2ZT9D

Crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 33
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2008-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2zt9D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2zt9D02
1Q90C 4NBED 5KLVE 4NB9D 4HM3A 2E74D 2E75D 1SQBE 3D89A 4HM8A 4P1CH 3GKEA 4PD4E 4QDFA 4H0LD 3VCPA 4NBGD 1G8JB 2E4PA 4NBAD 2NVFA 1SQQE 2DE5D 4U3FE 5HL4A 1VF5C 4HM6A 2E4QA 1PPJE 2YFLA 4H0LC 2HMJA 2XSOA 1EG9A 2HMNA 1ZRTE 4HM5A 1PP9E 2D2CD 2XSHA 2YFIA 2ZT9C 4QCKA 3VMID 3GTEA 3L74E 1SQXE 3L73E 1UUWA 4H44C 2XRXA 5CXMA 4NBFD 3VMHD 5AEUA 2QPZA 1SQVE 3GTSA 2I7FA 3L71E 4QDDA 2YFJA 2YIUC 3GOBA 1SQPE 5AEWA 3H1HE 1NYKA 2E75C 2GBXA 5KKZC 2NWFA 1NDOA 2BCCE 3L72E 4EMJB 2QJPC 1EZVE 3N0QA 3L75E 3GL0A 1ULIA 4HM0A 4HM2A 4H13D 2BMQA 3VCAA 1UUVA 1KYOE 1NTZE 1BCCE 1NTKE 2GBWA 4NBDD 2A06E 2DE7D 4QUQA 4NBCD 1L0LE 2YVJB 3CWBE 3GB4A 2HMOA 4OGQD 4QDFB 2CKFA 4OGQC 4I7ZC 1JM1A 2IBZE 4NBHD 2Q3WA 3H1IE 3GL2A 4H44D 2NVEA 2ZYLA 1L0NE 4HKVA 2NVGA 2BMOA 2JO6A 2NUMA 3FOUA 1RIEA 3CXHE 3GZXA 2B1XA 3BCCE 3GZYA 2FYNC 4PV1D 4HJLA 1VF5D 1O7GA 3TGUE 3L70E 4P1BH 1O7PA 3H1JE 1O7NA 1G8KB 1SJGA 5KLIC 3VMGD 5BOKA 2E76C 4HM1A 1FQTA 1VM9A 4H13C 1KB9E 1NTME 2QJKC 4HM7A 4NBBD 4NB8D 1O7WA 2FYUE 4QURA 2QJYC 4HM4A 2BMRA 3H1KE 2YMKA 2HMMA 4AIVA 2E76D 3H1LE 4AAYB 1RFSA 3AZCA 2HMKA 2XR8A 1O7MA 1O7HA 4PV1C 1NU1E 1ULJA 2E74C 1WQLA 2D2CC 3DQYA 4QUPA 1VCKA 2ZT9D 1BE3E 1P84E 2JZAA 3EQQA 4QDCA 2HMLA 3GCEA 2DE6D 3C0DA 3EN1A 2NUKA 3CX5E 2B24A
chains in the Genus database with same CATH superfamily
3BATA 4QDFA 2MKVA 4EI2A 1M56D 3UIAA 2HODA 1SQXG 2KZJA 1G8JB 3L35A 3CLQA 1PPJE 2WPSA 2YXRB 2N1TD 3M9HA 3CL3D 5AW5B 1VQKP 1SQXD 1MKMA 4O9BA 1IC2A 4N3YB 1EDLA 4HB1A 4DZOA 1SQQD 3GF7A 3M0DA 2L5GB 3CI9A 4WB4A 3L75E 3RK3E 3NTNA 2W27A 5TISE 2HODB 1W2EA 2A06D 3WMM0 4N6JA 4I7ZC 1BCCJ 1S4XA 1URQC 2PP6A 2DW3A 3L75D 3AECC 3W68A 3D70A 3TNUA 2Z5HA 1RIEA 2Q3EA 1W5CE 3MGNA 4YXDC 1OZHA 1GK6A 4NPFX 1N73B 1L4AB 4I2LC 4L73A 1AA0A 1LTJA 1PP9D 1NO4A 1L0ND 5AVRB 2IBZD 1KQFB 2JZAA 2GM4A 5CCGC 1YI2P 1KILA 2LXBA 2AEJA 1USEA 3H32B 3T97A 2IBZI 4NB9D 1SQPG 2YKPA 4K35A 1WT6A 4PJ0H 2C9LY 1SQPJ 3M0AA 1NJIQ 3L71G 4XFJA 2RH0A 3B5NC 4I7ZB 5AW6B 5GTHH 1BE3G 4R4LA 1W2BO 1KQGB 4DT0A 5CXMA 1SQVE 2QM8A 3L74D 1PL5A 3L73J 3GOBA 1NYKA 1E5WA 3JCUH 4BRYB 2YO2A 1YJNP 3N0QA 2W6AA 3VCAA 1J1DC 3CWBE 2ZAEB 1BCCG 2JR8A 5AW2B 3U1AA 1RY3A 1S5LX 1IFDA 4NPEA 3CCRP 1NOHA 3B5ND 1OW8A 1FU1A 2NPSA 3HD7B 3CXHE 3VP8A 1CZQA 2FYNC 1NTMD 3RK3C 3R4YA 2W90A 3H1KJ 1S9KE 3O8ZA 1M1JC 5AW8B 2Q5UA 1EZVI 1JOCA 2HMMA 1QX8A 4MN4C 2XR8A 3SWFA 1BSHA 2J5UA 1BE3E 1P84E 2NPSB 1NU1G 4PD4E 5CHXA 3VMYA 4HM3A 3ABVC 3RL0C 3AE9C 3SWYA 4IL6X 3HUSB 1H8AA 1SP4A 3A0BE 1T2KC 3BVHA 4DCKA 3GMAA 5B5EE 2KK7A 4H44B 2HLOA 2ZT9C 1Y8AA 1PGOA 2KXPB 2L91A 4JYBA 4UB6H 2KSJA 3ITKA 5AVZB 2K88A 1WRGA 1K8AQ 2IYOA 1SQBG 1QVFO 2O01N 2A06E 3RK2C 4L75A 4NBCD 3HUSA 3CC7P 4GKGA 2NRGA 3A0BH 2ZYLA 5KAIE 4WBAA 3TNUB 2QJYB 5CMZA 1GTWA 3JSVC 1O7NA 1GK4A 2FFDA 1PIXA 3PLNA 3V6IA 1LTAC 3CMEP 1SQBJ 2PRRA 2P10A 3VMAA 1URQA 3CXHD 1RF1C 1LTIC 3CCSP 3T97B 2WSCH 4EIJA 2ZT9D 1HBWA 3VYIA 3EN1A 1RF0A 2GUVA 5CJ0A 4OH8B 2H8PD 4WY4A 3Q5RA 2E4PA 2M3EA 5DJTB 3TGUJ 1VDFA 2E4QA 2Y9ZA 3VOPA 1RHZB 3L72G 4HM5A 1FC2C 3VMID 2R5BA 1SQVD 3L74E 2NPSC 3WUVA 2YFJA 1SQPE 1X22A 2POHA 1P84H 2OARA 4EMJB 1VQOP 4L76A 3H1ID 1NTKG 3AEBC 1G2CA 1ULIA 3KPEA 3USSA 3CWBD 2FYUD 4GOEA 1MZ9A 1LTJB 3MZWB 3H1IG 1Q81Q 2KB7P 3H25A 1KB9D 4EYYQ 2NVGA 2BMOA 2FYNB 2Y0CA 3FOUA 3GF3A 3Q3DA 1EDJA 2B87A 3O6QA 1QL2A 1VQ7P 4AQRD 4OWFA 2E76C 1AFOA 5KLVJ 1YYCA 3M9BA 1NTME 4GOFA 1HWTC 1FZCC 1XTGB 3H1KE 1FZCB 2JDIH 1L0LG 1J1DB 1G1JA 1JY2P 2GA1A 5KJ7D 3F89A 4D6TD 5APSA 2WPRA 1IK9A 1YHQP 2OTKE 3VCPA 4C46A 3GW6A 5EFWB 2E5TA 3PJSK 3B71A 2HMNA 3AE8C 4RO0A 1JUNA 1SQXE 1UUWA 2RKLA 2FYZA 4W7YA 1KB9H 4QDDA 1NDOA 1LWUB 1T3JA 5CCHC 2E75B 5KKZB 1NTKJ 4LC1A 1QGKB 1SQBD 1KYOE 1BCCE 1OVVA 2DE7D 1FZCA 1LJ2A 2OYHB 1HGZA 3GHGA 2IBZE 4UB6E 1ZV8A 3CCQP 1EDIA 2NVEA 4RJTA 3H1JD 1YTZI 4KJMA 4AYCA 1NYHA 2WSCJ 4PV1D 5C39A 1O7GA 1P84I 2VRSA 3CMAP 1FS0E 3D71A 1NTZK 4HM1A 3IR9A 2OYIA 4IOIH 4LGDE 1CSBA 3KDPB 2QE7H 3D6YA 3TSIA 2QM7A 3CX5D 1M7LA 2KUBA 3U1CA 1HUCA 4N78D 3A0HE 2IBZG 4IL6E 2HR3A 1GW3A 4NBAD 1L0NJ 1M8OB 1MV8A 3CPWO 1A02J 1GDTA 1DEBA 1LNQA 1IO4A 1FJKA 5APXA 2K3RA 1SFCA 1SQQE 1GL2A 3L70J 3MD0A 3PRJA 4C7NB 2CK3H 1EZVD 3IFMA 4DOJA 1X79B 1QEXA 1VQ5P 4WY4C 1N86A 2XNDH 4H44C 2OYIC 3SFDC 1TU3F 3HD7D 3H1HE 3P7KA 2M0BA 1J1EC 4UB8H 4EDFA 3H1LD 1UUVA 4GIFA 4BWNA 4QUQA 4PD4I 1H0TA 1PZQA 3JCUE 2B87B 1OFCX 3P8CD 3EFGA 1JY3P 3HD7A 1SQQG 3H1KG 3BCCE 4HJLA 2WZ7A 3VN0A 2NPSD 3P8MC 2JWAA 2JWDA 1FDMA 1JY3O 2JKVA 2WQYC 3AEAC 2E74B 1N7SD 5CCHA 1NTMJ 2KI7B 1SQPD 1BGYE 3FWLA 3M91A 4XE5B 2Q9IA 2CPBA 2JEEA 2PGDA 2ZXXA 4QURA 2B89A 2G8YA 5B66E 3C8VA 3HTKB 3AZCA 1S5LE 3L74J 2Q3IA 1K04A 2I1JA 1L0LJ 5BU8B 2FYUK 1NAYA 2E43A 4JBZA 2OTLP 1MFZA 1BGYJ 2N1TC 4IFFA 3PTZA 4UB8E 3AE1C 1DH3A 5HL4A 3CXHI 1SQPK 2JO1A 2HMJA 4WY4D 1LT9A 2R3CA 5AVXB 1A02F 1JB0J 1BE3J 2BEZF 3AE5C 2XRXA 1R5LA 1Q7YQ 1FDIA 2I7FA 2HG5D 1ZXGA 3KXDA 2ZYDA 1JEKA 1NU1D 1EZVE 1JNMA 5TISH 2ZJSE 2ZFCA 1KFMA 3EFFK 2O3JA 2FY8A 2AXCA 3H1HJ 3A0HH 3HE4A 4KT0J 2QVAA 2BCCG 1CI6A 3K5BA 2B1XA 1DD3A 1UIXA 1T2KD 4C7NA 3L70E 3NXSA 1VQPP 3AE7C 1SVFA 2FFDB 1N73C 2SPZA 2AEMA 1N2DC 1KD1Q 5K5GB 5DJUB 1T3UA 4BXLA 1JO5A 1GZLA 3FGAD 3AE6C 1OVUA 1LTSC 3KZIE 1WQLA 2D2CC 2A45G 1BDDA 1Q90D 4NBED 1VQ6P 1KILE 2IX7C 3VTPC 1BSNA 3H1LJ 1L4AD 4H0LD 4NBGD 2OYHA 1NVOA 3GHGC 2NVFA 3AEFC 1K73Q 4I6MC 1SFCB 3C1LA 5H2FE 1SQQK 3GTEA 2IZ1A 5CCGA 1L0LK 3B5NA 3MUDC 3OJAB 3G4SP 2YKOA 1NTZJ 2C0XA 3L74G 3M9QA 4HM0A 2Z5IA 3RK2B 2K1AA 3Q5PA 4YTPC 3AEDC 1N7LA 1FZGA 2WSFJ 3N4XA 1S2EA 2AXTE 1LP1A 1AQ5A 3L72D 3TDKA 3SFEC 3ZDMA 2KNCA 1HJBA 1KQLA 5KLIC 2NZ2A 3LIEA 5GTIH 3TGUD 2BEQD 3AEGC 3BASA 2RN0A 1N73A 2V7QJ 3B5NB 5KLVD 1ULJA 5CCGD 3G6EP 5E79E 3HRNA 1DX7A 1Q90C 3H32A 4JYCA 3H1IJ 3NMDA 2QSIA 3LIDA 3CC4P 2JJLA 1SFCD 3I5CA 1NU1K 5M1BA 2A06G 1PP9E 1M1JA 2OYIB 4ASVA 3TF5A 3L73E 1KILD 1LTGC 2Y0EA 1N8RQ 2RMZA 5AW9B 1GU5A 1H0TB 1KB9I 1YQ4C 5KLVK 3JC22 3RK3B 3CCLP 4HM2A 2GBWA 1HF9A 1NTKE 3WU2H 3WUUA 2YVJB 3H1JG 1AQTA 4OVNF 3L37A 4GDOA 3B4SA 1RF1A 3PH0A 4HKVA 2BCCD 2O1KA 4TT3H 1AVYA 1NWQA 1YBKA 5B66H 1L0NG 4D6TJ 1LP1B 4JF7A 1T6AA 1OXZA 2IPPA 2KS1B 5BOKA 1NH4A 1YITP 1GD2E 4NB8D 1LT9C 1X0TA 2QJYC 1VQMP 5L8RJ 4AIVA 4Z1MH 3Q2YA 3V4QA 2HMKA 2XNXA 4U3FD 1IFJA 4QUPA 1KYOI 1YJ9P 4M3LA 1LGHB 1EC5A 1GL2D 2H88C 5KLVE 2IFMA 1NTKD 1KYOD 4HM8A 1R5SA 2XKMA 1RQUA 4R4MA 1FZBA 2YNYA 2KZIA 4RKUJ 3H1LG 4HM6A 2IZ0A 1L0NK 1RQVA 2YFLA 3MUDA 1JM0A 2R5DA 1M90Q 1PV3A 1LT1A 2D2CD 5AEUA 2ZT9B 3HE5B 2JP3A 3RL0D 1NKZB 2I1KA 2KYVA 1IFIA 4H13D 4GT1A 1SQBK 1NTZE 3I55P 3D6ZA 3AE2C 1EXJA 4Y99B 2YMYA 4QDFB 1HGVA 1JM1A 2LR2A 3CCEP 3E7KA 1AJYA 2JO6A 1EXIA 2Q6QA 3B8EB 1L2PA 3U59A 4D6TG 2QEXP 1VF5D 1MUUA 3BCCD 4ZKPA 2OTJP 1KFNA 1G8KB 3CX5I 1ZP0C 4L74A 2K9JB 5KTBA 1K05A 1GL2C 3BRTB 2R44A 1YJWP 4WVZA 1LWUA 2N1TB 3RL0g 1RF0C 2ITAA 1O7HA 1J2JB 1NU1E 3KQGA 1ZW0A 1VL2A 3EQQA 3CCUP 1HTLC 4HH2A 1S72P 3D89A 2XU6A 1IK7A 2OYOA 4YXWH 1IFMA 1RE3A 2WMMA 2FXOA 1VF5C 2V7QH 2LKMA 1S5LH 1CI6B 2BCCJ 2IDBA 4XA4A 1KMIZ 2WVRA 4BRYA 2FKWB 2P67A 3RL0B 2KSEA 3FXDA 2O01J 3S4RA 4PD4D 4HYTB 4CPGA 1KILC 1LTJC 5AVSB 2R32A 3HTKA 4HJGH 1E79H 1N7SC 1L0LE 3GB4A 4NBHD 2Q3WA 3BRVB 5KAFH 4B86A 1WMKA 1AV1A 1M57D 2GUSA 1L0LD 2I8DA 3M0DC 3HE4B 2HYNA 4P1BH 1O7PA 1Q86Q 3H1JE 1ZMEC 1FZAA 3SSUA 1RE3C 2OYHC 1NTMG 5KLIB 3A2AA 1NTMK 3RBZA 1Y47A 1OMIA 1LT9B 2C0WA 3P8CE 4ZNCA 5AW7B 1QVGO 3II6A 1VCKA 4QDCA 4PV1B 2HPCA 3GCEA 3VMHD 3R2PA 1NU1J 1H88A 1OX3A 3L36A 1X9VA 1VQ4P 3AE4C 3QWOC 1H89A 1ZRTE 3L70G 1IFPA 5AW1B 2WSSH 4JPZB 3BCCJ 2ZYGA 2FBWC 3H6PA 2IFNA 3E1IA 3BCCG 2BMQA 1K9MQ 2FYUG 4NBDD 1IJDB 3KYQA 2A45H 1RE4C 1EZVG 1VQLP 3TK1A 3LW5J 1FZFA 1SQXJ 1FZEA 3FWNA 2C9NY 3A7OA 2WITA 2Q1KA 3MP7B 2M5AA 3IAOA 1KYOH 2OQQA 1SQQJ 1ZLLA 1HJ0A 1SQVK 1MFTA 3CWBG 1SQXK 2KS1A 2YIUB 1HH0A 4ZMDA 4TLFA 5AVTB 2V4HA 4Y99C 3RBXA 1FJPA 4H13C 1KB9E 2QG4A 1O7WA 2BMRA 2B9BA 4ZKUA 1O7MA 2N1TA 1KILB 1DEEG 3OAKA 2W6BA 1PGJA 2B24A 1R8EA 2YKQA 5AVWB 2E74D 2KIKA 4U3FG 1RH5B 3OW2O 2YXQB 2E42A 3NFQA 2H7HA 1KQSO 1BGYG 4U3FE 1PP9G 4H0LB 1J1EB 3CCJP 4C7RA 5TJHA 2Y0DA 4EOTA 3L72J 1PP9J 2WPQA 1VQNP 2YFIA 3L70D 1KORA 2ZYAA 1LTBC 3FX0A 2P1JA 2XV5A 2WT7A 4D6TE 2UWJE 1IZNB 5AEWA 3A5TA 2R3SA 1ZRTD 3L72E 1JTHA 2XZRA 2AEFA 1G2CB 1XTCC 1KC8Q 3L75J 1KV4A 2N9BA 5AVQB 1GMJA 1Y9BA 2HMOA 4OGQC 4WY4B 1U7MA 3C9IA 1SLQA 3EQ2A 3GHGB 4OGQB 3H1HG 2NUMA 3Q1MA 2PFXA 3GZYA 2OGUA 3EWKA 1JMMA 1VQ9P 1NKNA 2K9YA 2P7JA 4LLHA 1DIPA 2QA4P 3L75G 2QJKC 3CCMP 4W7ZA 3PHLA 2FYUE 4HM4A 4AAYB 1NHLA 4A7PA 3WUTA 2D2CB 2ZVNB 4PV1C 4ASWA 5GTIE 3SWKA 3V2PA 3I56P 1JCCA 2ZXEB 5CBOA 3CC2P 1BDCA 1Q82Q 5CJ4A 4U3FJ 1SQBE 1NGMB 4P1CH 3V5BA 5CBNA 1G1IA 1KTMA 4N78E 2KNCB 1BGYD 3CCVP 2P2UA 2FFDC 3OA7A 3AE3C 2XSOA 2G3AA 3F5HA 2FXMA 1KN7A 2HFED 1ZOYC 3LW5H 5AW0B 4NBFD 2QPZA 2A45I 5GTHE 5AW4B 2M5AB 1OW7A 2WPVB 2E75C 2GBXA 1BE3D 1PGQA 1VF5B 5KKZC 4NPDA 1ZR4A 1PGPA 3V2QA 1X8YA 1JY2O 4KHXA 1NTKK 4PJ0E 3V2NA 3VMZA 1UIIA 3VP9A 3RK3D 4QMAA 2KOGA 5KAIH 3H1JJ 4OGQD 1VPCA 3KHUA 3L71J 1FAVA 1VQ8P 4IFDK 1N7SA 1YTZT 3H1IE 2IYPA 3W67A 1S1CX 1FE6A 4YPCA 1ZN5A 3H1KD 1YQ3C 3H1HD 2J59M 2P58A 1JY2N 3L73G 2LXCB 3TGUE 1IFNA 3RK2D 2MJZA 1FQTA 4HM7A 2HPCB 5AW3B 2Q7CA 4RESB 5B5EH 3H1LE 3MHVA 1OIPA 1FBMA 3GG2A 3P32A 2E74C 2E76B 3DQYA 1GW4A 3M06A 2DE6D 2PAJA 2YO3A 3G3ZA 1FDOA 3HUSC 2E75D 1PFIA 3GKEA 2K9JA 5H2FH 3O6QB 1Q2NA 2XDJA 1JMBA 3TGUG 1LWUC 5AVVB 1EG9A 5APUA 2O1JA 1SFCC 2XSHA 2B88A 2QIWA 4QCKA 1PPJD 3L71E 2YIUC 1EQ7A 3GLMA 5BVZA 3IF4A 1D7MA 5CCHD 3GL0A 1PPJG 1LTTC 3WU2E 3G9RA 5APTA 5AVYB 1CW5A 3CXHH 1NTZD 4AUWA 1HVVA 2M8RA 2QJKB 2O01H 4H44D 1U7JA 2W8ZA 1DD4A 2H89C 1USDA 2WSEH 3PP5A 3GZXA 2H43A 5APQA 4PD4H 3TYYA 1URQB 1SJGA 2QRXA 1S9KD 2KP8A 2E5YA 1Z56A 1YIJP 1NTZG 3Q5SA 1BCCD 2E76D 5E79H 1QL1A 1U57A 1SS1A 2CPSA 3L4FA 3S9OA 4K3AA 2K37A 4Y28J 4HKZH 2HMLA 3C0DA 1JCDA 3CX5E 2KLUA 1S3JA 2FXPA 2M3BA 5APVA 2ZVOB 2WWWA 3VMXA 3G71P 5KJ7C 1OWAA 3HE5A 2DE5D 1SQVJ 4U7JA 4WWIA 3FXEA 2W6JH 3L71D 4H0LC 1L4AC 1EDKA 3RGUA 1JY3N 4IFMA 5KLVG 4I1LA 2J58A 5KJ7A 3GTSA 3V2RA 1GL2B 2WT7B 4GODA 3CD6P 1FOSF 4DJGA 3AEEC 2AXTH 3CWBJ 1GU4A 2NWFA 2N9YB 2FYUJ 2BCCE 5KAFE 2QJPC 1T8ZA 3V4WA 2WSFH 3A3YB 1N7SB 2BASA 2WSEJ 3E1RA 1AVOA 1KZUB 1OW6A 1P84D 2CKFA 3CX5H 1SQVG 4JQ0D 3GL2A 3N7NA 2Y9YA 1L0NE 1QLED 1ZR2A 2WTYA 5APYA 5AVUB 1URQD 3L73D 1RF1B 3QH9A 1OVRA 1M1KQ 3IN6A 2W83C 4H13B 4IL6H 3VMGD 1M1JB 5BU5A 3S1KA 1VM9A 1RE4A 1NAFA 4NBBD 1L4AA 4W80A 2YMKA 2QJPB 3HD7C 1RFSA 2Z4EA 3KZIH 5APWA 1JTHB 1FOSE 3MTUE 3MIWA 2KLVA 2NUKA
chains in the Genus database with same CATH topology
1R8EA 1Q90C 2E74D 2QSIA 4QDFA 2MKVA 3VCPA 1G8JB 4U3FE 4H0LB 1PPJE 5M1BA 3B71A 2HMNA 3AE8C 1PP9E 1MKMA 2YFIA 1KORA 1SQXE 3L73E 1UUWA 4QDDA 5AEWA 1YQ4C 3GF7A 1NDOA 3L72E 2E75B 3L75E 3RK3E 4HM2A 1KYOE 2GBWA 1HF9A 1BCCE 1NTKE 2DE7D 1GMJA 1Y9BA 2YVJB 2HMOA 4OGQC 4I7ZC 2IBZE 4GDOA 3AECC 2NVEA 4HKVA 4OGQB 3D70A 4TT3H 2NUMA 3Q1MA 1RIEA 3GZYA 1NYHA 2WSCJ 3EWKA 4PV1D 1O7GA 4YXDC 2K9YA 3D71A 5BOKA 4HM1A 1DIPA 2QJKC 4NB8D 2FYUE 2QJYC 5L8RJ 4HM4A 4AIVA 4AAYB 3D6YA 4Z1MH 3Q2YA 2HMKA 2D2CB 4PV1C 4QUPA 1KQFB 2JZAA 2H88C 4NBAD 5KLVE 4NB9D 1NGMB 1SQBE 4HM8A 4P1CH 1RQUA 4R4MA 4RKUJ 1KTMA 1SQQE 4XFJA 4HM6A 1RQVA 3AE3C 2YFLA 2XSOA 2G3AA 4I7ZB 1PV3A 4R4LA 2D2CD 1KQGB 1ZOYC 4H44C 5AEUA 5CXMA 4NBFD 2ZT9B 2QPZA 3SFDC 1SQVE 1TU3F 1PL5A 1OW7A 3GOBA 3H1HE 2JP3A 1NYKA 2WPVB 2E75C 5KKZC 2GBXA 1VF5B 3N0QA 4H13D 3VCAA 1UUVA 1NTZE 3D6ZA 3AE2C 1EXJA 4QUQA 3CWBE 4OGQD 4QDFB 1JM1A 1S5LX 3H1IE 1S1CX 1AJYA 1OW8A 2JO6A 1YQ3C 1EXIA 3CXHE 3BCCE 2FYNC 4HJLA 1VF5D 3R4YA 3TGUE 2WQYC 3AEAC 1G8KB 2E74B 1ZP0C 1K05A 1FQTA 4HM7A 4QURA 2G8YA 3RL0g 2HMMA 3H1LE 3C8VA 3AZCA 2XR8A 1O7HA 1NU1E 2J5UA 1VL2A 2E74C 2E76B 1K04A 3DQYA 1BE3E 1P84E 3EQQA 2DE6D 4PD4E 1FDOA 4HM3A 3ABVC 2E75D 3D89A 3AE9C 3GKEA 4IL6X 1IK7A 3AE1C 5HL4A 1VF5C 2JO1A 2HMJA 1EG9A 3GMAA 2IDBA 1JB0J 1KMIZ 4H44B 2XSHA 2ZT9C 4QCKA 2BEZF 2QIWA 3AE5C 2XRXA 2O01J 1FDIA 2I7FA 3L71E 2YIUC 3GLMA 1EZVE 3GL0A 3G9RA 2A06E 4NBCD 1L0LE 3GB4A 4NBHD 2Q3WA 4H44D 4KT0J 2ZYLA 1DD4A 1WMKA 2H89C 3GZXA 2B1XA 1DD3A 1UIXA 3L70E 4P1BH 1O7PA 3AE7C 3H1JE 1O7NA 1ZMEC 1SJGA 1PIXA 2P10A 1OMIA 3Q5SA 2E76D 3FGAD 1U57A 3AE6C 3T97B 3S9OA 1WQLA 2D2CC 4QDCA 1VCKA 2ZT9D 4PV1B 4Y28J 2HMLA 3GCEA 3C0DA 3VMHD 3EN1A 1Q90D 3CX5E 4NBED 1KILE 2FXPA 4H0LD 4NBGD 3Q5RA 2E4PA 2NVFA 2DE5D 4U7JA 3AEFC 2E4QA 3AE4C 4H0LC 1ZRTE 4HM5A 3VMID 3GTEA 3L74E 3GTSA 2YFJA 1SQPE 3AEEC 2FBWC 2NWFA 2BCCE 4EMJB 2QJPC 3AEBC 1ULIA 4HM0A 2BMQA 4NBDD 3Q5PA 4YTPC 2WSEJ 3AEDC 1OW6A 3H25A 2CKFA 2WSFJ 3GL2A 3LW5J 1L0NE 2NVGA 2BMOA 3FOUA 3GF3A 3Q3DA 3IAOA 3SFEC 2OQQA 1HJ0A 3O6QA 3IN6A 4H13B 5KLIC 3VMGD 2NZ2A 2E76C 2BEQD 1VM9A 4H13C 1KB9E 3AEGC 1NTME 4NBBD 1O7WA 2V7QJ 2BMRA 3H1KE 2YMKA 1RFSA 1O7MA 1ULJA 2NUKA 2B24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 C;  4NBE D;  5KLV E;  4NB9 D;  4HM3 A;  2E74 D;  2E75 D;  1SQB E;  3D89 A;  4HM8 A;  4P1C H;  3GKE A;  4PD4 E;  4QDF A;  4H0L D;  3VCP A;  4NBG D;  1G8J B;  2E4P A;  4NBA D;  2NVF A;  1SQQ E;  2DE5 D;  4U3F E;  5HL4 A;  1VF5 C;  4HM6 A;  2E4Q A;  1PPJ E;  2YFL A;  4H0L C;  2HMJ A;  2XSO A;  1EG9 A;  2HMN A;  1ZRT E;  4HM5 A;  1PP9 E;  2D2C D;  2XSH A;  2YFI A;  2ZT9 C;  4QCK A;  3VMI D;  3GTE A;  3L74 E;  1SQX E;  3L73 E;  1UUW A;  4H44 C;  2XRX A;  5CXM A;  4NBF D;  3VMH D;  5AEU A;  2QPZ A;  1SQV E;  3GTS A;  2I7F A;  3L71 E;  4QDD A;  2YFJ A;  2YIU C;  3GOB A;  1SQP E;  5AEW A;  3H1H E;  1NYK A;  2E75 C;  2GBX A;  5KKZ C;  2NWF A;  1NDO A;  2BCC E;  3L72 E;  4EMJ B;  2QJP C;  1EZV E;  3N0Q A;  3L75 E;  3GL0 A;  1ULI A;  4HM0 A;  4HM2 A;  4H13 D;  2BMQ A;  3VCA A;  1UUV A;  1KYO E;  1NTZ E;  1BCC E;  1NTK E;  2GBW A;  4NBD D;  2A06 E;  2DE7 D;  4QUQ A;  4NBC D;  1L0L E;  2YVJ B;  3CWB E;  3GB4 A;  2HMO A;  4OGQ D;  4QDF B;  2CKF A;  4OGQ C;  4I7Z C;  1JM1 A;  2IBZ E;  4NBH D;  2Q3W A;  3H1I E;  3GL2 A;  4H44 D;  2NVE A;  2ZYL A;  1L0N E;  4HKV A;  2NVG A;  2BMO A;  2JO6 A;  2NUM A;  3FOU A;  1RIE A;  3CXH E;  3GZX A;  2B1X A;  3BCC E;  3GZY A;  2FYN C;  4PV1 D;  4HJL A;  1VF5 D;  1O7G A;  3TGU E;  3L70 E;  4P1B H;  1O7P A;  3H1J E;  1O7N A;  1G8K B;  1SJG A;  5KLI C;  3VMG D;  5BOK A;  2E76 C;  4HM1 A;  1FQT A;  1VM9 A;  4H13 C;  1KB9 E;  1NTM E;  2QJK C;  4HM7 A;  4NBB D;  4NB8 D;  1O7W A;  2FYU E;  4QUR A;  2QJY C;  4HM4 A;  2BMR A;  3H1K E;  2YMK A;  2HMM A;  4AIV A;  2E76 D;  3H1L E;  4AAY B;  1RFS A;  3AZC A;  2HMK A;  2XR8 A;  1O7M A;  1O7H A;  4PV1 C;  1NU1 E;  1ULJ A;  2E74 C;  1WQL A;  2D2C C;  3DQY A;  4QUP A;  1VCK A;  2ZT9 D;  1BE3 E;  1P84 E;  2JZA A;  3EQQ A;  4QDC A;  2HML A;  3GCE A;  2DE6 D;  3C0D A;  3EN1 A;  2NUK A;  3CX5 E;  2B24 A; 
#chains in the Genus database with same CATH topology
 3BAT A;  4QDF A;  2MKV A;  4EI2 A;  1M56 D;  3UIA A;  2HOD A;  1SQX G;  2KZJ A;  1G8J B;  3L35 A;  3CLQ A;  1PPJ E;  2WPS A;  2YXR B;  2N1T D;  3M9H A;  3CL3 D;  5AW5 B;  1VQK P;  1SQX D;  1MKM A;  4O9B A;  1IC2 A;  4N3Y B;  1EDL A;  4HB1 A;  4DZO A;  1SQQ D;  3GF7 A;  3M0D A;  2L5G B;  3CI9 A;  4WB4 A;  3L75 E;  3RK3 E;  3NTN A;  2W27 A;  5TIS E;  2HOD B;  1W2E A;  2A06 D;  3WMM 0;  4N6J A;  4I7Z C;  1BCC J;  1S4X A;  1URQ C;  2PP6 A;  2DW3 A;  3L75 D;  3AEC C;  3W68 A;  3D70 A;  3TNU A;  2Z5H A;  1RIE A;  2Q3E A;  1W5C E;  3MGN A;  4YXD C;  1OZH A;  1GK6 A;  4NPF X;  1N73 B;  1L4A B;  4I2L C;  4L73 A;  1AA0 A;  1LTJ A;  1PP9 D;  1NO4 A;  1L0N D;  5AVR B;  2IBZ D;  1KQF B;  2JZA A;  2GM4 A;  5CCG C;  1YI2 P;  1KIL A;  2LXB A;  2AEJ A;  1USE A;  3H32 B;  3T97 A;  2IBZ I;  4NB9 D;  1SQP G;  2YKP A;  4K35 A;  1WT6 A;  4PJ0 H;  2C9L Y;  1SQP J;  3M0A A;  1NJI Q;  3L71 G;  4XFJ A;  2RH0 A;  3B5N C;  4I7Z B;  5AW6 B;  5GTH H;  1BE3 G;  4R4L A;  1W2B O;  1KQG B;  4DT0 A;  5CXM A;  1SQV E;  2QM8 A;  3L74 D;  1PL5 A;  3L73 J;  3GOB A;  1NYK A;  1E5W A;  3JCU H;  4BRY B;  2YO2 A;  1YJN P;  3N0Q A;  2W6A A;  3VCA A;  1J1D C;  3CWB E;  2ZAE B;  1BCC G;  2JR8 A;  5AW2 B;  3U1A A;  1RY3 A;  1S5L X;  1IFD A;  4NPE A;  3CCR P;  1NOH A;  3B5N D;  1OW8 A;  1FU1 A;  2NPS A;  3HD7 B;  3CXH E;  3VP8 A;  1CZQ A;  2FYN C;  1NTM D;  3RK3 C;  3R4Y A;  2W90 A;  3H1K J;  1S9K E;  3O8Z A;  1M1J C;  5AW8 B;  2Q5U A;  1EZV I;  1JOC A;  2HMM A;  1QX8 A;  4MN4 C;  2XR8 A;  3SWF A;  1BSH A;  2J5U A;  1BE3 E;  1P84 E;  2NPS B;  1NU1 G;  4PD4 E;  5CHX A;  3VMY A;  4HM3 A;  3ABV C;  3RL0 C;  3AE9 C;  3SWY A;  4IL6 X;  3HUS B;  1H8A A;  1SP4 A;  3A0B E;  1T2K C;  3BVH A;  4DCK A;  3GMA A;  5B5E E;  2KK7 A;  4H44 B;  2HLO A;  2ZT9 C;  1Y8A A;  1PGO A;  2KXP B;  2L91 A;  4JYB A;  4UB6 H;  2KSJ A;  3ITK A;  5AVZ B;  2K88 A;  1WRG A;  1K8A Q;  2IYO A;  1SQB G;  1QVF O;  2O01 N;  2A06 E;  3RK2 C;  4L75 A;  4NBC D;  3HUS A;  3CC7 P;  4GKG A;  2NRG A;  3A0B H;  2ZYL A;  5KAI E;  4WBA A;  3TNU B;  2QJY B;  5CMZ A;  1GTW A;  3JSV C;  1O7N A;  1GK4 A;  2FFD A;  1PIX A;  3PLN A;  3V6I A;  1LTA C;  3CME P;  1SQB J;  2PRR A;  2P10 A;  3VMA A;  1URQ A;  3CXH D;  1RF1 C;  1LTI C;  3CCS P;  3T97 B;  2WSC H;  4EIJ A;  2ZT9 D;  1HBW A;  3VYI A;  3EN1 A;  1RF0 A;  2GUV A;  5CJ0 A;  4OH8 B;  2H8P D;  4WY4 A;  3Q5R A;  2E4P A;  2M3E A;  5DJT B;  3TGU J;  1VDF A;  2E4Q A;  2Y9Z A;  3VOP A;  1RHZ B;  3L72 G;  4HM5 A;  1FC2 C;  3VMI D;  2R5B A;  1SQV D;  3L74 E;  2NPS C;  3WUV A;  2YFJ A;  1SQP E;  1X22 A;  2POH A;  1P84 H;  2OAR A;  4EMJ B;  1VQO P;  4L76 A;  3H1I D;  1NTK G;  3AEB C;  1G2C A;  1ULI A;  3KPE A;  3USS A;  3CWB D;  2FYU D;  4GOE A;  1MZ9 A;  1LTJ B;  3MZW B;  3H1I G;  1Q81 Q;  2KB7 P;  3H25 A;  1KB9 D;  4EYY Q;  2NVG A;  2BMO A;  2FYN B;  2Y0C A;  3FOU A;  3GF3 A;  3Q3D A;  1EDJ A;  2B87 A;  3O6Q A;  1QL2 A;  1VQ7 P;  4AQR D;  4OWF A;  2E76 C;  1AFO A;  5KLV J;  1YYC A;  3M9B A;  1NTM E;  4GOF A;  1HWT C;  1FZC C;  1XTG B;  3H1K E;  1FZC B;  2JDI H;  1L0L G;  1J1D B;  1G1J A;  1JY2 P;  2GA1 A;  5KJ7 D;  3F89 A;  4D6T D;  5APS A;  2WPR A;  1IK9 A;  1YHQ P;  2OTK E;  3VCP A;  4C46 A;  3GW6 A;  5EFW B;  2E5T A;  3PJS K;  3B71 A;  2HMN A;  3AE8 C;  4RO0 A;  1JUN A;  1SQX E;  1UUW A;  2RKL A;  2FYZ A;  4W7Y A;  1KB9 H;  4QDD A;  1NDO A;  1LWU B;  1T3J A;  5CCH C;  2E75 B;  5KKZ B;  1NTK J;  4LC1 A;  1QGK B;  1SQB D;  1KYO E;  1BCC E;  1OVV A;  2DE7 D;  1FZC A;  1LJ2 A;  2OYH B;  1HGZ A;  3GHG A;  2IBZ E;  4UB6 E;  1ZV8 A;  3CCQ P;  1EDI A;  2NVE A;  4RJT A;  3H1J D;  1YTZ I;  4KJM A;  4AYC A;  1NYH A;  2WSC J;  4PV1 D;  5C39 A;  1O7G A;  1P84 I;  2VRS A;  3CMA P;  1FS0 E;  3D71 A;  1NTZ K;  4HM1 A;  3IR9 A;  2OYI A;  4IOI H;  4LGD E;  1CSB A;  3KDP B;  2QE7 H;  3D6Y A;  3TSI A;  2QM7 A;  3CX5 D;  1M7L A;  2KUB A;  3U1C A;  1HUC A;  4N78 D;  3A0H E;  2IBZ G;  4IL6 E;  2HR3 A;  1GW3 A;  4NBA D;  1L0N J;  1M8O B;  1MV8 A;  3CPW O;  1A02 J;  1GDT A;  1DEB A;  1LNQ A;  1IO4 A;  1FJK A;  5APX A;  2K3R A;  1SFC A;  1SQQ E;  1GL2 A;  3L70 J;  3MD0 A;  3PRJ A;  4C7N B;  2CK3 H;  1EZV D;  3IFM A;  4DOJ A;  1X79 B;  1QEX A;  1VQ5 P;  4WY4 C;  1N86 A;  2XND H;  4H44 C;  2OYI C;  3SFD C;  1TU3 F;  3HD7 D;  3H1H E;  3P7K A;  2M0B A;  1J1E C;  4UB8 H;  4EDF A;  3H1L D;  1UUV A;  4GIF A;  4BWN A;  4QUQ A;  4PD4 I;  1H0T A;  1PZQ A;  3JCU E;  2B87 B;  1OFC X;  3P8C D;  3EFG A;  1JY3 P;  3HD7 A;  1SQQ G;  3H1K G;  3BCC E;  4HJL A;  2WZ7 A;  3VN0 A;  2NPS D;  3P8M C;  2JWA A;  2JWD A;  1FDM A;  1JY3 O;  2JKV A;  2WQY C;  3AEA C;  2E74 B;  1N7S D;  5CCH A;  1NTM J;  2KI7 B;  1SQP D;  1BGY E;  3FWL A;  3M91 A;  4XE5 B;  2Q9I A;  2CPB A;  2JEE A;  2PGD A;  2ZXX A;  4QUR A;  2B89 A;  2G8Y A;  5B66 E;  3C8V A;  3HTK B;  3AZC A;  1S5L E;  3L74 J;  2Q3I A;  1K04 A;  2I1J A;  1L0L J;  5BU8 B;  2FYU K;  1NAY A;  2E43 A;  4JBZ A;  2OTL P;  1MFZ A;  1BGY J;  2N1T C;  4IFF A;  3PTZ A;  4UB8 E;  3AE1 C;  1DH3 A;  5HL4 A;  3CXH I;  1SQP K;  2JO1 A;  2HMJ A;  4WY4 D;  1LT9 A;  2R3C A;  5AVX B;  1A02 F;  1JB0 J;  1BE3 J;  2BEZ F;  3AE5 C;  2XRX A;  1R5L A;  1Q7Y Q;  1FDI A;  2I7F A;  2HG5 D;  1ZXG A;  3KXD A;  2ZYD A;  1JEK A;  1NU1 D;  1EZV E;  1JNM A;  5TIS H;  2ZJS E;  2ZFC A;  1KFM A;  3EFF K;  2O3J A;  2FY8 A;  2AXC A;  3H1H J;  3A0H H;  3HE4 A;  4KT0 J;  2QVA A;  2BCC G;  1CI6 A;  3K5B A;  2B1X A;  1DD3 A;  1UIX A;  1T2K D;  4C7N A;  3L70 E;  3NXS A;  1VQP P;  3AE7 C;  1SVF A;  2FFD B;  1N73 C;  2SPZ A;  2AEM A;  1N2D C;  1KD1 Q;  5K5G B;  5DJU B;  1T3U A;  4BXL A;  1JO5 A;  1GZL A;  3FGA D;  3AE6 C;  1OVU A;  1LTS C;  3KZI E;  1WQL A;  2D2C C;  2A45 G;  1BDD A;  1Q90 D;  4NBE D;  1VQ6 P;  1KIL E;  2IX7 C;  3VTP C;  1BSN A;  3H1L J;  1L4A D;  4H0L D;  4NBG D;  2OYH A;  1NVO A;  3GHG C;  2NVF A;  3AEF C;  1K73 Q;  4I6M C;  1SFC B;  3C1L A;  5H2F E;  1SQQ K;  3GTE A;  2IZ1 A;  5CCG A;  1L0L K;  3B5N A;  3MUD C;  3OJA B;  3G4S P;  2YKO A;  1NTZ J;  2C0X A;  3L74 G;  3M9Q A;  4HM0 A;  2Z5I A;  3RK2 B;  2K1A A;  3Q5P A;  4YTP C;  3AED C;  1N7L A;  1FZG A;  2WSF J;  3N4X A;  1S2E A;  2AXT E;  1LP1 A;  1AQ5 A;  3L72 D;  3TDK A;  3SFE C;  3ZDM A;  2KNC A;  1HJB A;  1KQL A;  5KLI C;  2NZ2 A;  3LIE A;  5GTI H;  3TGU D;  2BEQ D;  3AEG C;  3BAS A;  2RN0 A;  1N73 A;  2V7Q J;  3B5N B;  5KLV D;  1ULJ A;  5CCG D;  3G6E P;  5E79 E;  3HRN A;  1DX7 A;  1Q90 C;  3H32 A;  4JYC A;  3H1I J;  3NMD A;  2QSI A;  3LID A;  3CC4 P;  2JJL A;  1SFC D;  3I5C A;  1NU1 K;  5M1B A;  2A06 G;  1PP9 E;  1M1J A;  2OYI B;  4ASV A;  3TF5 A;  3L73 E;  1KIL D;  1LTG C;  2Y0E A;  1N8R Q;  2RMZ A;  5AW9 B;  1GU5 A;  1H0T B;  1KB9 I;  1YQ4 C;  5KLV K;  3JC2 2;  3RK3 B;  3CCL P;  4HM2 A;  2GBW A;  1HF9 A;  1NTK E;  3WU2 H;  3WUU A;  2YVJ B;  3H1J G;  1AQT A;  4OVN F;  3L37 A;  4GDO A;  3B4S A;  1RF1 A;  3PH0 A;  4HKV A;  2BCC D;  2O1K A;  4TT3 H;  1AVY A;  1NWQ A;  1YBK A;  5B66 H;  1L0N G;  4D6T J;  1LP1 B;  4JF7 A;  1T6A A;  1OXZ A;  2IPP A;  2KS1 B;  5BOK A;  1NH4 A;  1YIT P;  1GD2 E;  4NB8 D;  1LT9 C;  1X0T A;  2QJY C;  1VQM P;  5L8R J;  4AIV A;  4Z1M H;  3Q2Y A;  3V4Q A;  2HMK A;  2XNX A;  4U3F D;  1IFJ A;  4QUP A;  1KYO I;  1YJ9 P;  4M3L A;  1LGH B;  1EC5 A;  1GL2 D;  2H88 C;  5KLV E;  2IFM A;  1NTK D;  1KYO D;  4HM8 A;  1R5S A;  2XKM A;  1RQU A;  4R4M A;  1FZB A;  2YNY A;  2KZI A;  4RKU J;  3H1L G;  4HM6 A;  2IZ0 A;  1L0N K;  1RQV A;  2YFL A;  3MUD A;  1JM0 A;  2R5D A;  1M90 Q;  1PV3 A;  1LT1 A;  2D2C D;  5AEU A;  2ZT9 B;  3HE5 B;  2JP3 A;  3RL0 D;  1NKZ B;  2I1K A;  2KYV A;  1IFI A;  4H13 D;  4GT1 A;  1SQB K;  1NTZ E;  3I55 P;  3D6Z A;  3AE2 C;  1EXJ A;  4Y99 B;  2YMY A;  4QDF B;  1HGV A;  1JM1 A;  2LR2 A;  3CCE P;  3E7K A;  1AJY A;  2JO6 A;  1EXI A;  2Q6Q A;  3B8E B;  1L2P A;  3U59 A;  4D6T G;  2QEX P;  1VF5 D;  1MUU A;  3BCC D;  4ZKP A;  2OTJ P;  1KFN A;  1G8K B;  3CX5 I;  1ZP0 C;  4L74 A;  2K9J B;  5KTB A;  1K05 A;  1GL2 C;  3BRT B;  2R44 A;  1YJW P;  4WVZ A;  1LWU A;  2N1T B;  3RL0 g;  1RF0 C;  2ITA A;  1O7H A;  1J2J B;  1NU1 E;  3KQG A;  1ZW0 A;  1VL2 A;  3EQQ A;  3CCU P;  1HTL C;  4HH2 A;  1S72 P;  3D89 A;  2XU6 A;  1IK7 A;  2OYO A;  4YXW H;  1IFM A;  1RE3 A;  2WMM A;  2FXO A;  1VF5 C;  2V7Q H;  2LKM A;  1S5L H;  1CI6 B;  2BCC J;  2IDB A;  4XA4 A;  1KMI Z;  2WVR A;  4BRY A;  2FKW B;  2P67 A;  3RL0 B;  2KSE A;  3FXD A;  2O01 J;  3S4R A;  4PD4 D;  4HYT B;  4CPG A;  1KIL C;  1LTJ C;  5AVS B;  2R32 A;  3HTK A;  4HJG H;  1E79 H;  1N7S C;  1L0L E;  3GB4 A;  4NBH D;  2Q3W A;  3BRV B;  5KAF H;  4B86 A;  1WMK A;  1AV1 A;  1M57 D;  2GUS A;  1L0L D;  2I8D A;  3M0D C;  3HE4 B;  2HYN A;  4P1B H;  1O7P A;  1Q86 Q;  3H1J E;  1ZME C;  1FZA A;  3SSU A;  1RE3 C;  2OYH C;  1NTM G;  5KLI B;  3A2A A;  1NTM K;  3RBZ A;  1Y47 A;  1OMI A;  1LT9 B;  2C0W A;  3P8C E;  4ZNC A;  5AW7 B;  1QVG O;  3II6 A;  1VCK A;  4QDC A;  4PV1 B;  2HPC A;  3GCE A;  3VMH D;  3R2P A;  1NU1 J;  1H88 A;  1OX3 A;  3L36 A;  1X9V A;  1VQ4 P;  3AE4 C;  3QWO C;  1H89 A;  1ZRT E;  3L70 G;  1IFP A;  5AW1 B;  2WSS H;  4JPZ B;  3BCC J;  2ZYG A;  2FBW C;  3H6P A;  2IFN A;  3E1I A;  3BCC G;  2BMQ A;  1K9M Q;  2FYU G;  4NBD D;  1IJD B;  3KYQ A;  2A45 H;  1RE4 C;  1EZV G;  1VQL P;  3TK1 A;  3LW5 J;  1FZF A;  1SQX J;  1FZE A;  3FWN A;  2C9N Y;  3A7O A;  2WIT A;  2Q1K A;  3MP7 B;  2M5A A;  3IAO A;  1KYO H;  2OQQ A;  1SQQ J;  1ZLL A;  1HJ0 A;  1SQV K;  1MFT A;  3CWB G;  1SQX K;  2KS1 A;  2YIU B;  1HH0 A;  4ZMD A;  4TLF A;  5AVT B;  2V4H A;  4Y99 C;  3RBX A;  1FJP A;  4H13 C;  1KB9 E;  2QG4 A;  1O7W A;  2BMR A;  2B9B A;  4ZKU A;  1O7M A;  2N1T A;  1KIL B;  1DEE G;  3OAK A;  2W6B A;  1PGJ A;  2B24 A;  1R8E A;  2YKQ A;  5AVW B;  2E74 D;  2KIK A;  4U3F G;  1RH5 B;  3OW2 O;  2YXQ B;  2E42 A;  3NFQ A;  2H7H A;  1KQS O;  1BGY G;  4U3F E;  1PP9 G;  4H0L B;  1J1E B;  3CCJ P;  4C7R A;  5TJH A;  2Y0D A;  4EOT A;  3L72 J;  1PP9 J;  2WPQ A;  1VQN P;  2YFI A;  3L70 D;  1KOR A;  2ZYA A;  1LTB C;  3FX0 A;  2P1J A;  2XV5 A;  2WT7 A;  4D6T E;  2UWJ E;  1IZN B;  5AEW A;  3A5T A;  2R3S A;  1ZRT D;  3L72 E;  1JTH A;  2XZR A;  2AEF A;  1G2C B;  1XTC C;  1KC8 Q;  3L75 J;  1KV4 A;  2N9B A;  5AVQ B;  1GMJ A;  1Y9B A;  2HMO A;  4OGQ C;  4WY4 B;  1U7M A;  3C9I A;  1SLQ A;  3EQ2 A;  3GHG B;  4OGQ B;  3H1H G;  2NUM A;  3Q1M A;  2PFX A;  3GZY A;  2OGU A;  3EWK A;  1JMM A;  1VQ9 P;  1NKN A;  2K9Y A;  2P7J A;  4LLH A;  1DIP A;  2QA4 P;  3L75 G;  2QJK C;  3CCM P;  4W7Z A;  3PHL A;  2FYU E;  4HM4 A;  4AAY B;  1NHL A;  4A7P A;  3WUT A;  2D2C B;  2ZVN B;  4PV1 C;  4ASW A;  5GTI E;  3SWK A;  3V2P A;  3I56 P;  1JCC A;  2ZXE B;  5CBO A;  3CC2 P;  1BDC A;  1Q82 Q;  5CJ4 A;  4U3F J;  1SQB E;  1NGM B;  4P1C H;  3V5B A;  5CBN A;  1G1I A;  1KTM A;  4N78 E;  2KNC B;  1BGY D;  3CCV P;  2P2U A;  2FFD C;  3OA7 A;  3AE3 C;  2XSO A;  2G3A A;  3F5H A;  2FXM A;  1KN7 A;  2HFE D;  1ZOY C;  3LW5 H;  5AW0 B;  4NBF D;  2QPZ A;  2A45 I;  5GTH E;  5AW4 B;  2M5A B;  1OW7 A;  2WPV B;  2E75 C;  2GBX A;  1BE3 D;  1PGQ A;  1VF5 B;  5KKZ C;  4NPD A;  1ZR4 A;  1PGP A;  3V2Q A;  1X8Y A;  1JY2 O;  4KHX A;  1NTK K;  4PJ0 E;  3V2N A;  3VMZ A;  1UII A;  3VP9 A;  3RK3 D;  4QMA A;  2KOG A;  5KAI H;  3H1J J;  4OGQ D;  1VPC A;  3KHU A;  3L71 J;  1FAV A;  1VQ8 P;  4IFD K;  1N7S A;  1YTZ T;  3H1I E;  2IYP A;  3W67 A;  1S1C X;  1FE6 A;  4YPC A;  1ZN5 A;  3H1K D;  1YQ3 C;  3H1H D;  2J59 M;  2P58 A;  1JY2 N;  3L73 G;  2LXC B;  3TGU E;  1IFN A;  3RK2 D;  2MJZ A;  1FQT A;  4HM7 A;  2HPC B;  5AW3 B;  2Q7C A;  4RES B;  5B5E H;  3H1L E;  3MHV A;  1OIP A;  1FBM A;  3GG2 A;  3P32 A;  2E74 C;  2E76 B;  3DQY A;  1GW4 A;  3M06 A;  2DE6 D;  2PAJ A;  2YO3 A;  3G3Z A;  1FDO A;  3HUS C;  2E75 D;  1PFI A;  3GKE A;  2K9J A;  5H2F H;  3O6Q B;  1Q2N A;  2XDJ A;  1JMB A;  3TGU G;  1LWU C;  5AVV B;  1EG9 A;  5APU A;  2O1J A;  1SFC C;  2XSH A;  2B88 A;  2QIW A;  4QCK A;  1PPJ D;  3L71 E;  2YIU C;  1EQ7 A;  3GLM A;  5BVZ A;  3IF4 A;  1D7M A;  5CCH D;  3GL0 A;  1PPJ G;  1LTT C;  3WU2 E;  3G9R A;  5APT A;  5AVY B;  1CW5 A;  3CXH H;  1NTZ D;  4AUW A;  1HVV A;  2M8R A;  2QJK B;  2O01 H;  4H44 D;  1U7J A;  2W8Z A;  1DD4 A;  2H89 C;  1USD A;  2WSE H;  3PP5 A;  3GZX A;  2H43 A;  5APQ A;  4PD4 H;  3TYY A;  1URQ B;  1SJG A;  2QRX A;  1S9K D;  2KP8 A;  2E5Y A;  1Z56 A;  1YIJ P;  1NTZ G;  3Q5S A;  1BCC D;  2E76 D;  5E79 H;  1QL1 A;  1U57 A;  1SS1 A;  2CPS A;  3L4F A;  3S9O A;  4K3A A;  2K37 A;  4Y28 J;  4HKZ H;  2HML A;  3C0D A;  1JCD A;  3CX5 E;  2KLU A;  1S3J A;  2FXP A;  2M3B A;  5APV A;  2ZVO B;  2WWW A;  3VMX A;  3G71 P;  5KJ7 C;  1OWA A;  3HE5 A;  2DE5 D;  1SQV J;  4U7J A;  4WWI A;  3FXE A;  2W6J H;  3L71 D;  4H0L C;  1L4A C;  1EDK A;  3RGU A;  1JY3 N;  4IFM A;  5KLV G;  4I1L A;  2J58 A;  5KJ7 A;  3GTS A;  3V2R A;  1GL2 B;  2WT7 B;  4GOD A;  3CD6 P;  1FOS F;  4DJG A;  3AEE C;  2AXT H;  3CWB J;  1GU4 A;  2NWF A;  2N9Y B;  2FYU J;  2BCC E;  5KAF E;  2QJP C;  1T8Z A;  3V4W A;  2WSF H;  3A3Y B;  1N7S B;  2BAS A;  2WSE J;  3E1R A;  1AVO A;  1KZU B;  1OW6 A;  1P84 D;  2CKF A;  3CX5 H;  1SQV G;  4JQ0 D;  3GL2 A;  3N7N A;  2Y9Y A;  1L0N E;  1QLE D;  1ZR2 A;  2WTY A;  5APY A;  5AVU B;  1URQ D;  3L73 D;  1RF1 B;  3QH9 A;  1OVR A;  1M1K Q;  3IN6 A;  2W83 C;  4H13 B;  4IL6 H;  3VMG D;  1M1J B;  5BU5 A;  3S1K A;  1VM9 A;  1RE4 A;  1NAF A;  4NBB D;  1L4A A;  4W80 A;  2YMK A;  2QJP B;  3HD7 C;  1RFS A;  2Z4E A;  3KZI H;  5APW A;  1JTH B;  1FOS E;  3MTU E;  3MIW A;  2KLV A;  2NUK A; 
#chains in the Genus database with same CATH homology
 1R8E A;  1Q90 C;  2E74 D;  2QSI A;  4QDF A;  2MKV A;  3VCP A;  1G8J B;  4U3F E;  4H0L B;  1PPJ E;  5M1B A;  3B71 A;  2HMN A;  3AE8 C;  1PP9 E;  1MKM A;  2YFI A;  1KOR A;  1SQX E;  3L73 E;  1UUW A;  4QDD A;  5AEW A;  1YQ4 C;  3GF7 A;  1NDO A;  3L72 E;  2E75 B;  3L75 E;  3RK3 E;  4HM2 A;  1KYO E;  2GBW A;  1HF9 A;  1BCC E;  1NTK E;  2DE7 D;  1GMJ A;  1Y9B A;  2YVJ B;  2HMO A;  4OGQ C;  4I7Z C;  2IBZ E;  4GDO A;  3AEC C;  2NVE A;  4HKV A;  4OGQ B;  3D70 A;  4TT3 H;  2NUM A;  3Q1M A;  1RIE A;  3GZY A;  1NYH A;  2WSC J;  3EWK A;  4PV1 D;  1O7G A;  4YXD C;  2K9Y A;  3D71 A;  5BOK A;  4HM1 A;  1DIP A;  2QJK C;  4NB8 D;  2FYU E;  2QJY C;  5L8R J;  4HM4 A;  4AIV A;  4AAY B;  3D6Y A;  4Z1M H;  3Q2Y A;  2HMK A;  2D2C B;  4PV1 C;  4QUP A;  1KQF B;  2JZA A;  2H88 C;  4NBA D;  5KLV E;  4NB9 D;  1NGM B;  1SQB E;  4HM8 A;  4P1C H;  1RQU A;  4R4M A;  4RKU J;  1KTM A;  1SQQ E;  4XFJ A;  4HM6 A;  1RQV A;  3AE3 C;  2YFL A;  2XSO A;  2G3A A;  4I7Z B;  1PV3 A;  4R4L A;  2D2C D;  1KQG B;  1ZOY C;  4H44 C;  5AEU A;  5CXM A;  4NBF D;  2ZT9 B;  2QPZ A;  3SFD C;  1SQV E;  1TU3 F;  1PL5 A;  1OW7 A;  3GOB A;  3H1H E;  2JP3 A;  1NYK A;  2WPV B;  2E75 C;  5KKZ C;  2GBX A;  1VF5 B;  3N0Q A;  4H13 D;  3VCA A;  1UUV A;  1NTZ E;  3D6Z A;  3AE2 C;  1EXJ A;  4QUQ A;  3CWB E;  4OGQ D;  4QDF B;  1JM1 A;  1S5L X;  3H1I E;  1S1C X;  1AJY A;  1OW8 A;  2JO6 A;  1YQ3 C;  1EXI A;  3CXH E;  3BCC E;  2FYN C;  4HJL A;  1VF5 D;  3R4Y A;  3TGU E;  2WQY C;  3AEA C;  1G8K B;  2E74 B;  1ZP0 C;  1K05 A;  1FQT A;  4HM7 A;  4QUR A;  2G8Y A;  3RL0 g;  2HMM A;  3H1L E;  3C8V A;  3AZC A;  2XR8 A;  1O7H A;  1NU1 E;  2J5U A;  1VL2 A;  2E74 C;  2E76 B;  1K04 A;  3DQY A;  1BE3 E;  1P84 E;  3EQQ A;  2DE6 D;  4PD4 E;  1FDO A;  4HM3 A;  3ABV C;  2E75 D;  3D89 A;  3AE9 C;  3GKE A;  4IL6 X;  1IK7 A;  3AE1 C;  5HL4 A;  1VF5 C;  2JO1 A;  2HMJ A;  1EG9 A;  3GMA A;  2IDB A;  1JB0 J;  1KMI Z;  4H44 B;  2XSH A;  2ZT9 C;  4QCK A;  2BEZ F;  2QIW A;  3AE5 C;  2XRX A;  2O01 J;  1FDI A;  2I7F A;  3L71 E;  2YIU C;  3GLM A;  1EZV E;  3GL0 A;  3G9R A;  2A06 E;  4NBC D;  1L0L E;  3GB4 A;  4NBH D;  2Q3W A;  4H44 D;  4KT0 J;  2ZYL A;  1DD4 A;  1WMK A;  2H89 C;  3GZX A;  2B1X A;  1DD3 A;  1UIX A;  3L70 E;  4P1B H;  1O7P A;  3AE7 C;  3H1J E;  1O7N A;  1ZME C;  1SJG A;  1PIX A;  2P10 A;  1OMI A;  3Q5S A;  2E76 D;  3FGA D;  1U57 A;  3AE6 C;  3T97 B;  3S9O A;  1WQL A;  2D2C C;  4QDC A;  1VCK A;  2ZT9 D;  4PV1 B;  4Y28 J;  2HML A;  3GCE A;  3C0D A;  3VMH D;  3EN1 A;  1Q90 D;  3CX5 E;  4NBE D;  1KIL E;  2FXP A;  4H0L D;  4NBG D;  3Q5R A;  2E4P A;  2NVF A;  2DE5 D;  4U7J A;  3AEF C;  2E4Q A;  3AE4 C;  4H0L C;  1ZRT E;  4HM5 A;  3VMI D;  3GTE A;  3L74 E;  3GTS A;  2YFJ A;  1SQP E;  3AEE C;  2FBW C;  2NWF A;  2BCC E;  4EMJ B;  2QJP C;  3AEB C;  1ULI A;  4HM0 A;  2BMQ A;  4NBD D;  3Q5P A;  4YTP C;  2WSE J;  3AED C;  1OW6 A;  3H25 A;  2CKF A;  2WSF J;  3GL2 A;  3LW5 J;  1L0N E;  2NVG A;  2BMO A;  3FOU A;  3GF3 A;  3Q3D A;  3IAO A;  3SFE C;  2OQQ A;  1HJ0 A;  3O6Q A;  3IN6 A;  4H13 B;  5KLI C;  3VMG D;  2NZ2 A;  2E76 C;  2BEQ D;  1VM9 A;  4H13 C;  1KB9 E;  3AEG C;  1NTM E;  4NBB D;  1O7W A;  2V7Q J;  2BMR A;  3H1K E;  2YMK A;  1RFS A;  1O7M A;  1ULJ A;  2NUK A;  2B24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...