2ZT9D

Crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
166
Chain Sequence
b'DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
pubmed doi rcsb
molecule tags Photosynthesis
total genus 33
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2008-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2zt9D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2zt9D02
2B1XA 1VM9A 2E74C 4QDFA 2HMKA 1NTZE 3L72E 1SQQE 3GB4A 1L0LE 2HMOA 3H1KE 3GL2A 3L74E 3GCEA 4AIVA 3GL0A 2YFJA 4AAYB 2NUKA 1UUWA 4QDCA 2QJYC 4NBBD 3AZCA 1WQLA 3CX5E 3DQYA 2FYUE 2E76C 2A06E 2E75C 3EN1A 2E76D 2E75D 1O7MA 4PV1C 4P1BH 1NU1E 1O7NA 1NTKE 4PV1D 1SJGA 1PPJE 3GZXA 4QUPA 1SQPE 4H0LC 5KLVE 4QURA 3D89A 2NVEA 2XSHA 3VMGD 3EQQA 5HL4A 1BCCE 1KYOE 2HMLA 1PP9E 2B24A 2BMRA 4H13C 4I7ZC 5CXMA 2XSOA 4NBAD 1BE3E 4H13D 2CKFA 3H1LE 1ZRTE 4OGQC 1O7WA 4HJLA 4NBCD 5KKZC 2BMOA 4NBED 4OGQD 2NVGA 1UUVA 3CXHE 3N0QA 3L73E 2DE7D 2JO6A 3L75E 2D2CC 2XRXA 2Q3WA 4H44C 2ZT9C 1G8KB 2D2CD 1VF5C 2JZAA 4H44D 2ZT9D 1JM1A 1SQXE 2BMQA 1NTME 4HM8A 3C0DA 1VF5D 4HM2A 1O7PA 4HM1A 2QJKC 1SQBE 1O7GA 2GBXA 1P84E 3GOBA 3VMHD 3VMID 1ULJA 2QJPC 3GTSA 2BCCE 4NBDD 1L0NE 2FYNC 2HMMA 2YFIA 3BCCE 3H1IE 4QUQA 2YVJB 4HM3A 2I7FA 3H1JE 3H1HE 2E4PA 4HM0A 2DE5D 4QCKA 2IBZE 1G8JB 2NWFA 1RFSA 1Q90C 4NBGD 1NYKA 1VCKA 4HM7A 3CWBE 1ULIA 1O7HA 4NBFD 3VCAA 4NBHD 2E74D 1NDOA 2XR8A 2DE6D 4NB9D 5AEUA 3TGUE 2HMJA 4EMJB 2NVFA 2YIUC 3GZYA 4HM4A 4QDDA 2ZYLA 5KLIC 4QDFB 1SQVE 4PD4E 2YFLA 3FOUA 3GKEA 3GTEA 4NB8D 1RIEA 3L70E 1EG9A 3VCPA 4U3FE 2GBWA 3L71E 1EZVE 2E4QA 5AEWA 4HM5A 5BOKA 2QPZA 1KB9E 4HKVA 4HM6A 1FQTA 4P1CH 4H0LD 2YMKA 2HMNA 2NUMA
chains in the Genus database with same CATH superfamily
2E74C 2O01N 2WPVB 1SQQE 1K8AQ 1YJ9P 5BVZA 2YO2A 3EFGA 4NBBD 2IBZG 2KNCB 3HTKA 4NPDA 3FGAD 5AW9B 2WSEJ 3H1JD 2KK7A 1JTHA 3HUSA 5KLVE 5E79H 1CW5A 2JEEA 2NVEA 4D6TG 1JM0A 3B8EB 4I7ZC 3L71G 1EZVG 3SWKA 2BMOA 2E5YA 3LW5J 2P58A 3Q3DA 3VMYA 5K5GB 4LGDE 2ZT9D 3M9QA 3M0DC 2QSIA 4YXWH 1LTBC 1RF1B 1GL2D 3L36A 2M3BA 2W6AA 3TDKA 3L74D 3L72J 2HMMA 5CBOA 1NVOA 1KFNA 2I7FA 2V7QH 1JEKA 2DE5D 2QEXP 3FX0A 3EFFK 1RE3A 2FXOA 1LWUB 1PP9G 4U3FJ 4NBFD 2ZYAA 1NOHA 2AXTH 2HODA 3H32A 3USSA 4C46A 5H2FH 4DOJA 5KLIC 1L0LJ 1EG9A 3L75G 3VCPA 1LTJA 1FQTA 3RK3C 3HTKB 2B87B 5KJ7C 1FBMA 1JCDA 5GTIE 4QDCA 1P84H 2FYUE 2WVRA 1Q2NA 3SFEC 4PV1D 2WPRA 2HLOA 3GF7A 4AYCA 3KYQA 3BVHA 3PJSK 1SQVG 3L72D 3L73J 4WWIA 2Z4EA 4I7ZB 2ITAA 3R2PA 3LIDA 1OVRA 1IK7A 1M1JC 2ZYDA 5KKZC 4OGQD 5CJ0A 1UUVA 3CXHE 1EDLA 2YMYA 4U3FD 1NTZG 1L0NJ 3RK2D 1GDTA 3H1KG 2M5AA 2W6BA 2IPPA 3L71J 4H44D 3H6PA 2A45I 3VYIA 1NTKK 1L0LD 2GA1A 2K9YA 1KYOH 2BCCE 3MUDC 1PV3A 2O1KA 4WY4A 2YVJB 3C1LA 4HM0A 2A06D 4GOEA 1G8JB 1AVYA 1T2KD 1BGYG 3KPEA 2HMJA 3L4FA 5KLIB 4HM4A 2WSSH 2Q7CA 1S9KD 4LLHA 3L70E 3P32A 4OH8B 2KLVA 1ZN5A 5BOKA 1LTGC 4RESB 2W83C 3RK3B 3AE6C 5CBNA 1N7LA 1FZAA 1N8RQ 4NPEA 4PJ0H 2N9BA 1ZP0C 1YTZI 2YFJA 3BATA 2E42A 1L0ND 5TISE 1Y8AA 1J1EC 3L71D 1O7NA 3CCMP 1EC5A 3GZXA 3TGUG 3WU2H 1N7SD 4H13C 5KKZB 2XSOA 1M90Q 3V4WA 2B88A 3NTNA 5GTHE 3VMAA 4WY4B 2YO3A 3H1IJ 1SFCD 1G2CA 2G3AA 2FXMA 1PP9D 2IFMA 3MGNA 1NU1G 1X0TA 3NXSA 1LT9A 5KAFE 4Y99B 3VMXA 4WBAA 1YITP 1FE6A 3FWNA 1S4XA 4QDDA 1KZUB 3V2NA 1OXZA 3GTEA 1VQ6P 3LW5H 2ZYGA 4BRYA 2GBWA 2RMZA 1YTZT 4L75A 4RKUJ 1GTWA 5E79E 1DD4A 1L4AD 1SQBG 3P8CD 1VM9A 1N86A 1TU3F 3VOPA 1N73C 4L76A 2PGDA 3GCEA 2PAJA 3A2AA 1BDDA 1SQVD 5APSA 1WT6A 1KILE 1BCCJ 2I1JA 1J1EB 3JCUE 1KQGB 3H1ID 3A3YB 1FDIA 1ZMEC 2POHA 1E79H 1GD2E 4H13B 1PGQA 1CSBA 2BMRA 2RN0A 1SQXJ 1G2CB 5AVVB 1JUNA 2KYVA 3CX5D 3V2PA 1VQKP 1RQVA 3N4XA 2PRRA 3BRTB 4YTPC 2AXTE 4EIJA 1LT9B 2FBWC 5H2FE 1G1JA 3HE4A 1VQPP 1NHLA 3B4SA 3KXDA 4UB6H 2P10A 2QA4P 1KV4A 4IL6H 2R3SA 3CC7P 1PIXA 3GTSA 3M9HA 1K73Q 3BCCE 4HJGH 2AXCA 2MJZA 1SQPG 1L0LK 4R4LA 3Q2YA 2A45H 4MN4C 3MHVA 1OW7A 5BU8B 4NBGD 1JB0J 3T97B 4O9BA 2XR8A 2DE6D 1BCCD 5KAIE 1MZ9A 1NYHA 5AVXB 2NZ2A 2OYHC 3H25A 1N73B 2HMNA 4GKGA 2ZXEB 1SQXD 1NTKJ 3TGUD 2VRSA 1J1DC 3CCUP 1YQ3C 3H1HG 2WSFH 2HG5D 4XA4A 3IR9A 2E43A 1PGPA 2M0BA 1BE3J 1L0NK 1NAFA 1NKNA 3KZIE 1KYOE 1FJPA 4R4MA 4RJTA 2B89A 4UB8E 3II6A 2XZRA 4M3LA 3NMDA 3Q1MA 3H1LE 1ZRTE 4NBCD 2Y9ZA 2KS1A 2P67A 4C7NB 2HPCA 1G1IA 1SQQG 1FZGA 4CPGA 3CD6P 4HYTB 1O7GA 4DT0A 2C9LY 3S1KA 2IYOA 4NBDD 1JMBA 4N78D 3H1JE 5KLVG 5TISH 4PJ0E 1JY3P 4IFDK 1YJNP 2KOGA 3N7NA 2Q9IA 1FC2C 1NH4A 1UIIA 3NFQA 1PGJA 2Z5IA 1AFOA 5C39A 4ZKUA 1BE3D 2GUVA 1T3UA 1JY2N 1J2JB 5AEWA 3F89A 2B9BA 3TNUA 2KIKA 4P1CH 2ZJSE 3RK3D 3VP9A 2Q5UA 1LNQA 5KJ7D 2HMOA 1J1DB 2NPSA 3L74E 2H7HA 1KTMA 3VMZA 4KHXA 4EOTA 3OA7A 3L37A 1ZR2A 1JY3N 2L5GB 3V4QA 5APUA 3V6IA 3IF4A 2HPCB 3G3ZA 3VN0A 3HUSC 1KQFB 1T3JA 4IFMA 1VQNP 1KILC 3CI9A 1EXJA 3W67A 4DZOA 1X9VA 5APTA 5AW3B 1IC2A 3B5NA 1SQPD 4GDOA 1H0TA 1ZR4A 4WY4D 1KILA 2FYUG 2WT7A 3VMID 1OX3A 1QGKB 2YFIA 1MUUA 4WVZA 1FAVA 1KMIZ 2WTYA 1U57A 2IDBA 2OARA 3SWFA 2O3JA 3JCUH 1Q90C 3D6YA 2WWWA 1LP1B 4K35A 1FZCA 1RE3C 3GKEA 2O1JA 2AEJA 1OWAA 3GW6A 1KQLA 5CHXA 4U3FE 1OW8A 4H0LB 4B86A 3AE5C 2N1TA 2QM7A 3E1IA 4JF7A 2BCCG 1L0LE 2R44A 2K88A 1LTJC 1W2EA 1X22A 2KXPB 3CLQA 3AE8C 1SQXK 3AECC 4PD4D 1WQLA 2A06E 2E76C 2E75C 3EN1A 3AE9C 5AW6B 3EWKA 2R3CA 2WZ7A 2ZAEB 3BRVB 4UB6E 3AEDC 3CMAP 3HRNA 4EDFA 3D70A 2J58A 4IL6E 5AW5B 1JTHB 2YKQA 1SQQD 1S9KE 3B5NB 3HUSB 5AVZB 1RF0C 1K05A 3L70G 3R4YA 3RL0C 1GU4A 2B24A 4NBAD 1KILB 4H13D 1NGMB 2Y0EA 5CCGC 4EI2A 2WT7B 5KAIH 2NVGA 1YBKA 2FXPA 1RF0A 3L73E 2YXQB 1KB9D 1KORA 1NTME 5CCGA 1L2PA 3O6QA 2OGUA 5AVQB 1VQLP 3AEGC 2I1KA 1L0NE 4HM3A 4GT1A 2RH0A 1ZXGA 4D6TJ 3C8VA 4WY4C 3I5CA 2N1TB 1QL2A 5AW0B 2ZYLA 3W68A 4U7JA 5AVUB 1GMJA 2IBZI 2YFLA 3KZIH 3FOUA 2HODB 3H32B 3TSIA 1RIEA 4UB8H 1JOCA 2GM4A 3GMAA 2E4QA 3C9IA 5CMZA 4HM6A 3P8MC 4Y99C 1U7MA 2O01H 2HMKA 1LTJB 2BASA 3TF5A 3GL2A 3I56P 1T6AA 1EZVI 1FZBA 1AVOA 2E76B 2WSCJ 2E75B 2XNDH 1PP9J 4QUPA 1ZOYC 3QWOC 1LJ2A 2IBZD 3WMM0 1KQSO 1S1CX 3RL0B 1DEBA 3PRJA 5AVWB 3L75J 1HGZA 3O6QB 1RY3A 1O7WA 1CZQA 4D6TD 3U59A 1DX7A 1M56D 3N0QA 1NKZB 3B71A 2KUBA 2JKVA 1EZVD 2XRXA 2Q3WA 2OYOA 2R5DA 2JZAA 1O7PA 2QJKC 3SSUA 2QG4A 1LTIC 2M5AB 4IL6X 4TT3H 3GOBA 2M8RA 1JO5A 3H1IE 4QUQA 1NO4A 2W8ZA 3CXHD 1SQVJ 5BU5A 3P7KA 4QCKA 3ZDMA 1YIJP 4HM7A 3CWBE 2L91A 3RL0g 1LT9C 2Z5HA 2KSEA 1NTZJ 2BCCD 1AQTA 2WSEH 3H1KJ 5AW7B 1A02J 2K9JA 2C9NY 2JR8A 1FDMA 2Q6QA 2E5TA 3JC22 3L75D 1KD1Q 1GK6A 4JBZA 1FOSF 3BCCG 1Q82Q 2IFNA 3WUUA 1BGYJ 1U7JA 1HVVA 2WITA 3CCQP 4W7YA 3CPWO 2CPSA 1PPJE 1EDKA 3CX5I 4HB1A 4HH2A 1BCCE 2HMLA 3KHUA 2W6JH 1E5WA 1RQUA 2OYIC 1Y9BA 2CKFA 1SQQK 3TYYA 1DIPA 1MFTA 1OW6A 3I55P 2QIWA 1M8OB 2D2CC 2HFED 2OYIA 3Q5PA 1VF5C 4W7ZA 1SQXE 2QJKB 4GODA 3C0DA 4HM2A 1NTZD 4JQ0D 2GBXA 3E1RA 2LXCB 3H1KD 5B66E 1ULJA 2V4HA 5EFWB 3TGUJ 3V2RA 2ZVOB 3MIWA 2FY8A 2J59M 2K9JB 1O7HA 4EMJB 3F5HA 2IX7C 3H1LG 5DJUB 1BGYD 1HWTC 1T8ZA 1WMKA 2QPZA 1IFMA 2V7QJ 1VQ5P 4H0LD 4BRYB 2FFDC 3HE5A 2B1XA 1NU1J 2IZ1A 3H1JG 4C7RA 1PFIA 1MV8A 1LT1A 3M9BA 2FFDA 1ZLLA 4YPCA 1QLED 2JDIH 1NTKE 3A0HH 1PGOA 1M57D 4OVNF 1BDCA 3FWLA 2C0WA 3D89A 3CCEP 2XSHA 1PL5A 3G4SP 1JNMA 5CCHC 5M1BA 2OYIB 3B5ND 1BE3E 1SQBJ 1USDA 1KILD 2H89C 2D2CB 2P7JA 5CCHA 3FXEA 1VF5B 1IO4A 2KZJA 1EDIA 2JWAA 1QL1A 3L74G 1LTAC 3GHGA 2YKPA 3AE3C 3KDPB 1VQ7P 4GIFA 3UIAA 1XTCC 2FYNC 1Q81Q 3HE4B 2M3EA 4WB4A 3WUVA 1KN7A 2WPQA 2E4PA 3AE7C 1P84I 3HD7C 1NU1D 2W27A 1Q90D 2XU6A 3A0BE 2IZ0A 4N6JA 2YIUC 2N1TD 2YKOA 1QEXA 3HD7A 5AVTB 1S3JA 2WQYC 2QVAA 4AQRD 4ZKPA 3MD0A 2FFDB 2Q3IA 3A7OA 4ZMDA 2PP6A 1SQPJ 2Q3EA 1W2BO 1SQBD 4L74A 1H88A 2H88C 1AQ5A 1N2DC 2P2UA 1P84D 3MP7B 3DQYA 3S4RA 3AEBC 2E76D 2E75D 2NPSC 1Y47A 2HR3A 2W90A 4H0LC 2MKVA 4QURA 1FOSE 3CCSP 3KQGA 1URQC 3CCLP 3RL0D 4U3FG 5AVYB 2BEQD 4NBED 5CCGD 3CX5H 1JCCA 1GW3A 3D71A 1URQA 2OTLP 1SQVK 3VTPC 5KTBA 1L0LG 2HYNA 1QX8A 2KS1B 3H1HJ 4HM8A 3CC4P 1KYOD 2A06G 2FYNB 3VMHD 1S5LE 3B5NC 4KJMA 1NTZK 3H1LD 1ZRTD 2YNYA 3OW2O 3HD7B 4AUWA 3LIEA 2WPSA 1YHQP 1Q7YQ 1YJWP 3GLMA 3PLNA 2YIUB 1JMMA 2NVFA 2A45G 3M91A 3L35A 1GW4A 3PH0A 1A02F 1FZFA 5APYA 4NB8D 1SQQJ 1FDOA 2N9YB 3L73G 2B87A 1RE4C 4HM5A 1FZCC 4GOFA 1KB9E 1NTMG 4HKVA 2YMKA 4PD4I 4KT0J 4N3YB 3L72E 1VL2A 1L0NG 2R5BA 1EDJA 3TNUB 1RE4A 2J5UA 2Y0DA 2N1TC 2NUKA 5KLVJ 4JYBA 1VQ4P 2ZVNB 2NPSB 5B66H 3G6EP 3H1HD 1USEA 2BEZF 1IFJA 2P1JA 3AEAC 1LTTC 1URQB 1GZLA 1Q86Q 5HL4A 1HUCA 3QH9A 3RGUA 1NJIQ 3EQ2A 1KB9I 3CL3D 3OAKA 1FJKA 3M0DA 3AEEC 1IJDB 2JO1A 2Q1KA 2BMQA 3AE1C 5AW1B 3Q5RA 3ITKA 2QM8A 1H0TB 5DJTB 2IBZE 2E74B 5B5EH 2ZFCA 1VCKA 1QVFO 3VCAA 2G8YA 1FZEA 2QRXA 3CCVP 5KLVD 3AE4C 1NU1K 1IFPA 1R5LA 5APVA 4D6TE 3M0AA 1S5LX 3D6ZA 5KJ7A 3A0HE 1FZCB 3L71E 1EZVE 1LTSC 3TK1A 1HF9A 3A5TA 1NAYA 2FYUJ 3Q5SA 2OTKE 2PFXA 4QDFA 1K9MQ 2JP3A 3GB4A 2LXBA 3H1IG 4YXDC 1AA0A 1NWQA 3RBXA 1NTMJ 1UUWA 3AZCA 4K3AA 1SQBK 3CWBG 4P1BH 3CC2P 1IK9A 1M1JA 1SVFA 4ASWA 1XTGB 1PZQA 3EQQA 4XE5B 3K5BA 4DCKA 1PP9E 1HBWA 3A0BH 1W5CE 3U1AA 3FXDA 3G9RA 1FU1A 4HJLA 2WSFJ 1X79B 2YXRB 2BCCJ 3L75E 1ZW0A 2ZT9C 1G8KB 2D2CD 3MUDA 1VF5D 1GL2C 4TLFA 1KC8Q 3CCJP 3CXHI 1OZHA 1K04A 2FKWB 2QJPC 1MFZA 2FYZA 4EYYQ 1PPJG 1H89A 1GL2A 3GG2A 2FYUD 3P8CE 1SP4A 3U1CA 3L70J 1BCCG 3L73D 3AEFC 4NBHD 1NDOA 1NTMD 2KI7B 1SQPK 4QDFB 1SQVE 2KB7P 1IFIA 2UWJE 1YQ4C 1SQXG 1VQ9P 2IYPA 2H43A 5CXMA 3G71P 1VQOP 3PHLA 1NTZE 3BASA 3H1KE 1HGVA 1M1JB 4AAYB 3CX5E 4PD4H 1OMIA 1S5LH 2DW3A 4L73A 3S9OA 4PV1C 1DEEG 3M06A 2K1AA 2CK3H 2Y0CA 4ASVA 4LC1A 1IZNB 1BGYE 3CWBJ 2LKMA 5CCHD 1DD3A 2KZIA 4OGQC 1BSNA 3L70D 3RK2C 2ZT9B 1R8EA 4XFJA 1EQ7A 2JO6A 4BXLA 4H44C 5AW4B 2ZXXA 1GL2B 2K3RA 1JM1A 1KB9H 2WMMA 4HM1A 2QJPB 4DJGA 4NPFX 4JPZB 1HH0A 5APWA 5APXA 1GK4A 3GF3A 1NTKG 3WUTA 1EXIA 2QE7H 3T97A 1T2KC 3IN6A 1R5SA 1VQ8P 3HD7D 4JYCA 5AEUA 3TGUE 1BE3G 2OTJP 1H8AA 5KLVK 1AJYA 1N73A 1WRGA 1OVUA 1AV1A 2R32A 3CCRP 4Z1MH 3CWBD 1QVGO 3PTZA 1VQMP 2KSJA 3GL0A 2QJYC 1Z56A 2XNXA 4I2LC 4PV1B 1NU1E 2NPSD 1SJGA 3VMGD 1N7SC 1URQD 3MZWB 4C7NA 4OGQB 4N78E 4OWFA 3IAOA 5GTIH 2JJLA 3RK2B 1LGHB 5B5EE 2KP8A 1N7SA 4H44B 4IFFA 1VPCA 1SFCC 3BCCJ 1PPJD 2H8PD 4I6MC 4I1LA 1SQBE 1P84E 1CI6A 3V5BA 1SFCA 3GHGC 4ZNCA 1YYCA 4W80A 4IOIH 3CXHH 1OVVA 3RK3E 2XV5A 2FYUK 4HKZH 2E74D 4NB9D 4Y28J 1KFMA 1DH3A 3GZYA 2XDJA 5APQA 2WSCH 2OYHA 4RO0A 1NTMK 2SPZA 3IFMA 2GUSA 1FS0E 1L4AC 1SS1A 1HJBA 3MTUE 1ZV8A 1M1KQ 2NUMA 1MKMA 2XKMA 3PP5A 2CPBA 1OIPA 3VP8A 4AIVA 1YI2P 2KLUA 3HE5B 2QJYB 1L4AA 2AEMA 2C0XA 3BCCD 1O7MA 1JY2P 3O8ZA 1JY2O 1SQPE 5AW2B 2K37A 3H1LJ 5AW8B 4BWNA 1N7SB 2O01J 3V2QA 3ABVC 1RHZB 2KNCA 5AVSB 1OFCX 5L8RJ 2I8DA 2RKLA 4QMAA 3SFDC 5CJ4A 1CI6B 2NRGA 1HJ0A 1GU5A 1HTLC 1SFCB 3OJAB 1KYOI 2Y9YA 3L72G 3RBZA 2DE7D 1NTKD 5AVRB 1JY3O 3H1JJ 1X8YA 3E7KA 3AE2C 3JSVC 1IFDA 1RF1C 3GHGB 4A7PA 1M7LA 1LP1A 3H1HE 2OYHB 3WU2E 1S2EA 2AEFA 2JWDA 1IFNA 2NWFA 2OQQA 5TJHA 1RFSA 1RF1A 1NYKA 5GTHH 1ULIA 2LR2A 3SWYA 1LWUC 3CMEP 1RH5B 1D7MA 1S72P 4PD4E 1SLQA 3L74J 1LWUA 1L4AB 1VDFA 1UIXA 1BSHA 5KAFH
chains in the Genus database with same CATH topology
2E74C 4QDFA 2WPVB 1SQQE 2JP3A 3GB4A 4YXDC 1YQ3C 1UUWA 4NBBD 3AZCA 3FGAD 2WSEJ 4P1BH 1PPJE 5KLVE 2NVEA 3EQQA 1BCCE 1KYOE 2HMLA 4R4MA 1PP9E 1RQUA 4I7ZC 1Y9BA 3G9RA 2CKFA 3Q1MA 3H1LE 1ZRTE 4NBCD 4HJLA 1DIPA 2BMOA 1OW6A 2WSFJ 3LW5J 2QIWA 3Q3DA 3L75E 2D2CC 2ZT9C 1G8KB 2D2CD 3Q5PA 1VF5C 2ZT9D 1SQXE 3C0DA 1VF5D 4HM2A 2QSIA 1O7GA 2GBXA 1K04A 1ULJA 2QJPC 4NBDD 2HMMA 2I7FA 3H1JE 2DE5D 1O7HA 3AEFC 4NBFD 4NBHD 1NDOA 4EMJB 5KLIC 4QDFB 1SQVE 1EG9A 3VCPA 5AEWA 1WMKA 1YQ4C 2QPZA 2V7QJ 1FQTA 4P1CH 4H0LD 5CXMA 2B1XA 1NTZE 2HMOA 3H1KE 3L74E 1KTMA 4AAYB 4QDCA 3CX5E 2FYUE 1OMIA 3S9OA 4PV1C 3SFEC 1NTKE 4PV1D 3GF7A 3D89A 2XSHA 1PL5A 4I7ZB 5M1BA 1KQFB 1DD3A 1BE3E 1IK7A 4OGQC 5KKZC 4OGQD 1UUVA 3CXHE 2H89C 1EXJA 2D2CB 2ZT9B 1R8EA 4XFJA 2JO6A 1VF5B 4H44C 4GDOA 4H44D 1JM1A 3AE3C 4HM1A 3VMID 2K9YA 2BCCE 2FYNC 2YFIA 1PV3A 3GF3A 1EXIA 2YVJB 1KMIZ 2E4PA 4HM0A 1U57A 2IDBA 3IN6A 1G8JB 3AE7C 1Q90C 3D6YA 1Q90D 5AEUA 3TGUE 2HMJA 2YIUC 4HM4A 3Q5SA 1AJYA 3GKEA 3L70E 2WQYC 4U3FE 1OW8A 5BOKA 4H0LB 3AE5C 3AE6C 4Z1MH 1L0LE 1ZP0C 3GL0A 2YFJA 2H88C 3AE8C 2QJYC 3AECC 1WQLA 3DQYA 3AEBC 2E76C 2A06E 2E75C 3EN1A 4PV1B 3AE9C 2E76D 2E75D 1NU1E 3EWKA 1O7NA 1SJGA 3GZXA 4H0LC 2MKVA 3AEDC 4QURA 3VMGD 3D70A 1K05A 3R4YA 2B24A 4H13C 4OGQB 2XSOA 4NBAD 4H13D 3IAOA 1NGMB 2BEQD 4NBED 2NVGA 2FXPA 3D71A 4H44B 3L73E 1KORA 4HM8A 1NTME 3O6QA 1SQBE 2G3AA 1P84E 3VMHD 3AEGC 1L0NE 4HM3A 3C8VA 3RK3E 2E74D 4NB9D 3GLMA 4Y28J 2NVFA 3GZYA 4QDDA 2ZYLA 4U7JA 1GMJA 2YFLA 3FOUA 3GTEA 4NB8D 1RIEA 1FDOA 2GBWA 3GMAA 2E4QA 4HM5A 4RKUJ 1KB9E 4HKVA 4HM6A 1DD4A 2YMKA 2NUMA 1VM9A 1MKMA 1TU3F 4KT0J 2HMKA 3L72E 1VL2A 3GL2A 3GCEA 4AIVA 2J5UA 2NUKA 2E76B 2WSCJ 2E75B 1KILE 1KQGB 1FDIA 1O7MA 4QUPA 1ZOYC 1SQPE 2BEZF 1ZMEC 3AEAC 1S1CX 2O01J 5HL4A 3ABVC 4H13B 2BMRA 5L8RJ 3SFDC 1O7WA 3AEEC 1HJ0A 3N0QA 1RQVA 2JO1A 3B71A 4YTPC 2DE7D 2XRXA 2Q3WA 2FBWC 2JZAA 2BMQA 3AE1C 3AE2C 1O7PA 2QJKC 2P10A 3Q5RA 4IL6X 4TT3H 3GOBA 1PIXA 3GTSA 3BCCE 3H1IE 4QUQA 3H1HE 4R4LA 3Q2YA 4QCKA 2IBZE 2NWFA 2OQQA 1OW7A 2E74B 1RFSA 4NBGD 1NYKA 1VCKA 4HM7A 3CWBE 1ULIA 1JB0J 3T97B 3VCAA 2G8YA 2XR8A 2DE6D 3AE4C 3RL0g 4PD4E 1S5LX 3D6ZA 1NYHA 3L71E 2NZ2A 1EZVE 1HF9A 1UIXA 3H25A 2HMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1X A;  1VM9 A;  2E74 C;  4QDF A;  2HMK A;  1NTZ E;  3L72 E;  1SQQ E;  3GB4 A;  1L0L E;  2HMO A;  3H1K E;  3GL2 A;  3L74 E;  3GCE A;  4AIV A;  3GL0 A;  2YFJ A;  4AAY B;  2NUK A;  1UUW A;  4QDC A;  2QJY C;  4NBB D;  3AZC A;  1WQL A;  3CX5 E;  3DQY A;  2FYU E;  2E76 C;  2A06 E;  2E75 C;  3EN1 A;  2E76 D;  2E75 D;  1O7M A;  4PV1 C;  4P1B H;  1NU1 E;  1O7N A;  1NTK E;  4PV1 D;  1SJG A;  1PPJ E;  3GZX A;  4QUP A;  1SQP E;  4H0L C;  5KLV E;  4QUR A;  3D89 A;  2NVE A;  2XSH A;  3VMG D;  3EQQ A;  5HL4 A;  1BCC E;  1KYO E;  2HML A;  1PP9 E;  2B24 A;  2BMR A;  4H13 C;  4I7Z C;  5CXM A;  2XSO A;  4NBA D;  1BE3 E;  4H13 D;  2CKF A;  3H1L E;  1ZRT E;  4OGQ C;  1O7W A;  4HJL A;  4NBC D;  5KKZ C;  2BMO A;  4NBE D;  4OGQ D;  2NVG A;  1UUV A;  3CXH E;  3N0Q A;  3L73 E;  2DE7 D;  2JO6 A;  3L75 E;  2D2C C;  2XRX A;  2Q3W A;  4H44 C;  2ZT9 C;  1G8K B;  2D2C D;  1VF5 C;  2JZA A;  4H44 D;  2ZT9 D;  1JM1 A;  1SQX E;  2BMQ A;  1NTM E;  4HM8 A;  3C0D A;  1VF5 D;  4HM2 A;  1O7P A;  4HM1 A;  2QJK C;  1SQB E;  1O7G A;  2GBX A;  1P84 E;  3GOB A;  3VMH D;  3VMI D;  1ULJ A;  2QJP C;  3GTS A;  2BCC E;  4NBD D;  1L0N E;  2FYN C;  2HMM A;  2YFI A;  3BCC E;  3H1I E;  4QUQ A;  2YVJ B;  4HM3 A;  2I7F A;  3H1J E;  3H1H E;  2E4P A;  4HM0 A;  2DE5 D;  4QCK A;  2IBZ E;  1G8J B;  2NWF A;  1RFS A;  1Q90 C;  4NBG D;  1NYK A;  1VCK A;  4HM7 A;  3CWB E;  1ULI A;  1O7H A;  4NBF D;  3VCA A;  4NBH D;  2E74 D;  1NDO A;  2XR8 A;  2DE6 D;  4NB9 D;  5AEU A;  3TGU E;  2HMJ A;  4EMJ B;  2NVF A;  2YIU C;  3GZY A;  4HM4 A;  4QDD A;  2ZYL A;  5KLI C;  4QDF B;  1SQV E;  4PD4 E;  2YFL A;  3FOU A;  3GKE A;  3GTE A;  4NB8 D;  1RIE A;  3L70 E;  1EG9 A;  3VCP A;  4U3F E;  2GBW A;  3L71 E;  1EZV E;  2E4Q A;  5AEW A;  4HM5 A;  5BOK A;  2QPZ A;  1KB9 E;  4HKV A;  4HM6 A;  1FQT A;  4P1C H;  4H0L D;  2YMK A;  2HMN A;  2NUM A; 
#chains in the Genus database with same CATH topology
 2E74 C;  2O01 N;  2WPV B;  1SQQ E;  1K8A Q;  1YJ9 P;  5BVZ A;  2YO2 A;  3EFG A;  4NBB D;  2IBZ G;  2KNC B;  3HTK A;  4NPD A;  3FGA D;  5AW9 B;  2WSE J;  3H1J D;  2KK7 A;  1JTH A;  3HUS A;  5KLV E;  5E79 H;  1CW5 A;  2JEE A;  2NVE A;  4D6T G;  1JM0 A;  3B8E B;  4I7Z C;  3L71 G;  1EZV G;  3SWK A;  2BMO A;  2E5Y A;  3LW5 J;  2P58 A;  3Q3D A;  3VMY A;  5K5G B;  4LGD E;  2ZT9 D;  3M9Q A;  3M0D C;  2QSI A;  4YXW H;  1LTB C;  1RF1 B;  1GL2 D;  3L36 A;  2M3B A;  2W6A A;  3TDK A;  3L74 D;  3L72 J;  2HMM A;  5CBO A;  1NVO A;  1KFN A;  2I7F A;  2V7Q H;  1JEK A;  2DE5 D;  2QEX P;  3FX0 A;  3EFF K;  1RE3 A;  2FXO A;  1LWU B;  1PP9 G;  4U3F J;  4NBF D;  2ZYA A;  1NOH A;  2AXT H;  2HOD A;  3H32 A;  3USS A;  4C46 A;  5H2F H;  4DOJ A;  5KLI C;  1L0L J;  1EG9 A;  3L75 G;  3VCP A;  1LTJ A;  1FQT A;  3RK3 C;  3HTK B;  2B87 B;  5KJ7 C;  1FBM A;  1JCD A;  5GTI E;  4QDC A;  1P84 H;  2FYU E;  2WVR A;  1Q2N A;  3SFE C;  4PV1 D;  2WPR A;  2HLO A;  3GF7 A;  4AYC A;  3KYQ A;  3BVH A;  3PJS K;  1SQV G;  3L72 D;  3L73 J;  4WWI A;  2Z4E A;  4I7Z B;  2ITA A;  3R2P A;  3LID A;  1OVR A;  1IK7 A;  1M1J C;  2ZYD A;  5KKZ C;  4OGQ D;  5CJ0 A;  1UUV A;  3CXH E;  1EDL A;  2YMY A;  4U3F D;  1NTZ G;  1L0N J;  3RK2 D;  1GDT A;  3H1K G;  2M5A A;  2W6B A;  2IPP A;  3L71 J;  4H44 D;  3H6P A;  2A45 I;  3VYI A;  1NTK K;  1L0L D;  2GA1 A;  2K9Y A;  1KYO H;  2BCC E;  3MUD C;  1PV3 A;  2O1K A;  4WY4 A;  2YVJ B;  3C1L A;  4HM0 A;  2A06 D;  4GOE A;  1G8J B;  1AVY A;  1T2K D;  1BGY G;  3KPE A;  2HMJ A;  3L4F A;  5KLI B;  4HM4 A;  2WSS H;  2Q7C A;  1S9K D;  4LLH A;  3L70 E;  3P32 A;  4OH8 B;  2KLV A;  1ZN5 A;  5BOK A;  1LTG C;  4RES B;  2W83 C;  3RK3 B;  3AE6 C;  5CBN A;  1N7L A;  1FZA A;  1N8R Q;  4NPE A;  4PJ0 H;  2N9B A;  1ZP0 C;  1YTZ I;  2YFJ A;  3BAT A;  2E42 A;  1L0N D;  5TIS E;  1Y8A A;  1J1E C;  3L71 D;  1O7N A;  3CCM P;  1EC5 A;  3GZX A;  3TGU G;  3WU2 H;  1N7S D;  4H13 C;  5KKZ B;  2XSO A;  1M90 Q;  3V4W A;  2B88 A;  3NTN A;  5GTH E;  3VMA A;  4WY4 B;  2YO3 A;  3H1I J;  1SFC D;  1G2C A;  2G3A A;  2FXM A;  1PP9 D;  2IFM A;  3MGN A;  1NU1 G;  1X0T A;  3NXS A;  1LT9 A;  5KAF E;  4Y99 B;  3VMX A;  4WBA A;  1YIT P;  1FE6 A;  3FWN A;  1S4X A;  4QDD A;  1KZU B;  3V2N A;  1OXZ A;  3GTE A;  1VQ6 P;  3LW5 H;  2ZYG A;  4BRY A;  2GBW A;  2RMZ A;  1YTZ T;  4L75 A;  4RKU J;  1GTW A;  5E79 E;  1DD4 A;  1L4A D;  1SQB G;  3P8C D;  1VM9 A;  1N86 A;  1TU3 F;  3VOP A;  1N73 C;  4L76 A;  2PGD A;  3GCE A;  2PAJ A;  3A2A A;  1BDD A;  1SQV D;  5APS A;  1WT6 A;  1KIL E;  1BCC J;  2I1J A;  1J1E B;  3JCU E;  1KQG B;  3H1I D;  3A3Y B;  1FDI A;  1ZME C;  2POH A;  1E79 H;  1GD2 E;  4H13 B;  1PGQ A;  1CSB A;  2BMR A;  2RN0 A;  1SQX J;  1G2C B;  5AVV B;  1JUN A;  2KYV A;  3CX5 D;  3V2P A;  1VQK P;  1RQV A;  3N4X A;  2PRR A;  3BRT B;  4YTP C;  2AXT E;  4EIJ A;  1LT9 B;  2FBW C;  5H2F E;  1G1J A;  3HE4 A;  1VQP P;  1NHL A;  3B4S A;  3KXD A;  4UB6 H;  2P10 A;  2QA4 P;  1KV4 A;  4IL6 H;  2R3S A;  3CC7 P;  1PIX A;  3GTS A;  3M9H A;  1K73 Q;  3BCC E;  4HJG H;  2AXC A;  2MJZ A;  1SQP G;  1L0L K;  4R4L A;  3Q2Y A;  2A45 H;  4MN4 C;  3MHV A;  1OW7 A;  5BU8 B;  4NBG D;  1JB0 J;  3T97 B;  4O9B A;  2XR8 A;  2DE6 D;  1BCC D;  5KAI E;  1MZ9 A;  1NYH A;  5AVX B;  2NZ2 A;  2OYH C;  3H25 A;  1N73 B;  2HMN A;  4GKG A;  2ZXE B;  1SQX D;  1NTK J;  3TGU D;  2VRS A;  1J1D C;  3CCU P;  1YQ3 C;  3H1H G;  2WSF H;  2HG5 D;  4XA4 A;  3IR9 A;  2E43 A;  1PGP A;  2M0B A;  1BE3 J;  1L0N K;  1NAF A;  1NKN A;  3KZI E;  1KYO E;  1FJP A;  4R4M A;  4RJT A;  2B89 A;  4UB8 E;  3II6 A;  2XZR A;  4M3L A;  3NMD A;  3Q1M A;  3H1L E;  1ZRT E;  4NBC D;  2Y9Z A;  2KS1 A;  2P67 A;  4C7N B;  2HPC A;  1G1I A;  1SQQ G;  1FZG A;  4CPG A;  3CD6 P;  4HYT B;  1O7G A;  4DT0 A;  2C9L Y;  3S1K A;  2IYO A;  4NBD D;  1JMB A;  4N78 D;  3H1J E;  5KLV G;  5TIS H;  4PJ0 E;  1JY3 P;  4IFD K;  1YJN P;  2KOG A;  3N7N A;  2Q9I A;  1FC2 C;  1NH4 A;  1UII A;  3NFQ A;  1PGJ A;  2Z5I A;  1AFO A;  5C39 A;  4ZKU A;  1BE3 D;  2GUV A;  1T3U A;  1JY2 N;  1J2J B;  5AEW A;  3F89 A;  2B9B A;  3TNU A;  2KIK A;  4P1C H;  2ZJS E;  3RK3 D;  3VP9 A;  2Q5U A;  1LNQ A;  5KJ7 D;  2HMO A;  1J1D B;  2NPS A;  3L74 E;  2H7H A;  1KTM A;  3VMZ A;  4KHX A;  4EOT A;  3OA7 A;  3L37 A;  1ZR2 A;  1JY3 N;  2L5G B;  3V4Q A;  5APU A;  3V6I A;  3IF4 A;  2HPC B;  3G3Z A;  3VN0 A;  3HUS C;  1KQF B;  1T3J A;  4IFM A;  1VQN P;  1KIL C;  3CI9 A;  1EXJ A;  3W67 A;  4DZO A;  1X9V A;  5APT A;  5AW3 B;  1IC2 A;  3B5N A;  1SQP D;  4GDO A;  1H0T A;  1ZR4 A;  4WY4 D;  1KIL A;  2FYU G;  2WT7 A;  3VMI D;  1OX3 A;  1QGK B;  2YFI A;  1MUU A;  4WVZ A;  1FAV A;  1KMI Z;  2WTY A;  1U57 A;  2IDB A;  2OAR A;  3SWF A;  2O3J A;  3JCU H;  1Q90 C;  3D6Y A;  2WWW A;  1LP1 B;  4K35 A;  1FZC A;  1RE3 C;  3GKE A;  2O1J A;  2AEJ A;  1OWA A;  3GW6 A;  1KQL A;  5CHX A;  4U3F E;  1OW8 A;  4H0L B;  4B86 A;  3AE5 C;  2N1T A;  2QM7 A;  3E1I A;  4JF7 A;  2BCC G;  1L0L E;  2R44 A;  2K88 A;  1LTJ C;  1W2E A;  1X22 A;  2KXP B;  3CLQ A;  3AE8 C;  1SQX K;  3AEC C;  4PD4 D;  1WQL A;  2A06 E;  2E76 C;  2E75 C;  3EN1 A;  3AE9 C;  5AW6 B;  3EWK A;  2R3C A;  2WZ7 A;  2ZAE B;  3BRV B;  4UB6 E;  3AED C;  3CMA P;  3HRN A;  4EDF A;  3D70 A;  2J58 A;  4IL6 E;  5AW5 B;  1JTH B;  2YKQ A;  1SQQ D;  1S9K E;  3B5N B;  3HUS B;  5AVZ B;  1RF0 C;  1K05 A;  3L70 G;  3R4Y A;  3RL0 C;  1GU4 A;  2B24 A;  4NBA D;  1KIL B;  4H13 D;  1NGM B;  2Y0E A;  5CCG C;  4EI2 A;  2WT7 B;  5KAI H;  2NVG A;  1YBK A;  2FXP A;  1RF0 A;  3L73 E;  2YXQ B;  1KB9 D;  1KOR A;  1NTM E;  5CCG A;  1L2P A;  3O6Q A;  2OGU A;  5AVQ B;  1VQL P;  3AEG C;  2I1K A;  1L0N E;  4HM3 A;  4GT1 A;  2RH0 A;  1ZXG A;  4D6T J;  3C8V A;  4WY4 C;  3I5C A;  2N1T B;  1QL2 A;  5AW0 B;  2ZYL A;  3W68 A;  4U7J A;  5AVU B;  1GMJ A;  2IBZ I;  2YFL A;  3KZI H;  3FOU A;  2HOD B;  3H32 B;  3TSI A;  1RIE A;  4UB8 H;  1JOC A;  2GM4 A;  3GMA A;  2E4Q A;  3C9I A;  5CMZ A;  4HM6 A;  3P8M C;  4Y99 C;  1U7M A;  2O01 H;  2HMK A;  1LTJ B;  2BAS A;  3TF5 A;  3GL2 A;  3I56 P;  1T6A A;  1EZV I;  1FZB A;  1AVO A;  2E76 B;  2WSC J;  2E75 B;  2XND H;  1PP9 J;  4QUP A;  1ZOY C;  3QWO C;  1LJ2 A;  2IBZ D;  3WMM 0;  1KQS O;  1S1C X;  3RL0 B;  1DEB A;  3PRJ A;  5AVW B;  3L75 J;  1HGZ A;  3O6Q B;  1RY3 A;  1O7W A;  1CZQ A;  4D6T D;  3U59 A;  1DX7 A;  1M56 D;  3N0Q A;  1NKZ B;  3B71 A;  2KUB A;  2JKV A;  1EZV D;  2XRX A;  2Q3W A;  2OYO A;  2R5D A;  2JZA A;  1O7P A;  2QJK C;  3SSU A;  2QG4 A;  1LTI C;  2M5A B;  4IL6 X;  4TT3 H;  3GOB A;  2M8R A;  1JO5 A;  3H1I E;  4QUQ A;  1NO4 A;  2W8Z A;  3CXH D;  1SQV J;  5BU5 A;  3P7K A;  4QCK A;  3ZDM A;  1YIJ P;  4HM7 A;  3CWB E;  2L91 A;  3RL0 g;  1LT9 C;  2Z5H A;  2KSE A;  1NTZ J;  2BCC D;  1AQT A;  2WSE H;  3H1K J;  5AW7 B;  1A02 J;  2K9J A;  2C9N Y;  2JR8 A;  1FDM A;  2Q6Q A;  2E5T A;  3JC2 2;  3L75 D;  1KD1 Q;  1GK6 A;  4JBZ A;  1FOS F;  3BCC G;  1Q82 Q;  2IFN A;  3WUU A;  1BGY J;  1U7J A;  1HVV A;  2WIT A;  3CCQ P;  4W7Y A;  3CPW O;  2CPS A;  1PPJ E;  1EDK A;  3CX5 I;  4HB1 A;  4HH2 A;  1BCC E;  2HML A;  3KHU A;  2W6J H;  1E5W A;  1RQU A;  2OYI C;  1Y9B A;  2CKF A;  1SQQ K;  3TYY A;  1DIP A;  1MFT A;  1OW6 A;  3I55 P;  2QIW A;  1M8O B;  2D2C C;  2HFE D;  2OYI A;  3Q5P A;  1VF5 C;  4W7Z A;  1SQX E;  2QJK B;  4GOD A;  3C0D A;  4HM2 A;  1NTZ D;  4JQ0 D;  2GBX A;  3E1R A;  2LXC B;  3H1K D;  5B66 E;  1ULJ A;  2V4H A;  5EFW B;  3TGU J;  3V2R A;  2ZVO B;  3MIW A;  2FY8 A;  2J59 M;  2K9J B;  1O7H A;  4EMJ B;  3F5H A;  2IX7 C;  3H1L G;  5DJU B;  1BGY D;  1HWT C;  1T8Z A;  1WMK A;  2QPZ A;  1IFM A;  2V7Q J;  1VQ5 P;  4H0L D;  4BRY B;  2FFD C;  3HE5 A;  2B1X A;  1NU1 J;  2IZ1 A;  3H1J G;  4C7R A;  1PFI A;  1MV8 A;  1LT1 A;  3M9B A;  2FFD A;  1ZLL A;  4YPC A;  1QLE D;  2JDI H;  1NTK E;  3A0H H;  1PGO A;  1M57 D;  4OVN F;  1BDC A;  3FWL A;  2C0W A;  3D89 A;  3CCE P;  2XSH A;  1PL5 A;  3G4S P;  1JNM A;  5CCH C;  5M1B A;  2OYI B;  3B5N D;  1BE3 E;  1SQB J;  1USD A;  1KIL D;  2H89 C;  2D2C B;  2P7J A;  5CCH A;  3FXE A;  1VF5 B;  1IO4 A;  2KZJ A;  1EDI A;  2JWA A;  1QL1 A;  3L74 G;  1LTA C;  3GHG A;  2YKP A;  3AE3 C;  3KDP B;  1VQ7 P;  4GIF A;  3UIA A;  1XTC C;  2FYN C;  1Q81 Q;  3HE4 B;  2M3E A;  4WB4 A;  3WUV A;  1KN7 A;  2WPQ A;  2E4P A;  3AE7 C;  1P84 I;  3HD7 C;  1NU1 D;  2W27 A;  1Q90 D;  2XU6 A;  3A0B E;  2IZ0 A;  4N6J A;  2YIU C;  2N1T D;  2YKO A;  1QEX A;  3HD7 A;  5AVT B;  1S3J A;  2WQY C;  2QVA A;  4AQR D;  4ZKP A;  3MD0 A;  2FFD B;  2Q3I A;  3A7O A;  4ZMD A;  2PP6 A;  1SQP J;  2Q3E A;  1W2B O;  1SQB D;  4L74 A;  1H88 A;  2H88 C;  1AQ5 A;  1N2D C;  2P2U A;  1P84 D;  3MP7 B;  3DQY A;  3S4R A;  3AEB C;  2E76 D;  2E75 D;  2NPS C;  1Y47 A;  2HR3 A;  2W90 A;  4H0L C;  2MKV A;  4QUR A;  1FOS E;  3CCS P;  3KQG A;  1URQ C;  3CCL P;  3RL0 D;  4U3F G;  5AVY B;  2BEQ D;  4NBE D;  5CCG D;  3CX5 H;  1JCC A;  1GW3 A;  3D71 A;  1URQ A;  2OTL P;  1SQV K;  3VTP C;  5KTB A;  1L0L G;  2HYN A;  1QX8 A;  2KS1 B;  3H1H J;  4HM8 A;  3CC4 P;  1KYO D;  2A06 G;  2FYN B;  3VMH D;  1S5L E;  3B5N C;  4KJM A;  1NTZ K;  3H1L D;  1ZRT D;  2YNY A;  3OW2 O;  3HD7 B;  4AUW A;  3LIE A;  2WPS A;  1YHQ P;  1Q7Y Q;  1YJW P;  3GLM A;  3PLN A;  2YIU B;  1JMM A;  2NVF A;  2A45 G;  3M91 A;  3L35 A;  1GW4 A;  3PH0 A;  1A02 F;  1FZF A;  5APY A;  4NB8 D;  1SQQ J;  1FDO A;  2N9Y B;  3L73 G;  2B87 A;  1RE4 C;  4HM5 A;  1FZC C;  4GOF A;  1KB9 E;  1NTM G;  4HKV A;  2YMK A;  4PD4 I;  4KT0 J;  4N3Y B;  3L72 E;  1VL2 A;  1L0N G;  2R5B A;  1EDJ A;  3TNU B;  1RE4 A;  2J5U A;  2Y0D A;  2N1T C;  2NUK A;  5KLV J;  4JYB A;  1VQ4 P;  2ZVN B;  2NPS B;  5B66 H;  3G6E P;  3H1H D;  1USE A;  2BEZ F;  1IFJ A;  2P1J A;  3AEA C;  1LTT C;  1URQ B;  1GZL A;  1Q86 Q;  5HL4 A;  1HUC A;  3QH9 A;  3RGU A;  1NJI Q;  3EQ2 A;  1KB9 I;  3CL3 D;  3OAK A;  1FJK A;  3M0D A;  3AEE C;  1IJD B;  2JO1 A;  2Q1K A;  2BMQ A;  3AE1 C;  5AW1 B;  3Q5R A;  3ITK A;  2QM8 A;  1H0T B;  5DJT B;  2IBZ E;  2E74 B;  5B5E H;  2ZFC A;  1VCK A;  1QVF O;  3VCA A;  2G8Y A;  1FZE A;  2QRX A;  3CCV P;  5KLV D;  3AE4 C;  1NU1 K;  1IFP A;  1R5L A;  5APV A;  4D6T E;  3M0A A;  1S5L X;  3D6Z A;  5KJ7 A;  3A0H E;  1FZC B;  3L71 E;  1EZV E;  1LTS C;  3TK1 A;  1HF9 A;  3A5T A;  1NAY A;  2FYU J;  3Q5S A;  2OTK E;  2PFX A;  4QDF A;  1K9M Q;  2JP3 A;  3GB4 A;  2LXB A;  3H1I G;  4YXD C;  1AA0 A;  1NWQ A;  3RBX A;  1NTM J;  1UUW A;  3AZC A;  4K3A A;  1SQB K;  3CWB G;  4P1B H;  3CC2 P;  1IK9 A;  1M1J A;  1SVF A;  4ASW A;  1XTG B;  1PZQ A;  3EQQ A;  4XE5 B;  3K5B A;  4DCK A;  1PP9 E;  1HBW A;  3A0B H;  1W5C E;  3U1A A;  3FXD A;  3G9R A;  1FU1 A;  4HJL A;  2WSF J;  1X79 B;  2YXR B;  2BCC J;  3L75 E;  1ZW0 A;  2ZT9 C;  1G8K B;  2D2C D;  3MUD A;  1VF5 D;  1GL2 C;  4TLF A;  1KC8 Q;  3CCJ P;  3CXH I;  1OZH A;  1K04 A;  2FKW B;  2QJP C;  1MFZ A;  2FYZ A;  4EYY Q;  1PPJ G;  1H89 A;  1GL2 A;  3GG2 A;  2FYU D;  3P8C E;  1SP4 A;  3U1C A;  3L70 J;  1BCC G;  3L73 D;  3AEF C;  4NBH D;  1NDO A;  1NTM D;  2KI7 B;  1SQP K;  4QDF B;  1SQV E;  2KB7 P;  1IFI A;  2UWJ E;  1YQ4 C;  1SQX G;  1VQ9 P;  2IYP A;  2H43 A;  5CXM A;  3G71 P;  1VQO P;  3PHL A;  1NTZ E;  3BAS A;  3H1K E;  1HGV A;  1M1J B;  4AAY B;  3CX5 E;  4PD4 H;  1OMI A;  1S5L H;  2DW3 A;  4L73 A;  3S9O A;  4PV1 C;  1DEE G;  3M06 A;  2K1A A;  2CK3 H;  2Y0C A;  4ASV A;  4LC1 A;  1IZN B;  1BGY E;  3CWB J;  2LKM A;  5CCH D;  1DD3 A;  2KZI A;  4OGQ C;  1BSN A;  3L70 D;  3RK2 C;  2ZT9 B;  1R8E A;  4XFJ A;  1EQ7 A;  2JO6 A;  4BXL A;  4H44 C;  5AW4 B;  2ZXX A;  1GL2 B;  2K3R A;  1JM1 A;  1KB9 H;  2WMM A;  4HM1 A;  2QJP B;  4DJG A;  4NPF X;  4JPZ B;  1HH0 A;  5APW A;  5APX A;  1GK4 A;  3GF3 A;  1NTK G;  3WUT A;  1EXI A;  2QE7 H;  3T97 A;  1T2K C;  3IN6 A;  1R5S A;  1VQ8 P;  3HD7 D;  4JYC A;  5AEU A;  3TGU E;  1BE3 G;  2OTJ P;  1H8A A;  5KLV K;  1AJY A;  1N73 A;  1WRG A;  1OVU A;  1AV1 A;  2R32 A;  3CCR P;  4Z1M H;  3CWB D;  1QVG O;  3PTZ A;  1VQM P;  2KSJ A;  3GL0 A;  2QJY C;  1Z56 A;  2XNX A;  4I2L C;  4PV1 B;  1NU1 E;  2NPS D;  1SJG A;  3VMG D;  1N7S C;  1URQ D;  3MZW B;  4C7N A;  4OGQ B;  4N78 E;  4OWF A;  3IAO A;  5GTI H;  2JJL A;  3RK2 B;  1LGH B;  5B5E E;  2KP8 A;  1N7S A;  4H44 B;  4IFF A;  1VPC A;  1SFC C;  3BCC J;  1PPJ D;  2H8P D;  4I6M C;  4I1L A;  1SQB E;  1P84 E;  1CI6 A;  3V5B A;  1SFC A;  3GHG C;  4ZNC A;  1YYC A;  4W80 A;  4IOI H;  3CXH H;  1OVV A;  3RK3 E;  2XV5 A;  2FYU K;  4HKZ H;  2E74 D;  4NB9 D;  4Y28 J;  1KFM A;  1DH3 A;  3GZY A;  2XDJ A;  5APQ A;  2WSC H;  2OYH A;  4RO0 A;  1NTM K;  2SPZ A;  3IFM A;  2GUS A;  1FS0 E;  1L4A C;  1SS1 A;  1HJB A;  3MTU E;  1ZV8 A;  1M1K Q;  2NUM A;  1MKM A;  2XKM A;  3PP5 A;  2CPB A;  1OIP A;  3VP8 A;  4AIV A;  1YI2 P;  2KLU A;  3HE5 B;  2QJY B;  1L4A A;  2AEM A;  2C0X A;  3BCC D;  1O7M A;  1JY2 P;  3O8Z A;  1JY2 O;  1SQP E;  5AW2 B;  2K37 A;  3H1L J;  5AW8 B;  4BWN A;  1N7S B;  2O01 J;  3V2Q A;  3ABV C;  1RHZ B;  2KNC A;  5AVS B;  1OFC X;  5L8R J;  2I8D A;  2RKL A;  4QMA A;  3SFD C;  5CJ4 A;  1CI6 B;  2NRG A;  1HJ0 A;  1GU5 A;  1HTL C;  1SFC B;  3OJA B;  1KYO I;  2Y9Y A;  3L72 G;  3RBZ A;  2DE7 D;  1NTK D;  5AVR B;  1JY3 O;  3H1J J;  1X8Y A;  3E7K A;  3AE2 C;  3JSV C;  1IFD A;  1RF1 C;  3GHG B;  4A7P A;  1M7L A;  1LP1 A;  3H1H E;  2OYH B;  3WU2 E;  1S2E A;  2AEF A;  2JWD A;  1IFN A;  2NWF A;  2OQQ A;  5TJH A;  1RFS A;  1RF1 A;  1NYK A;  5GTH H;  1ULI A;  2LR2 A;  3SWY A;  1LWU C;  3CME P;  1RH5 B;  1D7M A;  1S72 P;  4PD4 E;  1SLQ A;  3L74 J;  1LWU A;  1L4A B;  1VDF A;  1UIX A;  1BSH A;  5KAF H; 
#chains in the Genus database with same CATH homology
 2E74 C;  4QDF A;  2WPV B;  1SQQ E;  2JP3 A;  3GB4 A;  4YXD C;  1YQ3 C;  1UUW A;  4NBB D;  3AZC A;  3FGA D;  2WSE J;  4P1B H;  1PPJ E;  5KLV E;  2NVE A;  3EQQ A;  1BCC E;  1KYO E;  2HML A;  4R4M A;  1PP9 E;  1RQU A;  4I7Z C;  1Y9B A;  3G9R A;  2CKF A;  3Q1M A;  3H1L E;  1ZRT E;  4NBC D;  4HJL A;  1DIP A;  2BMO A;  1OW6 A;  2WSF J;  3LW5 J;  2QIW A;  3Q3D A;  3L75 E;  2D2C C;  2ZT9 C;  1G8K B;  2D2C D;  3Q5P A;  1VF5 C;  2ZT9 D;  1SQX E;  3C0D A;  1VF5 D;  4HM2 A;  2QSI A;  1O7G A;  2GBX A;  1K04 A;  1ULJ A;  2QJP C;  4NBD D;  2HMM A;  2I7F A;  3H1J E;  2DE5 D;  1O7H A;  3AEF C;  4NBF D;  4NBH D;  1NDO A;  4EMJ B;  5KLI C;  4QDF B;  1SQV E;  1EG9 A;  3VCP A;  5AEW A;  1WMK A;  1YQ4 C;  2QPZ A;  2V7Q J;  1FQT A;  4P1C H;  4H0L D;  5CXM A;  2B1X A;  1NTZ E;  2HMO A;  3H1K E;  3L74 E;  1KTM A;  4AAY B;  4QDC A;  3CX5 E;  2FYU E;  1OMI A;  3S9O A;  4PV1 C;  3SFE C;  1NTK E;  4PV1 D;  3GF7 A;  3D89 A;  2XSH A;  1PL5 A;  4I7Z B;  5M1B A;  1KQF B;  1DD3 A;  1BE3 E;  1IK7 A;  4OGQ C;  5KKZ C;  4OGQ D;  1UUV A;  3CXH E;  2H89 C;  1EXJ A;  2D2C B;  2ZT9 B;  1R8E A;  4XFJ A;  2JO6 A;  1VF5 B;  4H44 C;  4GDO A;  4H44 D;  1JM1 A;  3AE3 C;  4HM1 A;  3VMI D;  2K9Y A;  2BCC E;  2FYN C;  2YFI A;  1PV3 A;  3GF3 A;  1EXI A;  2YVJ B;  1KMI Z;  2E4P A;  4HM0 A;  1U57 A;  2IDB A;  3IN6 A;  1G8J B;  3AE7 C;  1Q90 C;  3D6Y A;  1Q90 D;  5AEU A;  3TGU E;  2HMJ A;  2YIU C;  4HM4 A;  3Q5S A;  1AJY A;  3GKE A;  3L70 E;  2WQY C;  4U3F E;  1OW8 A;  5BOK A;  4H0L B;  3AE5 C;  3AE6 C;  4Z1M H;  1L0L E;  1ZP0 C;  3GL0 A;  2YFJ A;  2H88 C;  3AE8 C;  2QJY C;  3AEC C;  1WQL A;  3DQY A;  3AEB C;  2E76 C;  2A06 E;  2E75 C;  3EN1 A;  4PV1 B;  3AE9 C;  2E76 D;  2E75 D;  1NU1 E;  3EWK A;  1O7N A;  1SJG A;  3GZX A;  4H0L C;  2MKV A;  3AED C;  4QUR A;  3VMG D;  3D70 A;  1K05 A;  3R4Y A;  2B24 A;  4H13 C;  4OGQ B;  2XSO A;  4NBA D;  4H13 D;  3IAO A;  1NGM B;  2BEQ D;  4NBE D;  2NVG A;  2FXP A;  3D71 A;  4H44 B;  3L73 E;  1KOR A;  4HM8 A;  1NTM E;  3O6Q A;  1SQB E;  2G3A A;  1P84 E;  3VMH D;  3AEG C;  1L0N E;  4HM3 A;  3C8V A;  3RK3 E;  2E74 D;  4NB9 D;  3GLM A;  4Y28 J;  2NVF A;  3GZY A;  4QDD A;  2ZYL A;  4U7J A;  1GMJ A;  2YFL A;  3FOU A;  3GTE A;  4NB8 D;  1RIE A;  1FDO A;  2GBW A;  3GMA A;  2E4Q A;  4HM5 A;  4RKU J;  1KB9 E;  4HKV A;  4HM6 A;  1DD4 A;  2YMK A;  2NUM A;  1VM9 A;  1MKM A;  1TU3 F;  4KT0 J;  2HMK A;  3L72 E;  1VL2 A;  3GL2 A;  3GCE A;  4AIV A;  2J5U A;  2NUK A;  2E76 B;  2WSC J;  2E75 B;  1KIL E;  1KQG B;  1FDI A;  1O7M A;  4QUP A;  1ZOY C;  1SQP E;  2BEZ F;  1ZME C;  3AEA C;  1S1C X;  2O01 J;  5HL4 A;  3ABV C;  4H13 B;  2BMR A;  5L8R J;  3SFD C;  1O7W A;  3AEE C;  1HJ0 A;  3N0Q A;  1RQV A;  2JO1 A;  3B71 A;  4YTP C;  2DE7 D;  2XRX A;  2Q3W A;  2FBW C;  2JZA A;  2BMQ A;  3AE1 C;  3AE2 C;  1O7P A;  2QJK C;  2P10 A;  3Q5R A;  4IL6 X;  4TT3 H;  3GOB A;  1PIX A;  3GTS A;  3BCC E;  3H1I E;  4QUQ A;  3H1H E;  4R4L A;  3Q2Y A;  4QCK A;  2IBZ E;  2NWF A;  2OQQ A;  1OW7 A;  2E74 B;  1RFS A;  4NBG D;  1NYK A;  1VCK A;  4HM7 A;  3CWB E;  1ULI A;  1JB0 J;  3T97 B;  3VCA A;  2G8Y A;  2XR8 A;  2DE6 D;  3AE4 C;  3RL0 g;  4PD4 E;  1S5L X;  3D6Z A;  1NYH A;  3L71 E;  2NZ2 A;  1EZV E;  1HF9 A;  1UIX A;  3H25 A;  2HMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...