2ZT9D

Crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
166
Chain Sequence
b'DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
molecule tags Photosynthesis
publication title Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
pubmed doi rcsb
total genus 33
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2008-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2zt9D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2zt9D02
2B1XA 3DQYA 1ULIA 2XSHA 1NDOA 4HM3A 1EG9A 3GL2A 3H1KE 4QCKA 2YIUC 1UUWA 2BMQA 2HMOA 2BMOA 2Q3WA 3L71E 2DE6D 2GBWA 3VCPA 4H44C 4NBDD 3CWBE 2NVFA 4PV1D 1O7HA 2HMLA 2E74D 1ULJA 2CKFA 2NUKA 3GCEA 3FOUA 3L74E 4HKVA 4P1BH 1BE3E 4U3FE 2YMKA 2XR8A 3GTEA 5KKZC 2QJPC 3GKEA 3VMID 1PP9E 4H13C 5AEWA 2E75D 3CXHE 1L0LE 4NBFD 3L72E 2XSOA 3AZCA 4H0LD 3VMHD 1FQTA 2HMMA 2JO6A 4QDFA 3H1LE 1VM9A 4HM6A 4HM0A 2I7FA 1G8JB 2BMRA 2XRXA 4NBAD 2DE7D 5KLIC 2NWFA 4AIVA 4NB8D 1SQQE 2HMKA 2HMNA 4QUPA 1NTME 1NTZE 1G8KB 1Q90C 4H44D 1O7GA 1P84E 2IBZE 2YVJB 1RIEA 3L73E 4NBGD 2HMJA 2GBXA 2E4QA 1EZVE 3L70E 2D2CC 4PD4E 1SJGA 4HM4A 3EQQA 1BCCE 5BOKA 2ZT9C 4HM1A 1L0NE 2E4PA 1WQLA 4H13D 1O7WA 2D2CD 1SQPE 4QURA 1NYKA 5AEUA 4I7ZC 2BCCE 2DE5D 2YFJA 4QDDA 2E74C 2JZAA 3GOBA 3GZXA 3H1HE 3L75E 4NBCD 4QDCA 4NBBD 4PV1C 1SQBE 2B24A 4QDFB 1NU1E 2E76C 1UUVA 1RFSA 5HL4A 4NB9D 4AAYB 1VCKA 4QUQA 3EN1A 4OGQC 1JM1A 1SQVE 3D89A 3TGUE 4NBHD 5KLVE 4EMJB 2ZT9D 2QPZA 3GTSA 3CX5E 2YFIA 4H0LC 2A06E 3N0QA 4HJLA 1NTKE 2E75C 1VF5C 1O7MA 1PPJE 2YFLA 1SQXE 3BCCE 4P1CH 2NVGA 3VCAA 4HM2A 2NVEA 2ZYLA 4HM8A 5CXMA 4HM7A 3GB4A 2FYNC 4OGQD 1O7PA 4HM5A 2FYUE 2QJYC 1KB9E 3C0DA 3H1JE 1KYOE 3GZYA 2QJKC 2E76D 2NUMA 1ZRTE 3H1IE 1VF5D 3GL0A 4NBED 3VMGD 1O7NA
chains in the Genus database with same CATH superfamily
4GT1A 3L75D 1T3UA 4W7ZA 4GKGA 1KFNA 2M0BA 1HTLC 2ZVOB 4LLHA 2MJZA 3LIEA 2E5YA 1N7SD 2QJYB 1S2EA 2KNCB 1KILA 3S9OA 4HYTB 2WSCH 3TGUD 1BSNA 1XTCC 3AE1C 4HM6A 2K1AA 3KZIE 1SQBK 2MKVA 4AIVA 2GM4A 1NH4A 1SQQE 5H2FE 5GTIE 3H1LD 1NTMG 2HMJA 3FWNA 1AVYA 4PD4D 1N73A 1QL1A 1VQNP 4WY4C 2V7QJ 2E74C 3AEGC 4QDCA 1GU4A 1JY2O 4NBBD 1J1DC 4NB9D 4QUQA 3H1JD 4UB6E 3VMAA 3BCCD 4NBHD 1RE3A 1D7MA 1H0TA 1FC2C 5AW4B 1L4AB 1NTKE 2RKLA 1PPJE 5AVRB 4JBZA 3G9RA 3T97B 4HM2A 4HM8A 4OGQD 3U1AA 3P7KA 1VL2A 3H1JE 2ZXEB 3KDPB 5KJ7A 1NOHA 2P2UA 4JQ0D 1FE6A 1Q7YQ 3BRVB 2OYHA 2KS1A 3O6QA 2GUSA 3AEEC 2BMQA 2H7HA 1L2PA 3LIDA 2IFMA 1H0TB 3WU2E 4K3AA 1LGHB 3CCJP 4AYCA 3VMGD 5APQA 1YI2P 1X22A 2Z5IA 2J59M 1NTMJ 3L72E 1S5LH 3G6EP 3I5CA 4QDFA 1JB0J 1IFJA 1IK9A 1SQQD 1NU1J 5KAIH 4I1LA 1VQMP 1GMJA 1K04A 2V7QH 1USDA 3USSA 1OVUA 3OW2O 5CHXA 1A02J 4R4MA 3CMAP 4HM1A 4RKUJ 1E79H 4QDDA 1TU3F 1T8ZA 3B8EB 3JCUH 2E74B 4HKZH 1J1EC 2KNCA 1EC5A 5BU8B 1BCCD 3D89A 3ITKA 1Z56A 2Y0EA 3G3ZA 4EYYQ 5KLIB 1E5WA 1SFCC 1KQLA 2O3JA 2JJLA 5CCHA 1FZFA 1T6AA 1PV3A 1RF1A 2PAJA 1GZLA 1MUUA 1OVRA 3FGAD 4KJMA 3KQGA 4NPDA 1S5LX 1M7LA 3U59A 1S3JA 2NPSA 3M0DC 3H1KE 3CPWO 2O1JA 2LXBA 2H43A 1AFOA 1GDTA 3L70D 3VMID 1EDLA 3CXHE 2B87B 5TJHA 1FU1A 4NBFD 1N86A 1PFIA 1SFCD 2JO6A 2E42A 1LTTC 4JYBA 4L73A 5CMZA 4NPEA 3OA7A 3O6QB 2P10A 4NB8D 1LWUC 3CC7P 2E75B 1JM0A 5CCHC 1ZP0C 1JUNA 3RK3E 1J1DB 1LNQA 3GW6A 2FYUG 1YQ4C 1ZW0A 1NAFA 3H1HD 3H1KG 1KYOD 2JZAA 2BCCJ 3TF5A 3FX0A 1YBKA 3H1ID 2NPSC 3M0DA 2WSFH 1PGJA 3C8VA 2JP3A 3CCRP 2ZT9B 3MP7B 1CI6B 1NO4A 2H89C 3AE7C 1JY2N 3CXHH 3N0QA 3H25A 3HRNA 4OVNF 1QX8A 1G1IA 1FZBA 2YKQA 2FYUD 1HH0A 3VMYA 2E5TA 2N1TD 3M91A 4K35A 2JWDA 4DJGA 1YTZI 2C0WA 1HUCA 3Q3DA 1O7NA 3JSVC 2KSEA 4OH8B 1U57A 2H88C 3MGNA 2OYIA 2HR3A 2DW3A 2IX7C 3B4SA 1VQ9P 3II6A 3CWBE 1T2KD 1H8AA 3CX5H 2HMLA 1X79B 1N7SB 2QJPC 2OYOA 4D6TG 3V2RA 5APWA 2HPCB 1YJ9P 2YKOA 1NTMK 3CCSP 5KLVJ 2XZRA 3M0AA 4QUPA 1N8RQ 3WMM0 1KQGB 2BCCG 1JY3P 2HLOA 3H1LJ 2NPSD 2IBZE 1O7GA 1P84H 2A06G 1W2BO 2W6JH 2E4PA 1O7WA 1SQPE 1HJBA 4PD4I 1BE3D 3H1HE 5KAFH 1SVFA 3L75E 3GZXA 4QDFB 2FYZA 5C39A 3TSIA 1LWUA 4W80A 1JM1A 3AEAC 1URQC 3HD7C 1NTMD 1NTZJ 2LKMA 1LTAC 2E75C 2P7JA 1ZRTD 1X8YA 1M57D 3WU2H 2KLVA 3L37A 2QEXP 3C0DA 2FKWB 2M8RA 2QJKC 3VMZA 1NU1K 2Q7CA 2OYIC 2I1JA 4NBED 2XV5A 3A5TA 5CBOA 3WUUA 3HTKA 1AQ5A 4EOTA 3F89A 1ZR4A 3GCEA 2M3BA 4U3FE 2XR8A 2O01N 3BCCJ 2J58A 4WB4A 2Z5HA 3CWBG 3PRJA 1PP9E 3VTPC 3RL0D 3A7OA 3GF3A 3H32B 3H6PA 3C9IA 1SFCA 4XE5B 1FZCA 2ZXXA 1VM9A 3CXHI 2QVAA 1PIXA 1SQPK 4EIJA 1N73B 1S72P 5AW5B 3B71A 2YVJB 1KILD 2IBZG 2IBZI 3K5BA 4HH2A 4YPCA 5AVTB 1LTJA 2D2CD 1K9MQ 4Z1MH 1QVGO 2DE5D 3L71D 1QGKB 1M1JA 3VYIA 3BRTB 1GL2B 2IZ1A 1KZUB 1YQ3C 4D6TD 2N9YB 2ZJSE 5KLVD 3BCCE 3A0HH 3WUVA 1HF9A 2NVEA 4QMAA 4C7RA 1L4AD 1O7PA 2XNXA 1GL2A 1FZGA 1M1JB 3CX5D 1VF5D 3DQYA 1R5LA 3FWLA 2WSEH 1SQBJ 1KYOH 1PP9G 1OXZA 2BMOA 5AVQB 1FZAA 3L74G 4IFFA 3A0BH 2A45H 4PV1D 1YTZT 2WT7A 5AW0B 2NUKA 2Q1KA 2K9JB 4L74A 5APYA 4U3FG 4XA4A 1X0TA 2E75D 1PGPA 3IAOA 4IL6H 1QLED 2WPSA 3L73J 1X9VA 1SFCB 3L35A 3SFEC 1W5CE 2DE7D 2WSFJ 5L8RJ 3L73E 1KB9H 4NBGD 2ZYAA 3HTKB 1FAVA 1VQ7P 2FFDC 1Q82Q 2ZYDA 2YFJA 3GOBA 3VN0A 2VRSA 1K73Q 3SWFA 1OVVA 1KYOI 3RK2C 5CCGD 2HODB 2WSEJ 1W2EA 1GW4A 3AE6C 1IFDA 3AE4C 2PRRA 1IJDB 1KQFB 2A06E 3KYQA 4HJLA 1U7JA 1NHLA 1VF5C 2NZ2A 1FS0E 2IZ0A 2KSJA 5CCGA 3H1HG 2R3CA 5AVVB 1EQ7A 1IK7A 1KB9E 4Y99C 5GTHH 5AVWB 2ZVNB 2RH0A 2R5DA 3CI9A 2C9NY 3GL0A 1VQOP 1G2CA 1LT9A 1WRGA 2ZYGA 3QH9A 4QCKA 4TLFA 2AEFA 5CBNA 2Y9ZA 4NBDD 1R8EA 3BVHA 2K9YA 4W7YA 1CZQA 4HM0A 1L4AC 4NBAD 4U3FJ 5CJ4A 1HGZA 4C7NA 1Q86Q 1SQVG 1P84E 2E4QA 1SQXG 4OGQB 2WWWA 2WTYA 1VQ6P 1QL2A 1WMKA 5AEUA 1GL2D 2M3EA 3H1LG 4B86A 5KLVK 3EFGA 1LP1B 1Q90D 3L72G 1NVOA 3EN1A 3JCUE 2KYVA 4ASWA 3CL3D 1LJ2A 5CJ0A 3H32A 4AUWA 5TISE 4HM7A 2KB7P 3ABVC 3S4RA 3L75G 2FYUE 2QJYC 1L0LD 2JO1A 2YXRB 4MN4C 3PHLA 2E76D 3H1HJ 2KZIA 1NTKJ 4PJ0H 3PH0A 2B1XA 2BEZF 1LT1A 3RL0g 1EG9A 4WBAA 1RY3A 1YIJP 2L5GB 1NU1G 3CCEP 3A3YB 2OYIB 1LTJB 2KZJA 2R5BA 3AEBC 1PPJD 1JOCA 3L75J 1VQPP 1L0NG 3GKEA 4H13C 1Q81Q 2Q5UA 4I6MC 3OAKA 3V2QA 1S4XA 3HUSC 2WQYC 1FQTA 1AA0A 3H1LE 3Q5SA 3RK3D 1L0LK 2I7FA 4WY4A 5AVYB 1JCDA 3PTZA 3NTNA 3HD7B 2G3AA 2R32A 5EFWB 4BRYB 1KB9D 1NKNA 1FZCB 1KB9I 1SQBG 1RIEA 1JY3O 1P84I 1SJGA 2NRGA 1IFMA 1XTGB 3H1KD 2IDBA 2NPSB 3M06A 3MD0A 1NGMB 3V4QA 1JCCA 4AAYB 3NMDA 4OGQC 3RK3B 2D2CB 5AVUB 4IL6E 3QWOC 1JY2P 4IL6X 1DH3A 3V2NA 4JYCA 1RE3C 1IFPA 2WVRA 4YTPC 2YFLA 1L0NK 3MTUE 5APTA 5GTIH 5B66E 3NFQA 3L73D 3VOPA 1EDIA 4N78E 1LTJC 1PGOA 3L74D 1DD4A 2WSSH 5AW6B 3RBZA 1RQUA 2M5AA 3RBXA 2HFED 3CCVP 1R5SA 3W67A 5M1BA 2W6BA 3VCPA 2GA1A 2YKPA 2NVFA 3B5ND 2E74D 2CKFA 4EDFA 3TDKA 4GDOA 4DOJA 2KXPB 3TNUA 2WPRA 4CPGA 1M8OB 3BCCG 1SS1A 3H1JJ 2A45I 3L4FA 1KV4A 1GTWA 2HPCA 3L73G 4L75A 1EZVE 4WY4D 1A02F 1VQKP 4ZKPA 3L72D 3IN6A 1SQXK 3RK2B 2JWAA 2BCCD 2FY8A 4GODA 1H88A 2QA4P 5HL4A 2FFDB 4GIFA 1DIPA 1NYHA 1OIPA 5KLVE 2PGDA 2B88A 3D6ZA 1N7LA 5E79E 1YHQP 3IFMA 3EWKA 2OTJP 1NTKD 3NXSA 2O1KA 2B87A 2ZYLA 5KKZB 4EI2A 4HM5A 3SWKA 3JC22 3PLNA 1K8AQ 3L74J 3GHGB 1QEXA 4O9BA 1UIXA 1ULIA 2OYHC 4JF7A 1BSHA 2HMOA 1PP9D 2FBWC 3RK2D 1SQPJ 3I55P 2IFNA 2FXOA 1O7HA 2XDJA 1YJNP 5E79H 3GG2A 2JEEA 1ZLLA 2AXTH 2FYNB 1SP4A 3SFDC 5AEWA 1CSBA 1HGVA 2GUVA 2XSOA 1MKMA 1OMIA 4IOIH 1KTMA 3AZCA 3MIWA 1FOSE 1RF1C 1VF5B 1G8JB 2XRXA 3VMXA 3O8ZA 5KLIC 2V4HA 1EXIA 1PL5A 3S1KA 1L0LJ 1GD2E 2KP8A 1PZQA 4HJGH 5K5GB 2K3RA 2KI7B 4ASVA 1J1EB 1VDFA 2RN0A 3M9HA 4PV1B 2Z4EA 4YXDC 1BGYG 1S9KE 2XU6A 1BE3J 3L71G 4PV1C 3FXEA 1KMIZ 3GLMA 4TT3H 2E76C 1UUVA 2AXCA 1VCKA 2OTKE 1JMBA 1BE3G 3E1RA 4UB8E 2W83C 1O7MA 1RF1B 5AW7B 4C46A 3P8MC 4M3LA 1AV1A 2FYNC 3GB4A 1YJWP 3KXDA 2J5UA 1KILB 4U3FD 1JY3N 1NJIQ 2BASA 1LTBC 5DJTB 2FYUK 2QG4A 2OYHB 5AW1B 2Q3WA 1FDIA 2O01H 4HB1A 1L0LG 2W90A 2KOGA 2Y0CA 2YMKA 2B89A 2KLUA 3H1KJ 5KKZC 1HJ0A 1KN7A 5KJ7C 2Q9IA 2Y9YA 1MV8A 3Q5PA 3T97A 2RMZA 2FYUJ 3H1IG 1MFTA 3F5HA 5GTHE 1OFCX 1SQQJ 3CLQA 3BASA 1G2CB 2Y0DA 3AE9C 2WPQA 2CK3H 1SQVD 4BRYA 1H89A 3HD7A 1L0NE 2OGUA 1KD1Q 5KJ7D 4WY4B 1SQQK 3AE2C 1SQBE 2XKMA 2W27A 2FXPA 3E7KA 2B24A 1S9KD 1VQ5P 1RH5B 1BCCJ 1NU1E 2QRXA 1N73C 2IBZD 2HODA 2R44A 1SQBD 3GF7A 1ZXGA 2OTLP 1YYCA 2LXCB 3B5NC 1NU1D 2CPBA 5AW2B 2KIKA 2XNDH 1L4AA 1KYOE 3V2PA 3GZYA 1M90Q 1BGYJ 2POHA 1L0ND 4KHXA 3CWBJ 1URQD 2YIUB 3KZIH 3RGUA 1OW6A 1USEA 2HG5D 1NTKG 4U7JA 2C0XA 2DE6D 2GBWA 2HYNA 1BDCA 5B5EH 3CCUP 1M1KQ 3V4WA 1DEBA 2K9JA 1ULJA 5AVZB 3N4XA 1LP1A 3A0BE 2CPSA 1N2DC 4H0LD 1KILE 3MUDC 3UIAA 3B5NB 2QE7H 1KQSO 1NTME 3L72J 4WVZA 1BCCG 1PP9J 4GOFA 4C7NB 1JMMA 1CW5A 1JEKA 1MZ9A 4HM4A 3EQQA 3FXDA 1NWQA 4H13D 1OX3A 2QM7A 3A0HE 2FXMA 2P58A 1ZN5A 1LTIC 3CC4P 2ZAEB 5AVXB 1SQQG 3CD6P 2ZT9D 2QPZA 3CCQP 1RF0A 3OJAB 2BEQD 3Q2YA 4N78D 3VP9A 2N1TA 1NTZG 2N1TC 4P1CH 1LT9B 3D70A 1DX7A 1N7SC 2QJPB 2W6AA 4PD4H 1IFNA 3R4YA 2SPZA 1ZRTE 1FBMA 3CCLP 3GHGA 1VQ4P 4LC1A 1LTGC 4RESB 1NAYA 2WSCJ 1NDOA 5APXA 2WPVB 4AQRD 2YIUC 2AXTE 5CCHD 5KTBA 5AW3B 1NTZD 3HUSA 4A7PA 3A2AA 2QIWA 4UB6H 1G1JA 2IYOA 1KILC 2FFDA 4JPZB 2LR2A 2QM8A 2YMYA 1URQA 3RL0C 1FZEA 1EZVG 5AW9B 1Y9BA 3LW5H 4NPFX 4BXLA 1DD3A 1G8KB 2E43A 3H1JG 2KUBA 3HE4B 3WUTA 1BCCE 1WQLA 5APSA 3PP5A 4QURA 1BDDA 5APVA 2Q6QA 3D6YA 2E76B 1NYKA 2YNYA 5CCGC 3AEFC 3P8CE 4ZNCA 3EQ2A 1SQVE 1JTHB 3TNUB 2K88A 1LWUB 3M9BA 2YFIA 3E1IA 2Q3IA 1NTZK 3AE8C 1SQXE 3P32A 3ZDMA 2AEJA 4IFMA 3TYYA 2I1KA 2P67A 5CXMA 2M5AB 3CXHD 1Q2NA 2C9LY 1SQPG 3M9QA 3HE5B 3EFFK 1AVOA 1EZVI 1UIIA 2JKVA 4R4LA 1RF0C 5B66H 3L71E 2G8YA 2WITA 1FDMA 3C1LA 1N7SA 3IF4A 5KLVG 4Y99B 1RQVA 3FOUA 4P1BH 5APUA 1WT6A 1DEEG 3LW5J 5B5EE 4Y28J 1KC8Q 3PJSK 3H1IJ 2BMRA 4H0LB 4BWNA 2HMNA 1EDJA 1NTZE 2JR8A 1Q90C 5AW8B 1IZNB 2UWJE 4L76A 2GBXA 4RO0A 1GL2C 1SQVK 3CX5I 2H8PD 4I7ZB 1BGYD 1S1CX 4I7ZC 2YXQB 3AE3C 1IC2A 4NBCD 1GW3A 1IO4A 1CI6A 1P84D 3HE4A 3GTSA 2A06D 4H0LC 1ZR2A 1PPJG 1KFMA 2NVGA 1FOSF 3TGUJ 1VQ8P 1J2JB 2N9BA 2WZ7A 3KHUA 1GK6A 1RE4C 2NUMA 4N6JA 1RHZB 1VPCA 3CWBD 1GK4A 2XSHA 4HM3A 1SQPD 3L70J 1HBWA 1SQVJ 1UUWA 2KK7A 1M1JC 3GHGC 1U7MA 2OQQA 3MZWB 3L74E 1BE3E 2I8DA 1NKZB 3GTEA 3R2PA 3SWYA 1YITP 2WT7B 2L91A 2QJKB 1OWAA 1T3JA 3G4SP 3VMHD 2YO3A 4PJ0E 5KAFE 1QVFO 2NWFA 4N3YB 2N1TB 1FJKA 4DT0A 3CCMP 3V6IA 5TISH 2B9BA 3VCAA 3N7NA 2D2CC 1ZV8A 1ZMEC 5BOKA 1Y8AA 1L0NJ 4UB8H 3MHVA 3VP8A 2BCCE 5KAIE 2W8ZA 1RFSA 3L36A 1K05A 4XFJA 1Y47A 1SLQA 3Q5RA 4RJTA 3HE5A 4ZMDA 3W68A 3MUDA 1IFIA 3CX5E 4D6TE 3RL0B 1FZCC 4D6TJ 2QSIA 3KPEA 1HWTC 3Q1MA 1EZVD 2PP6A 1EXJA 3P8CD 1AJYA 4YXWH 2K37A 1SQXD 2PFXA 3HUSB 3AECC 3TGUG 3L71J 4OWFA 1HVVA 3H1IE 1MFZA 2WMMA 1JTHA 4DZOA 1AQTA 1VQLP 1S5LE 3GL2A 3AE5C 4H44B 1FJPA 1OZHA 2OARA 4H44C 4KT0J 2IPPA 2ITAA 1NTKK 1RE4A 4HKVA 3U1CA 5BU5A 1LT9C 1SQXJ 1L0LE 2YO2A 2IYPA 3HD7D 2HMMA 2KS1B 3CMEP 2O01J 1URQB 1T2KC 3G71P 3TK1A 2AEMA 2HMKA 1M56D 4IFDK 3RK3C 4LGDE 3BATA 5BVZA 4H44D 4PD4E 3L70E 1ZOYC 2ZT9C 4I2LC 2ZFCA 2R3SA 1GU5A 3SSUA 1OW7A 4ZKUA 4DCKA 1FDOA 3TGUE 3CC2P 4EMJB 5AVSB 2Q3EA 3AEDC 1EDKA 2P1JA 1OW8A 3D71A 2JDIH 3B5NA 1BGYE 1JNMA 4GOEA 5DJUB 3I56P 4H13B 5H2FH 1KORA 3GMAA 1JO5A 3IR9A 4WWIA 3V5BA 1PGQA 3L70G 1LTSC 2A45G
chains in the Genus database with same CATH topology
1RQUA 2WSCJ 1NDOA 2WPVB 2YIUC 5M1BA 3VCPA 2NVFA 2E74D 2CKFA 3GCEA 4U3FE 4GDOA 2XR8A 1PP9E 2QIWA 3S9OA 3GF3A 3AE1C 1VM9A 4HM6A 1Y9BA 2MKVA 4AIVA 1SQQE 1PIXA 1DD3A 1G8KB 3B71A 2YVJB 2HMJA 1EZVE 1BCCE 1WQLA 3IN6A 2D2CD 4QURA 3D6YA 1NYKA 2E76B 4Z1MH 2V7QJ 2DE5D 2E74C 3AEGC 4QDCA 4NBBD 3AEFC 5HL4A 4NB9D 4QUQA 1DIPA 1SQVE 1NYHA 4NBHD 5KLVE 3D6ZA 2YFIA 1YQ3C 3EWKA 3AE8C 1NTKE 1PPJE 1SQXE 3BCCE 3G9RA 3T97B 4HM2A 1HF9A 2NVEA 2ZYLA 4HM8A 5CXMA 4OGQD 1O7PA 4HM5A 1VL2A 3H1JE 1UIXA 1VF5D 3DQYA 1ULIA 4R4LA 3O6QA 3AEEC 2BMQA 2HMOA 2BMOA 3L71E 2FBWC 2G8YA 4PV1D 1O7HA 3VMGD 2NUKA 1RQVA 3FOUA 4P1BH 3SFDC 3LW5J 5AEWA 2E75D 3IAOA 3L72E 2XSOA 4Y28J 1MKMA 1OMIA 1KTMA 3AZCA 4QDFA 1VF5B 1JB0J 1G8JB 2BMRA 3SFEC 2XRXA 2DE7D 4H0LB 5KLIC 1EXIA 1PL5A 2HMNA 2WSFJ 5L8RJ 1GMJA 1NTZE 1Q90C 1K04A 3L73E 4NBGD 2GBXA 4PV1B 4R4MA 4YXDC 4HM1A 4I7ZB 4RKUJ 1S1CX 4I7ZC 4QDDA 1TU3F 2YFJA 3AE3C 3GOBA 4NBCD 4PV1C 2E74B 1KMIZ 3GLMA 4TT3H 2E76C 1UUVA 1VCKA 2WSEJ 3D89A 3AE6C 3AE4C 3GTSA 1KQFB 4H0LC 2A06E 4HJLA 1VF5C 1O7MA 2NZ2A 2NVGA 3GB4A 1PV3A 2FYNC 1IK7A 1KB9E 2J5UA 3FGAD 2NUMA 3GL0A 1S5LX 2XSHA 4HM3A 3H1KE 4QCKA 1UUWA 2Q3WA 1FDIA 4NBDD 1R8EA 2OQQA 3L74E 1BE3E 2YMKA 3GTEA 5KKZC 1HJ0A 3VMID 3CXHE 3Q5PA 2K9YA 4NBFD 3VMHD 2JO6A 4HM0A 4NBAD 2NWFA 2P10A 4NB8D 2E75B 3AE9C 1ZP0C 1P84E 3RK3E 3VCAA 2E4QA 2D2CC 1ZMEC 5BOKA 4OGQB 1L0NE 1YQ4C 1WMKA 5AEUA 3AE2C 2BCCE 2JZAA 1SQBE 2B24A 2FXPA 1NU1E 1RFSA 1Q90D 1K05A 4XFJA 3C8VA 2JP3A 3EN1A 3Q5RA 2ZT9B 3CX5E 2H89C 3AE7C 3GF7A 3N0QA 3H25A 2QSIA 3Q1MA 1EXJA 1AJYA 4HM7A 3ABVC 2QJYC 2FYUE 3AECC 2JO1A 1KYOE 3GZYA 2E76D 3H1IE 3Q3DA 1O7NA 2B1XA 2BEZF 3RL0g 1U57A 1EG9A 3GL2A 3AE5C 2H88C 4H44B 1OW6A 4U7JA 2DE6D 2GBWA 4H44C 4KT0J 3CWBE 3AEBC 2HMLA 4HKVA 1ULJA 2QJPC 3GKEA 4H13C 1L0LE 4H0LD 2WQYC 1FQTA 2HMMA 1KILE 3H1LE 3Q5SA 2I7FA 2O01J 2G3AA 2HMKA 4QUPA 1NTME 1KQGB 4H44D 1O7GA 2IBZE 1RIEA 4PD4E 3L70E 1ZOYC 1SJGA 4HM4A 3EQQA 2ZT9C 2E4PA 4H13D 1O7WA 1SQPE 2IDBA 3H1HE 3GZXA 3L75E 4QDFB 1OW7A 1NGMB 4AAYB 1FDOA 4OGQC 1JM1A 3TGUE 4EMJB 2D2CB 2ZT9D 3AEDC 3AEAC 2QPZA 1OW8A 3D71A 4IL6X 2BEQD 3Q2YA 2E75C 4YTPC 2YFLA 4P1CH 4H13B 3D70A 1KORA 3GMAA 3C0DA 2QJKC 3R4YA 1ZRTE 1DD4A 4NBED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1X A;  3DQY A;  1ULI A;  2XSH A;  1NDO A;  4HM3 A;  1EG9 A;  3GL2 A;  3H1K E;  4QCK A;  2YIU C;  1UUW A;  2BMQ A;  2HMO A;  2BMO A;  2Q3W A;  3L71 E;  2DE6 D;  2GBW A;  3VCP A;  4H44 C;  4NBD D;  3CWB E;  2NVF A;  4PV1 D;  1O7H A;  2HML A;  2E74 D;  1ULJ A;  2CKF A;  2NUK A;  3GCE A;  3FOU A;  3L74 E;  4HKV A;  4P1B H;  1BE3 E;  4U3F E;  2YMK A;  2XR8 A;  3GTE A;  5KKZ C;  2QJP C;  3GKE A;  3VMI D;  1PP9 E;  4H13 C;  5AEW A;  2E75 D;  3CXH E;  1L0L E;  4NBF D;  3L72 E;  2XSO A;  3AZC A;  4H0L D;  3VMH D;  1FQT A;  2HMM A;  2JO6 A;  4QDF A;  3H1L E;  1VM9 A;  4HM6 A;  4HM0 A;  2I7F A;  1G8J B;  2BMR A;  2XRX A;  4NBA D;  2DE7 D;  5KLI C;  2NWF A;  4AIV A;  4NB8 D;  1SQQ E;  2HMK A;  2HMN A;  4QUP A;  1NTM E;  1NTZ E;  1G8K B;  1Q90 C;  4H44 D;  1O7G A;  1P84 E;  2IBZ E;  2YVJ B;  1RIE A;  3L73 E;  4NBG D;  2HMJ A;  2GBX A;  2E4Q A;  1EZV E;  3L70 E;  2D2C C;  4PD4 E;  1SJG A;  4HM4 A;  3EQQ A;  1BCC E;  5BOK A;  2ZT9 C;  4HM1 A;  1L0N E;  2E4P A;  1WQL A;  4H13 D;  1O7W A;  2D2C D;  1SQP E;  4QUR A;  1NYK A;  5AEU A;  4I7Z C;  2BCC E;  2DE5 D;  2YFJ A;  4QDD A;  2E74 C;  2JZA A;  3GOB A;  3GZX A;  3H1H E;  3L75 E;  4NBC D;  4QDC A;  4NBB D;  4PV1 C;  1SQB E;  2B24 A;  4QDF B;  1NU1 E;  2E76 C;  1UUV A;  1RFS A;  5HL4 A;  4NB9 D;  4AAY B;  1VCK A;  4QUQ A;  3EN1 A;  4OGQ C;  1JM1 A;  1SQV E;  3D89 A;  3TGU E;  4NBH D;  5KLV E;  4EMJ B;  2ZT9 D;  2QPZ A;  3GTS A;  3CX5 E;  2YFI A;  4H0L C;  2A06 E;  3N0Q A;  4HJL A;  1NTK E;  2E75 C;  1VF5 C;  1O7M A;  1PPJ E;  2YFL A;  1SQX E;  3BCC E;  4P1C H;  2NVG A;  3VCA A;  4HM2 A;  2NVE A;  2ZYL A;  4HM8 A;  5CXM A;  4HM7 A;  3GB4 A;  2FYN C;  4OGQ D;  1O7P A;  4HM5 A;  2FYU E;  2QJY C;  1KB9 E;  3C0D A;  3H1J E;  1KYO E;  3GZY A;  2QJK C;  2E76 D;  2NUM A;  1ZRT E;  3H1I E;  1VF5 D;  3GL0 A;  4NBE D;  3VMG D;  1O7N A; 
#chains in the Genus database with same CATH topology
 4GT1 A;  3L75 D;  1T3U A;  4W7Z A;  4GKG A;  1KFN A;  2M0B A;  1HTL C;  2ZVO B;  4LLH A;  2MJZ A;  3LIE A;  2E5Y A;  1N7S D;  2QJY B;  1S2E A;  2KNC B;  1KIL A;  3S9O A;  4HYT B;  2WSC H;  3TGU D;  1BSN A;  1XTC C;  3AE1 C;  4HM6 A;  2K1A A;  3KZI E;  1SQB K;  2MKV A;  4AIV A;  2GM4 A;  1NH4 A;  1SQQ E;  5H2F E;  5GTI E;  3H1L D;  1NTM G;  2HMJ A;  3FWN A;  1AVY A;  4PD4 D;  1N73 A;  1QL1 A;  1VQN P;  4WY4 C;  2V7Q J;  2E74 C;  3AEG C;  4QDC A;  1GU4 A;  1JY2 O;  4NBB D;  1J1D C;  4NB9 D;  4QUQ A;  3H1J D;  4UB6 E;  3VMA A;  3BCC D;  4NBH D;  1RE3 A;  1D7M A;  1H0T A;  1FC2 C;  5AW4 B;  1L4A B;  1NTK E;  2RKL A;  1PPJ E;  5AVR B;  4JBZ A;  3G9R A;  3T97 B;  4HM2 A;  4HM8 A;  4OGQ D;  3U1A A;  3P7K A;  1VL2 A;  3H1J E;  2ZXE B;  3KDP B;  5KJ7 A;  1NOH A;  2P2U A;  4JQ0 D;  1FE6 A;  1Q7Y Q;  3BRV B;  2OYH A;  2KS1 A;  3O6Q A;  2GUS A;  3AEE C;  2BMQ A;  2H7H A;  1L2P A;  3LID A;  2IFM A;  1H0T B;  3WU2 E;  4K3A A;  1LGH B;  3CCJ P;  4AYC A;  3VMG D;  5APQ A;  1YI2 P;  1X22 A;  2Z5I A;  2J59 M;  1NTM J;  3L72 E;  1S5L H;  3G6E P;  3I5C A;  4QDF A;  1JB0 J;  1IFJ A;  1IK9 A;  1SQQ D;  1NU1 J;  5KAI H;  4I1L A;  1VQM P;  1GMJ A;  1K04 A;  2V7Q H;  1USD A;  3USS A;  1OVU A;  3OW2 O;  5CHX A;  1A02 J;  4R4M A;  3CMA P;  4HM1 A;  4RKU J;  1E79 H;  4QDD A;  1TU3 F;  1T8Z A;  3B8E B;  3JCU H;  2E74 B;  4HKZ H;  1J1E C;  2KNC A;  1EC5 A;  5BU8 B;  1BCC D;  3D89 A;  3ITK A;  1Z56 A;  2Y0E A;  3G3Z A;  4EYY Q;  5KLI B;  1E5W A;  1SFC C;  1KQL A;  2O3J A;  2JJL A;  5CCH A;  1FZF A;  1T6A A;  1PV3 A;  1RF1 A;  2PAJ A;  1GZL A;  1MUU A;  1OVR A;  3FGA D;  4KJM A;  3KQG A;  4NPD A;  1S5L X;  1M7L A;  3U59 A;  1S3J A;  2NPS A;  3M0D C;  3H1K E;  3CPW O;  2O1J A;  2LXB A;  2H43 A;  1AFO A;  1GDT A;  3L70 D;  3VMI D;  1EDL A;  3CXH E;  2B87 B;  5TJH A;  1FU1 A;  4NBF D;  1N86 A;  1PFI A;  1SFC D;  2JO6 A;  2E42 A;  1LTT C;  4JYB A;  4L73 A;  5CMZ A;  4NPE A;  3OA7 A;  3O6Q B;  2P10 A;  4NB8 D;  1LWU C;  3CC7 P;  2E75 B;  1JM0 A;  5CCH C;  1ZP0 C;  1JUN A;  3RK3 E;  1J1D B;  1LNQ A;  3GW6 A;  2FYU G;  1YQ4 C;  1ZW0 A;  1NAF A;  3H1H D;  3H1K G;  1KYO D;  2JZA A;  2BCC J;  3TF5 A;  3FX0 A;  1YBK A;  3H1I D;  2NPS C;  3M0D A;  2WSF H;  1PGJ A;  3C8V A;  2JP3 A;  3CCR P;  2ZT9 B;  3MP7 B;  1CI6 B;  1NO4 A;  2H89 C;  3AE7 C;  1JY2 N;  3CXH H;  3N0Q A;  3H25 A;  3HRN A;  4OVN F;  1QX8 A;  1G1I A;  1FZB A;  2YKQ A;  2FYU D;  1HH0 A;  3VMY A;  2E5T A;  2N1T D;  3M91 A;  4K35 A;  2JWD A;  4DJG A;  1YTZ I;  2C0W A;  1HUC A;  3Q3D A;  1O7N A;  3JSV C;  2KSE A;  4OH8 B;  1U57 A;  2H88 C;  3MGN A;  2OYI A;  2HR3 A;  2DW3 A;  2IX7 C;  3B4S A;  1VQ9 P;  3II6 A;  3CWB E;  1T2K D;  1H8A A;  3CX5 H;  2HML A;  1X79 B;  1N7S B;  2QJP C;  2OYO A;  4D6T G;  3V2R A;  5APW A;  2HPC B;  1YJ9 P;  2YKO A;  1NTM K;  3CCS P;  5KLV J;  2XZR A;  3M0A A;  4QUP A;  1N8R Q;  3WMM 0;  1KQG B;  2BCC G;  1JY3 P;  2HLO A;  3H1L J;  2NPS D;  2IBZ E;  1O7G A;  1P84 H;  2A06 G;  1W2B O;  2W6J H;  2E4P A;  1O7W A;  1SQP E;  1HJB A;  4PD4 I;  1BE3 D;  3H1H E;  5KAF H;  1SVF A;  3L75 E;  3GZX A;  4QDF B;  2FYZ A;  5C39 A;  3TSI A;  1LWU A;  4W80 A;  1JM1 A;  3AEA C;  1URQ C;  3HD7 C;  1NTM D;  1NTZ J;  2LKM A;  1LTA C;  2E75 C;  2P7J A;  1ZRT D;  1X8Y A;  1M57 D;  3WU2 H;  2KLV A;  3L37 A;  2QEX P;  3C0D A;  2FKW B;  2M8R A;  2QJK C;  3VMZ A;  1NU1 K;  2Q7C A;  2OYI C;  2I1J A;  4NBE D;  2XV5 A;  3A5T A;  5CBO A;  3WUU A;  3HTK A;  1AQ5 A;  4EOT A;  3F89 A;  1ZR4 A;  3GCE A;  2M3B A;  4U3F E;  2XR8 A;  2O01 N;  3BCC J;  2J58 A;  4WB4 A;  2Z5H A;  3CWB G;  3PRJ A;  1PP9 E;  3VTP C;  3RL0 D;  3A7O A;  3GF3 A;  3H32 B;  3H6P A;  3C9I A;  1SFC A;  4XE5 B;  1FZC A;  2ZXX A;  1VM9 A;  3CXH I;  2QVA A;  1PIX A;  1SQP K;  4EIJ A;  1N73 B;  1S72 P;  5AW5 B;  3B71 A;  2YVJ B;  1KIL D;  2IBZ G;  2IBZ I;  3K5B A;  4HH2 A;  4YPC A;  5AVT B;  1LTJ A;  2D2C D;  1K9M Q;  4Z1M H;  1QVG O;  2DE5 D;  3L71 D;  1QGK B;  1M1J A;  3VYI A;  3BRT B;  1GL2 B;  2IZ1 A;  1KZU B;  1YQ3 C;  4D6T D;  2N9Y B;  2ZJS E;  5KLV D;  3BCC E;  3A0H H;  3WUV A;  1HF9 A;  2NVE A;  4QMA A;  4C7R A;  1L4A D;  1O7P A;  2XNX A;  1GL2 A;  1FZG A;  1M1J B;  3CX5 D;  1VF5 D;  3DQY A;  1R5L A;  3FWL A;  2WSE H;  1SQB J;  1KYO H;  1PP9 G;  1OXZ A;  2BMO A;  5AVQ B;  1FZA A;  3L74 G;  4IFF A;  3A0B H;  2A45 H;  4PV1 D;  1YTZ T;  2WT7 A;  5AW0 B;  2NUK A;  2Q1K A;  2K9J B;  4L74 A;  5APY A;  4U3F G;  4XA4 A;  1X0T A;  2E75 D;  1PGP A;  3IAO A;  4IL6 H;  1QLE D;  2WPS A;  3L73 J;  1X9V A;  1SFC B;  3L35 A;  3SFE C;  1W5C E;  2DE7 D;  2WSF J;  5L8R J;  3L73 E;  1KB9 H;  4NBG D;  2ZYA A;  3HTK B;  1FAV A;  1VQ7 P;  2FFD C;  1Q82 Q;  2ZYD A;  2YFJ A;  3GOB A;  3VN0 A;  2VRS A;  1K73 Q;  3SWF A;  1OVV A;  1KYO I;  3RK2 C;  5CCG D;  2HOD B;  2WSE J;  1W2E A;  1GW4 A;  3AE6 C;  1IFD A;  3AE4 C;  2PRR A;  1IJD B;  1KQF B;  2A06 E;  3KYQ A;  4HJL A;  1U7J A;  1NHL A;  1VF5 C;  2NZ2 A;  1FS0 E;  2IZ0 A;  2KSJ A;  5CCG A;  3H1H G;  2R3C A;  5AVV B;  1EQ7 A;  1IK7 A;  1KB9 E;  4Y99 C;  5GTH H;  5AVW B;  2ZVN B;  2RH0 A;  2R5D A;  3CI9 A;  2C9N Y;  3GL0 A;  1VQO P;  1G2C A;  1LT9 A;  1WRG A;  2ZYG A;  3QH9 A;  4QCK A;  4TLF A;  2AEF A;  5CBN A;  2Y9Z A;  4NBD D;  1R8E A;  3BVH A;  2K9Y A;  4W7Y A;  1CZQ A;  4HM0 A;  1L4A C;  4NBA D;  4U3F J;  5CJ4 A;  1HGZ A;  4C7N A;  1Q86 Q;  1SQV G;  1P84 E;  2E4Q A;  1SQX G;  4OGQ B;  2WWW A;  2WTY A;  1VQ6 P;  1QL2 A;  1WMK A;  5AEU A;  1GL2 D;  2M3E A;  3H1L G;  4B86 A;  5KLV K;  3EFG A;  1LP1 B;  1Q90 D;  3L72 G;  1NVO A;  3EN1 A;  3JCU E;  2KYV A;  4ASW A;  3CL3 D;  1LJ2 A;  5CJ0 A;  3H32 A;  4AUW A;  5TIS E;  4HM7 A;  2KB7 P;  3ABV C;  3S4R A;  3L75 G;  2FYU E;  2QJY C;  1L0L D;  2JO1 A;  2YXR B;  4MN4 C;  3PHL A;  2E76 D;  3H1H J;  2KZI A;  1NTK J;  4PJ0 H;  3PH0 A;  2B1X A;  2BEZ F;  1LT1 A;  3RL0 g;  1EG9 A;  4WBA A;  1RY3 A;  1YIJ P;  2L5G B;  1NU1 G;  3CCE P;  3A3Y B;  2OYI B;  1LTJ B;  2KZJ A;  2R5B A;  3AEB C;  1PPJ D;  1JOC A;  3L75 J;  1VQP P;  1L0N G;  3GKE A;  4H13 C;  1Q81 Q;  2Q5U A;  4I6M C;  3OAK A;  3V2Q A;  1S4X A;  3HUS C;  2WQY C;  1FQT A;  1AA0 A;  3H1L E;  3Q5S A;  3RK3 D;  1L0L K;  2I7F A;  4WY4 A;  5AVY B;  1JCD A;  3PTZ A;  3NTN A;  3HD7 B;  2G3A A;  2R32 A;  5EFW B;  4BRY B;  1KB9 D;  1NKN A;  1FZC B;  1KB9 I;  1SQB G;  1RIE A;  1JY3 O;  1P84 I;  1SJG A;  2NRG A;  1IFM A;  1XTG B;  3H1K D;  2IDB A;  2NPS B;  3M06 A;  3MD0 A;  1NGM B;  3V4Q A;  1JCC A;  4AAY B;  3NMD A;  4OGQ C;  3RK3 B;  2D2C B;  5AVU B;  4IL6 E;  3QWO C;  1JY2 P;  4IL6 X;  1DH3 A;  3V2N A;  4JYC A;  1RE3 C;  1IFP A;  2WVR A;  4YTP C;  2YFL A;  1L0N K;  3MTU E;  5APT A;  5GTI H;  5B66 E;  3NFQ A;  3L73 D;  3VOP A;  1EDI A;  4N78 E;  1LTJ C;  1PGO A;  3L74 D;  1DD4 A;  2WSS H;  5AW6 B;  3RBZ A;  1RQU A;  2M5A A;  3RBX A;  2HFE D;  3CCV P;  1R5S A;  3W67 A;  5M1B A;  2W6B A;  3VCP A;  2GA1 A;  2YKP A;  2NVF A;  3B5N D;  2E74 D;  2CKF A;  4EDF A;  3TDK A;  4GDO A;  4DOJ A;  2KXP B;  3TNU A;  2WPR A;  4CPG A;  1M8O B;  3BCC G;  1SS1 A;  3H1J J;  2A45 I;  3L4F A;  1KV4 A;  1GTW A;  2HPC A;  3L73 G;  4L75 A;  1EZV E;  4WY4 D;  1A02 F;  1VQK P;  4ZKP A;  3L72 D;  3IN6 A;  1SQX K;  3RK2 B;  2JWA A;  2BCC D;  2FY8 A;  4GOD A;  1H88 A;  2QA4 P;  5HL4 A;  2FFD B;  4GIF A;  1DIP A;  1NYH A;  1OIP A;  5KLV E;  2PGD A;  2B88 A;  3D6Z A;  1N7L A;  5E79 E;  1YHQ P;  3IFM A;  3EWK A;  2OTJ P;  1NTK D;  3NXS A;  2O1K A;  2B87 A;  2ZYL A;  5KKZ B;  4EI2 A;  4HM5 A;  3SWK A;  3JC2 2;  3PLN A;  1K8A Q;  3L74 J;  3GHG B;  1QEX A;  4O9B A;  1UIX A;  1ULI A;  2OYH C;  4JF7 A;  1BSH A;  2HMO A;  1PP9 D;  2FBW C;  3RK2 D;  1SQP J;  3I55 P;  2IFN A;  2FXO A;  1O7H A;  2XDJ A;  1YJN P;  5E79 H;  3GG2 A;  2JEE A;  1ZLL A;  2AXT H;  2FYN B;  1SP4 A;  3SFD C;  5AEW A;  1CSB A;  1HGV A;  2GUV A;  2XSO A;  1MKM A;  1OMI A;  4IOI H;  1KTM A;  3AZC A;  3MIW A;  1FOS E;  1RF1 C;  1VF5 B;  1G8J B;  2XRX A;  3VMX A;  3O8Z A;  5KLI C;  2V4H A;  1EXI A;  1PL5 A;  3S1K A;  1L0L J;  1GD2 E;  2KP8 A;  1PZQ A;  4HJG H;  5K5G B;  2K3R A;  2KI7 B;  4ASV A;  1J1E B;  1VDF A;  2RN0 A;  3M9H A;  4PV1 B;  2Z4E A;  4YXD C;  1BGY G;  1S9K E;  2XU6 A;  1BE3 J;  3L71 G;  4PV1 C;  3FXE A;  1KMI Z;  3GLM A;  4TT3 H;  2E76 C;  1UUV A;  2AXC A;  1VCK A;  2OTK E;  1JMB A;  1BE3 G;  3E1R A;  4UB8 E;  2W83 C;  1O7M A;  1RF1 B;  5AW7 B;  4C46 A;  3P8M C;  4M3L A;  1AV1 A;  2FYN C;  3GB4 A;  1YJW P;  3KXD A;  2J5U A;  1KIL B;  4U3F D;  1JY3 N;  1NJI Q;  2BAS A;  1LTB C;  5DJT B;  2FYU K;  2QG4 A;  2OYH B;  5AW1 B;  2Q3W A;  1FDI A;  2O01 H;  4HB1 A;  1L0L G;  2W90 A;  2KOG A;  2Y0C A;  2YMK A;  2B89 A;  2KLU A;  3H1K J;  5KKZ C;  1HJ0 A;  1KN7 A;  5KJ7 C;  2Q9I A;  2Y9Y A;  1MV8 A;  3Q5P A;  3T97 A;  2RMZ A;  2FYU J;  3H1I G;  1MFT A;  3F5H A;  5GTH E;  1OFC X;  1SQQ J;  3CLQ A;  3BAS A;  1G2C B;  2Y0D A;  3AE9 C;  2WPQ A;  2CK3 H;  1SQV D;  4BRY A;  1H89 A;  3HD7 A;  1L0N E;  2OGU A;  1KD1 Q;  5KJ7 D;  4WY4 B;  1SQQ K;  3AE2 C;  1SQB E;  2XKM A;  2W27 A;  2FXP A;  3E7K A;  2B24 A;  1S9K D;  1VQ5 P;  1RH5 B;  1BCC J;  1NU1 E;  2QRX A;  1N73 C;  2IBZ D;  2HOD A;  2R44 A;  1SQB D;  3GF7 A;  1ZXG A;  2OTL P;  1YYC A;  2LXC B;  3B5N C;  1NU1 D;  2CPB A;  5AW2 B;  2KIK A;  2XND H;  1L4A A;  1KYO E;  3V2P A;  3GZY A;  1M90 Q;  1BGY J;  2POH A;  1L0N D;  4KHX A;  3CWB J;  1URQ D;  2YIU B;  3KZI H;  3RGU A;  1OW6 A;  1USE A;  2HG5 D;  1NTK G;  4U7J A;  2C0X A;  2DE6 D;  2GBW A;  2HYN A;  1BDC A;  5B5E H;  3CCU P;  1M1K Q;  3V4W A;  1DEB A;  2K9J A;  1ULJ A;  5AVZ B;  3N4X A;  1LP1 A;  3A0B E;  2CPS A;  1N2D C;  4H0L D;  1KIL E;  3MUD C;  3UIA A;  3B5N B;  2QE7 H;  1KQS O;  1NTM E;  3L72 J;  4WVZ A;  1BCC G;  1PP9 J;  4GOF A;  4C7N B;  1JMM A;  1CW5 A;  1JEK A;  1MZ9 A;  4HM4 A;  3EQQ A;  3FXD A;  1NWQ A;  4H13 D;  1OX3 A;  2QM7 A;  3A0H E;  2FXM A;  2P58 A;  1ZN5 A;  1LTI C;  3CC4 P;  2ZAE B;  5AVX B;  1SQQ G;  3CD6 P;  2ZT9 D;  2QPZ A;  3CCQ P;  1RF0 A;  3OJA B;  2BEQ D;  3Q2Y A;  4N78 D;  3VP9 A;  2N1T A;  1NTZ G;  2N1T C;  4P1C H;  1LT9 B;  3D70 A;  1DX7 A;  1N7S C;  2QJP B;  2W6A A;  4PD4 H;  1IFN A;  3R4Y A;  2SPZ A;  1ZRT E;  1FBM A;  3CCL P;  3GHG A;  1VQ4 P;  4LC1 A;  1LTG C;  4RES B;  1NAY A;  2WSC J;  1NDO A;  5APX A;  2WPV B;  4AQR D;  2YIU C;  2AXT E;  5CCH D;  5KTB A;  5AW3 B;  1NTZ D;  3HUS A;  4A7P A;  3A2A A;  2QIW A;  4UB6 H;  1G1J A;  2IYO A;  1KIL C;  2FFD A;  4JPZ B;  2LR2 A;  2QM8 A;  2YMY A;  1URQ A;  3RL0 C;  1FZE A;  1EZV G;  5AW9 B;  1Y9B A;  3LW5 H;  4NPF X;  4BXL A;  1DD3 A;  1G8K B;  2E43 A;  3H1J G;  2KUB A;  3HE4 B;  3WUT A;  1BCC E;  1WQL A;  5APS A;  3PP5 A;  4QUR A;  1BDD A;  5APV A;  2Q6Q A;  3D6Y A;  2E76 B;  1NYK A;  2YNY A;  5CCG C;  3AEF C;  3P8C E;  4ZNC A;  3EQ2 A;  1SQV E;  1JTH B;  3TNU B;  2K88 A;  1LWU B;  3M9B A;  2YFI A;  3E1I A;  2Q3I A;  1NTZ K;  3AE8 C;  1SQX E;  3P32 A;  3ZDM A;  2AEJ A;  4IFM A;  3TYY A;  2I1K A;  2P67 A;  5CXM A;  2M5A B;  3CXH D;  1Q2N A;  2C9L Y;  1SQP G;  3M9Q A;  3HE5 B;  3EFF K;  1AVO A;  1EZV I;  1UII A;  2JKV A;  4R4L A;  1RF0 C;  5B66 H;  3L71 E;  2G8Y A;  2WIT A;  1FDM A;  3C1L A;  1N7S A;  3IF4 A;  5KLV G;  4Y99 B;  1RQV A;  3FOU A;  4P1B H;  5APU A;  1WT6 A;  1DEE G;  3LW5 J;  5B5E E;  4Y28 J;  1KC8 Q;  3PJS K;  3H1I J;  2BMR A;  4H0L B;  4BWN A;  2HMN A;  1EDJ A;  1NTZ E;  2JR8 A;  1Q90 C;  5AW8 B;  1IZN B;  2UWJ E;  4L76 A;  2GBX A;  4RO0 A;  1GL2 C;  1SQV K;  3CX5 I;  2H8P D;  4I7Z B;  1BGY D;  1S1C X;  4I7Z C;  2YXQ B;  3AE3 C;  1IC2 A;  4NBC D;  1GW3 A;  1IO4 A;  1CI6 A;  1P84 D;  3HE4 A;  3GTS A;  2A06 D;  4H0L C;  1ZR2 A;  1PPJ G;  1KFM A;  2NVG A;  1FOS F;  3TGU J;  1VQ8 P;  1J2J B;  2N9B A;  2WZ7 A;  3KHU A;  1GK6 A;  1RE4 C;  2NUM A;  4N6J A;  1RHZ B;  1VPC A;  3CWB D;  1GK4 A;  2XSH A;  4HM3 A;  1SQP D;  3L70 J;  1HBW A;  1SQV J;  1UUW A;  2KK7 A;  1M1J C;  3GHG C;  1U7M A;  2OQQ A;  3MZW B;  3L74 E;  1BE3 E;  2I8D A;  1NKZ B;  3GTE A;  3R2P A;  3SWY A;  1YIT P;  2WT7 B;  2L91 A;  2QJK B;  1OWA A;  1T3J A;  3G4S P;  3VMH D;  2YO3 A;  4PJ0 E;  5KAF E;  1QVF O;  2NWF A;  4N3Y B;  2N1T B;  1FJK A;  4DT0 A;  3CCM P;  3V6I A;  5TIS H;  2B9B A;  3VCA A;  3N7N A;  2D2C C;  1ZV8 A;  1ZME C;  5BOK A;  1Y8A A;  1L0N J;  4UB8 H;  3MHV A;  3VP8 A;  2BCC E;  5KAI E;  2W8Z A;  1RFS A;  3L36 A;  1K05 A;  4XFJ A;  1Y47 A;  1SLQ A;  3Q5R A;  4RJT A;  3HE5 A;  4ZMD A;  3W68 A;  3MUD A;  1IFI A;  3CX5 E;  4D6T E;  3RL0 B;  1FZC C;  4D6T J;  2QSI A;  3KPE A;  1HWT C;  3Q1M A;  1EZV D;  2PP6 A;  1EXJ A;  3P8C D;  1AJY A;  4YXW H;  2K37 A;  1SQX D;  2PFX A;  3HUS B;  3AEC C;  3TGU G;  3L71 J;  4OWF A;  1HVV A;  3H1I E;  1MFZ A;  2WMM A;  1JTH A;  4DZO A;  1AQT A;  1VQL P;  1S5L E;  3GL2 A;  3AE5 C;  4H44 B;  1FJP A;  1OZH A;  2OAR A;  4H44 C;  4KT0 J;  2IPP A;  2ITA A;  1NTK K;  1RE4 A;  4HKV A;  3U1C A;  5BU5 A;  1LT9 C;  1SQX J;  1L0L E;  2YO2 A;  2IYP A;  3HD7 D;  2HMM A;  2KS1 B;  3CME P;  2O01 J;  1URQ B;  1T2K C;  3G71 P;  3TK1 A;  2AEM A;  2HMK A;  1M56 D;  4IFD K;  3RK3 C;  4LGD E;  3BAT A;  5BVZ A;  4H44 D;  4PD4 E;  3L70 E;  1ZOY C;  2ZT9 C;  4I2L C;  2ZFC A;  2R3S A;  1GU5 A;  3SSU A;  1OW7 A;  4ZKU A;  4DCK A;  1FDO A;  3TGU E;  3CC2 P;  4EMJ B;  5AVS B;  2Q3E A;  3AED C;  1EDK A;  2P1J A;  1OW8 A;  3D71 A;  2JDI H;  3B5N A;  1BGY E;  1JNM A;  4GOE A;  5DJU B;  3I56 P;  4H13 B;  5H2F H;  1KOR A;  3GMA A;  1JO5 A;  3IR9 A;  4WWI A;  3V5B A;  1PGQ A;  3L70 G;  1LTS C;  2A45 G; 
#chains in the Genus database with same CATH homology
 1RQU A;  2WSC J;  1NDO A;  2WPV B;  2YIU C;  5M1B A;  3VCP A;  2NVF A;  2E74 D;  2CKF A;  3GCE A;  4U3F E;  4GDO A;  2XR8 A;  1PP9 E;  2QIW A;  3S9O A;  3GF3 A;  3AE1 C;  1VM9 A;  4HM6 A;  1Y9B A;  2MKV A;  4AIV A;  1SQQ E;  1PIX A;  1DD3 A;  1G8K B;  3B71 A;  2YVJ B;  2HMJ A;  1EZV E;  1BCC E;  1WQL A;  3IN6 A;  2D2C D;  4QUR A;  3D6Y A;  1NYK A;  2E76 B;  4Z1M H;  2V7Q J;  2DE5 D;  2E74 C;  3AEG C;  4QDC A;  4NBB D;  3AEF C;  5HL4 A;  4NB9 D;  4QUQ A;  1DIP A;  1SQV E;  1NYH A;  4NBH D;  5KLV E;  3D6Z A;  2YFI A;  1YQ3 C;  3EWK A;  3AE8 C;  1NTK E;  1PPJ E;  1SQX E;  3BCC E;  3G9R A;  3T97 B;  4HM2 A;  1HF9 A;  2NVE A;  2ZYL A;  4HM8 A;  5CXM A;  4OGQ D;  1O7P A;  4HM5 A;  1VL2 A;  3H1J E;  1UIX A;  1VF5 D;  3DQY A;  1ULI A;  4R4L A;  3O6Q A;  3AEE C;  2BMQ A;  2HMO A;  2BMO A;  3L71 E;  2FBW C;  2G8Y A;  4PV1 D;  1O7H A;  3VMG D;  2NUK A;  1RQV A;  3FOU A;  4P1B H;  3SFD C;  3LW5 J;  5AEW A;  2E75 D;  3IAO A;  3L72 E;  2XSO A;  4Y28 J;  1MKM A;  1OMI A;  1KTM A;  3AZC A;  4QDF A;  1VF5 B;  1JB0 J;  1G8J B;  2BMR A;  3SFE C;  2XRX A;  2DE7 D;  4H0L B;  5KLI C;  1EXI A;  1PL5 A;  2HMN A;  2WSF J;  5L8R J;  1GMJ A;  1NTZ E;  1Q90 C;  1K04 A;  3L73 E;  4NBG D;  2GBX A;  4PV1 B;  4R4M A;  4YXD C;  4HM1 A;  4I7Z B;  4RKU J;  1S1C X;  4I7Z C;  4QDD A;  1TU3 F;  2YFJ A;  3AE3 C;  3GOB A;  4NBC D;  4PV1 C;  2E74 B;  1KMI Z;  3GLM A;  4TT3 H;  2E76 C;  1UUV A;  1VCK A;  2WSE J;  3D89 A;  3AE6 C;  3AE4 C;  3GTS A;  1KQF B;  4H0L C;  2A06 E;  4HJL A;  1VF5 C;  1O7M A;  2NZ2 A;  2NVG A;  3GB4 A;  1PV3 A;  2FYN C;  1IK7 A;  1KB9 E;  2J5U A;  3FGA D;  2NUM A;  3GL0 A;  1S5L X;  2XSH A;  4HM3 A;  3H1K E;  4QCK A;  1UUW A;  2Q3W A;  1FDI A;  4NBD D;  1R8E A;  2OQQ A;  3L74 E;  1BE3 E;  2YMK A;  3GTE A;  5KKZ C;  1HJ0 A;  3VMI D;  3CXH E;  3Q5P A;  2K9Y A;  4NBF D;  3VMH D;  2JO6 A;  4HM0 A;  4NBA D;  2NWF A;  2P10 A;  4NB8 D;  2E75 B;  3AE9 C;  1ZP0 C;  1P84 E;  3RK3 E;  3VCA A;  2E4Q A;  2D2C C;  1ZME C;  5BOK A;  4OGQ B;  1L0N E;  1YQ4 C;  1WMK A;  5AEU A;  3AE2 C;  2BCC E;  2JZA A;  1SQB E;  2B24 A;  2FXP A;  1NU1 E;  1RFS A;  1Q90 D;  1K05 A;  4XFJ A;  3C8V A;  2JP3 A;  3EN1 A;  3Q5R A;  2ZT9 B;  3CX5 E;  2H89 C;  3AE7 C;  3GF7 A;  3N0Q A;  3H25 A;  2QSI A;  3Q1M A;  1EXJ A;  1AJY A;  4HM7 A;  3ABV C;  2QJY C;  2FYU E;  3AEC C;  2JO1 A;  1KYO E;  3GZY A;  2E76 D;  3H1I E;  3Q3D A;  1O7N A;  2B1X A;  2BEZ F;  3RL0 g;  1U57 A;  1EG9 A;  3GL2 A;  3AE5 C;  2H88 C;  4H44 B;  1OW6 A;  4U7J A;  2DE6 D;  2GBW A;  4H44 C;  4KT0 J;  3CWB E;  3AEB C;  2HML A;  4HKV A;  1ULJ A;  2QJP C;  3GKE A;  4H13 C;  1L0L E;  4H0L D;  2WQY C;  1FQT A;  2HMM A;  1KIL E;  3H1L E;  3Q5S A;  2I7F A;  2O01 J;  2G3A A;  2HMK A;  4QUP A;  1NTM E;  1KQG B;  4H44 D;  1O7G A;  2IBZ E;  1RIE A;  4PD4 E;  3L70 E;  1ZOY C;  1SJG A;  4HM4 A;  3EQQ A;  2ZT9 C;  2E4P A;  4H13 D;  1O7W A;  1SQP E;  2IDB A;  3H1H E;  3GZX A;  3L75 E;  4QDF B;  1OW7 A;  1NGM B;  4AAY B;  1FDO A;  4OGQ C;  1JM1 A;  3TGU E;  4EMJ B;  2D2C B;  2ZT9 D;  3AED C;  3AEA C;  2QPZ A;  1OW8 A;  3D71 A;  4IL6 X;  2BEQ D;  3Q2Y A;  2E75 C;  4YTP C;  2YFL A;  4P1C H;  4H13 B;  3D70 A;  1KOR A;  3GMA A;  3C0D A;  2QJK C;  3R4Y A;  1ZRT E;  1DD4 A;  4NBE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...