIJ P;  1QR8 A;  3A3Y B;  5JCO A;  5APS A;  3CCV P;  3CC2 P;  3QTC A;  4P9P A;  2Y48 A;  3T97 B;  2DYS B;  3HD7 D;  2Q7G A;  2WT7 B;  2ZYG A;  5LXT B;  2YSU B;  1Y9B A;  3B40 A;  1BSH A;  1AFO A;  4K35 A;  1XMO B;  2YNY A;  4IYH A;  5LGU A;  1M90 Q;  1I0H A;  4PJ0 H;  1K7D A;  1MZE A;  4U3J B;  3X2Q B;  1FU1 A;  2E75 D;  1Q3E A;  3AG4 B;  4D7T A;  3JD4 A;  4O4H A;  4MN4 C;  1GM7 A;  3JAW B;  3B5N C;  1MSD A;  1ORQ C;  5LMN O;  1S3J A;  1FZC C;  4LH7 A;  1QLE D;  3MZW B;  2CTQ A;  3H1L G;  5B66 E;  3H1L D;  4Y99 C;  1K33 A;  1SF9 A;  4OX9 O;  1BDC A;  1R1B A;  3CWB H;  4GYC B;  1DF5 A;  1RE3 C;  3WUV A;  5KAI Z;  1PPJ E;  2Z5I A;  3KHU A;  4EDF A;  4O2B A;  2W0X A;  5B3S C;  4I6M C;  3ASO B;  1WLE A;  1YXB A;  3CEI A;  3AG3 B;  1LTJ B;  3DTU B;  4FLZ A;  1W2E A;  5EFW B;  5EK0 A;  3DC5 A;  1JOY A;  2IU0 A;  1DX7 A;  3HKD A;  4BWN A;  1JMM A;  2IDB A;  3PN1 A;  3VTP C;  4R4M A;  3CL3 D;  3ABK C;  1OCR C;  1WRG A;  2XOK G;  3S3W A;  1CPY A;  2WAM A;  1SQX H;  1W2B U;  2YIB A;  3RT3 C;  3K0G A;  3CS5 A;  5CMZ A;  1USE A;  4D6T J;  1JA8 A;  1WAZ A;  4DR7 O;  4JYB A;  1LGH B;  1ZR4 A;  4Z1M G;  1G2C A;  1H2N A;  3A8T A;  1EXJ A;  2A06 H;  4TT3 G;  1F4M A;  3M06 A;  3KZI H;  1K4D C;  2EJ7 A;  3JAK B;  5APQ A;  1KYO F;  1Y67 A;  4PA9 A;  1BL8 A;  1PGQ A;  1EQ7 A;  1OW7 A;  3VOP A;  4K0K B;  4HBN A;  5CA1 B;  1L0L H;  2E5Y A;  4OH8 B;  2M8R A;  3UIA A;  2OCC B;  4PV1 B;  2OYO A;  3N27 A;  3N2K A;  1CSB A;  2N1T B;  4IOI H;  1HWT C;  5IYZ B;  5CCH C;  1LTA C;  4ZI7 B;  5TIS E;  1OCZ C;  4KL1 A;  3H6P A;  4I4T A;  1Y74 A;  2X6C A;  5KAF H;  3WB0 A;  2Q5Z A;  2OTL P;  4QPJ A;  4HH2 A;  2KLV A;  3V2R A;  1EDL A;  1AI6 A;  3CC7 P;  1AVY A;  4JV5 B;  4R7C A;  2HOD A;  2WLI B;  1H88 A;  5HFM A;  2D2C B;  3WUU A;  2Q7H A;  1K8A W;  4LH6 A;  5LP6 A;  3EHB B;  1KKD A;  1SKV A;  1GTW A;  3I5C A;  2GA1 A;  3AEF C;  3TK1 A;  4ZOL A;  1BGY G;  3T1H B;  2RN9 A;  1BGY D;  2MK3 A;  3SWF A;  2EIL B;  5JVD A;  4FM2 A;  5CCG D;  1NTM E;  1KQL A;  1H38 A;  2Q8V A;  3RYH B;  1DF4 A;  3JD0 A;  4PD4 I;  2KSE A;  4J11 A;  1SQP J;  1LT9 B;  3CXH I;  2QSI A;  3BRV B;  4FLW A;  2C2A A;  3STL C;  1X0T A;  3CCJ P;  1T3U A;  1NI8 A;  2I8D A;  4ASV A;  1VQM P;  2Z5H A;  5BZB A;  5APW A;  1NOH A;  2OGU A;  3OGI B;  3P32 A;  5B5E E;  3RYF B;  1FZC A;  2NNU A;  4UCS A;  4FZ0 A;  1XHX A;  5E79 E;  2OIG A;  3CLQ A;  4O4H B;  2M7W A;  1VQK P;  3ZMS A;  1XMO O;  1R73 A;  1LR1 A;  1VQ8 P;  2IZ0 A;  1LT1 A;  2K88 A;  4BIO A;  2JJ2 G;  3SJC C;  5APX A;  4DRX B;  5KLI C;  5CBO A;  3LDD A;  1S5L H;  1S2E A;  1PV0 A;  1K04 A;  3S1K A;  1IC2 A;  4DT0 A;  3L75 G;  3L75 D;  4OGQ C;  4L76 A;  3H32 A;  1XHZ A;  3V2Q A;  1PFI A;  2JJ1 G;  2C9L Y;  4X62 B;  1MAB G;  4UB8 Z;  1HP8 A;  2AXT Z;  5LBQ A;  2UUA O;  2WLL B;  1BQZ A;  3A0B Z;  2ZJS E;  4AQY O;  1SQX G;  1FPO A;  4WFB V;  4YHH O;  4DV7 O;  2V7Q H;  3RYC B;  2Y9Y A;  4H37 A;  4KHP B;  2OTK E;  3L71 G;  3L71 D;  3B77 A;  4BXL A;  4H44 D;  2W27 A;  2A06 G;  2A06 D;  1JNM A;  2M6Y A;  2BCC E;  1KD1 W;  2IBZ I;  1DD4 A;  2WSF J;  3CCU P;  1YJW P;  2EIM C;  2UWJ E;  2GUS A;  3L73 G;  1GDT A;  2E74 B;  1L0L G;  3L73 D;  1L0L D;  1K8A Q;  5IYC O;  1HJB A;  1J95 A;  1G2C B;  1NTK K;  2LW1 A;  3B2E E;  3HKC B;  2FXO A;  3WB2 A;  4YJ2 A;  1M57 C;  4OPA A;  2VWK A;  4I55 A;  3RBZ A;  1L0N G;  1L0N D;  5KKZ B;  5B1A B;  1X9V A;  1NVP B;  3ZX6 A;  1Q8I A;  1RQU A;  4FMT A;  4K0K O;  5K1X A;  3BHP A;  2ZAE B;  2YS8 A;  1Y74 B;  3H1K E;  2FL4 A;  1I5X A;  2ZNJ A;  1D2D A;  1MFT A;  3UM7 A;  1HJ0 A;  2XAJ A;  1BCC D;  4RAI A;  1AQ5 A;  4RKU J;  2ZXX A;  1RSO A;  1P84 D;  2EJR A;  1SQV K;  1NTM K;  2QM7 A;  5LP6 B;  4DR2 B;  3HUS B;  5M1B A;  3K3W A;  3KG2 A;  1FXH A;  4I7Z B;  2VWJ A;  4JV5 O;  1GK6 A;  4GUN A;  5IYB O;  1B3Q A;  4QPK A;  3JCU H;  1M1J B;  2FYU K;  3AK3 A;  1QL2 A;  3ETD A;  4DR5 B;  1VQN V;  1O9H A;  3D36 C;  2M3E A;  5JVD B;  4D6T D;  3WU2 E;  3NR7 A;  3BY6 A;  1KYO H;  4PD4 E;  5EYP A;  3MAQ A;  3CXH E;  5AW1 B;  1VQ4 P;  4TOI A;  1WB8 A;  4EIJ A;  3OTF A;  5DM6 V;  1WP7 A;  3A0H Z;  1AVO A;  3ZHS A;  1Y8A A;  2XDJ A;  4JF3 A;  4LF8 O;  4WFA V;  3LSS A;  3P3P A;  1NTM J;  2KQX A;  3B5N B;  2UUC B;  2A45 H;  2O01 H;  4HYT B;  1TA8 A;  1URF A;  4X89 A;  1H2K A;  1FZC B;  1YF2 A;  1IO4 A;  3TXQ A;  3L72 H;  1K9M W;  4Y99 B;  2A7W A;  4JI3 B;  2UXX A;  1LUW A;  2G38 A;  2WQY C;  3NXS A;  5APY A;  4FIP C;  3JC2 2;  3M9Q A;  3G71 P;  1KD1 Q;  4PV1 D;  1HNZ O;  4O4L A;  1WMK A;  2N1T D;  1KB9 E;  5B3S B;  3RL0 C;  1K5S A;  5J9P C;  4N3Y B;  2F4V B;  3GF3 A;  5H2F Z;  2DYR C;  2YXQ B;  2V7Q G;  1E1R G;  2XT9 A;  4WVZ A;  2EIK C;  3AE5 C;  2ZE6 A;  1S0V A;  3H32 B;  5CB4 A;  2R72 A;  2R32 A;  2XND H;  2LW7 A;  1VL2 A;  4JGS A;  1N7S C;  3UO3 A;  2B1I A;  1NTK H;  3ABK B;  1OCR B;  1H8A A;  4CH3 A;  1TUE B;  4J42 A;  3J80 N;  3BRT B;  4JI4 B;  5KMG B;  1RY3 A;  4FZ1 A;  4LFC O;  4X20 A;  2YXR B;  4KHP O;  4ABM A;  2IBZ E;  4QNH B;  2R3S A;  1VF6 C;  4B3S O;  4XE5 B;  4NXN B;  1QX8 A;  3AE8 C;  1JMB A;  4ICG A;  3F5H A;  1P49 A;  1JY2 N;  1SS1 A;  3CMA V;  1XBL A;  1OCZ B;  1SQQ H;  3FB8 C;  2BCC J;  3PRJ A;  4B3T B;  4I55 B;  1SQV H;  4UB6 E;  2KSD A;  3CB2 A;  1GKF A;  4TQF A;  4MT8 A;  1I94 O;  2UUB B;  2Q73 A;  2G8Y A;  3TGU H;  1OJH A;  5AW9 B;  2FYU H;  4FM1 A;  4GOE A;  3CME V;  4DR4 O;  2H8P D;  4QE9 A;  2BTQ A;  1AJY A;  2O3J A;  5LHG A;  1NR7 A;  1S5H C;  3O6Q A;  2IJH A;  1U97 A;  2QEX P;  1RSO B;  2Q67 A;  1GD2 E;  1XL6 A;  1JCC A;  1M5I A;  3D36 A;  1YTF B;  2B87 B;  1CW5 A;  3SYO A;  2YIC A;  4B3M O;  3ZJZ A;  3SJA C;  3H1K J;  1KYO D;  1PPJ G;  1K9M Q;  1TVK A;  1PPJ D;  3MHV A;  2H94 A;  3H1H H;  1U57 A;  4K8X A;  4U3F H; 
#chains in the Genus database with same CATH homology
 2QIW A;  4Z1M H;  2ZT9 B;  1NGM B;  3AE6 C;  4TT3 H;  1YQ3 C;  2J5U A;  2P10 A;  3Q1M A;  3Q5P A;  2E75 B;  1R8E A;  2WSE J;  1JB0 J;  4H0L D;  2FBW C;  3AE7 C;  1NYH A;  4Y28 J;  5KLI C;  1KQG B;  1ZOY C;  3AE4 C;  1K04 A;  2K9Y A;  4H13 B;  4H0L C;  3C8V A;  4OGQ C;  2WQY C;  1UIX A;  3GLM A;  5L8R J;  2IDB A;  4R4M A;  3D71 A;  1KOR A;  2E74 D;  2YMK A;  1K05 A;  4PV1 D;  1DIP A;  1WMK A;  1KTM A;  1OW8 A;  2E74 C;  3D70 A;  4PV1 C;  3AE2 C;  1Q90 D;  1YQ4 C;  4XFJ A;  1KMI Z;  3GF3 A;  3RK3 E;  1EXJ A;  3AE5 C;  2NZ2 A;  4H44 D;  1PIX A;  4H0L B;  4KT0 J;  2H88 C;  3AEC C;  4OGQ B;  3G9R A;  5KKZ C;  3AED C;  3B71 A;  1VL2 A;  4H44 C;  4OGQ D;  1OW7 A;  1DD4 A;  2FXP A;  2WSF J;  3AEA C;  2WPV B;  1MKM A;  1DD3 A;  2D2C C;  3AE9 C;  2E74 B;  2JO1 A;  4PV1 B;  4YTP C;  2BEZ F;  2QJK C;  4GDO A;  3H25 A;  2BEQ D;  1S5L X;  1PV3 A;  1ZP0 C;  2MKV A;  1FDO A;  3AEE C;  2G3A A;  1PL5 A;  1KQF B;  4H44 B;  1FDI A;  1OW6 A;  1EXI A;  2D2C B;  4I7Z C;  1RQU A;  3Q3D A;  3Q2Y A;  3GMA A;  3ABV C;  3AE8 C;  1TU3 F;  2D2C D;  2OQQ A;  1ZRT E;  2JP3 A;  3FGA D;  1OMI A;  2YIU C;  1GMJ A;  1KIL E;  3AEF C;  4YXD C;  1HJ0 A;  2E76 D;  4RKU J;  3AE1 C;  4IL6 X;  4U7J A;  1IK7 A;  2O01 J;  2QJP C;  1HF9 A;  4R4L A;  2G8Y A;  3LW5 J;  2E76 C;  3D6Z A;  3T97 B;  1VF5 C;  5M1B A;  4I7Z B;  3IAO A;  3S9O A;  1Y9B A;  2ZT9 D;  2QSI A;  1RQV A;  3R4Y A;  3Q5R A;  1S1C X;  1AJY A;  2ZT9 C;  2E75 D;  3AEG C;  3O6Q A;  3SFE C;  3EWK A;  3Q5S A;  2QJY C;  3D6Y A;  2E75 C;  3IN6 A;  2H89 C;  2WSC J;  4H13 D;  2E76 B;  2V7Q J;  3SFD C;  3RL0 g;  1VF5 B;  2FYN C;  1ZME C;  3AEB C;  4H13 C;  3AE3 C;  3GF7 A;  1VF5 D;  1U57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...