2ZT9D

Crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
pubmed doi rcsb
molecule tags Photosynthesis
total genus 33
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2008-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2zt9D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2zt9D02
2BMRA 4PV1C 3EN1A 1G8KB 1VCKA 2A06E 3GCEA 3EQQA 4U3FE 2GBWA 4H44D 4HM0A 2DE7D 1BE3E 2NUMA 3VMID 2NVGA 3C0DA 3L70E 3CXHE 2FYNC 2FYUE 1O7HA 1NTKE 4HM1A 4HM8A 2NUKA 3VCPA 4HKVA 2YIUC 5AEUA 2YMKA 4NB9D 1KB9E 2XRXA 1SQXE 4HM2A 1SQQE 2HMMA 3GTSA 2DE6D 3GKEA 1O7GA 2XR8A 4NBGD 1VM9A 4QCKA 4H44C 3VMGD 5CXMA 1WQLA 2B24A 2IBZE 2ZT9D 3H1IE 1RIEA 1RFSA 3GB4A 3H1JE 2E75D 4QDFA 4I7ZC 2NVFA 1ULJA 2QJYC 1PPJE 2NVEA 4QDDA 2HMJA 1O7PA 2HMKA 2E76D 3GTEA 1G8JB 1UUVA 2XSOA 4H13C 1L0LE 3H1HE 2Q3WA 2YFJA 1EG9A 2HMOA 3BCCE 1NU1E 3D89A 4HJLA 1JM1A 3TGUE 4P1BH 1L0NE 3DQYA 4AIVA 2E74D 2E75C 2QJKC 5HL4A 2I7FA 1NTZE 3H1LE 2GBXA 2B1XA 1SQPE 2E76C 3N0QA 4HM6A 1VF5D 4HM4A 3GZYA 1PP9E 3FOUA 3L73E 1NTME 4QUQA 5KKZC 4NBHD 1NDOA 4NBCD 1Q90C 1O7NA 4NB8D 3GL2A 3CWBE 5BOKA 1SJGA 4NBED 4HM3A 4H0LD 2E4QA 2E4PA 2ZT9C 3VCAA 1FQTA 2JO6A 2CKFA 2D2CD 1VF5C 3GZXA 3L75E 2YFIA 4OGQD 2BMOA 3L74E 2YFLA 3L71E 4NBFD 4QUPA 1O7MA 1SQBE 3GOBA 2HMNA 1ZRTE 1UUWA 3GL0A 2BMQA 4QDFB 1NYKA 4HM7A 4PD4E 4NBDD 4PV1D 4H0LC 4NBAD 2HMLA 1EZVE 4NBBD 2D2CC 4EMJB 2NWFA 2YVJB 3H1KE 4OGQC 4P1CH 1P84E 3AZCA 2JZAA 2E74C 3CX5E 5AEWA 2XSHA 3VMHD 5KLVE 4QURA 1O7WA 4HM5A 4H13D 2ZYLA 1BCCE 2QPZA 2QJPC 3L72E 1KYOE 4QDCA 5KLIC 4AAYB 2DE5D 1SQVE 1ULIA 2BCCE
chains in the Genus database with same CATH superfamily
2BMRA 3VP8A 1X0TA 1BE3J 3KZIE 2NRGA 1H8AA 1VDFA 1L0NK 3H1HJ 4HM1A 3GF3A 5AW2B 1EXIA 1NTZK 4NB9D 2E43A 1N7SA 3II6A 2C0XA 3VTPC 4NBGD 3B5ND 2OGUA 1YQ3C 2QE7H 1M57D 2KK7A 1BSHA 3C8VA 2QJYC 2NVFA 1AFOA 5KTBA 2P7JA 3OAKA 1KILB 1M7LA 4IL6X 4LC1A 2D2CB 1RE3A 1L0NE 1SQBJ 5B66H 1PGQA 3B5NA 1NTZE 1OVRA 2PFXA 1LTJB 2QJPB 5KLIB 3AE4C 3AE6C 1FAVA 1AA0A 4NB8D 3JSVC 2JO6A 2CKFA 2M3EA 3D71A 1VF5C 2IZ0A 2WT7A 3VMAA 2BMOA 1R5LA 4GOEA 5GTHH 3NTNA 3HD7D 1DIPA 1GK6A 1NYHA 1YJWP 4I6MC 1KILC 4PD4E 1OWAA 2HLOA 5AW7B 2D2CC 5AVTB 3RBXA 4EMJB 3M0DC 1ZN5A 5APWA 2O01N 5E79E 1O7WA 2ZYLA 1BE3G 1LTSC 1LTJC 2QJPC 5KLIC 3L37A 1OXZA 2WTYA 1JY3N 3H1HG 1QL2A 3HD7A 1BE3E 2NUMA 3RL0g 2WZ7A 1BDDA 4GIFA 1KB9E 5BVZA 3CLQA 4HM2A 3RK3C 2HMMA 2DE6D 1JEKA 2O1JA 1NTMK 3KPEA 1SS1A 2XR8A 4H44C 1DEEG 1OFCX 3CXHD 1HGVA 3H1IJ 1HUCA 2ZT9D 3C1LA 5CCHD 3B71A 3CWBJ 1JY2N 2Q1KA 2E76B 4PJ0E 1SQBG 3D89A 2WWWA 4IFFA 3S4RA 1NJIQ 5BU8B 2HFED 4L74A 5CCHA 1DEBA 1NTME 1S5LX 2BEZF 1SQVK 3LW5H 2Y0DA 2JDIH 5AW0B 3D70A 1LT9A 5APQA 1T2KC 4OGQB 1USEA 3NMDA 2OYHA 3GL0A 3HE5A 1SQQK 4Y99B 4YPCA 5B5EH 3D6ZA 2YNYA 1IK9A 4IFMA 1L4AD 5KAIE 3CC4P 3A0BE 4P1CH 1X9VA 3CCJP 1SFCD 5TJHA 3VMHD 2H88C 2CPSA 1PGJA 4GOFA 1SQVE 1MUUA 2BCCE 4NPFX 1AQTA 2FYUJ 1SLQA 2KUBA 3CC2P 2P10A 2ZVNB 3WUVA 2KS1A 1L4AA 1SQQE 1LTGC 1X8YA 3GKEA 1SFCA 4QCKA 4Y99C 3L70D 4BRYA 3PRJA 3H1IE 3CWBG 2ZJSE 3WU2H 3MTUE 3H1JJ 4C46A 5DJUB 1FJKA 1JY3O 2JKVA 3KQGA 1ZR2A 4UB6E 3U1CA 3ZDMA 4P1BH 4IL6E 1WT6A 1H0TB 3CCEP 4LLHA 1FZEA 1T3JA 3FOUA 2Q5UA 4NBCD 2FYZA 3GL2A 3LIDA 3H1LD 1CI6B 2FYUK 1PP9D 2KYVA 1FDMA 2KZJA 2WVRA 3Q2YA 1NKNA 2R5DA 3WUTA 3VMYA 3TDKA 1LT1A 3AE8C 2NWFA 3H1KE 3CX5E 1CZQA 2Z4EA 3T97B 3M9QA 3M9HA 3AEAC 1ZOYC 1IZNB 2OARA 2FYUG 1M8OB 3MUDA 2W6JH 3VN0A 1VCKA 2R32A 4HM0A 2FYUE 1BGYD 2AEMA 1NAFA 1IFIA 2O01H 2BASA 3M91A 2GM4A 2NPSB 4WVZA 1XTGB 4LGDE 1WQLA 2G3AA 2L91A 1PV3A 2B89A 3VOPA 2J59M 3H1JE 4YTPC 1FZFA 1ZLLA 1IFMA 1Q2NA 1VQ5P 1AVYA 1W2EA 1VQ9P 2QRXA 1KYOI 3G71P 3NFQA 4HM4A 1YQ4C 3NXSA 4RJTA 5KAFH 4OH8B 1N73A 1GU5A 2XU6A 1J1EC 1IJDB 5AVZB 1HF9A 1S5LE 1N7SB 5CHXA 1IO4A 3CCRP 4AQRD 2QVAA 3AEFC 2AEFA 3L74E 2B88A 2YXQB 3QWOC 5AVYB 1UUWA 1NGMB 4EDFA 4EIJA 2QEXP 1G2CA 4WY4D 5AVWB 3GLMA 2ZXEB 5KLVJ 2WSEH 2Y9ZA 2OQQA 3B8EB 3TSIA 1LWUA 1KYOH 3B5NB 4HYTB 2IX7C 1VQKP 3VP9A 2YO2A 3M0AA 1EZVD 1EDIA 1FU1A 2GA1A 1N7SC 3EQ2A 3VMID 1FE6A 4BWNA 1A02J 1O7HA 1EDLA 4WY4A 1GK4A 2YMKA 3A5TA 2Q7CA 2L5GB 2XNXA 1RF0A 3L35A 2WT7B 1OW8A 2Y9YA 4W7YA 1YJNP 5EFWB 2P58A 1VQOP 4WBAA 1PGOA 3H1LJ 2DW3A 2V7QJ 1FC2C 3O6QA 3V2QA 1PP9J 1RFSA 4KHXA 3AE5C 4GT1A 2OTJP 2WSCJ 4PD4I 1UUVA 3B5NC 2HG5D 1JM1A 3V2NA 3GF7A 1KORA 2ITAA 1KILE 2E74B 2FY8A 3N0QA 5AW6B 5KLVK 2OYOA 1Q81Q 2WSFH 1NU1D 4QUQA 1HGZA 1IFDA 3P8CE 1RY3A 3CI9A 2MKVA 1SJGA 2O3JA 1BGYJ 2XDJA 4IFDK 4H0LB 2R3SA 1KB9I 1KZUB 1KQGB 2KSJA 2YIUB 3L70G 3L75E 5AVSB 4AUWA 2YFIA 3FWLA 2YFLA 2VRSA 4QUPA 1RF1A 4D6TE 4ZNCA 5KLVG 4PD4H 1OW7A 1M90Q 5AVRB 3L4FA 3RK3E 1R5SA 3V4WA 5KLVE 5AEWA 2E74C 1ZP0C 5E79H 1RQVA 1ZRTD 1GZLA 3HD7C 4M3LA 1IFJA 2KNCA 4UB8E 3EN1A 5CBOA 3FGAD 1JCDA 2JR8A 5K5GB 1EDKA 1NTKE 3SWKA 1JTHA 2YIUC 2OYIA 2PRRA 3H1LG 1KB9H 3U1AA 3RBZA 1PP9G 3A0HE 1H89A 2R44A 1AQ5A 2IBZE 2B24A 5C39A 3HE5B 3P8MC 2JJLA 1SQXD 2E75D 4QDDA 2FXOA 3PLNA 1XTCC 2XKMA 4PJ0H 1QVGO 1MKMA 1S9KE 5M1BA 4ASVA 3Q5SA 1Q90D 3WMM0 5CCHC 2E5YA 4AIVA 4A7PA 1PPJD 2AXTH 4HM6A 1VF5B 3AE9C 3BCCD 1BGYG 5KKZC 4NBHD 1L4AB 2M8RA 1T3UA 5APSA 3FX0A 3EWKA 3L72J 3SSUA 1ZMEC 4HH2A 3L73D 1QVFO 1U7JA 3IR9A 2JO1A 1Q86Q 1NYKA 3TNUB 1Y47A 4PV1D 5AVXB 2HMLA 5KAIH 3A0BH 3CPWO 3L71D 5CMZA 1BCCJ 3BRTB 2RKLA 3GHGB 1L4AC 3RK3B 1FOSE 1WRGA 4H44B 1SFCC 2H89C 2WITA 2BEQD 3GG2A 4GKGA 3RL0D 2A06D 2NZ2A 2QIWA 2HMKA 3H1HE 3GHGC 1SQBK 4UB6H 4ZKPA 2Q3WA 1PFIA 1FZBA 3M06A 3CX5I 4IL6H 1H88A 3V6IA 1RQUA 1EZVG 3V2RA 1LP1A 4YXWH 1N2DC 2M5AA 1CW5A 2N9YB 2Q9IA 3TGUD 3L72G 3L74D 2N9BA 2QG4A 1SQPD 4ZKUA 1NH4A 3MIWA 3AE3C 1SQBE 1GW4A 2WSSH 2BMQA 5CCGC 4CPGA 1VQPP 3C9IA 1BCCG 3IFMA 3MUDC 5AW3B 2CPBA 3CX5H 2XSHA 1YI2P 1BCCE 2RH0A 3G6EP 1P84D 2MJZA 1NU1G 3BCCJ 2Y0EA 4N78E 4U3FD 3H32A 3CMAP 1S2EA 3JCUE 4L76A 3SWYA 5APUA 3L73J 1G2CB 2V4HA 3CL3D 4TT3H 2J58A 2WQYC 1OX3A 3Q1MA 4KT0J 1JOCA 2C9LY 1LWUB 1N73C 1YTZI 2W6BA 1KQFB 1SVFA 1S3JA 3L71J 2ZXXA 2WMMA 1QL1A 1K73Q 3ITKA 2HPCA 1L0LD 1KQLA 2G8YA 4WY4B 1PL5A 1O7NA 2W8ZA 3A3YB 3CWBE 1S5LH 2HODA 2E4QA 1P84I 2R3CA 3O6QB 3OW2O 1VPCA 5APVA 4TLFA 3OA7A 4XE5B 1LWUC 1YHQP 2YVJB 2HYNA 1JY2O 1OMIA 1PPJG 4H13B 3KHUA 1NTKD 4WY4C 1OW6A 1RF0C 3BCCG 2XZRA 3A7OA 2WPSA 5H2FE 3RK2D 1KYOD 2IBZD 5AEUA 1K9MQ 3TGUJ 1P84H 2KXPB 4K35A 1DX7A 3L73G 2QSIA 1RF1B 3H6PA 2KSEA 1S9KD 2A45I 1O7PA 2E76D 3GTEA 3HE4A 4H13C 3L71G 1T6AA 2HMOA 2KNCB 1J1EB 3F5HA 3HRNA 5APTA 3GZYA 1Q7YQ 1J1DB 2QM7A 1JTHB 3VYIA 2OYIB 1L0ND 2I1KA 3Q5RA 3CCUP 4EOTA 1NTZD 2A06G 1RF1C 3CCLP 2E4PA 3CCSP 1FQTA 1FDIA 2B87A 4OGQD 1YITP 4NBFD 4U3FJ 3GOBA 2A45H 2HMNA 2IBZI 4HM7A 3V5BA 2Z5IA 2UWJE 1BSNA 1NAYA 5BU5A 1T8ZA 4PD4D 4QDCA 1J1DC 1LTTC 1AJYA 4OWFA 1S4XA 4UB8H 2OYIC 2YKOA 2IDBA 1IK7A 3P7KA 3L70J 1GTWA 3C0DA 1OIPA 2E75B 3TGUG 3CXHE 3LIEA 1L0LJ 1YIJP 1FJPA 2CK3H 1QEXA 1D7MA 1GU4A 2IYPA 1BE3D 3A0HH 3QH9A 1VM9A 1L2PA 2P1JA 5CXMA 4I2LC 2ZYDA 1KB9D 3KZIH 3V2PA 1QLED 3G9RA 2NVEA 2HMJA 1AVOA 3P32A 1HJ0A 2ZYGA 3Q5PA 1USDA 2JEEA 2E75C 1GDTA 2I7FA 2KOGA 5CJ4A 1FZCA 4PV1B 1RE3C 1Q90C 1VL2A 4NBED 3R4YA 4U3FG 4XA4A 1MV8A 1NTMD 4QMAA 4EYYQ 1VQ4P 3HD7B 3R2PA 2YO3A 2Q6QA 3BRVB 4L75A 1LTBC 2OTKE 3MP7B 3KYQA 3RL0B 4NPDA 3AEDC 1VQ8P 4HM5A 1R8EA 1LP1B 2KLUA 4XFJA 2N1TD 2R5BA 4PV1C 1L0LG 4K3AA 2K37A 4W7ZA 5AVUB 2QJKB 3L70E 1MFTA 2H8PD 4HKVA 1PZQA 1SQVD 3AE7C 1GL2D 2BCCD 2NPSD 1L0NJ 3EFFK 3T97A 1LGHB 1NTZJ 2KB7P 3D6YA 2K9JA 2WSFJ 2ZT9B 2WPVB 2N1TA 1SP4A 1SQQD 3RL0C 3GW6A 2AEJA 1JO5A 2AXCA 4N3YB 2YXRB 3H1ID 5KKZB 3L36A 1GL2A 2NPSA 1LT9B 1KV4A 1JB0J 1JNMA 2QJKC 2OYHB 3H1LE 1URQD 1Z56A 1PP9E 1FBMA 1FDOA 2I1JA 1N7SD 1HJBA 1RHZB 3H32B 2FYNB 2ZT9C 3VCAA 1OZHA 4JYCA 4O9BA 1EXJA 4OVNF 5TISE 5AW1B 3MHVA 2B9BA 3HTKA 5L8RJ 1VQ7P 1RE4A 1KFNA 1FOSF 1URQA 1IFPA 1IC2A 4NBAD 2W83C 1G1IA 1U57A 1LT9C 5GTIE 4DCKA 2KS1B 1M56D 2OYHC 1SFCB 3CCVP 1BGYE 2QPZA 2FFDA 4BRYB 3Q3DA 2HPCB 2KI7B 4EI2A 4Z1MH 3EQQA 3H1KD 3CX5D 3KDPB 2FYNC 4JBZA 1CSBA 1N8RQ 1L0NG 2HODB 1S1CX 1NTZG 2POHA 2M3BA 3PP5A 1FS0E 1HTLC 1W2BO 3HUSA 3JCUH 2FYUD 1M1JA 4GDOA 1NTMJ 4L73A 3G4SP 3N7NA 1NVOA 3V4QA 4C7NA 1S72P 1NU1J 1KQSO 1NO4A 2JWAA 3USSA 3FXEA 2IZ1A 3H1JD 3DQYA 1PIXA 2E74D 4N6JA 4JQ0D 5KJ7D 4RO0A 2C0WA 1LTIC 3UIAA 2FKWB 1OVVA 3WUUA 4JF7A 2Q3IA 1DD4A 4HB1A 1K04A 4H0LD 1JM0A 1SQVJ 4B86A 2BCCJ 1LJ2A 1AV1A 2RMZA 5KJ7A 1VQMP 2O1KA 1KFMA 3HE4B 1HBWA 1EZVE 3RK2B 1SQQJ 4IOIH 3IN6A 4MN4C 2W27A 2W6AA 3OJAB 1ZXGA 3L72E 4AAYB 2DE5D 3M9BA 2FXMA 3GCEA 2H7HA 1K05A 2FBWC 1NU1K 4DT0A 2W90A 1HH0A 4I1LA 1MZ9A 5H2FH 3K5BA 1SQXJ 3U59A 2B87B 3GTSA 2IYOA 1NKZB 1U7MA 1NTMG 2AXTE 1NOHA 3PHLA 1KD1Q 1RIEA 3RK2C 2K88A 1N73B 5CBNA 1ZW0A 4QDFA 2ZAEB 2QA4P 1E79H 3F89A 1G8JB 1JY3P 3S9OA 2YFJA 2K9YA 3MZWB 3KXDA 1NU1E 2ZFCA 3E1RA 5B66E 2Q3EA 4R4MA 1X22A 2B1XA 2E76C 1VF5D 2SPZA 3FWNA 4DZOA 3JC22 1YJ9P 3LW5J 3H1KJ 1SQVG 5BOKA 3AEEC 3CXHI 1KILD 2BCCG 5APYA 1BDCA 1KTMA 4HM3A 2GUVA 3W68A 3I55P 2D2CD 3GZXA 2LXBA 1JY2P 1MFZA 5GTHE 5AVQB 1QX8A 1ZRTE 3P8CD 3RGUA 1ZR4A 1SQXK 2QM8A 4HJGH 1SQQG 4RKUJ 4NBDD 2HR3A 3L75D 5APXA 3H1IG 4OGQC 2JZAA 4I7ZB 1KILA 5DJTB 4D6TD 5AW5B 1JMMA 1W5CE 4W80A 2KLVA 2Z5HA 3M0DA 3RK3D 3PH0A 1FZCB 4H44D 5KLVD 1SQXG 1LTJA 3CXHH 3TNUA 3VCPA 1VQLP 2E42A 1PGPA 1JMBA 1Q82Q 1SQXE 3S1KA 2YKQA 3B4SA 1O7GA 3VMGD 2OTLP 3GHGA 2IFNA 3I5CA 3CCQP 3IAOA 2RN0A 4I7ZC 1ULJA 1PPJE 1FZGA 1UIXA 4C7RA 5CCGD 1M1KQ 1EG9A 3BCCE 3L74J 1FZCC 3VMZA 1JCCA 5HL4A 1Y9BA 4KJMA 1SQPJ 3H1KG 2KZIA 3I56P 3L73E 2H43A 1T2KD 3VMXA 3FXDA 1LNQA 3PJSK 3PTZA 1JUNA 4NPEA 3BATA 5CCGA 1IFNA 1NWQA 3AE2C 4JPZB 2K9JB 3E7KA 3L71E 2Y0CA 2N1TB 1WMKA 4WWIA 1X79B 5B5EE 3E1IA 1YBKA 2LR2A 2FXPA 5CJ0A 3MGNA 2WPQA 5AVVB 3AECC 2LKMA 1FZAA 3AZCA 2IFMA 1GL2B 1ZV8A 3GMAA 2K3RA 3N4XA 3H1JG 4JYBA 1KC8Q 1G8KB 4U7JA 2A06E 2GBWA 3G3ZA 2DE7D 3O8ZA 1RH5B 2NVGA 3H25A 3BVHA 3CMEP 4ASWA 2O01J 3TYYA 3BASA 2XRXA 1SQPK 2N1TC 4R4LA 3AEGC 3HTKB 3WU2E 1URQB 3GB4A 1GL2C 2NPSC 2LXCB 3AEBC 3L74G 1K8AQ 1EQ7A 1SQPG 1DH3A 3L75J 2FFDB 4WB4A 3TGUE 1VQNP 5AW9B 1KMIZ 1OVUA 4D6TJ 1SQPE 2J5UA 2V7QH 3H1HD 1J2JB 4BXLA 1KN7A 2WSCH 4DOJA 1RE4C 3HUSB 3SWFA 1URQC 5TISH 1M1JB 2K1AA 2XNDH 1NHLA 1NTKJ 3AE1C 3L72D 2WPRA 2FFDC 4NBBD 5GTIH 3TF5A 2WSEJ 4C7NB 1HVVA 3TK1A 1P84E 3MD0A 1SQBD 2C9NY 4QURA 3W67A 2PGDA 4H13D 2ZVOB 1UIIA 1VQ6P 1GMJA 1ULIA 1L0LK 1H0TA 1EC5A 2P67A 4U3FE 1E5WA 4YXDC 4DJGA 3HUSC 4HM8A 1BCCD 2NUKA 2KIKA 3SFDC 1M1JC 1A02F 1GW3A 2P2UA 1LTAC 1CI6A 4GODA 5AW8B 2M5AB 1YTZT 1N7LA 4N78D 3L75G 2IPPA 2XSOA 1L0LE 3CCMP 3SFEC 2A45G 2YKPA 1EZVI 1GD2E 4HKZH 4HJLA 4D6TG 2YMYA 1NTKK 3A2AA 2PAJA 4ZMDA 5AW4B 4RESB 2GBXA 2I8DA 5KAFE 3ABVC 2PP6A 1NDOA 1G1JA 1HWTC 2M0BA 2E5TA 1YYCA 5KJ7C 1Y8AA 4AYCA 2GUSA 1NTKG 1O7MA 3CWBD 4QDFB 1DD3A 1QGKB 3EFGA 1EDJA 1TU3F 4H0LC 2JP3A 3CD6P 2IBZG 1N86A 4Y28J 2JWDA 2QJYB 2XV5A 2ZYAA 3IF4A 3CC7P 1KYOE 2KP8A
chains in the Genus database with same CATH topology
2BMRA 1OW6A 3GCEA 1K05A 3VMID 2FBWC 1O7HA 4HM1A 3GF3A 1EXIA 5AEUA 2YMKA 4NB9D 3GTSA 1OW8A 2QSIA 4NBGD 2V7QJ 1YQ3C 3O6QA 1RIEA 1RFSA 3C8VA 3AE5C 2QJYC 2NVFA 4QDFA 2WSCJ 1O7PA 2E76D 3GTEA 1G8JB 1UUVA 4H13C 3S9OA 2YFJA 2K9YA 2HMOA 1NU1E 1JM1A 4IL6X 3GF7A 1KORA 2D2CB 1L0NE 1KILE 2E74B 1NTZE 4R4MA 2B1XA 3N0QA 2E76C 1VF5D 3GZYA 3AE4C 4QUQA 3AE6C 3LW5J 4NB8D 5BOKA 3Q5RA 3AEEC 1KTMA 2MKVA 1SJGA 4HM3A 2E4PA 1FQTA 2JO6A 2CKFA 1FDIA 2D2CD 4H0LB 3D71A 1KQGB 1VF5C 3GZXA 3L75E 2YFIA 4OGQD 2BMOA 2YFLA 4NBFD 4QUPA 3GOBA 2HMNA 1DIPA 1ZRTE 1NYHA 4HM7A 4RKUJ 4PD4E 4NBDD 1OW7A 3RK3E 2D2CC 4EMJB 4OGQC 5KLVE 5AEWA 2JZAA 2E74C 4I7ZB 1ZP0C 1RQVA 1O7WA 2ZYLA 2QJPC 5KLIC 4QDCA 1AJYA 3EN1A 2IDBA 1IK7A 3FGAD 4H44D 2NUMA 1BE3E 3RL0g 3C0DA 2E75B 3CXHE 1NTKE 3VCPA 2YIUC 1KB9E 1SQXE 4HM2A 2HMMA 2DE6D 1O7GA 2XR8A 1VM9A 4H44C 3VMGD 5CXMA 2B24A 2IBZE 2ZT9D 3B71A 3IAOA 2E75D 4I7ZC 1ULJA 3G9RA 1PPJE 2NVEA 4QDDA 1UIXA 2HMJA 2E76B 1HJ0A 1EG9A 1MKMA 3BCCE 3Q5PA 3D89A 5M1BA 3Q5SA 1Q90D 4AIVA 2E75C 5HL4A 1Y9BA 2I7FA 4HM6A 1VF5B 3AE9C 3L73E 1NTME 5KKZC 1S5LX 4NBHD 4PV1B 1Q90C 2BEZF 1VL2A 4NBED 3R4YA 3EWKA 3AE2C 3D70A 1ZMEC 4OGQB 3L71E 2JO1A 1WMKA 3GL0A 1NYKA 3D6ZA 2FXPA 4PV1D 2HMLA 3AECC 4P1CH 3AZCA 3VMHD 2H88C 3AEDC 3GMAA 4HM5A 1R8EA 1SQVE 4XFJA 2BCCE 4PV1C 1G8KB 4U7JA 2A06E 2GBWA 2DE7D 4H44B 2NVGA 3H25A 3L70E 2H89C 2P10A 2BEQD 2O01J 4HKVA 3AE7C 2XRXA 4R4LA 1SQQE 3AEGC 3GKEA 4QCKA 3D6YA 2WSFJ 3H1IE 2ZT9B 2NZ2A 2QIWA 2WPVB 3GB4A 2HMKA 3AEBC 3H1HE 2Q3WA 3TGUE 4P1BH 1JB0J 1RQUA 2QJKC 1KMIZ 3H1LE 1SQPE 2J5UA 1PP9E 3FOUA 1FDOA 4NBCD 3GL2A 2ZT9C 3VCAA 1EXJA 3AE3C 1SQBE 5L8RJ 2BMQA 3Q2YA 3AE1C 4NBAD 3AE8C 1U57A 4NBBD 2WSEJ 2NWFA 3H1KE 1P84E 3CX5E 2XSHA 3T97B 4QURA 4H13D 3AEAC 1ZOYC 1BCCE 2QPZA 3Q3DA 1GMJA 1ULIA 4Z1MH 1VCKA 3EQQA 4U3FE 4HM0A 4YXDC 2FYNC 2FYUE 4HM8A 2NUKA 3SFDC 1S1CX 1WQLA 2G3AA 1PV3A 4GDOA 3H1JE 4TT3H 2WQYC 4YTPC 2XSOA 1L0LE 3Q1MA 3SFEC 4KT0J 4HJLA 1KQFB 3DQYA 1PIXA 2E74D 2GBXA 4HM4A 1YQ4C 2G8YA 3ABVC 1HF9A 1NDOA 1PL5A 1O7NA 3CWBE 1DD4A 1K04A 4H0LD 2E4QA 3AEFC 3L74E 1O7MA 1UUWA 1NGMB 4QDFB 1DD3A 1TU3F 4H0LC 3GLMA 2JP3A 1EZVE 4Y28J 2YVJB 3IN6A 2OQQA 3L72E 1OMIA 1KYOE 4H13B 4AAYB 2DE5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMR A;  4PV1 C;  3EN1 A;  1G8K B;  1VCK A;  2A06 E;  3GCE A;  3EQQ A;  4U3F E;  2GBW A;  4H44 D;  4HM0 A;  2DE7 D;  1BE3 E;  2NUM A;  3VMI D;  2NVG A;  3C0D A;  3L70 E;  3CXH E;  2FYN C;  2FYU E;  1O7H A;  1NTK E;  4HM1 A;  4HM8 A;  2NUK A;  3VCP A;  4HKV A;  2YIU C;  5AEU A;  2YMK A;  4NB9 D;  1KB9 E;  2XRX A;  1SQX E;  4HM2 A;  1SQQ E;  2HMM A;  3GTS A;  2DE6 D;  3GKE A;  1O7G A;  2XR8 A;  4NBG D;  1VM9 A;  4QCK A;  4H44 C;  3VMG D;  5CXM A;  1WQL A;  2B24 A;  2IBZ E;  2ZT9 D;  3H1I E;  1RIE A;  1RFS A;  3GB4 A;  3H1J E;  2E75 D;  4QDF A;  4I7Z C;  2NVF A;  1ULJ A;  2QJY C;  1PPJ E;  2NVE A;  4QDD A;  2HMJ A;  1O7P A;  2HMK A;  2E76 D;  3GTE A;  1G8J B;  1UUV A;  2XSO A;  4H13 C;  1L0L E;  3H1H E;  2Q3W A;  2YFJ A;  1EG9 A;  2HMO A;  3BCC E;  1NU1 E;  3D89 A;  4HJL A;  1JM1 A;  3TGU E;  4P1B H;  1L0N E;  3DQY A;  4AIV A;  2E74 D;  2E75 C;  2QJK C;  5HL4 A;  2I7F A;  1NTZ E;  3H1L E;  2GBX A;  2B1X A;  1SQP E;  2E76 C;  3N0Q A;  4HM6 A;  1VF5 D;  4HM4 A;  3GZY A;  1PP9 E;  3FOU A;  3L73 E;  1NTM E;  4QUQ A;  5KKZ C;  4NBH D;  1NDO A;  4NBC D;  1Q90 C;  1O7N A;  4NB8 D;  3GL2 A;  3CWB E;  5BOK A;  1SJG A;  4NBE D;  4HM3 A;  4H0L D;  2E4Q A;  2E4P A;  2ZT9 C;  3VCA A;  1FQT A;  2JO6 A;  2CKF A;  2D2C D;  1VF5 C;  3GZX A;  3L75 E;  2YFI A;  4OGQ D;  2BMO A;  3L74 E;  2YFL A;  3L71 E;  4NBF D;  4QUP A;  1O7M A;  1SQB E;  3GOB A;  2HMN A;  1ZRT E;  1UUW A;  3GL0 A;  2BMQ A;  4QDF B;  1NYK A;  4HM7 A;  4PD4 E;  4NBD D;  4PV1 D;  4H0L C;  4NBA D;  2HML A;  1EZV E;  4NBB D;  2D2C C;  4EMJ B;  2NWF A;  2YVJ B;  3H1K E;  4OGQ C;  4P1C H;  1P84 E;  3AZC A;  2JZA A;  2E74 C;  3CX5 E;  5AEW A;  2XSH A;  3VMH D;  5KLV E;  4QUR A;  1O7W A;  4HM5 A;  4H13 D;  2ZYL A;  1BCC E;  2QPZ A;  2QJP C;  3L72 E;  1KYO E;  4QDC A;  5KLI C;  4AAY B;  2DE5 D;  1SQV E;  1ULI A;  2BCC E; 
#chains in the Genus database with same CATH topology
 2BMR A;  3VP8 A;  1X0T A;  1BE3 J;  3KZI E;  2NRG A;  1H8A A;  1VDF A;  1L0N K;  3H1H J;  4HM1 A;  3GF3 A;  5AW2 B;  1EXI A;  1NTZ K;  4NB9 D;  2E43 A;  1N7S A;  3II6 A;  2C0X A;  3VTP C;  4NBG D;  3B5N D;  2OGU A;  1YQ3 C;  2QE7 H;  1M57 D;  2KK7 A;  1BSH A;  3C8V A;  2QJY C;  2NVF A;  1AFO A;  5KTB A;  2P7J A;  3OAK A;  1KIL B;  1M7L A;  4IL6 X;  4LC1 A;  2D2C B;  1RE3 A;  1L0N E;  1SQB J;  5B66 H;  1PGQ A;  3B5N A;  1NTZ E;  1OVR A;  2PFX A;  1LTJ B;  2QJP B;  5KLI B;  3AE4 C;  3AE6 C;  1FAV A;  1AA0 A;  4NB8 D;  3JSV C;  2JO6 A;  2CKF A;  2M3E A;  3D71 A;  1VF5 C;  2IZ0 A;  2WT7 A;  3VMA A;  2BMO A;  1R5L A;  4GOE A;  5GTH H;  3NTN A;  3HD7 D;  1DIP A;  1GK6 A;  1NYH A;  1YJW P;  4I6M C;  1KIL C;  4PD4 E;  1OWA A;  2HLO A;  5AW7 B;  2D2C C;  5AVT B;  3RBX A;  4EMJ B;  3M0D C;  1ZN5 A;  5APW A;  2O01 N;  5E79 E;  1O7W A;  2ZYL A;  1BE3 G;  1LTS C;  1LTJ C;  2QJP C;  5KLI C;  3L37 A;  1OXZ A;  2WTY A;  1JY3 N;  3H1H G;  1QL2 A;  3HD7 A;  1BE3 E;  2NUM A;  3RL0 g;  2WZ7 A;  1BDD A;  4GIF A;  1KB9 E;  5BVZ A;  3CLQ A;  4HM2 A;  3RK3 C;  2HMM A;  2DE6 D;  1JEK A;  2O1J A;  1NTM K;  3KPE A;  1SS1 A;  2XR8 A;  4H44 C;  1DEE G;  1OFC X;  3CXH D;  1HGV A;  3H1I J;  1HUC A;  2ZT9 D;  3C1L A;  5CCH D;  3B71 A;  3CWB J;  1JY2 N;  2Q1K A;  2E76 B;  4PJ0 E;  1SQB G;  3D89 A;  2WWW A;  4IFF A;  3S4R A;  1NJI Q;  5BU8 B;  2HFE D;  4L74 A;  5CCH A;  1DEB A;  1NTM E;  1S5L X;  2BEZ F;  1SQV K;  3LW5 H;  2Y0D A;  2JDI H;  5AW0 B;  3D70 A;  1LT9 A;  5APQ A;  1T2K C;  4OGQ B;  1USE A;  3NMD A;  2OYH A;  3GL0 A;  3HE5 A;  1SQQ K;  4Y99 B;  4YPC A;  5B5E H;  3D6Z A;  2YNY A;  1IK9 A;  4IFM A;  1L4A D;  5KAI E;  3CC4 P;  3A0B E;  4P1C H;  1X9V A;  3CCJ P;  1SFC D;  5TJH A;  3VMH D;  2H88 C;  2CPS A;  1PGJ A;  4GOF A;  1SQV E;  1MUU A;  2BCC E;  4NPF X;  1AQT A;  2FYU J;  1SLQ A;  2KUB A;  3CC2 P;  2P10 A;  2ZVN B;  3WUV A;  2KS1 A;  1L4A A;  1SQQ E;  1LTG C;  1X8Y A;  3GKE A;  1SFC A;  4QCK A;  4Y99 C;  3L70 D;  4BRY A;  3PRJ A;  3H1I E;  3CWB G;  2ZJS E;  3WU2 H;  3MTU E;  3H1J J;  4C46 A;  5DJU B;  1FJK A;  1JY3 O;  2JKV A;  3KQG A;  1ZR2 A;  4UB6 E;  3U1C A;  3ZDM A;  4P1B H;  4IL6 E;  1WT6 A;  1H0T B;  3CCE P;  4LLH A;  1FZE A;  1T3J A;  3FOU A;  2Q5U A;  4NBC D;  2FYZ A;  3GL2 A;  3LID A;  3H1L D;  1CI6 B;  2FYU K;  1PP9 D;  2KYV A;  1FDM A;  2KZJ A;  2WVR A;  3Q2Y A;  1NKN A;  2R5D A;  3WUT A;  3VMY A;  3TDK A;  1LT1 A;  3AE8 C;  2NWF A;  3H1K E;  3CX5 E;  1CZQ A;  2Z4E A;  3T97 B;  3M9Q A;  3M9H A;  3AEA C;  1ZOY C;  1IZN B;  2OAR A;  2FYU G;  1M8O B;  3MUD A;  2W6J H;  3VN0 A;  1VCK A;  2R32 A;  4HM0 A;  2FYU E;  1BGY D;  2AEM A;  1NAF A;  1IFI A;  2O01 H;  2BAS A;  3M91 A;  2GM4 A;  2NPS B;  4WVZ A;  1XTG B;  4LGD E;  1WQL A;  2G3A A;  2L91 A;  1PV3 A;  2B89 A;  3VOP A;  2J59 M;  3H1J E;  4YTP C;  1FZF A;  1ZLL A;  1IFM A;  1Q2N A;  1VQ5 P;  1AVY A;  1W2E A;  1VQ9 P;  2QRX A;  1KYO I;  3G71 P;  3NFQ A;  4HM4 A;  1YQ4 C;  3NXS A;  4RJT A;  5KAF H;  4OH8 B;  1N73 A;  1GU5 A;  2XU6 A;  1J1E C;  1IJD B;  5AVZ B;  1HF9 A;  1S5L E;  1N7S B;  5CHX A;  1IO4 A;  3CCR P;  4AQR D;  2QVA A;  3AEF C;  2AEF A;  3L74 E;  2B88 A;  2YXQ B;  3QWO C;  5AVY B;  1UUW A;  1NGM B;  4EDF A;  4EIJ A;  2QEX P;  1G2C A;  4WY4 D;  5AVW B;  3GLM A;  2ZXE B;  5KLV J;  2WSE H;  2Y9Z A;  2OQQ A;  3B8E B;  3TSI A;  1LWU A;  1KYO H;  3B5N B;  4HYT B;  2IX7 C;  1VQK P;  3VP9 A;  2YO2 A;  3M0A A;  1EZV D;  1EDI A;  1FU1 A;  2GA1 A;  1N7S C;  3EQ2 A;  3VMI D;  1FE6 A;  4BWN A;  1A02 J;  1O7H A;  1EDL A;  4WY4 A;  1GK4 A;  2YMK A;  3A5T A;  2Q7C A;  2L5G B;  2XNX A;  1RF0 A;  3L35 A;  2WT7 B;  1OW8 A;  2Y9Y A;  4W7Y A;  1YJN P;  5EFW B;  2P58 A;  1VQO P;  4WBA A;  1PGO A;  3H1L J;  2DW3 A;  2V7Q J;  1FC2 C;  3O6Q A;  3V2Q A;  1PP9 J;  1RFS A;  4KHX A;  3AE5 C;  4GT1 A;  2OTJ P;  2WSC J;  4PD4 I;  1UUV A;  3B5N C;  2HG5 D;  1JM1 A;  3V2N A;  3GF7 A;  1KOR A;  2ITA A;  1KIL E;  2E74 B;  2FY8 A;  3N0Q A;  5AW6 B;  5KLV K;  2OYO A;  1Q81 Q;  2WSF H;  1NU1 D;  4QUQ A;  1HGZ A;  1IFD A;  3P8C E;  1RY3 A;  3CI9 A;  2MKV A;  1SJG A;  2O3J A;  1BGY J;  2XDJ A;  4IFD K;  4H0L B;  2R3S A;  1KB9 I;  1KZU B;  1KQG B;  2KSJ A;  2YIU B;  3L70 G;  3L75 E;  5AVS B;  4AUW A;  2YFI A;  3FWL A;  2YFL A;  2VRS A;  4QUP A;  1RF1 A;  4D6T E;  4ZNC A;  5KLV G;  4PD4 H;  1OW7 A;  1M90 Q;  5AVR B;  3L4F A;  3RK3 E;  1R5S A;  3V4W A;  5KLV E;  5AEW A;  2E74 C;  1ZP0 C;  5E79 H;  1RQV A;  1ZRT D;  1GZL A;  3HD7 C;  4M3L A;  1IFJ A;  2KNC A;  4UB8 E;  3EN1 A;  5CBO A;  3FGA D;  1JCD A;  2JR8 A;  5K5G B;  1EDK A;  1NTK E;  3SWK A;  1JTH A;  2YIU C;  2OYI A;  2PRR A;  3H1L G;  1KB9 H;  3U1A A;  3RBZ A;  1PP9 G;  3A0H E;  1H89 A;  2R44 A;  1AQ5 A;  2IBZ E;  2B24 A;  5C39 A;  3HE5 B;  3P8M C;  2JJL A;  1SQX D;  2E75 D;  4QDD A;  2FXO A;  3PLN A;  1XTC C;  2XKM A;  4PJ0 H;  1QVG O;  1MKM A;  1S9K E;  5M1B A;  4ASV A;  3Q5S A;  1Q90 D;  3WMM 0;  5CCH C;  2E5Y A;  4AIV A;  4A7P A;  1PPJ D;  2AXT H;  4HM6 A;  1VF5 B;  3AE9 C;  3BCC D;  1BGY G;  5KKZ C;  4NBH D;  1L4A B;  2M8R A;  1T3U A;  5APS A;  3FX0 A;  3EWK A;  3L72 J;  3SSU A;  1ZME C;  4HH2 A;  3L73 D;  1QVF O;  1U7J A;  3IR9 A;  2JO1 A;  1Q86 Q;  1NYK A;  3TNU B;  1Y47 A;  4PV1 D;  5AVX B;  2HML A;  5KAI H;  3A0B H;  3CPW O;  3L71 D;  5CMZ A;  1BCC J;  3BRT B;  2RKL A;  3GHG B;  1L4A C;  3RK3 B;  1FOS E;  1WRG A;  4H44 B;  1SFC C;  2H89 C;  2WIT A;  2BEQ D;  3GG2 A;  4GKG A;  3RL0 D;  2A06 D;  2NZ2 A;  2QIW A;  2HMK A;  3H1H E;  3GHG C;  1SQB K;  4UB6 H;  4ZKP A;  2Q3W A;  1PFI A;  1FZB A;  3M06 A;  3CX5 I;  4IL6 H;  1H88 A;  3V6I A;  1RQU A;  1EZV G;  3V2R A;  1LP1 A;  4YXW H;  1N2D C;  2M5A A;  1CW5 A;  2N9Y B;  2Q9I A;  3TGU D;  3L72 G;  3L74 D;  2N9B A;  2QG4 A;  1SQP D;  4ZKU A;  1NH4 A;  3MIW A;  3AE3 C;  1SQB E;  1GW4 A;  2WSS H;  2BMQ A;  5CCG C;  4CPG A;  1VQP P;  3C9I A;  1BCC G;  3IFM A;  3MUD C;  5AW3 B;  2CPB A;  3CX5 H;  2XSH A;  1YI2 P;  1BCC E;  2RH0 A;  3G6E P;  1P84 D;  2MJZ A;  1NU1 G;  3BCC J;  2Y0E A;  4N78 E;  4U3F D;  3H32 A;  3CMA P;  1S2E A;  3JCU E;  4L76 A;  3SWY A;  5APU A;  3L73 J;  1G2C B;  2V4H A;  3CL3 D;  4TT3 H;  2J58 A;  2WQY C;  1OX3 A;  3Q1M A;  4KT0 J;  1JOC A;  2C9L Y;  1LWU B;  1N73 C;  1YTZ I;  2W6B A;  1KQF B;  1SVF A;  1S3J A;  3L71 J;  2ZXX A;  2WMM A;  1QL1 A;  1K73 Q;  3ITK A;  2HPC A;  1L0L D;  1KQL A;  2G8Y A;  4WY4 B;  1PL5 A;  1O7N A;  2W8Z A;  3A3Y B;  3CWB E;  1S5L H;  2HOD A;  2E4Q A;  1P84 I;  2R3C A;  3O6Q B;  3OW2 O;  1VPC A;  5APV A;  4TLF A;  3OA7 A;  4XE5 B;  1LWU C;  1YHQ P;  2YVJ B;  2HYN A;  1JY2 O;  1OMI A;  1PPJ G;  4H13 B;  3KHU A;  1NTK D;  4WY4 C;  1OW6 A;  1RF0 C;  3BCC G;  2XZR A;  3A7O A;  2WPS A;  5H2F E;  3RK2 D;  1KYO D;  2IBZ D;  5AEU A;  1K9M Q;  3TGU J;  1P84 H;  2KXP B;  4K35 A;  1DX7 A;  3L73 G;  2QSI A;  1RF1 B;  3H6P A;  2KSE A;  1S9K D;  2A45 I;  1O7P A;  2E76 D;  3GTE A;  3HE4 A;  4H13 C;  3L71 G;  1T6A A;  2HMO A;  2KNC B;  1J1E B;  3F5H A;  3HRN A;  5APT A;  3GZY A;  1Q7Y Q;  1J1D B;  2QM7 A;  1JTH B;  3VYI A;  2OYI B;  1L0N D;  2I1K A;  3Q5R A;  3CCU P;  4EOT A;  1NTZ D;  2A06 G;  1RF1 C;  3CCL P;  2E4P A;  3CCS P;  1FQT A;  1FDI A;  2B87 A;  4OGQ D;  1YIT P;  4NBF D;  4U3F J;  3GOB A;  2A45 H;  2HMN A;  2IBZ I;  4HM7 A;  3V5B A;  2Z5I A;  2UWJ E;  1BSN A;  1NAY A;  5BU5 A;  1T8Z A;  4PD4 D;  4QDC A;  1J1D C;  1LTT C;  1AJY A;  4OWF A;  1S4X A;  4UB8 H;  2OYI C;  2YKO A;  2IDB A;  1IK7 A;  3P7K A;  3L70 J;  1GTW A;  3C0D A;  1OIP A;  2E75 B;  3TGU G;  3CXH E;  3LIE A;  1L0L J;  1YIJ P;  1FJP A;  2CK3 H;  1QEX A;  1D7M A;  1GU4 A;  2IYP A;  1BE3 D;  3A0H H;  3QH9 A;  1VM9 A;  1L2P A;  2P1J A;  5CXM A;  4I2L C;  2ZYD A;  1KB9 D;  3KZI H;  3V2P A;  1QLE D;  3G9R A;  2NVE A;  2HMJ A;  1AVO A;  3P32 A;  1HJ0 A;  2ZYG A;  3Q5P A;  1USD A;  2JEE A;  2E75 C;  1GDT A;  2I7F A;  2KOG A;  5CJ4 A;  1FZC A;  4PV1 B;  1RE3 C;  1Q90 C;  1VL2 A;  4NBE D;  3R4Y A;  4U3F G;  4XA4 A;  1MV8 A;  1NTM D;  4QMA A;  4EYY Q;  1VQ4 P;  3HD7 B;  3R2P A;  2YO3 A;  2Q6Q A;  3BRV B;  4L75 A;  1LTB C;  2OTK E;  3MP7 B;  3KYQ A;  3RL0 B;  4NPD A;  3AED C;  1VQ8 P;  4HM5 A;  1R8E A;  1LP1 B;  2KLU A;  4XFJ A;  2N1T D;  2R5B A;  4PV1 C;  1L0L G;  4K3A A;  2K37 A;  4W7Z A;  5AVU B;  2QJK B;  3L70 E;  1MFT A;  2H8P D;  4HKV A;  1PZQ A;  1SQV D;  3AE7 C;  1GL2 D;  2BCC D;  2NPS D;  1L0N J;  3EFF K;  3T97 A;  1LGH B;  1NTZ J;  2KB7 P;  3D6Y A;  2K9J A;  2WSF J;  2ZT9 B;  2WPV B;  2N1T A;  1SP4 A;  1SQQ D;  3RL0 C;  3GW6 A;  2AEJ A;  1JO5 A;  2AXC A;  4N3Y B;  2YXR B;  3H1I D;  5KKZ B;  3L36 A;  1GL2 A;  2NPS A;  1LT9 B;  1KV4 A;  1JB0 J;  1JNM A;  2QJK C;  2OYH B;  3H1L E;  1URQ D;  1Z56 A;  1PP9 E;  1FBM A;  1FDO A;  2I1J A;  1N7S D;  1HJB A;  1RHZ B;  3H32 B;  2FYN B;  2ZT9 C;  3VCA A;  1OZH A;  4JYC A;  4O9B A;  1EXJ A;  4OVN F;  5TIS E;  5AW1 B;  3MHV A;  2B9B A;  3HTK A;  5L8R J;  1VQ7 P;  1RE4 A;  1KFN A;  1FOS F;  1URQ A;  1IFP A;  1IC2 A;  4NBA D;  2W83 C;  1G1I A;  1U57 A;  1LT9 C;  5GTI E;  4DCK A;  2KS1 B;  1M56 D;  2OYH C;  1SFC B;  3CCV P;  1BGY E;  2QPZ A;  2FFD A;  4BRY B;  3Q3D A;  2HPC B;  2KI7 B;  4EI2 A;  4Z1M H;  3EQQ A;  3H1K D;  3CX5 D;  3KDP B;  2FYN C;  4JBZ A;  1CSB A;  1N8R Q;  1L0N G;  2HOD B;  1S1C X;  1NTZ G;  2POH A;  2M3B A;  3PP5 A;  1FS0 E;  1HTL C;  1W2B O;  3HUS A;  3JCU H;  2FYU D;  1M1J A;  4GDO A;  1NTM J;  4L73 A;  3G4S P;  3N7N A;  1NVO A;  3V4Q A;  4C7N A;  1S72 P;  1NU1 J;  1KQS O;  1NO4 A;  2JWA A;  3USS A;  3FXE A;  2IZ1 A;  3H1J D;  3DQY A;  1PIX A;  2E74 D;  4N6J A;  4JQ0 D;  5KJ7 D;  4RO0 A;  2C0W A;  1LTI C;  3UIA A;  2FKW B;  1OVV A;  3WUU A;  4JF7 A;  2Q3I A;  1DD4 A;  4HB1 A;  1K04 A;  4H0L D;  1JM0 A;  1SQV J;  4B86 A;  2BCC J;  1LJ2 A;  1AV1 A;  2RMZ A;  5KJ7 A;  1VQM P;  2O1K A;  1KFM A;  3HE4 B;  1HBW A;  1EZV E;  3RK2 B;  1SQQ J;  4IOI H;  3IN6 A;  4MN4 C;  2W27 A;  2W6A A;  3OJA B;  1ZXG A;  3L72 E;  4AAY B;  2DE5 D;  3M9B A;  2FXM A;  3GCE A;  2H7H A;  1K05 A;  2FBW C;  1NU1 K;  4DT0 A;  2W90 A;  1HH0 A;  4I1L A;  1MZ9 A;  5H2F H;  3K5B A;  1SQX J;  3U59 A;  2B87 B;  3GTS A;  2IYO A;  1NKZ B;  1U7M A;  1NTM G;  2AXT E;  1NOH A;  3PHL A;  1KD1 Q;  1RIE A;  3RK2 C;  2K88 A;  1N73 B;  5CBN A;  1ZW0 A;  4QDF A;  2ZAE B;  2QA4 P;  1E79 H;  3F89 A;  1G8J B;  1JY3 P;  3S9O A;  2YFJ A;  2K9Y A;  3MZW B;  3KXD A;  1NU1 E;  2ZFC A;  3E1R A;  5B66 E;  2Q3E A;  4R4M A;  1X22 A;  2B1X A;  2E76 C;  1VF5 D;  2SPZ A;  3FWN A;  4DZO A;  3JC2 2;  1YJ9 P;  3LW5 J;  3H1K J;  1SQV G;  5BOK A;  3AEE C;  3CXH I;  1KIL D;  2BCC G;  5APY A;  1BDC A;  1KTM A;  4HM3 A;  2GUV A;  3W68 A;  3I55 P;  2D2C D;  3GZX A;  2LXB A;  1JY2 P;  1MFZ A;  5GTH E;  5AVQ B;  1QX8 A;  1ZRT E;  3P8C D;  3RGU A;  1ZR4 A;  1SQX K;  2QM8 A;  4HJG H;  1SQQ G;  4RKU J;  4NBD D;  2HR3 A;  3L75 D;  5APX A;  3H1I G;  4OGQ C;  2JZA A;  4I7Z B;  1KIL A;  5DJT B;  4D6T D;  5AW5 B;  1JMM A;  1W5C E;  4W80 A;  2KLV A;  2Z5H A;  3M0D A;  3RK3 D;  3PH0 A;  1FZC B;  4H44 D;  5KLV D;  1SQX G;  1LTJ A;  3CXH H;  3TNU A;  3VCP A;  1VQL P;  2E42 A;  1PGP A;  1JMB A;  1Q82 Q;  1SQX E;  3S1K A;  2YKQ A;  3B4S A;  1O7G A;  3VMG D;  2OTL P;  3GHG A;  2IFN A;  3I5C A;  3CCQ P;  3IAO A;  2RN0 A;  4I7Z C;  1ULJ A;  1PPJ E;  1FZG A;  1UIX A;  4C7R A;  5CCG D;  1M1K Q;  1EG9 A;  3BCC E;  3L74 J;  1FZC C;  3VMZ A;  1JCC A;  5HL4 A;  1Y9B A;  4KJM A;  1SQP J;  3H1K G;  2KZI A;  3I56 P;  3L73 E;  2H43 A;  1T2K D;  3VMX A;  3FXD A;  1LNQ A;  3PJS K;  3PTZ A;  1JUN A;  4NPE A;  3BAT A;  5CCG A;  1IFN A;  1NWQ A;  3AE2 C;  4JPZ B;  2K9J B;  3E7K A;  3L71 E;  2Y0C A;  2N1T B;  1WMK A;  4WWI A;  1X79 B;  5B5E E;  3E1I A;  1YBK A;  2LR2 A;  2FXP A;  5CJ0 A;  3MGN A;  2WPQ A;  5AVV B;  3AEC C;  2LKM A;  1FZA A;  3AZC A;  2IFM A;  1GL2 B;  1ZV8 A;  3GMA A;  2K3R A;  3N4X A;  3H1J G;  4JYB A;  1KC8 Q;  1G8K B;  4U7J A;  2A06 E;  2GBW A;  3G3Z A;  2DE7 D;  3O8Z A;  1RH5 B;  2NVG A;  3H25 A;  3BVH A;  3CME P;  4ASW A;  2O01 J;  3TYY A;  3BAS A;  2XRX A;  1SQP K;  2N1T C;  4R4L A;  3AEG C;  3HTK B;  3WU2 E;  1URQ B;  3GB4 A;  1GL2 C;  2NPS C;  2LXC B;  3AEB C;  3L74 G;  1K8A Q;  1EQ7 A;  1SQP G;  1DH3 A;  3L75 J;  2FFD B;  4WB4 A;  3TGU E;  1VQN P;  5AW9 B;  1KMI Z;  1OVU A;  4D6T J;  1SQP E;  2J5U A;  2V7Q H;  3H1H D;  1J2J B;  4BXL A;  1KN7 A;  2WSC H;  4DOJ A;  1RE4 C;  3HUS B;  3SWF A;  1URQ C;  5TIS H;  1M1J B;  2K1A A;  2XND H;  1NHL A;  1NTK J;  3AE1 C;  3L72 D;  2WPR A;  2FFD C;  4NBB D;  5GTI H;  3TF5 A;  2WSE J;  4C7N B;  1HVV A;  3TK1 A;  1P84 E;  3MD0 A;  1SQB D;  2C9N Y;  4QUR A;  3W67 A;  2PGD A;  4H13 D;  2ZVO B;  1UII A;  1VQ6 P;  1GMJ A;  1ULI A;  1L0L K;  1H0T A;  1EC5 A;  2P67 A;  4U3F E;  1E5W A;  4YXD C;  4DJG A;  3HUS C;  4HM8 A;  1BCC D;  2NUK A;  2KIK A;  3SFD C;  1M1J C;  1A02 F;  1GW3 A;  2P2U A;  1LTA C;  1CI6 A;  4GOD A;  5AW8 B;  2M5A B;  1YTZ T;  1N7L A;  4N78 D;  3L75 G;  2IPP A;  2XSO A;  1L0L E;  3CCM P;  3SFE C;  2A45 G;  2YKP A;  1EZV I;  1GD2 E;  4HKZ H;  4HJL A;  4D6T G;  2YMY A;  1NTK K;  3A2A A;  2PAJ A;  4ZMD A;  5AW4 B;  4RES B;  2GBX A;  2I8D A;  5KAF E;  3ABV C;  2PP6 A;  1NDO A;  1G1J A;  1HWT C;  2M0B A;  2E5T A;  1YYC A;  5KJ7 C;  1Y8A A;  4AYC A;  2GUS A;  1NTK G;  1O7M A;  3CWB D;  4QDF B;  1DD3 A;  1QGK B;  3EFG A;  1EDJ A;  1TU3 F;  4H0L C;  2JP3 A;  3CD6 P;  2IBZ G;  1N86 A;  4Y28 J;  2JWD A;  2QJY B;  2XV5 A;  2ZYA A;  3IF4 A;  3CC7 P;  1KYO E;  2KP8 A; 
#chains in the Genus database with same CATH homology
 2BMR A;  1OW6 A;  3GCE A;  1K05 A;  3VMI D;  2FBW C;  1O7H A;  4HM1 A;  3GF3 A;  1EXI A;  5AEU A;  2YMK A;  4NB9 D;  3GTS A;  1OW8 A;  2QSI A;  4NBG D;  2V7Q J;  1YQ3 C;  3O6Q A;  1RIE A;  1RFS A;  3C8V A;  3AE5 C;  2QJY C;  2NVF A;  4QDF A;  2WSC J;  1O7P A;  2E76 D;  3GTE A;  1G8J B;  1UUV A;  4H13 C;  3S9O A;  2YFJ A;  2K9Y A;  2HMO A;  1NU1 E;  1JM1 A;  4IL6 X;  3GF7 A;  1KOR A;  2D2C B;  1L0N E;  1KIL E;  2E74 B;  1NTZ E;  4R4M A;  2B1X A;  3N0Q A;  2E76 C;  1VF5 D;  3GZY A;  3AE4 C;  4QUQ A;  3AE6 C;  3LW5 J;  4NB8 D;  5BOK A;  3Q5R A;  3AEE C;  1KTM A;  2MKV A;  1SJG A;  4HM3 A;  2E4P A;  1FQT A;  2JO6 A;  2CKF A;  1FDI A;  2D2C D;  4H0L B;  3D71 A;  1KQG B;  1VF5 C;  3GZX A;  3L75 E;  2YFI A;  4OGQ D;  2BMO A;  2YFL A;  4NBF D;  4QUP A;  3GOB A;  2HMN A;  1DIP A;  1ZRT E;  1NYH A;  4HM7 A;  4RKU J;  4PD4 E;  4NBD D;  1OW7 A;  3RK3 E;  2D2C C;  4EMJ B;  4OGQ C;  5KLV E;  5AEW A;  2JZA A;  2E74 C;  4I7Z B;  1ZP0 C;  1RQV A;  1O7W A;  2ZYL A;  2QJP C;  5KLI C;  4QDC A;  1AJY A;  3EN1 A;  2IDB A;  1IK7 A;  3FGA D;  4H44 D;  2NUM A;  1BE3 E;  3RL0 g;  3C0D A;  2E75 B;  3CXH E;  1NTK E;  3VCP A;  2YIU C;  1KB9 E;  1SQX E;  4HM2 A;  2HMM A;  2DE6 D;  1O7G A;  2XR8 A;  1VM9 A;  4H44 C;  3VMG D;  5CXM A;  2B24 A;  2IBZ E;  2ZT9 D;  3B71 A;  3IAO A;  2E75 D;  4I7Z C;  1ULJ A;  3G9R A;  1PPJ E;  2NVE A;  4QDD A;  1UIX A;  2HMJ A;  2E76 B;  1HJ0 A;  1EG9 A;  1MKM A;  3BCC E;  3Q5P A;  3D89 A;  5M1B A;  3Q5S A;  1Q90 D;  4AIV A;  2E75 C;  5HL4 A;  1Y9B A;  2I7F A;  4HM6 A;  1VF5 B;  3AE9 C;  3L73 E;  1NTM E;  5KKZ C;  1S5L X;  4NBH D;  4PV1 B;  1Q90 C;  2BEZ F;  1VL2 A;  4NBE D;  3R4Y A;  3EWK A;  3AE2 C;  3D70 A;  1ZME C;  4OGQ B;  3L71 E;  2JO1 A;  1WMK A;  3GL0 A;  1NYK A;  3D6Z A;  2FXP A;  4PV1 D;  2HML A;  3AEC C;  4P1C H;  3AZC A;  3VMH D;  2H88 C;  3AED C;  3GMA A;  4HM5 A;  1R8E A;  1SQV E;  4XFJ A;  2BCC E;  4PV1 C;  1G8K B;  4U7J A;  2A06 E;  2GBW A;  2DE7 D;  4H44 B;  2NVG A;  3H25 A;  3L70 E;  2H89 C;  2P10 A;  2BEQ D;  2O01 J;  4HKV A;  3AE7 C;  2XRX A;  4R4L A;  1SQQ E;  3AEG C;  3GKE A;  4QCK A;  3D6Y A;  2WSF J;  3H1I E;  2ZT9 B;  2NZ2 A;  2QIW A;  2WPV B;  3GB4 A;  2HMK A;  3AEB C;  3H1H E;  2Q3W A;  3TGU E;  4P1B H;  1JB0 J;  1RQU A;  2QJK C;  1KMI Z;  3H1L E;  1SQP E;  2J5U A;  1PP9 E;  3FOU A;  1FDO A;  4NBC D;  3GL2 A;  2ZT9 C;  3VCA A;  1EXJ A;  3AE3 C;  1SQB E;  5L8R J;  2BMQ A;  3Q2Y A;  3AE1 C;  4NBA D;  3AE8 C;  1U57 A;  4NBB D;  2WSE J;  2NWF A;  3H1K E;  1P84 E;  3CX5 E;  2XSH A;  3T97 B;  4QUR A;  4H13 D;  3AEA C;  1ZOY C;  1BCC E;  2QPZ A;  3Q3D A;  1GMJ A;  1ULI A;  4Z1M H;  1VCK A;  3EQQ A;  4U3F E;  4HM0 A;  4YXD C;  2FYN C;  2FYU E;  4HM8 A;  2NUK A;  3SFD C;  1S1C X;  1WQL A;  2G3A A;  1PV3 A;  4GDO A;  3H1J E;  4TT3 H;  2WQY C;  4YTP C;  2XSO A;  1L0L E;  3Q1M A;  3SFE C;  4KT0 J;  4HJL A;  1KQF B;  3DQY A;  1PIX A;  2E74 D;  2GBX A;  4HM4 A;  1YQ4 C;  2G8Y A;  3ABV C;  1HF9 A;  1NDO A;  1PL5 A;  1O7N A;  3CWB E;  1DD4 A;  1K04 A;  4H0L D;  2E4Q A;  3AEF C;  3L74 E;  1O7M A;  1UUW A;  1NGM B;  4QDF B;  1DD3 A;  1TU3 F;  4H0L C;  3GLM A;  2JP3 A;  1EZV E;  4Y28 J;  2YVJ B;  3IN6 A;  2OQQ A;  3L72 E;  1OMI A;  1KYO E;  4H13 B;  4AAY B;  2DE5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...