2ZTBA

Crystal structure of the parasporin-2 bacillus thuringiensis toxin that recognizes cancer cells
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
247
structure length
247
Chain Sequence
DVIREYLMFNELSALSSSPESVRSRFSSIYGTNPDGIALNNETYFNAVKPPITAQYGYYCYKNVGTVQYVNRPTDINPNVILAQDTLTNNTNEPFTTTITITGSFTNTSTVTSSTTTGFKFTSKLSIKKVFEIGGEVSFSTTIGTSETTTETITVSKSVTVTVPAQSRRTIQLTAKIAKESADFSAPITVDGYFGANFPKRVGPGGHYFWFNPARDVLNTTSGTLRGTVTNVSSFDFQTIVQPARSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crystal protein
publication title Crystal structure of the parasporin-2 Bacillus thuringiensis toxin that recognizes cancer cells
pubmed doi rcsb
source organism Bacillus thuringiensis serovar dakota
molecule tags Toxin
total genus 51
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ztbA03
3.10.290.50 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A 2ztbA01
3.30.1140.50 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 2ztbA02
2ZTBA
chains in the Genus database with same CATH superfamily
5F1KC 1NCWL 2EXYC 4K5OA 1JNLH 4K8RD 1GW0A 3IN0A 1A3ZA 5JXEA 1J0ZA 4WHDA 5SWZA 4RBPH 4JO3L 4KI5F 3VRIA 2AJ3B 4L29B 4A63A 4I5BA 5AVZB 3S4SB 1QWUA 1U8LB 1JZHA 3IT8D 3GPSA 4XBGA 4XP5L 5HYQB 3ZHDA 3T65B 4LHUA 2X4SA 4GPVA 2AERT 3HZMB 2UUCC 2QQKL 2DJ4A 2ZKYA 2VL5B 3II2A 2NY0B 3F58L 5GIRA 4FABL 1S3KH 2F8OA 3IDXH 4HC1L 3CFBA 4PJ5B 5D1QB 2P8MB 3WEAA 1ND0A 5PAZA 4HBCH 2OSLB 2W88A 32C2A 1IKOP 2F7RA 5DDHB 5DVLA 5EB9A 2HJLB 2SEBA 1F3JA 2EYRB 25C8L 4WHCA 2ICEA 3Q43A 4GAGL 4U31A 5D1XB 5LAXA 2N1TE 3IDGA 1N6QH 1WT5C 3AGVA 3H56A 1I7TA 1CDYA 1Z2KA 2BP8A 3A23A 3Q5TA 3V4PL 2IDTA 1KYOK 2BIMA 4ZSOA 2BIOA 5LWYL 1QFPA 2B77A 3G5XB 4S1SH 2FX9H 3CHRA 1JDAA 4PRIE 2XX0A 1IBFA 4MX7A 2OI9B 4YBQC 4NQDD 4F8OA 5DD0H 3VFRA 4I8DA 4FXLA 4XN7A 4ZK8A 2AJSH 4B9PA 3U0TB 2VQFC 4PJAA 1IEHA 3QR2A 4Z7WA 5JIMA 4Y4KA 3BPNB 3ECVA 3LPPA 3FO0L 2YQ3A 1WZMA 3QUYB 3KH4A 2HWZH 4MSWA 4Y16C 5F6HI 5AZUA 4WI0A 1E4KC 1U8NA 4M5ZL 3MV7E 2FO1A 4L2LA 2CE6A 2J56A 2X88A 5IESL 3U0WL 4G2AA 3U36A 1CLZL 5DJAB 1CK0H 3KGRA 1XH3A 3TT1H 3V0WL 4JBSA 2QELA 1CB4A 2W95A 3GBNL 1F5WA 1SHWA 4LEBA 2VN7A 4HCGA 4XP4H 5ETUB 1LP9A 2Y7NA 4DJMA 1ESOA 1SF5A 5E2JA 1W6WA 3DX0A 5AVWB 2XYBA 1UA3A 4AVHA 4DPCX 5DUPL 4RESB 3FCSB 4GB9A 2HLFD 3PWLA 1BJ8A 1AKJD 3PV7A 4PR5A 4KX8A 4XO8A 5DZ9A 3NRFA 5C0ND 4P5RA 5LN4A 2MPAL 5G4NA 3I6KB 4IBZA 4X99A 5F89A 5KJ7E 5L0QC 1SUHA 2Y7SA 4G6AC 4ZFOL 3K0WA 3RX5A 3BMWA 3D3VD 1DQDH 1R24A 3KNBA 4MWFA 1A3RL 4EI6A 1AS8A 3KG5A 1P7QA 4LOUC 1RURH 5AVYB 5DQDH 4ETQB 1FH2A 1RLBA 2VSMB 5D7EA 4GAJL 3UEZA 4DR7D 1UCBL 3MJ9H 4LSPL 4ONHA 2KUTA 2QFPA 3FAWA 3NG5A 3GIZL 4ZPVA 1OW0A 3QXUA 5CEYB 1D2PA 4K9EL 3NIFF 2AI0H 4NM4L 1JFQH 2EEBA 4JHVA 5E95B 4X8XA 1OT1A 4X7FC 3GBLA 2HKFH 4BYHA 3NJHA 1CO1A 4Y4FA 1BV8A 5DZNA 3S88L 3I50L 3LXUX 3RVWD 5JHAA 3PJLA 3JWOH 4K3EH 5HY9A 4OTXH 3WFCH 2WXJA 1YYMH 4G7VL 4HT1H 1BW8A 3ZE1F 2EE6A 5KVEH 2WSDA 3IMUA 5D2LE 4FXKC 1NDMA 4HGMA 4N2MA 3RX7A 1JYVA 4N2DA 3GSUB 4G1MB 4UQAA 2ADFH 3U4AA 1JHKL 2OJZH 3ZTDC 2LE9A 4RGNC 5BW7A 4M8QB 4ELME 3MBXH 1D5IH 4ZTOH 1ONQA 3KWWA 5C0JA 1AC6A 4V1DE 1M7IB 4WEMB 4KGJA 3ECQA 2ODIA 3OKLA 5GGSB 3HPJA 1T66D 4WDIB 4BE5A 4ATWA 2MCAA 1UD8A 1UM5H 1A7QH 2FCBA 4P2QB 5INCA 2CO6B 1Q0EA 2XA8L 1JPFB 1NMAL 2CG9X 4OLWL 3FUFA 3K81A 1JNLL 4WWPA 1XHHA 3DURB 2P8LA 4X6DE 4XO3A 4GG6B 1DP0A 3KLLA 2UU9C 4GKJD 2Z4QA 2H9GB 4PRPD 1JHTB 2PXYA 4NI6A 4AW4A 1I8MB 4MJIA 4Y1AA 4Y5XA 3KWXA 2BVUA 2FRGP 4LSDA 1LJMA 2RR3A 3TNMA 5ES4B 4PJDB 4U4BA 2Z0BA 3L7FB 1NMBL 2DV6A 2EXTA 2WTRB 3EYQD 4DUVA 4YHYC 3BO8A 1T1YB 2XZAH 3WFZA 1WFJA 3BIKB 1NOLA 3RFZC 1LILA 3FRPA 1OEZW 3OGCB 1FG2A 2P47B 1Q1PA 4M56A 1P1VA 2X42A 1DJYA 4GXUN 1IC5L 5KVDE 4XHJC 4IJ3B 5D7IA 3TN0B 4BH7A 1K85A 1NCOA 1XCTB 1TKWB 2ZXWB 3W56A 4PB9H 2LAGB 3MA7B 4HBCL 4YZWA 3RA7H 4PGZA 1RZGB 1S7UA 1VCBC 2B08A 3C9NB 3KBEA 3QQ9C 4NRZA 4LSTH 1QHPA 3UZEC 4WW1A 3OB0H 4GRLB 1V7MH 3X14B 2UWEF 2GCYA 4OX9D 4XNUH 4UQ2B 2X6VA 1ZT7A 1WHPA 3NIGB 5DS1A 3UYOD 4P9HH 4S1SL 1MCDA 3BWUC 5DLML 1A9VA 4FQHB 2FX9L 2VZTA 3SBQA 3ISRA 3QDGA 1JJUA 3CQFA 4KDVA 4HU2A 4YHZH 3P9MA 4LSUH 4RFEA 4MRBA 5DD0L 1A4BA 3S6CA 4PGBB 5BV7C 5J6GB 3N0AA 2AJSL 3SBWC 2IG2H 5ACLA 5F7MC 3NK3A 3RQ3A 5D1ZA 3GJFK 4L3CA 3VFWA 1YC8A 1UD3A 3VMOA 4HPYH 1G1YA 3B43A 4Q6IC 5TDPA 4OGYH 1SBSH 2IQAA 2Q6WB 3CFIC 2B59A 4GI8A 4ODXB 4L05A 2BY3A 2NNRA 3NZ8B 2WB7A 1CK0L 1RIUH 5FYKD 1X9RA 4LHJB 2F74A 2QGDA 4HIEA 1MI5A 3TT1L 4IBYA 5D6DA 3II3A 2AJVL 3VXPA 1NWOA 2JLPA 1N68A 2V2WB 4HK3N 1JNHA 5E1AB 3PWPB 5KS9E 4JPIA 4XRCB 3UTSD 1S7RA 3ZDYB 3QPQD 1QHOA 2W65B 4XP4L 3ZIMA 3NCBB 2DW5A 5TE7L 4BA8A 2VO8A 5DI8A 5CN1A 1ZT4B 2WVVB 2AK4D 4X9IA 1DBKH 1PZBA 2HG5B 2JB6A 4OW6A 3WDIA 3QUXA 2R1WB 5CEZH 3LXBA 4ODBD 3T0XA 3VSVA 1XGUB 4LIQH 4WUKH 3GJFB 1DQDL 2ENPA 1WP6A 4JDEB 5AW5B 3X1NA 2WCPA 4JDVA 3U30B 4JUSA 3AADB 3C5XA 4NQCD 1OSYA 5EZLA 1KLUB 1RURL 3WAKA 4PEEA 3TTSA 1IUZA 4QRTB 2ZWSA 4HWBL 1EPFA 5DQDL 2Q76A 2Z8VC 4RGMC 3WEBA 5EULV 4NQUA 4FYRA 4X0NA 1EHNA 1RULH 4APXA 4QYOA 3SKNB 1DVFC 1FYTE 4BK8A 4G8EB 2AI0L 3O6ML 1JFQL 1GYWA 4K9JA 2TAAA 5EFIA 1ACXA 5JLZB 2OCJA 3GIVB 4IMLB 3DTUB 1EXUB 1MHHB 4QRSA 1XR8A 1I3GH 3L5WA 5EO9B 3D2UD 1ES0B 3ABLB 3K2UH 4KK9D 4D0CB 5B3JE 4U1SA 3HFFA 4OTXL 1HXYA 1YYML 4ZS7H 3FT4B 4KNQA 3BEWA 2PP9A 1ADQA 3F2LA 3QIBC 5KVEL 5JYMA 4MZ2A 5A3ID 3RGVD 4BUQA 5C08B 2ADJB 2ADFL 4N6QA 5IHHA 1U58B 1UWGH 3MBXL 1D5IL 4OCXH 2GK2A 2XKSA 3N41B 4QR7A 5M7QA 1NCBL 1EVUA 3AM8A 2ZXEB 4JPVH 1E9QB 4QOKA 4YHPB 2J25A 3FB8B 3S3SA 4LVNC 1KCUL 1N33C 4V2CB 4ZAKB 4D8PB 1A7QL 3C60D 4ZUTB 3FCGA 1MH5B 1THAA 4XC3L 1AD9A 1A7NH 1R5IB 5TE6H 5DS8B 5LGJA 3QR1A 4AEIH 1NFDF 3J80E 1I94C 3UBXB 5SX4I 1KIQB 3LN4B 2DWTA 4Y7OC 4AEEA 1OSEA 3CZSA 3KZ8A 4JO4H 1R75A 1JIBA 5KSAC 2KBGA 5J6HA 2VOTA 1NAML 4AQAA 4FYQA 3KLSA 2BHFA 2WYIA 5DWPA 4PLNC 4JM0A 4L8DB 4XMZA 1B4LA 5T1DL 1ETA1 3KVDD 5EEWA 3ARBB 2BM3A 2XZAL 5KAQG 1OTTC 2NCMA 3MX0B 2O6FA 4HAGA 4KGLA 5J9PA 5FK9B 3FU9A 2L04A 2NY2B 4LESA 4PRHB 3EJQA 3PWVB 3G6JF 4K8RC 2B2XH 4HJEA 1AQKH 4XGZB 4KI5E 2D31A 1RUPH 2E27H 4P2CG 4FP8H 4PB9L 5IT9E 4MJJA 3RA7L 1UURA 2PWGA 4GEJA 4PJ7B 1IKNA 1OCRB 1OTSD 2BXYA 3BP7A 5AAWA 1YNKH 4LAQH 5JHDB 3TEWA 2M83A 2IH1A 3DHUA 1JGDB 4YC2C 2YARA 5FUCC 3UADA 3QO0A 3QJUB 4N8VA 2NW3B 4JM4H 4DR4D 3QQNA 1ML0A 4MB4A 4P4RB 4XNUL 5K9QI 5FIEA 1WQVT 4GW1A 4P9HL 2FBJL 2J73A 43C9A 2VR8A 5LKNA 5I5RA 4AIOA 5EBWA 3GSQB 1NGQH 4LK4A 2J1KA 3C8KB 4MNQB 4Q9BA 3T3MF 1G7LA 2APXA 1AGCB 4YHZL 3IDIA 5LQBH 4XXWC 4TULH 5F7BA 1AMXA 2QQQA 3RGBA 4P3CL 5I6PA 2IG2L 3EOAA 2R2EB 5CZVL 1GPOL 2L7UA 5MEND 4HPYL 4RRPG 4X4MA 1SBSL 2WAHA 5A2KH 4AEHL 3GBDA 4BINA 1FCGA 1BXAA 3FM7A 3ESVF 4WNQA 4A7TA 3LY6A 1VZGA 3OR6B 2QZ5A 2GJRA 1NIAA 2XFXA 1RIUL 4Y16B 1N5AA 3QT2A 2MKLC 1BLNB 3D48R 3RPIA 2E6PA 4ZMNA 1IO4C 2GUOB 1FL5B 3RPBA 4DP2X 3QWOA 5AKVA 3H9SB 4X5RA 3OPUA 4C58B 5MP6H 2HHHD 1AY1H 5BPPA 4KUCD 4PGDA 3IVKA 4PVMA 1U2CA 4Y5VC 2VR5A 1XCQA 2PWFA 5EU4A 1T1XB 2J12B 1ZVSB 3RWIA 4IRZH 1PGRB 4OLVH 3FOLA 3MLVH 4MBRA 5KSUA 2IPKB 4YLCA 4GFXA 3FC8A 1CDJA 3VI4B 1FQ9C 2DDQH 1HSAA 3QH3B 4NQDE 3DRTA 5DFTA 4WUKL 1MJJA 4D0DB 5EN3A 3SPIA 1AP2A 4LOFA 4KUCF 5CKGA 4ODSH 5L0QB 5HHOA 2YPKA 4G7YH 4OUUA 1T5WA 3MCLH 1KTJA 1A4JB 1E9PB 2MHAA 4E41A 4XBPB 3ZQ9A 2MWCA 3QI9A 3UCRA 3E7JA 5FO7A 3WYRA 3GEFA 1T0MA 3HR5A 4HFUL 2O6EA 1V3KA 3V8CA 5C0NC 4U1JB 2X1PA 1EHLH 1U3NA 1KIUA 4M7LT 4DO4A 1Z9OA 5AYUL 4G11A 5C7XL 4TNWF 5IJKC 1U95A 4E5XG 1YYCA 4LEEA 4JFYA 1M7DB 1I3GL 4JFXB 4B9FA 3K2UL 4G9DB 3HC4H 1SF3A 1KC5H 1J8SA 1Q0YH 4IBWA 4N2OA 2LLGA 1D2OA 5ENWA 3MUZ1 4JRFA 1IM9D 4KJYA 4X5WA 5I6KA 5I16A 3O11A 3EH4B 1YPZA 4ACTA 4DR7C 3DJTA 1FYHB 4N5EC 4CA4A 1XD1A 2Q3ZA 4UZGA 4CBPA 4DR3D 5AW1B 3ESPA 2IPUG 3D3VE 2DLGA 3NIFE 5JOPE 1UWGL 4Z18A 5EBLB 2FTAA 4JKLA 1OE3A 2G9KA 3PF2A 3RIKA 1CIDA 1OB1A 3UPCA 1ZTMA 4RGNB 4JFQA 4LLVA 4QRRE 2VWEC 4PJGF 2CUIA 1VFBA 4NBZB 3EYSH 2BOBA 3HHRB 4KU1A 3RVWC 5EUOA 4GJTB 3APCA 3IU4H 5MEPA 5TE6L 4AEIL 2WZ5A 3ZE1E 1PLCA 5KTEH 2DWDB 3MYZA 5HJGA 2D3JA 4WFHD 3K71B 4JO4L 2DQJH 5IKCA 4NO3B 1EERB 1KBWA 4ZOEA 3MBWB 1B4JL 5DRNA 3F12A 1J5IA 2XWJB 3T2OA 2X3BA 1JXGA 2IGFL 3GXMA 3LH2H 5F0LB 3ZL2A 4NCC2 2CPCA 3VXSE 1T66C 1MF2H 1Z3GL 1HH6B 1MRDH 3F05A 3NGBB 4K94L 3UAEA 3WENA 1ORSB 5EU6A 1OLZA 4Y2OB 4FOMA 4O58H 4GXUM 4YHYB 4MTMA 3UC0H 2B2XL 3B3BA 3RFZB 4NUMA 3D69A 1H3GA 4J3WA 3FCTB 2AK1H 3ZQWA 3U30C 4FP8L 3UBFA 4GKJC 3EJSA 4S2SB 2K8MA 5JUEH 1RK7A 5F0PB 5FUOL 3EO9H 3ZX1A 2QPEB 3NT0A 1K6QH 4NPYB 1L6PA 4LAQL 3FQTA 5C07B 4I0KA 4X5QA 3VA2C 2CBTA 5IVXB 1CI5A 5DO2D 3RIFK 4OVUA 4UT6H 3EYQC 5D96C 1IGJA 2E76C 4JM4L 1JERA 2AQPA 5IJCC 1Q9OA 5CBEB 2JXMA 4IJTA 4KV5F 1DQLL 4YEEA 1ZD6A 2RJMA 1U33A 1G7IA 4PRPE 3CN4A 3FFCA 1RZ8B 3GGWA 2J3SA 3EADA 1K3ZA 4HWUA 1CE1H 3E9UA 3ML9A 3NCJL 2Q7NA 3ARFD 1TQCC 2ZXGA 4XXCC 3TOPA 5LQBL 4NT6B 2H1LM 4R96A 4PI0A 3K4AA 1L9NA 4ZFGH 1KIRB 1NSNH 4H5SA 1OT2A 5CJXA 5MHSD 1J5ED 4ZMPA 2GKIA 2JTYA 5BV7B 2UWEE 3QDJE 3QCVH 3VXNB 1DVSA 1KTCA 2HJFB 2IWFA 2HLAB 4ZPTB 3TBTA 4Q6IB 5B39B 4HOMA 5A16A 2VN3A 3AXLB 4QO1A 1VJSA 4HLEA 2I07A 3HG4A 2YQGA 3OHXA 4PJIF 4BWUA 3A0OA 5DK2B 2OLDA 2KKQA 4BELD 1AY1L 5DMYA 4DR1D 3QUMB 1KB5B 3NSDA 4WK2B 1IAKA 5TDOB 3DSFH 5FW7A 3D25A 4C56A 1D5BA 2GFBA 5E8NA 5JHLH 4X4YA 4MJID 1S78C 4UDTB 4IRZL 4OLVL 4W68A 4DNLA 2Y2WA 4RFOH 3Q7JA 1MY7A 4AXWA 1UH4A 2DDQL 3VD2A 1JZEA 4WI7A 3DA0A 1PEZA 2Q87A 2XWRA 1TJHH 1BVLA 1SVZA 2MQGA 5C97A 3QXDA 1YECH 3FK3A 4ODSL 1GTFA 2KHAA 4MAYB 1T04A 3QPQC 4G7YL 3ML8A 3KYMA 3MCLL 3D7PA 2OMTA 4OZFH 2JQZA 1VIOA 3NH7H 5F9AC 1TQVA 4RMTA 6PCYA 4TUOA 5HHPB 5D5MB 4C83A 3BP6B 5EA0H 2WLNA 3TFBA 4LU5L 3OSKA 4RGMB 3V5KA 4BJLA 3UPRB 2IDSA 4E42A 1EHLL 1W16A 3EH5B 3SHSA 1NJ9A 1WZLA 4X5XB 3UTSE 1DVFB 2OTPA 3DSNB 1EX0A 4P57A 5IW6B 3LNGA 3SGJC 3TO2B 3HC4L 3OX8B 1KC5L 4PBWD 3LTVA 1BYOA 3QFJD 4OZGB 1XAUA 2ZWYA 3BKJH 4LF9D 3MNWB 4LLDB 1WISA 2V8MA 1N64H 1XIWA 2FT7A 3O2DA 5IREA 2W9EH 1JMXA 3MYJB 4JY6A 1F90L 5LGHL 4NQCE 2WLJA 4JRYD 2IDQA 2HX9A 5KEZA 1P4BH 5BCAA 5IVOA 4U6HA 4UNUA 1G6VK 1UM6L 4KK9C 1AGEA 4X9HA 4HPOH 1ZANH 1RK0A 2BHUA 1HHKA 3Q1SH 1LD9A 5I26A 3WIFB 2D8KA 4LVNB 1MI5D 1DJWA 4PTTA 4J3OH 5KTEL 5DSCA 1EAJA 2W81C 4MHHI 3ZTJH 3O45B 5IW1A 3RGVC 5G4MA 2AJYH 3BP4B 1RMFH 4NXND 2CHWA 1F18A 3E8UH 2XLLA 3AU1B 3OJDB 5AQ0A 3LH2L 4A39A 1YMMD 3L3HA 3U2SA 5CU5A 5HI5D 4WO4A 2PCFA 2RMNA 1MRDL 5FR3A 3O2VL 3U79A 3SPVA 4LLQB 5BZWB 1T1ZB 1NFDE 1PG7H 3MRDB 1HI6A 1XEUA 2AK1L 1BYNA 4OKVA 3GDBA 3LEXB 4XCNA 2FHCA 3RE0A 4YGVA 2HVKB 2TSBA 3EO9L 5DJ0B 4WVRA 1UACH 3KPRA 1K6QL 2UZXA 1ZEAL 3ZDZE 3VI3F 4UT6L 1MLCA 2NQDA 5FYLH 4BUGA 2QTVA 1DUZA 2P42B 4EXKA 5EWIH 3QEHA 2UXTA 4YC2B 4M7KH 3L4ZA 4RISL 4JFFB 1NCUA 2VKXA 4NRYA 2VC2H 2F61A 1MLBB 2ADIA 4LKCA 3QULB 4XH2A 5AAMA 3GRWA 3HZKB 1P5UA 1KOAA 3KYNB 2ZOLA 4FKHA 4DKFH 2H41A 1RP9A 3LIZH 1JHLH 4DFHA 4ZFGL 1RUMH 1H3UA 3BE1L 5DHEA 3TF4A 5KN5B 3K6SB 5JQIB 3TIDB 3QJOA 4JFDD 4B6ZA 2I7SA 2LW3A 4KOCA 3QCVL 4DR4C 5K1NA 4N0YH 2LLLA 1CD1A 3C6SA 3MRNA 4OV5A 43CAB 3CDZB 1CBJA 1U0QA 4ENED 3IMWA 5DJDA 4XVSL 4JJHA 2WZPA 4FQLL 1HXMB 1MHEA 2H0PA 3ILDA 2ZONA 4IHOA 3T3ME 5I1AA 3CLEH 3VXUA 2DEYX 2ZYSA 4KDTA 5F7NC 3WNLA 2OQJA 2C1PB 5BMFL 3DSFL 3LJ3A 1D7CA 4P4KA 3RL1B 1PZCA 4OZIB 3U9PH 5JHLL 1IL1B 1QQDA 3KWVA 4GMTH 4K3HA 3RY6C 4IGBA 4J12A 1AOZA 3DO3A 4GKZB 4OF8A 1BJMA 4Y5VB 3R1GH 2EAEA 1NUNB 5J12C 4ZXBA 1NLBH 1GW6A 3QGVA 3K74B 1B3JA 5EG6C 4M9OA 4YNYA 1G9NH 4UM9B 3LQAC 2KTLA 5LMUD 3T1FA 1YECL 5MENE 5E7BA 4ANVA 5F7LB 3UTQA 5F2FA 4MQSB 5I0XA 3DHPA 3QJXA 2N0MA 2WKGA 3NH7L 1JPEA 2E75C 1VGKB 3DI3B 3SD2A 4Z7VF 2XV0A 5EA0L 2P80D 2CBPA 2G5UA 3GSNB 4M00A 1BJ1J 2VRAA 3O9WA 5TDNA 3DDGA 4H8VA 3KLHD 2KLRA 3RUGF 1XMOD 4DUYD 2MNJB 1AKJB 3NJLA 5G4OA 1E9OA 1U36A 4AJ0A 1L9TA 1LWRA 3IWUA 4QHUB 2AHIA 4I2XB 2X2JA 3LVTA 3QNYB 1E5BA 4L1BA 3UZQB 2YA1A 4HK0A 5JQ6H 1RL1A 4K5LA 5IY5B 3QO1B 1QBMH 3QXTA 1SXZA 5CHNB 3BKJL 2E4FA 12E8H 2X7LA 3QZOA 3RNQA 3MRRB 1E50A 5LGYA 5JPNA 3MRBA 5CR8A 3QDMA 2ICEC 5FM8A 4GSRA 3UTTD 3K72A 3UTZA 3IMBA 1FO0A 2BWIA 2R59A 4RAHA 1K2DB 4X98B 3WJLA 2HG0A 1BZOA 3T4AA 5DO8A 4ZMTA 1ZANL 3FQNA 1JV2B 4IU2A 1EMTL 5LNDA 2XWCA 2WUBH 3L9YA 2KT6A 3MV9A 4UAOC 2WBJD 4JYAC 1RMFL 1EZVY 1P7BA 4HX1B 4DR3C 5C0DA 2HJKB 3I3BA 4K23H 2CUMA 4QF1A 2FATH 4Y4KC 3WEXA 4EDXB 2W0PA 1DLHA 2CR6A 3MNMA 4K5NA 1H15A 5C09A 1TPXC 4PJGE 1ZIAA 1NPNA 2EEXA 4A04A 3V9FA 3RGHA 3G5VA 3SD5A 3IGAA 3S2CA 1J1XH 3AWFA 4C55A 1AIFA 1TETH 3TONA 4X6CB 4Y4HA 1BG9A 2I24N 4ZO6A 1S9VB 2BNQB 2C3VB 3DETD 2F54A 3B2VH 4IBLT 3P11L 2FNWA 1UKSA 1TNNA 1EFXA 1LEIA 3VFSB 1J1OH 4F7MB 5CF3A 2GJ6D 4OLXL 1J88A 5FYLL 1DANU 1GGUA 5EWIL 4PV8A 3ES6B 2I25N 4M7KL 4WFHE 5CJOH 5C6TL 3QZMA 2AQ1A 4OLUH 5D96B 2VC2L 2X89A 3BW9A 4F2FA 3HAEG 5FYJH 3MGOB 4CKVX 1R5WA 4NO0A 3IKCB 2UY7A 1S7VB 4H1LA 3U9UB 5IHBA 4BFBD 2CPUA 1NKGA 4P5TA 3LIZL 3S8GB 1RUML 3FONB 1MVYA 2A9NL 3FS9A 1O6VA 3RVTD 2EVHA 1ITCA 2VR9A 4QRUA 5DO2C 5EBMA 1N32D 3U6XS 2LQRA 1OW0C 3W11D 4IRJA 4N0YL 2NSXA 3WNMA 4KV5E 3ULVF 4N5UA 1OM3H 5L7XH 1TZGH 5FGSA 5C0GA 1JN6B 2GK0B 5ISZE 1DJZA 3QJVB 2EKJA 4PS7A 3VI4F 5I1LB 2B3IA 4U7SA 4UNTA 4L8CA 4WFFD 3L45A 2GHZA 1J0KA 1IVLA 4MD4B 1HYSD 5T5FL 1G4MA 2Q9OA 4R0LA 1HOCA 2DAVA 1G7MB 5DVPA 4QCIA 2E4TA 2OM5A 2R0ZH 3LRSA 2Y07H 3KBHE 1H3XA 1J5EC 3QDHA 3GI8H 2VW6A 3U9PL 3ZHFA 1M3IA 4HKBB 4GMTL 5BW7C 2DIEA 2BJMH 4H8HA 4HUVB 1EH9A 1JG9A 1JS4A 3WE6A 3RPKA 4U1MA 1KCLA 1NLBL 1QPKA 2PR4H 4PJIE 2KQNA 3WFEH 5D71H 3I3DA 2YEZB 4X6FA 4GKOA 4N9GB 4NDMA 4KMQA 5MHSE 1B0GB 3BOVA 1VKXB 2ZCKH 2IDCA 4DR1C 1UZ6F 1KN4H 3VFUB 1J5HA 3NIDB 3MA9H 2AFNA 4P05A 4Y5XC 2XN1A 3MUUA 2H3NB 2VSDA 1GGCH 4NQSB 4N1HB 2XBDA 3MLTB 3MMEA 4YEFA 4XPHH 2AK4B 3P4LA 1ZSDA 5DK0A 2FQEA 3OAYK 4X80H 4DVBB 2KYIA 3BDXA 3DVNB 1NIFA 4O2FA 2VN5A 3NFPB 5BNXD 1UKQA 3P9LA 2Z7YA 4PJHE 3AW5A 3GM0A 4D2NA 4F2MB 1E5CA 2YR3A 3FFCD 3I9GH 2YZ8A 3WTVA 2EO7A 2R2HA 4OFDA 4LF4D 2WXLA 2WNGA 3S7GA 5JQ6L 2OMVB 5DHMC 2XKUA 1QBML 4FXTA 4OJDH 3NK4A 5C2BH 1UTDA 3P54A 3PNRB 4FFWC 4RMSA 1JGVH 1FIEA 2HPOA 3LZRA 4AYID 2O93L 5INDB 4JHWH 1CR9H 2H45A 3B9EA 2A99A 3MGTA 3UG4A 3BWSA 5IGXH 2CO7B 4PJ9A 1BZQK 1E5ZA 1ROWA 5JTWA 2AV7B 1TZIB 3EHBD 1UFUA 2MRYA 3JUZA 3QQ4A 4XMWA 4W9DC 4OIAA 2E8ZA 2QVFB 3ZMEA 1OT4A 3BKYH 4OLZH 1BJ1H 1HR0D 3LCYA 5H94B 5ABZA 1EGJA 3NPZB 5IBLC 2F1AA 5FB8A 4XX1E 4LF9C 4G8GD 4W9KC 3BH9B 3L3DA 3V7AG 3HMWH 1CXHA 2E74C 3FTVA 4CU8A 4ANWA 3PL6A 5D1ZC 1NFAA 4DQOL 2FATL 4JDZA 3RGVB 3K91A 2CQVA 1IKFH 3BT2L 5TGBA 2DQMA 4ZMZA 3CVBA 4HAFA 4AUJA 3QFJE 4YFLI 3BYTA 5F88A 2WV3A 3HC0B 4U1IB 2WYZA 3LKSA 1J1XL 5D6DC 3UJIL 1TETL 4ZMWA 1E4WH 5ERWA 3APFA 5M94B 4GT0A 1IBHA 1A7BA 4P2OA 1S7SB 5C9JA 2JMRA 4WFGD 4JRYE 2Q8BH 1MHPH 3B2VL 4NXNC 3BZ4A 1QKZL 3WGVB 1X9QA 1C9SA 1M6OA 4APQA 5IHWA 4F15C 1C06A 5E2UH 3O41B 2J43A 4WI3A 3RWJA 4H8QA 4TLSA 4JPQA 4YDJB 5HI5C 3PP3H 3VH8B 4UUJB 3EIFA 4YO0B 1JVOA 1U8CB 2BLFA 1GZHC 1WE5A 4JVPA 2ZQKA 3EYOA 5FYJL 1DQJA 4QIRA 4MNHB 2F53B 5CJQH 4KRPD 4A2EA 1UJTA 1YMME 3LN9A 2E9IA 3BD3A 3OLGA 4J4PD 3U4EA 4Z77B 3QJQB 3S34L 3TCLB 2VR3A 2J8OA 3NEXA 3LHPH 3MCKB 1T7XA 3VI3E 1E8XA 3T8XB 3AVEA 4MXVF 2BOCA 1S7XB 1XIWD 3HN5A 4AKOA 5IWAD 1B9KA 4RRPA 1OM3L 4TPRL 1TZGL 5H35A 2VDQB 3WIAA 5EPMB 2ATAA 2BSRA 1CD8A 4AV4A 1K5NA 2WLKA 3L3IB 1HHGA 3V0FA 3QARA 2C3XA 3P0GB 4EOWH 4QHKJ 5KVDH 3G7TA 2OBGA 4FJZA 4XNBA 1X7SA 3KGSA 4FQQB 4JI5D 4Y9GA 2VLKA 4OD3L 3EGSB 5CEXB 5F96H 2R0ZL 3CPUA 2CRZA 4AITA 3GI8L 3CBKB 2BPBA 2VDNH 1RJLA 2OR7A 4P2AA 3STBA 3RNKB 1R17A 1BD2A 4IIQC 3SPHA 5D4QA 3TNNB 4QKXB 3ZHLA 5FLXD 3EBGA 1CD0A 2G3XA 1JNNH 4EDWL 3ESMA 3PP4H 1OP5K 2PW1B 4ALAC 3GPEA 4LOVA 2A73B 1FH5H 1YLBB 3U1SH 4AQ8C 3WFEL 1AZBA 2AVFA 4ZOBA 2LU7A 1MEXH 4FG2A 5D71L 1ILUA 4HC1A 5J12B 2AAAA 1EZUA 1IGMH 2D73A 3ASWA 1LEKB 4JFDE 4L3ED 4EEEA 4NN6C 4B3MD 1TQSA 3V0HA 4AK1A 1UYWH 1AXSA 1JZFA 1KN4L 4D9QD 3ZZ1A 1HHIA 3KPMB 3UH8A 3CHXA 4M3HA 3FKUS 3FQXA 3MA9L 3CIQA 5DHYA 2D7MA 1Y6MR 3TEUA 3P4OA 5SWZB 5GS1A 5BVPH 3IK2A 4PLKD 2JKLA 1SEBA 1GGCL 2QQLH 1BF2A 1F13A 5FGCE 3V4PA 3VRIB 2VYRE 1KPUA 3ZL1A 4I5BB 5B1KA 4XPHL 3VJ6A 4G6MH 1KTDA 4ZUUA 4X8CA 1KCSH 2DL2A 1NZRA 4IKIA 5FQ2B 4XBGB 4XBEH 5LMUC 4LHUB 2X4SB 4W6WB 3I9GL 3GMMA 2IWKA 3D39D 4OIFA 4NQED 2CO3A 5C2BL 4Z7VE 4XC1H 1JGVL 5AAWC 4P2RA 2YGNA 4JE4B 3CFBB 3EH3B 3HVDA 1CR9L 4ICXA 4JHWL 4P46D 5IGXL 3L7EA 1ND0B 3S4SG 32C2B 2XKNA 2DY2A 4KMTH 4RDBA 4TQ8A 4NBYB 3RUGE 2SEBB 3KLHC 4XCCH 5E8DH 1F3JB 5EEVA 4DUYC 1CC3A 4OI8A 2ICEB 2ESVA 3ECUA 2J1ZA 1JWUA 1N3NA 1XGRA 3BKYL 4OLZL 4DETA 4Q9CA 1I7TB 2OL3H 2X4OA 1YQ2A 3BZDA 5K5YA 4ZSOB 3DHJA 3MBEA 3D2TA 4YUEH 1S9YA 1DR9A 2WNWA 3QB7C 5IVZA 4BSVA 5IR1A 2GSGB 2AKRB 2NY4D 5HDBF 1TUPA 1E5AA 1KJVA 1IM9B 4MX7B 1QVOA 2P45B 4TSCH 3ARGA 4UAOB 3VFRB 2XWBB 1IKFL 2IWEA 4ZQTA 4FXGC 3H54A 4PJAB 2CK0L 2WGXA 2FNBA 4ZFOA 1MCBA 4KXBA 1ZK5A 2EO9A 3PGFH 4MSWB 4OZFG 4TUJA 4Y4KB 2VGLM 4ZXBD 5I6OA 3QIUA 1DFBH 5K9QG 3PGCB 4WI0B 1U8NB 4H2AA 5J89A 4DEPB 3U36B 1E0OB 1E4WL 3P2TA 1NGWA 3UTTE 1H6EA 5HDWA 3TA3A 1XH3B 3FT2A 4CRPA 1JYXA 1MHPL 3PREA 3QAQA 2Y1VA 1GGBH 4UBDD 5E2UL 5CZXD 4ADIA 5JXAH 1F6AA 2EIMB 2NSMA 1OF0A 3BWAA 1AHWC 1UD4A 1QFWM 4B5ZA 3O9WD 1U41A 5HJDA 1PZDA 2Y22A 4QT5A 3PWLB 4R4ND 4PR5B 3AC0A 2CIIA 5CJQL 5DZPA 2PABA 1I7ZA 3JWNG 3GXPA 4WI9A 5DMKA 4NNPL 1QSFA 3GLZA 4EI0A 4POUB 3S5LA 2CMRH 1LM8V 1R24B 3KNBB 4MWFB 4EI6B 2BP0A 1P7QB 2DD8H 1U8JA 3QI9C 1KPVA 3B2UC 2LFEA 3SGDI 4PHZA 3WN5C 5ICZA 1GY1A 3SZ6A 3O6LH 2A4EA 1KPRA 4ONHB 1IBGH 1BEXA 2GI0A 4ZPVB 5B8CC 1CFNA 1ZV2A 5HDLA 4LCIL 3ZTJG 1O7DC 1T20A 4EOWL 4WTWA 2Y6TE 4N0UE 5KVDL 3T3PF 4OJYA 5AZ2H 3UJTH 4KITB 1X4YA 3SDCA 2GJ6E 2PTTA 1T7ZA 5F96L 4OUDA 1N2RB 1IFHH 3TV3H 3IFOB 5HY9B 3GMPA 3MREA 2H0EA 5E24E 5E2TH 1N32C 2VDNL 4KZDH 1XSIA 3W11C 2YXWA 5H37H 1H5BA 3VXMA 2DQHH 4OF6A 2AXJA 3GNMH 1NDMB 3KJ6H 4L4TA 4AGPA 3ULVE 3PY9A 4G70B 1KZYA 3L4TA 1JNNL 4K8RH 2NNAA 3PP4L 2Z7WA 1X4XA 1NDGA 1FH5L 3FQ2A 3U1SL 1NEUA 5D7HA 1HYSC 1ONQB 1FFOA 2BW5A 2EDHA 3KWWB 5G5DA 3ZHNA 1UUNA 2PN5A 5C0JB 2VDPB 1IGML 3BSGA 3OKLB 3HPJB 2VMDA 1XF1A 2PYEA 5INCB 1N7MH 2DOCA 3WTUA 3RTLA 5K69A 3KBFA 1FZKB 2P8LB 4JMNA 1BX2A 4WFFE 1CE6A 4PJHB 2Z4QB 2PXYB 3LNHA 4MJIB 4G6ML 4KZCA 2OULB 4Y1AB 3GINA 1FNGA 4NNXA 4Y5XB 5F7WC 5TDOA 3VFGH 3IGKA 1A4CA 2XG4A 5FW8A 3TNMB 2FJGA 5AW8B 1BQ5A 3VRJA 4FF9A 3BO8B 1YRKA 1A1OA 4Q97A 1UZ6E 1AZCA 3FRPB 4LVOC 1KYAA 4BRJA 4YXLH 1OF2A 1FG2B 4NO0D 2E9GA 4WHYH 4UQ9A 2FVNA 4EPSA 3LNDA 2VR4A 3HS0A 4TV3A 4CVZA 3P40A 4KH2A 4UANA 1GGIH 4WV1A 5D7IB 4XN9A 1KCVH 1P84J 3EDEA 4BH7B 2VR7A 4LFHG 1JZ7A 2XZQH 3M07A 1S7UB 3VQLA 2UXFA 2X4NA 1KB5L 1CF1A 3I75A 2A6IA 5GISH 2FBRA 4WW1B 4IMKC 4E9LA 1CQKA 2F18A 2DMKA 1MCEA 1XL4A 1OHZA 2X40A 4C57C 1YMHA 2GCYB 3D33A 3OAUH 2HB0A 3T4YA 1ZT7B 5I0DA 1CFMA 4UOW1 2QDWA 2XG5A 3KPSD 3QDGB 1A9EA 2WKOF 5DD5H 3P4MA 4QD2E 2WD0A 4TL4A 4TSCL 4N8UA 3P9MB 3EHBC 3LVEA 3RI5F 4NRXB 4IOIB 3WJJA 4WI8A 1JVKA 4ONFH 2COQA 3HVNA 4L3CB 5D1ZB 3KEDA 3VFWB 3ELAT 2VDKH 2WLIA 3PGFL 4ZMLA 1Z66A 2CLRA 1DFBL 1AZRA 2B59B 2VLRD 3GSNH 3F62A 3P3YA 3PAVA 4I3SH 4R97B 1HR0C 4WO0A 3HS9A 3T6WA 1TZ8A 2VDOB 4PIRF 4I9XA 5K39A 1JZGA 2F74B 4HIEB 1MI5B 3QWNA 1IC7H 3MJ9A 3VXPB 1B0IA 1CFQB 1GGBL 3CZKA 4FGMA 4HKZA 4UILH 4E9QA 1JNHB 3VWKA 3VXTA 4JPIB 1UWXK 1S7RB 1RZ7H 3JV0A 3DJSA 5JXAL 1KFAH 1Q72L 3GLEA 5L8KB 2JIXD 3VTAA 3VDBA 2X28A 4ZDHB 5DI8B 4F15B 4OCWL 1E3FA 2ED6A 4TSBH 4G8GE 1XSJA 2JFCA 3OPZH 4L37A 4PRBA 1NPJA 5A2FA 1C1EH 1JYNA 2QTEA 3QUXB 3V6FA 4LPXA 3KW7A 4OF0A 3CTTA 1QUPA 4JRXD 3UTPD 3CPLA 4YBLC 2CMRL 4XNDA 4MNGA 2YRPA 4L4VD 2DD8L 2AXFA 4U6XA 5EZLB 4BSJA 4JE0A 5D2NC 4ES8A 4RQQA 2Q76B 1T4KA 4PJ9D 5CGTA 1U8HA 4APXB 4AQEA 4LDOB 4QYOB 1IBGL 2VZ1A 5JNYA 2NT0A 4HJ0D 4PWJA 5EF0A 1F41A 5EFIB 3BAXA 4KRPC 2XY1A 3G6AA 1HQRA 3BKCH 5AZ2L 2BFVH 4QRSB 1KGJA 1XR8B 3L5WB 5D2NE 4XVOA 5DMGD 3TV3L 3VTMA 4BH8A 1AXIB 1X5XA 1BFTA 5E2TL 5LBGA 3KJ4C 3UFIA 1HXYB 4MXVE 3KE0A 3BEWB 3IFPA 3PL6D 5IIEA 4DV0D 1XIWC 4NKOA 1YN7A 2DQHL 5I1EL 4QHLA 5IWAC 3KJ6L 4H88H 1A8ZA 2X10A 5HI4D 4A2HA 4K8RL 4ANXA 3JAMD 1SM3H 4W9HC 3OL2A 1TLKA 3POCA 4YDMA 2OYPA 4ONGH 3Q8AA 2F7IA 4QOKB 3VXRA 4NXMD 5I82A 4ODHH 3WO3B 5GSRB 4YXKH 3EFDH 1N7ML 1OARL 1AD9B 3Q6FA 4ELKB 4M61B 4HETA 5DCCA 5LGJB 3SE3A 5I6NA 4NN6B 5MERA 4D0BA 2ENQA 2WZ0A 3DKHA 3GUTB 5G2NA 3GJEA 4H25A 5J6HB 4AQAB 1SJVA 3HJEA 4WO4C 2WAQA 3VFGL 1AGDA 2L7QA 2YA2A 1MCHA 4G72B 5LBSH 4JLRA 1BM7A 2NX5A 5JO5A 3GSOA 4CILA 1DE4A 2L8AA 4H13C 3CDYA 4F27A 1T7VA 5AZEL 2QR0A 4PJ6A 4B3MC 2X4PB 5J9PB 5HHNA 2VXTH 4YXLL 4R84A 5LB1A 3MFFA 1UG9A 4ATTA 3AT0A 3MRPB 4DZBA 5FLXE 3E3QC 4MHHG 2KLSA 1G5GA 4R7VA 1GGIL 2D31B 4PLKC 4RZKA 3BRDA 1G7PA 3NP3A 2VZUA 3O6KL 4BK5A 3GMOB 1YDPA 2XPZA 2YKLH 3BP7B 1PY0A 4L3EE 4QXVA 2PPAA 1NEPA 5CZKA 5BRZD 1PD0A 2C3GA 4O51A 5GISL 1OPGH 4ZI8A 3QO0B 3HKZA 3PE9A 5E4OA 4N8VB 5JOFB 1CXEA 4ZUVA 5AAMC 3E3QE 4PRDA 3EW3B 4IKKA 1TIUA 2AEIT 5IBTH 4PJFA 1ID2A 43C9B 5EBWB 2PO6A 2HUEA 2VLKD 2EDQA 2NDFA 2VO5A 3ARRA 4P46C 3E1ZA 1B88A 4LRIA 5HYJD 1IBBA 3A22A 1P9KA 2UUBD 2GJZB 3S2AA 2P5WD 1MXGA 3IDIB 3SODB 3F7YA 1SFHA 4MD5A 4JQIL 4ONFL 2HFFA 5D7LE 3GMRA 5DA4A 3D39E 4WKXA 4KTGA 2VDKL 7PCYA 3BQVA 2BP5M 3AQXA 1UT1A 4R5XA 5T3ZE 4GRWF 3GSNL 1B4TA 3S37L 2NR6A 4B97A 4FFYL 2HTLD 2KPWA 3OWRA 1JUFA 2XFXB 4G8IA 4KDTC 3RPIB 5HDBE 5SWSA 3CN0A 1WBXA 3QWOB 1A8JH 5I24A 4UILL 2YUWA 1PCSA 4P4KC 1TTBA 4XWOC 3JYBA 5D7KE 5HGDA 1WA2X 3BLKA 3SQBA 4IGBC 2ALWA 3IVKB 3HEIB 1CN4A 1XCQB 2FX8L 4RAVA 5CCHE 1TO4A 1HINH 3F00A 1XAKA 4I85A 2QHRH 4XO9A 4ZXBC 1BG1A 1HEHC 3O3UN 3F7RA 4OVVA 1QRND 3FOLB 1AHWB 3OPZL 4OQTA 1NMCB 3V0VA 4BCZA 4LCYA 5CR1A 5KSUB 4YSUA 2EDTA 5JIQA 1HSAB 2ZYIA 5DUBB 2A5UA 7FABH 3DRTB 2Y7LA 4H20L 1MJJB 4YXHH 1AP2B 3LMJH 4I77L 4UBDC 5HHOB 1NCTA 5CZXC 2YPKB 8FABA 4OUUB 1T5WB 5E08H 3PHSA 4Z3HA 2K9FB 2MHAB 4E41B 1Y6NR 1FPTH 2BVPA 3O9WC 3FQUA 4PJXF 3QI9B 2DYPD 4JVWA 5FO7B 3GWJA 1JTPA 1T0MB 3B9KA 4N3TA 3WN5B 3HR5B 4MYWB 2IBZY 4R4NC 1OP3K 3CDFA 4LLWA 4RSYA 4YFEA 2R1XA 1JAEA 2VQED 5AUMA 1KIUB 2HTKD 4JFEE 2Q1EA 4QWWC 3CJJA 3L5XL 4EZKA 1U95B 2BFVL 3QNZB 2ZWZA 5E6SB 2IFFH 4JFYB 3DX9B 4N0RA 4FCHA 4MQXD 2X12A 4K3JL 3WFBH 2VM3A 5ABAA 1PY9A 1C8QA 2C9AA 1XGPA 1D6VH 5ENWB 4EJ1C 4KHTH 5AW0B 2QJDA 1XWVA 3EFFA 4FERA 5I16B 5I30L 3O11B 4H88L 1YPZB 2QSQA 3ABMB 3QWRA 5GRJH 1OD9A 3MUGA 1SM3L 3LB6D 2DMBA 2YD3A 3T4AC 2AJXH 4XAWL 3N1MC 1EJOL 4S10A 4WEUD 3GLAA 1C5CH 3I9AA 1F6FB 4J8RA 3OJMB 4ONGL 3T3PE 1OB1B 1GRWA 2YD8A 4YHMH 3EJZD 4ODHL 4JFQB 4LLVB 4LLUA 4B9CA 1VFBB 3LSOA 1F11B 3V79C 1KYFA 2WMPA 5EUOB 5E94A 4YXKL 3TA3D 3NJGA 4NAQA 2YN3A 5MEPB 1L0PA 1OXYA 2FJFA 3MNVA 4GUPA 5E1GA 4AZ8A 4EN3D 2AQNA 3CZLA 2JJUA 4FNLH 2GC7C 1SJXA 5FOBA 1G0DA 2YGOA 1F4XH 3FULA 4WENB 3SEPA 5IKCB 5DRNB 3F12B 2FEDD 1SDYA 2D9QB 2XXCB 5LBSL 3DXAD 3HB3D 1HJCA 3KLAA 5HYSG 3PUCA 4PJEB 5DEFA 3L48A 3K1KC 3GXDA 3ILEA 3WBDA 3CXFA 4W81A 4Y4HC 5EU6B 1OCOB 2VXTL 2IEPA 4PV1C 2A6JA 1FVCA 4R90H 5ICXA 2WN2A 3D69B 5E03A 2AV1A 2OMBA 1CICA 4YMPA 5I23A 3QR0A 3RDJA 3VYOA 2YKLL 3CH8A 2Q10A 4FEIA 4ZX5A 1E3XA 3L1OH 3FQTB 3V0DA 2V7NA 3S3CB 2FJSA 3L95A 4Z7WF 1IGJB 4CAGA 3IDUA 1Q9OB 3SYOA 4BXSV 5TQ2H 2JXMB 1U3HD 1FSKC 3BKMH 3KPOA 4PSRA 1G7IB 1NGPH 1WBYA 3HKFA 3FFCB 3DIFA 3UACA 3ZYOA 4IRZA 5AVTB 5FYKL 3P69A 3BC9A 4XMLH 4R96B 1MFNA 1WUZA 3Q0HA 4IRJC 4N68A 3US9A 1OP4A 4U0QB 3O0LA 5JYLA 1LP9F 4H5SB 1BAFH 4L4TD 5D1ZI 5DEJA 1G1CA 2FECL 2J20A 1DTUA 1WAEA 5KSBA 1QPXA 1A1NA 3DMMA 4QHNA 3E6HA 2DB8A 5F21B 3SJVD 2MNUA 2WUCH 3GS0A 2G5RA 4NUJA 3TBTB 3ABGA 4IK6A 2WJ5A 5L9DH 1G9MH 3RILA 4O00A 4QO1B 3BVDB 5CCKL 2I07B 2XVGA 3OHXB 2PYED 3GSWA 2OZ4H 3C5ZD 2V3FA 1E40A 1AXTH 4LQFL 3TX4A 2FD6H 2D7OA 3U1PA 1U3ZA 3QAZC 1KB3A 3DX2A 3R8QA 1IAKB 4AH2A 2B9BA 3D25B 4C56B 1D5BB 2GFBB 2K45A 2ZWNA 1HINL 2Y69B 5E8NB 4X4YB 2QHRL 5I8CA 1TCRA 3U0PA 3A21A 5FV2A 4Q52A 4PS8A 5AVRB 5B39G 3KPSE 1IM3D 5AW7B 4B27A 1GL4B 4AXWB 4AC2A 2W38A 7FABL 1SMDA 3MJ8A 4ZFFA 2GEEA 2Q86A 2XTLA 4YXHL 4Y9BA 1IZJA 1B0WA 1EDQA 3QXDB 2WXRA 4NZFA 1T04B 2V9QA 1FE8H 1MY5A 3NA4A 1T2QL 3VG9C 3KYMB 4HG4J 2OMTB 2XTJB 2VLRE 3K4DA 1J8HD 1V27A 3RWFB 5KSVB 1QATA 5GXBB 1U3JA 4L1DA 4U05A 4TUOB 1B9ZA 1LO4H 4C83B 2G3ZA 4U49A 3UAJD 1BF5A 3V5KB 3WNPA 3D18A 4HSQA 4E42B 3T6QC 2J5WA 1P6FA 5TE4L 1NJ9B 5EHFA 4M6AA 3WEMA 1YEWA 1L6ZA 4P57B 2X3AA 1WJ3A 5JW5A 1YNTF 4WEBH 3W0WA 1N10A 2X0UA 5C0AA 2YO3A 2NY3D 3WFBL 2F5AH 4MCZA 4OCNC 2BINA 2O4EA 1D6VL 2HRPH 3K6DA 3NJVA 4KHTL 4Z7OF 1YEDA 2XFGB 1MCPL 5AB9A 4U1HA 4PJ9C 4OD1L 5GRJL 2ARWA 4J1UA 4ZW8A 1KGXA 3VRLF 4F92B 3G9AB 1G84A 4JRXE 1QFWI 5HHMD 2AJXL 1XIWB 4XPAL 3PDDA 4JY6B 5A2BA 4L4VE 2K6YA 1C5CL 4N4YB 3VDAA 1CS6A 4YHML 1QEWA 4U6HB 1AGEB 4FRWA 3IJ9A 1RK0B 3DX3A 3IGFA 1KN2L 3HHMA 5DMGC 1LD9B 4NLHA 2PW2A 1EJFA 3GTVA 3Q5OA 3UIYA 1R3LA 4HEPG 3PL6C 1NUFA 3VSTA 5DSCB 4ZYKA 4UT6A 4FNLL 3TEYA 4DV0C 5IW1B 3P02A 1ORQA 2Y06H 1CIUA 2P5PA 1U4FA 2ZX6A 3SSGA 2WLLA 4PWIA 1O7SA 2X6BA 2YJLA 3L3HB 3U2SB 5TTRA 1F8TH 1QLEB 5JW3H 4NXMC 3RVUD 4WO4B 5CILH 2Q20A 3GMLA 2FH8A 4FKEA 3C6LD 1I1AA 4LP8A 1RXLA 2Y25A 1AYOA 1DHKA 1A6ZB 4R90L 3RB7A 2ZNWA 5HYEA 4APQC 3SGEI 3TF7C 4XCNB 4WKZB 3VU1A 1FJ1A 1QZ1A 2MFNA 1N6VA 1T7YA 3L1OL 3MLUH 2UZXB 3S4SA 3ZZQA 1U8LA 2BVYA 1WZ1H 3ETSA 1CYWA 1MLCB 5F71A 4WGVB 1S4IA 1DUZB 5TQ2L 3KYCB 5I66A 2QFRA 3GO1H 1OE2A 2KQMA 3D30A 2FO8A 1WCBA 3QEHB 3Q13A 5A2CA 4GUOA 1NBQA 3Q8FA 4GQRA 3BKML 1EK3A 3ARPA 1ET8A 1NGPL 1SJMA 2ADIB 4LKCB 1WA1X 4NRYB 5H37G 5GZNA 3D85A 3A24A 3MU3A 4Q9RH 1P5UB 4MJ5A 5JHLA 1CYGA 4NQEB 2Y7QA 2ZOLB 3L9BA 1Q0XH 1U8IA 4JCLA 5E4EC 2Z31D 4KNUA 3ELQA 3LQAL 1GOHA 2O5YH 1BAFL 3OMZA 5D1XA 3H85A 2D4FA 4NP9A 4LFAD 3AG4B 1CD1B 3MRNB 3X12A 4OV5B 2JI1A 4GOSA 5DK3A 3SCMD 2IV8A 1I3RB 4OZFA 4POYA 5L9DL 5DQ9A 2IMNA 3VXRD 1SXSA 2BHYA 5DJDB 3S3JA 3AROA 1MHEB 2OZ4L 1R6VA 5BRZE 5GRVK 1G94A 4IHOB 2YRLA 1C7SA 4OCRH 1AXTL 4DZ8A 4F9PA 5I1AB 2UUBC 3BFOA 3M45A 3VXUB 2H5UA 3NFNA 2Y0SA 4R9HA 4JL2A 4OZHA 1JRHI 4GIOA 2GSMB 4W6XB 2OQJB 4P4KB 1BZ7A 2VAJA 1FAKT 4KOBA 1QQDB 2CRYA 4GRWE 4IGBB 2EH7L 2EIJB 4PW9A 4YDIL 4WHYG 1XTMA 5F0JB 2HTLC 3MJWA 1T83A 2OP4L 1VESA 4ZXBB 2P5WE 1S7WB 3FYIB 1AS6A 3L5JA 2WNXA 4PJCF 3D87B 5F7YC 1CFVL 5CGYD 4YNYB 1HWGB 4NN7B 3NYKA 4HS6A 5AWNH 4KC3B 4IOSA 1FE8L 3H3BC 4HQQH 3CMGA 2ZPKH 2EE2A 4M1GH 3UTQB 2FQGA 5GS1C 4EI5A 3ULUD 2CHDA 2Q2EB 5ETUA 2WIMA 4QXGH 3QHZH 2A9DA 3VSQA 1PAZA 4OD2B 1LO4L 4FX5A 4LGSB 2IALA 5KBPA 3GSVA 1TT6A 3FCSA 5I5JA 1HN1A 3L3OA 5CIPH 3RG1C 1AKPA 3HN3A 3LDBC 3O9WB 1Y18B 3R19A 3II1A 3OKDA 4R2GB 1AGFB 3I6KA 2QGCA 1E9OB 2ZD0A 1CUOA 1URLA 3ULUF 4NIYE 4LCWA 5C0RL 1ED3A 2CCLA 1UA6H 2F5AL 4PJBA 1U8QA 3VVVA 3WELA 2O72A 3QEGL 4HK0B 4JO8A 1QRNE 1DJGA 2K4AA 1JZ4A 4LASL 2ISTA 2X7LB 4PJXE 3RNQB 5CLYA 2R0KH 4PQXA 1EO7A 5JPNB 2CO4A 3MRBB 2NVUB 3QDMB 4JO1H 3JWDC 5CEZD 4Y8AA 3K72B 3UTZB 3ONHA 4MA1C 1IGIH 2VQEC 1U91B 1FO0B 4OLYH 1HFUA 1QLRA 2NY1C 4XNYH 1M9WA 4B9YA 3EZ8A 3T4AB 1BGXH 4X0KB 3MBEC 4K73A 4MQXC 4KKCC 3FQNB 4IU2B 3W9DA 4GSDL 4NYLB 2ADYA 1KV3A 4PRAB 4Z7UF 3MV9B 4CC4A 2DH2A 3K3QA 3ARGC 3OZKA 4E0RA 1EO5A 5L2JB 2Y06L 1S5IH 4HAKA 3SYQA 1QSEA 3LB6C 3NCCB 2EINB 5F0MB 1AAJA 4Z7UA 1FZMA 4RRPM 1QW8A 3WEXB 5JW3L 3QIUC 3U46A 1DLHB 2IPTH 3O81A 3EJZC 1H15B 1YC7A 3BD5A 3OJ2C 5C09B 4DGUA 3Q9QA 2ZWLT 4KTDH 4ZFZA 3HOGA 2IQ9H 3A3YB 3GEWB 4RMWA 4WDIA 4D3CL 2MCG1 3G5VB 5E5RB 5GHWH 3LIZA 5FOJA 3CVHH 3IGAB 3TA3C 1AGBB 5IV2A 4FTVD 3VGGA 4EZMA 3BP5A 4B7IA 1AIFB 2OZNA 2P5ED 1UWXH 4UT9H 3UYRH 4Y4HB 5E5UB 4NFBA 1H8OA 4K9EC 3BPOC 4KJPD 2F54B 3BVXA 2FEDC 2WBKA 4HKJB 1EFXB 3BYYA 3MLUL 4XNZC 4XMXA 5J11C 1LEIB 1UWYA 2C7FA 2WQXA 2IH3B 3PNWA 3O3AB 3MTRA 2DQDH 2WTRA 5FM4A 3GO1L 5ICYA 1J0IA 4PV8B 4QAWA 1L9PA 1FF5A 2NTSP 2W8CA 1A6UH 1CVSC 5HJ3B 4Q9RL 3WG7B 4O2EB 1R5WB 4NO0B 4A68A 2JI3A 2UY7B 3DXAE 1FSKB 1HKFA 3F83A 1TKWA 4H1LB 2XJKA 3GHBH 4ALAH 5AOJA 1Q0XL 1OCCB 4XXDA 4P5TB 1KSRA 1V7NH 1XNQD 4XNMA 2O5YL 2EUWA 1IGYA 1NCDH 3V6ZB 4QRUB 4YLQT 5EBMB 1FFNB 4IRJB 3RAJH 2B9AA 5B1BB 4EIBA 1U3HC 5C0GB 4G42A 5EC1A 2C4FT 3SDAD 1CG9A 4NI3A 3WUWA 4L8CB 4DHLA 3MACL 2BNRD 3IAQA 4OCRL 4W4OA 2XT1B 1JGEA 5GPRA 3TC9A 1OQXA 4QCIB 3NAAH 5GS0D 4X5PA 2ODHA 1LP9E 1QO3A 3H9HB 3LRSB 2QKIC 3TS8A 2RFXA 1NC2A 1DLFH 2AF2A 3ZL4H 5DLLA 4X4ZA 3C2SA 1D5ZA 1Q9KA 3PQYA 1OPOA 2Q6WA 5IFJA 3QAZB 3SGEH 4OF7A 3WE6B 3ZRSA 4Z7NB 2X2HA 5BS0E 4U1MB 2Y2YA 3NZ8A 3QZLA 4JFTA 5GGQH 2OK0H 5DGRA 3HBQA 4B9JA 3C5ZC 5DZVA 5J1SC 1EBAA 2ICWB 4KO7A 4NDMB 3QSKB 1WBZA 4Z7QB 2J8UE 1AR2A 3PWPA 4HUWA 3JZYA 4M1GL 3MLWH 3ZE2E 3SJVE 4FNPA 2CLZA 3CC5A 4LRNL 1T03H 4K7PX 3WLWD 3QEQD 4ZW5A 3MMEB 3BVNA 3HG1A 2Q7AA 4DP6X 1DVXA 1BXXA 1ZSDB 5DK0B 2ZTBA 3IJ8A 3CFEA 4O2FB 4YHHD 3FTUA 3G6DH 2VLMD 4WUUE 4HJTA 3P9LB 1UA6L 1RK1B 1NGYA 1U9KA 4YFDB 2VDMB 1O9ZA 3V7MA 1OD7A 3KR3H 3CX5K 2VDOL 3QUZD 1KSVA 1WFMA 4TNVK 2XIIA 3D09A 4DEWA 3UAJC 4JZOB 3HFMH 4L8SA 1OP9A 3MGTB 4JO1L 3ZDXB 3F84A 3VD5A 1CZ8H 1BQLL 1FC1A 4PJ9B 2VLJE 4KKZA 2BZ7A 4LDLB 3DMMD 2F08A 2VXUH 3QQ4B 1BGXL 1PL3A 3GIVA 1PLAA 3AFLA 4DR5D 1EXUA 1W6LA 1MHHA 4UZSA 1J8HE 3B1TA 5CMAA 1QEXA 1VFAA 4DP9X 5FB8B 5D7JA 1A25A 4FLOA 1YSOA 4LBEA 3D4YA 3VRLE 3W57A 2FJHA 1S5IL 3GXUB 3L3DB 3SO3C 2Y7MA 5C08A 3WJJC 3PL6B 4L0YA 4JQVC 1H0DA 3GZKA 1FNLA 4JDZB 1IQDA 1A4AA 4PLJD 5TGBB 3QPKA 2ROXA 4DWHA 4KTDL 1UCTA 2IQ9L 5F88B 4YDNA 4ZAKA 5GHWL 3CVHL 3LKSB 1VLXA 3DPDA 5JW4N 1YEHH 4BWWA 4UT9L 3LRHA 3UYRL 5ERWB 5HHME 3KVPA 4P2OB 3VWKC 2VUKA 2VDRB 2WNKA 1A22B 4NUPA 5C9JB 2BW4A 2XV2A 2CIKA 3BZ4B 3BUBA 3GLDA 1PFCA 3JTSB 1T0OA 2X2UA 2XSKA 2ROYA 1M6OB 4APQB 1F1GA 3FBKA 1T7WA 5K1VA 3RWJB 3RVUC 2R4SL 1ADQL 3MZGB 3JWOC 2DQDL 3V10A 1FL6A 3WNNA 1C7TA 2UV3A 4ABWA 4F7TA 4F91B 4NC1C 4NWUH 3C6LC 3MRLB 1KACB 3K80A 5LGKA 2X6UA 4G9FE 1QFWL 1A6UL 5BUAA 1EA9C 1I75A 1MDTA 3STZA 1DQJB 2A83A 4YHLH 2AJZB 1PZSA 4XGZA 4ALAL 3GHBL 1YNLL 4J2XA 2KMWA 3ASOB 1NCGA 2F58H 3U4EB 3RIAF 4II3A 2ZCHH 1ZOXA 3KDMA 4GQQA 3RJDA 1XGTA 3VH8G 5IJBC 4UIMA 5JDSA 5E4EB 5CJBA 2OTUA 1UASA 2J5LC 5IHLB 2NW3A 2WYHA 3QUHA 2DM2A 4PRIA 5H35B 1SDDB 2BSRB 4NJ9H 2HRGA 4HP5A 1K5NB 4LQ1A 1WT5A 2VZOA 4PP2B 4DVRH 1HHGB 1NCAL 5T8IA 4DV7D 1DJXA 5J4MA 1FHNA 1YG9A 4PY7B 4KY2A 1CL7I 4AY0A 1XB3A 3VFVA 1AANA 2VLKB 2Z31C 2IANE 5HYJB 3KGTA 3MV7A 4LLMA 1MRFH 4ISVA 3S36H 1EEYA 3CE1A 4GG8A 3PDOA 1ZWIA 2R2EA 3ZL4L 4EQ3A 1RJLB 3QG6A 1RUQH 2OAAA 4ORZC 5B7MA 3SCMC 4FQXA 3IE9A 1P4LA 5F1NA 4EO5A 2OXGA 3UABA 1MIMH 3WKYA 2X3CA 4LFCD 1GJWA 4M8UA 4Y16A 4YL4A 2W60B 3GTTA 1I8LC 1E4KA 1I1AD 4AWJC 2EC8A 4A7SA 3H9SA 1PTZA 1ETJA 3SE3C 4UNVA 2WINA 5I1DA 2Z1KA 3GMQA 2I26N 3FUNA 1AXSB 4KZEH 1HHIB 5DURD 1E6JH 3A6CH 3FQXB 4NXSA 5DHYB 1T03L 2XCMC 4UAHA 4ZJ9A 2XN0A 1ZVSA 2J7LA 3BSHA 5GS1B 3V4PB 1J9QA 1U4EA 3L4YA 1KPUB 2FYVA 3LKNA 3N1GC 1AQHA 3VJ6B 4QKTA 1KTDB 4ZUUB 3EKCA 4PJCE 1RV6X 1QR1A 2IGLA 4KKQA 3G6DL 3WS3A 1QFHA 5E8PA 3VXQA 1T1WA 4KROD 4OQ1A 1L5GB 5GZND 3KR3L 3GKWL 3GMMB 1IARB 2NY6C 3FQRA 4RETB 2JKJA 4CC1A 4F8TA 1A4JA 1E9PA 4BK5C 2CXKA 4P2RB 4HCIA 4XBPA 1KJ2B 2EDKA 3S35L 5HSFA 4NZRL 3HFML 4QNPF 1MAMH 2WPGA 3L7EB 1CZ8L 3EOBA 4BM7A 2VQUA 2XWTA 3L4WA 4YE0A 1JRHL 4Y2DD 3IJEA 2VXUL 4LHUG 2ZXAA 2ESVB 4ZMOA 1H3FA 2MPVA 3ULUE 2XC8A 3L4CA 3CVIL 1JWUB 4MA1B 1N3NB 1XGRB 1GKOA 1M7DA 1VERA 4NAJA 5D2LA 3G3LA 3KM2A 2NY1B 2PO6C 4JR9H 1HAWA 1SY6H 3Q2NA 2E47A 3MRMA 4LRIC 3MBEB 1S9YB 3PWJA 4BSVB 5IR1B 4KY1H 5IVZB 1U2HA 2FYYA 4V1DA 5F3BA 1Z1WA 1VEMA 2EDLA 2FDBP 1EUUA 1KJVB 3VW3H 5EOTA 3L9RB 1QVOB 4BKSC 3ARGB 1MW1A 4FXKA 5EBLA 2D7QA 2QPUA 1INDH 2AMUA 4HA1A 1OGAD 3TU6A 5IJVA 4X6DA 1K8DA 2XXGA 2GB2A 4ZFOB 1A7OL 2D9CA 4EIZC 5HYSA 4TUJB 4BD4A 1CYXA 2FL5A 3QIUB 4NZJA 4YWGH 3NA9L 3V0AC 1AJ7H 3FB6A 2QT6A 4R7LA 4DV2C 1NGWB 3F8UB 3OB8A 2Z93A 3TA3B 1W72H 4NGHH 2VERN 2WCGA 4N2KA 1GS8A 5J8OA 3SDXF 1IGFL 4PMEA 3TBSB 2V17H 5IHZA 3J7AF 3BPOB 4Z0BH 5HP5A 1PU0A 3LAFA 3BWAB 4IEFB 2AQ2A 4RBPK 4N1EA 4NWUL 1HH6A 4XNZB 1BLIA 3KDPB 4J3OD 3LX9A 2DQGH 3JV5A 5EORL 4Y2OA 4H8PA 3WHE1 4DGYH 3QISA 4QT5B 5K9JH 2V2TA 2HZHA 4FG0A 3T2LA 2CIIB 2NYYC 2H0FA 5JIHA 5D55A 1I7ZB 2EEDA 3FCTA 5DMKB 1NUGA 3S5ZA 3B7UX 3G9VA 3MOBH 2F58L 3S5LB 4KO5A 5AENA 2BP0B 4JI1D 4JJ5A 4MMYA 4POZD 1K4DA 2BHZA 1U8JB 1KPVB 5GGVY 4X4ME 4M93C 2IGTA 2P46B 4FTVE 5ICZB 3U2IA 3HG2A 2P4AB 3GS7A 4ETYA 2K6WA 2P5EE 4WHTA 1KPRB 3UZEA 2BS71 4WY7H 3PG2A 4M1DL 4NJ9L 5JQHC 3ROOA 4DVRL 5ANME 3B83A 3TWCL 4PY8I 1RZ8A 2FQDA 5KZCD 3QHTC 3FYEB 1H3EA 5LAPA 4L9LC 2PTTB 2WXOA 1VFMA 1BREA 4NT6A 1XNQC 3OF6D 1YQVL 1P5VA 1MRFL 2J4WH 3S36L 4YSOA 3GMPB 1KIRA 3MREB 4FMFA 1BBJB 4P0DA 4PG9A 4X9FA 5CNHA 1DM9A 1TYEB 4XODA 3HP7A 1RUQL 4WGWB 2NT1A 3H8NA 1H5BB 3VXMB 5CLTA 4L4TB 1NAKH 3MXVH 5ALCH 2A0LD 4Y9EA 5A2LH 2NNAB 2HLAA 4BGDA 1ZLUH 5KS9A 1MIML 1SMAA 4Q6IA 3SDAC 1NDGB 5B39A 2NXZD 4JKPH 2BVEA 3CZNA 4GO6B 4UINL 4XNXL 5DS2A 3FH5A 5IMKB 5G5DB 1FFOB 5IVNA 2ICWI 4JCWA 4BV1A 5DK2A 4LF8D 1UZGA 2PYEB 5GS0C 5EZIH 3MUY1 2Y5EA 1QASA 2H2SD 2EVFA 3WNJA 1E6JL 4GAAA 1E4XI 4W6YB 4ESKA 1TYRA 4XVTH 4ILDA 5KW9L 1BX2B 1CE6B 2OL3A 3QK0A 5T3ZH 4U1LB 1NL0H 2H32H 2B16A 2ZSVA 4BFRA 4NNXB 1FNGB 3HE7D 1BA9A 1MCIA 3L6FA 2XG4B 2X2YA 4AGLA 2FJGB 3L3GA 1HCVA 3OZ9L 2ZP9A 1PAMA 1RERA 1MCOH 3VRJB 1JMZA 4LVHB 1A1OB 1W0YT 5E6IA 4UMGA 3X11A 4FG6D 2NNCA 1FYTA 1OF2B 4Y8DC 3MOAH 2IH8A 1CICC 5AW3B 1M4KA 3HS0B 2NYZA 5DZLA 4CVZB 4JHZA 1BVKA 3LEYH 2MQ3A 4FQ2H 4WV1B 3U7YH 5HHPA 3WLWC 1MAML 1CL7H 5TF1H 2QEJA 4R4FH 2OJ1A 3TBYA 4FA8A 3RVXD 5F7DA 2X4NB 5K9OA 4KK6C 3AMLA 3I75B 2A6IB 4IHBA 5F1IA 2W0FA 1DVFA 4W70A 4TLUA 4DP5X 3FRPG 2AMGA 3TO2A 1IAMA 4DCQA 2MCPL 2DBJA 2GITA 3HLKA 1S6NA 5F9OH 5F8RC 5I1GH 1PKQE 3QUZC 3FT0A 1FZOA 1YY9D 3I02A 2CGYA 2XG5B 4JI2C 4HEPA 1A9EB 3VW3L 4LLDA 4MS6A 5FO9A 1XNRC 4A55A 3QIBA 4TNEA 3MYJA 4XX1G 1B6UA 3DMMC 4Z3JA 3SO3B 3G5ZA 1INDL 2LHAA 3QXWA 7TAAA 4Y1TA 1WYJA 2XXFA 4XP9L 5AKRA 4DR5C 4CMMA 2IH9A 2J21A 5IT2H 2WLIB 4PUBH 3SE4A 5JW4M 2YD0A 2CLRB 2O5ZH 4YWGL 3JUYA 3KLDA 4CU7A 4XVUD 3WIFA 1AJ7L 4X9YA 4Y7MA 3N44F 5B4MD 1SLUA 4GRMA 2JCCF 5K39B 4B9IA 2I27N 2GT9A 3BP4A 4HOWA 3D07A 4BZ1H 4HKZB 3IAPA 4S0TD 4ZW3A 3WTYA 3VWKB 2V17L 3VXTB 4E9XA 1R33A 2CXGA 2ED8A 4OFQA 4PLJC 5KSAA 5TH2A 3KXFE 1GR7A 2FO4B 1P4IH 3VSUA 3ISYA 2BVTA 2CM5A 3ZBMA 4EIGB 5K9JL 4DGYL 2NXYD 4Y19D 5IB1A 2XVKA 4LKXA 4L37B 4PRBB 4LMQE 1DBMH 4PD4K 5IBUB 2DQFB 3C6LB 1R3KA 1UGNA 3O0RH 3V6FB 1LYQA 2CALA 5HXMA 5H37A 3SYAA 3GRBA 1CVRA 3CPLB 3MRQA 2R7EA 3PWNB 4MNGB 3CFTA 1MQKH 3BLBA 1INEH 2ZXBA 4H2CA 1T4KB 4HS8H 2WTOA 4OGXL 4KKNA 1U8HB 3EOYG 4AQEB 2OW6A 3T0BA 4WY7L 5JNYB 4MRCA 1KULA 2P24A 4FADA 4WJG3 2XETA 2J5LB 4NNYA 3OKKA 1MLBA 4AVJA 3QULA 4TRPH 4U6YB 4AI7A 1QLEL 3OB0K 2I9TA 1LDPL 3G6AB 1HQRB 4YK4C 4Z3FA 4XNQA 4KKLC 3KBPA 3QQ3A 3S0PA 4KKBD 5HHQB 4ZNEE 3DTXA 4XO4A 2J4WL 1SVBA 4J23A 4U2ZA 4A2GA 3T1HC 2F8VA 1I3VA 3TIDA 1BQHG 4ABUA 5IIEB 2Z31B 4XXWA 2D0FA 1YN7B 4FNRA 4I9WE 4QHLB 2LT9A 1NAKL 3MXVL 4NOFA 2YWZA 1CQYA 4OSUH 1GYVA 3VDCA 3MRHA 1JL8A 3B5TA 3ZKND 2YBGA 3X3GL 3QCUL 3SCMB 5ACZA 4OF3A 1FDLL 2BOLA 3VXRB 1MREL 4FQ1H 2YGPA 2VITA 4Z8FH 4UCFA 5HVHC 3OLDA 3K2IA 2CHZA 3QZNA 1E4HA 1NM4A 3Q6FB 2C1PA 4YOKA 5MERB 4NQDA 1AACA 4XVTL 1KDIA 4QLWA 5DMIL 3GJEB 1NL0L 4H25B 4Y5VA 1V3JA 5DHDA 4FZ8L 4LFCC 4ZUSA 2BX5A 4JLRB 2NX5B 1I1AC 1HQ4B 3GSOB 1DE4B 1MCOL 3QRFM 4HMDA 3CMOL 5HHNB 3MOAL 4DZBB 4LGRB 5F72S 1JI1A 2Z3FA 3LEYL 3U7YL 1IBYA 3RFRA 2NY6B 3FQ1A 1G7PB 4B96A 1CL7L 5TF1L 3FT1A 3GSNA 1YDPB 4MKMA 2YPLE 3ZE0F 1BF8A 4HU8A 3D9AH 5A43C 3TH4T 3L1GA 5GZNC 3FHAA 35C8H 5F9OL 4FMVA 5IJKA 3D3VA 5LNGA 3S97C 2DF3A 5JOEA 3QBTB 3SZKC 5HBBA 2XQ0A 4GLRH 2AJUH 2PO6B 4QNPE 2VW7A 3MV7D 3MV8D 3FBQA 4QRRA 1CFTA 1KGWA 2X41A 1ZDQA 4MXQD 1S46A 4Y2DC 3F7YB 4MD5B 4OY9A 4N8VG 4L3FA 2HFFB 3L2MA 1JXJA 3P30H 4FQIH 1ID5I 1A3LL 5IT2L 1Z32X 2FIKA 2VZSA 1N36D 5GRVL 3BUDA 4X4KA 4BIKA 4DOHE 3WFDL 3H6JA 3EUUA 1PLGH 3EXLA 4LL4A 3PS6A 4G8IB 4F93B 1S3RA 1SLWA 4HLZG 4IW4C 4UM8A 4AW7A 4ODUB 1WBXB 3A4AA 1PPIA 3W1ZA 3N3EA 2MSPA 4RDQG 3KPRE 4HX1A 3BDYH 4RNRA 4BZ1L 3VNYA 1FNSL 1CCZA 1UEMA 4LEOA 2VABB 4JHBA 5HGDB 3WTSA 1PX8A 1JK8A 2Q8AH 3SQBB 2Q0ZX 1R5VB 1XTLA 4NZTH 1TXKA 4QHMA 4RAVB 3VE0B 2WO2B 1P4IL 3OR7A 4U2YA 2A2QT 4GQ9H 3D50A 4LDCA 1DCLA 3V0VB 4UOZA 4LCYB 1DBBH 1FO0L 3MKKA 4GQPH 3O0RL 3ROLA 3SPCA 3REVB 1NDTA 2F6AA 5DC9B 4LLYA 1TG8A 2YUXA 4KQ0A 3QFDA 3SDXE 1OGAE 3J7HA 5ITFA 8FABB 5EU5A 2V9RA 2DRUA 1E7VA 1DQTA 1JGUH 3HRPA 4PRPA 3VFSA 4F7MA 2EACA 3L3OC 3CSYA 2EADA 3RHWK 1MSPA 5T3XE 3FUHA 2WLYA 4X9BA 2BVPB 5FLUA 3FQUB 5I0ZA 4UU9A 4J3OC 4B5EA 4JRLA 5CLWA 2Y4SA 4LLWB 4TRPL 2R1XB 5T1KD 3EDFA 5AUMB 2NY7H 2LTQB 4JCMA 1ZT1A 2UX7A 4LPVA 4PIBA 3RWCB 1NPUA 3F3HA 2ENSA 1NINA 2J72A 1J87A 2UWEA 3QDJA 3CBRA 4JI1C 3ARSA 4RMBA 1DFXA 5LLIC 4POZC 2NRDA 3UEQA 1XGPB 2MOQA 4JL1A 5LBSA 4YDKH 4XXCA 1X5AA 4PJ8D 1H3PH 3EFFB 2ED7A 5SV4A 2IAMD 2WBWB 3TPUA 4KMLB 2EUVA 4JQXC 4OSUL 2QSVA 3MUGB 3PHOA 5I6MA 4K71C 2C26A 2DICA 2FT8A 2GK0A 4JAMB 5CFAA 3HRZC 5I1LA 5DD6B 4P06A 3VX0A 4GS7C 4J8RB 4YN3A 2EVJA 2IOMA 1N12A 4FQ1L 4L1LA 3SDAB 4LLUB 5EEXA 2HT4D 2WVSA 1PIGA 3LSOB 2BNRB 1I1RA 3NP4A 2WMPB 2ICES 2IV9A 3L5HA 2GC4C 2FJFB 3I85A 3MNVB 4AZ8B 4GUPB 4MMXA 4N3UA 1BQKA 4OR1A 3NZHH 4G43B 1PZ5A 4WAFA 2EC9T 1HCYA 2A0LC 4HUVA 3T0ED 3LEVL 1FORL 3FTGA 2NXZC 3VM5A 3B3IA 2LABA 3KLAB 2M8XA 3M1OA 4NENA 4A2LA 3AB0C 4K3DH 4AX3A 2G3NA 2JJVA 2OTWA 4XWGH 1GJIA 1B0GA 5ALBH 1T4WA 3CUPA 2XI9A 4N8CH 4QEGA 4RGOL 3FOMA 2H2SC 1FNHA 2VMCA 3EBHA 2A6JB 4PB0H 1DBJH 1H19A 1F4YH 1FVCB 4WW2F 5GRUH 2OKMA 5ICXB 2IBGA 3UTSA 4B3VA 3PU7A 2AV1B 3PFQA 1CICB 4I3RH 4GRWH 3G5YA 5D7SH 3Q8BA 3V9EA 3O6FD 1FLRH 1PKQB 2H4EA 5EZJA 3EF4A 3QEQB 2V7NB 1HU8A 1C08B 1A21A 1KGUA 3VD9A 5IK3A 1MCQA 3D9AL 4A7QA 1JXKA 2LR4A 1M42A 4ANKA 1SN0A 4JFHD 1QNIA 1TQUA 35C8L 4FG6C 4XPGL 5E2WL 2ZICA 3REWA 3KPOB 2WWNA 1WBYB 2YAOA 3L13A 3M8OH 4NQCA 2AJUL 4QXUH 1SN2A 3KEHA 4HUCA 3DIFB 4M5YL 2GY7B 5EOCJ 2HVJB 4DK5A 4L18A 2HRLA 1G9NC 3RVXC 2DJSA 4RLDA 3WXVL 5E4IA 2WP3O 3BAYA 3DH3A 4U3HA 1I1FA 5KSBB 1A1NB 4LLAA 3DMMB 4Z6AT 4QHNB 3E6HB 3WNKA 4E9YA 5SX5H 4NUJB 1N0XL 1YY9C 4W4OC 1IBLC 4JI0D 3D2UA 4B9KC 4DUZD 3ME0B 1ZLSH 2BIHA 5F44A 2QL1A 4AYDC 3KM1A 3BDYL 3ZLQC 3S3DB 1TVDA 1QBAA 4M43H 2UY6A 4U4IA 2F4VD 2B1AH 2Q8AL 4ZZFA 3MLSL 4ZD3L 5FA4B 1NFDA 4AH2B 4MJ2A 4ZMXA 3VG0H 1KJ2H 1GOFA 1MELA 2Z7ZA 4GQ9L 4UMSA 1TCRB 3BZEA 4XVUC 1FCCA 1HE7A 5ICUA 4TVPL 3S8WA 1NBVL 1ETZA 4LEXH 5B4MC 2JCCE 2ZUVA 1QTSA 2R0LH 5C86A 1AI1H 3C60A 3MJ8B 5DD1H 1HDMA 5E6ID 4ZFFB 3JWDH 4WSGA 4GINA 3T8VA 3CGTA 1FYTD 2CUHA 4JKKA 4KDWA 3TYGH 5B38A 4BFOA 2P7TA 4ES9A 4HF5L 5FS5A 1XSOA 2H7WA 4JM2D 4OGZA 3JT0A 4OKDA 1EGJL 3HC3L 5EN2A 1IJNA 1GZQA 4MAUH 2XX1A 3SYPA 1QBLL 2DQEH 3AXIA 3ERXA 2NXYC 1GXEA 3ULSB 3IAGC 3TO4D 3D18B 2HLEB 3CWGA 4FQJH 5HGGS 4F7EA 1BM3H 3E9TA 2JJSA 5CCJA 1RZFL 3BAKA 3ESNA 3IJ7A 4WIQA 5J7CC 1RIVH 3CIAA 1SEQL 1HE8A 5JW5B 4BBWA 3W0WB 4Z77A 1OGPA 5C0AB 3PAZA 4KZ0A 3TCLA 3DX4A 2MOVA 4RAUA 2Y3AA 2L4OA 2VXVH 3AXHA 4HMCA 1YEDB 4Y19E 4L8SC 4KRLB 1Y8XB 1D7DA 1U3YA 4U1HB 3UG3A 2VDRL 1FAIH 3NVQA 4J1UB 4DR6D 2O6PA 3HZVB 3SKMA 3DO4A 4ZW6A 4C54A 1J0YA 1P1ZA 4HXAH 4OFYA 2XACC 1TVBA 3SGKA 5J1AB 2HFTA 2LFGA 3MTXA 4WRLA 4AMKL 4F57H 1QEWB 1F02I 2K8QA 4ABVA 1F86A 1PS3A 3HIZA 3H3PH 4Y88A 3ZMRA 4DH2A 4RX4A 4WWNA 2PW2B 4TSAH 4OCLC 1R3LB 3IEAA 4UTAA 5HVHB 4LXFA 4KNTA 4ZYKB 3TH2T 3PPEA 2Z35A 3AMKA 3MJ7A 5I76A 1G4RA 5TQ0L 2X9ZA 1OHQA 5KG9A 5MENA 4PP1D 1X6LA 2VT0A 2GW5A 2V5TA 2PW1A 1PMYA 3ZKNC 3RY6A 4JPKH 4R5TA 5IT9D 4K3DL 3UGXA 4ZMVA 1UHVA 4XWGL 3GMLB 1Z9MA 2PR9A 1NOAA 5ALBL 2G0KA 3HBZA 1I1AB 1NC4D 4X7SL 4D9LL 4PB0L 4Q0XL 1DBJL 1F4YL 5GRUL 4AKQA 4E2OA 4DV4D 2ZOUA 2NZ1A 3GXNA 3HNSH 4I3RL 4O2CA 3LZNA 1ZLDA 2DIAA 2E56A 3ARVA 4Y9CA 5CM1A 1FJ1B 1Z9SA 2C7UA 2NNXA 5L4IA 1FLRL 4P49A 3ARQA 1JWMA 5C1MB 5DJXA 1AO7D 2OZ4A 2DI7A 1F4AA 1Y7VA 5GS3A 5I66B 2EABA 4KQ4L 3O4LE 4Z7IA 1WCBB 2ZXCA 3LQZA 1MG3C 2BWDA 5F9WC 1UEYA 2YAQA 3EJPA 3M8OL 1ULVA 4QXUL 3D85B 4MJ5B 1WTLA 1TJIL 4EKXA 3KBGA 2Y7QB 2Q7YA 4AE0A 1WO2A 3QRBA 5C0CD 2CGZA 2X38A 4UQCA 1U8IB 3ZE0E 4BQBA 2VN6A 4WJ5B 4QRPE 3FTWA 1UADC 3N43F 5IWLA 1CI3M 4U7MA 4N9OB 4ZS6D 3MKGA 5A6IA 3TBVA 2PWEA 2SODB 2VQ4A 1L3NA 3N42F 3D12B 5EH1A 2A77H 3X12B 4HIJA 4MKTA 3BWZA 4YDVA 4YR6A 4YSRA 4OZFB 5DQ9B 2JB5H 3MODH 4KBPA 1GIGH 2GSGA 2AKRA 4PJGA 2YWYA 3TBBA 1MUJA 4DZ8B 1IM9A 3P0YH 2PP7A 3NFNB 4MXQC 1S7QA 4OZHB 5IEKB 1IV8A 2XWBA 3R8BB 4F37F 3HUJF 2IBBA 4FQXC 1BZ7B 4NFCA 1KJ2L 1N36C 5EOCH 2OSXA 4P23D 2QV2A 1MRCH 3RX9A 3PGCA 3FU5A 4LEXL 3MV8E 1AI1L 4NUGH 3R18A 1HHJB 1IC4H 5E9DE 2M2DA 3QP3A 5DD1L 3UP6A 3JWDL 3AQYA 2EECA 2Z92A 2ZUQC 3TYGL 3QRLA 3CFJA 4LSQH 4HS6B 3OMIB 4HDIA 3CHQA 3VM7A 2QSCH 4QY8A 4EI5B 1P9MA 1G6RH 3ONGA 4K2UH 3TJEH 4MAUL 5FCSH 2DQEL 5DUMH 2Y9RT 2IALB 3HI6H 3WHXA 2BVOA 3GSVB 5I0WA 4GP5B 4IRSD 1NBYB 3L3OB 1LWHA 3BGFC 4FQJL 4AYBA 1BM3L 1QI5A 2X1WL 4QTFA 4AJYV 1MJ7L 1YEGL 2VZ3A 4KKPA 3SOBH 5IJDC 3OKDB 1RIVL 4XO5A 4U6TA 1SQ2N 4LF7D 1H8SA 5JOPD 3BDBA 4U1GC 3C2AH 2X9YA 4M6MH 4LCWB 1ED3B 3IS0X 1JBJA 5D70L 4PJBB 1U8QB 3BPLC 4UTBH 4WEEA 5FECB 5HVGB 2PCPA 3VFOB 1HL9A 4QRRD 4RFNC 3NZSA 1BD2E 5BZZA 2RQEA 1VF5C 4W9GC 1RIHH 4W4NA 1M2VA 2JKNA 4NQQA 5DR5L 4XTRC 5KVFE 4HXAL 4HEME 2FUQA 3VYPA 1R47A 1W91A 1QLRB 1U92A 3H2WA 5D4IA 3T6VA 4F57L 1N70A 4K71B 3N5AA 3EYVA 1KYDA 3HRZB 3H3PL 5C0IA 2E7CA 2YD4A 4GS7B 5KZCB 1UM4L 1PJ9A 3W9DB 4NKIH 1N2RA 1SVCP 4CVXA 3IFOA 4TSAL 3ARFA 5FHAL 3RKDD 3WKPA 3VXSD 3UPAA 4PJ8C 1RUAH 4PJIA 4TL5A 4FA7B 2IAMC 1C8PA 2AGJH 1YUKB 2FB4H 1IE5A 4E0RB 3GSXA 3MNDA 1QSEB 1VCAA 3GZOA 2YD2A 3DX8A 2CGRL 2VC2B 4Z7UB 1FZMB 3KYDB 1TQBC 4XP1L 2VISA 3U46B 3KD4A 2NXZB 2HT4C 4ZFZB 1BOYA 4ODVH 1HH9A 3N6YA 2F5BH 3FF7A 5IV2B 4I48A 4WWKD