2ZTBA

Crystal structure of the parasporin-2 bacillus thuringiensis toxin that recognizes cancer cells
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
247
structure length
247
Chain Sequence
b'DVIREYLMFNELSALSSSPESVRSRFSSIYGTNPDGIALNNETYFNAVKPPITAQYGYYCYKNVGTVQYVNRPTDINPNVILAQDTLTNNTNEPFTTTITITGSFTNTSTVTSSTTTGFKFTSKLSIKKVFEIGGEVSFSTTIGTSETTTETITVSKSVTVTVPAQSRRTIQLTAKIAKESADFSAPITVDGYFGANFPKRVGPGGHYFWFNPARDVLNTTSGTLRGTVTNVSSFDFQTIVQPARSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crystal protein
molecule tags Toxin
source organism Bacillus thuringiensis serovar dakota
publication title Crystal structure of the parasporin-2 Bacillus thuringiensis toxin that recognizes cancer cells
pubmed doi rcsb
total genus 51
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3040 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ztbA03
3.10.290.50 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A 2ztbA01
3.30.1140.50 Alpha Beta 2-Layer Sandwich Ribosomal protein S3 C-terminal domain Ribosomal protein S3 C-terminal domain 2ztbA02
2ZTBA
chains in the Genus database with same CATH superfamily
3H9SA 2FJFA 1QEWA 1VHPA 4GAYB 4HKBB 4JGJA 2ZOKB 3E2HC 4Z0BH 3BQUC 4BWWA 4PJ9B 3R4DA 5DFVC 1BF8A 1QI4A 2X53A 4B9JA 1AZVA 4R96B 2FBJH 1FNEA 2B2XL 5AW1B 1NKOA 1PY9A 3EGSB 5C7XL 1BXAA 2B15A 3L4YA 4Y8AA 2A1WH 2CGYA 1MFVA 4LIQE 4KXBA 2R7EA 2GT9A 2XQYA 2GIXA 2XVLA 4U6VH 4Q9BA 4OI9A 5IMLA 5KVMC 1WP6A 2IBGA 3IJHB 3QORD 4GO8A 5ACMA 4E9LA 5HYSA 2E76C 3CFJB 2JB5L 3B7YA 4UU9A 5FV1L 2EXTA 3SE9L 5L0QB 2Z92B 3BE1H 3VA6A 4DH2A 2VZTA 1QSFD 5JXEC 1VPOH 3S5LB 3VFVA 3GMNB 3NT0A 1JZ4A 1DQLL 2VLKE 3OJDA 4GQ9H 5FUZH 4LIQL 1DVSA 2QELA 5C6WH 3NPSC 2DN7A 2Z8WC 4ZDHB 4MAYD 1ASOA 2BC4B 1VJSA 2YD6A 5I6LA 4WTWA 3CN0A 1MNNA 2Z7UA 4P46A 2BIQA 1Z66A 3HI6H 4J12A 4F27A 2Q0ZX 1X9UA 4NJAL 4U1LA 5BPPA 3RJOA 4ZTEA 3OKYA 5C2BH 1KCVH 1YHPA 2BIOA 5A2LH 5GRJH 4DSYA 5JTWA 4KI5E 3IRZA 5JQ6H 2G2RA 2ILLA 2YD1A 5DWPA 5DWUH 4IRSB 2VISB 4EF3A 1NL0H 2AV1B 2JIXD 2I9TB 3HZMB 3QQDA 5MP6L 2XTJB 4P3CL 4K94H 3ZDZF 4JI6C 2NY5C 4ZFOL 2ZM6D 3MYJA 4LEOA 1G4RA 5AVQB 2ICEA 1A1OA 4YAQA 3ES6B 1OAQH 4MZ2A 1G7JB 4O2EB 4ODXB 4AJYV 1GIGH 4M48L 4NO0B 5CBAB 1WBYB 2RCSH 5DUBA 2HPTA 2P44B 4WW2C 3B9DA 3W81A 1IRAY 2D7PA 1CE6B 3IXTA 4LLMB 4RA3A 4L4TE 2XKUA 5D1QD 1ZV5A 2FEEI 5DRXA 5KBKA 1N32C 3DX7A 1AD0A 5I1HH 2PTUA 4ZOCA 1TUPA 1IM9D 1F18A 4MMZA 2ZJSL 1CFVL 3QJFB 1DQJA 3EH3B 3FYIB 3L3KA 1FYTA 4FFZL 2VL5A 4ZXBC 5C0CA 3FFCE 4OGXH 3ZW3A 2NLJB 1P4BH 3D30A 2HX8A 3EOTH 4QNPE 1KJMA 4NUJB 4XOEA 1K3ZA 1BZ9B 2V7HB 4ZQKB 1LMKA 2V33A 3GRWA 1X5JA 3GKWL 5KYUB 3QUYA 4P2RD 3US0A 5JQIB 1U8PA 2HFFB 5E7FA 1CFQA 4KO9A 3KYNB 1GTNA 3ZTDC 2YQGA 3DX1A 1ZA6A 1IBLD 2CHNA 3BKJL 3C2AL 5E03A 1ID5I 1KF9B 3SDCD 3T6ZA 3BXNA 5K39B 3FTXA 2GVYA 3DURB 4Y5YC 2Z35B 4NDMB 4RISL 5E7BA 4LDCA 1N0XL 4G2AA 4IRJD 3OB0K 4EOWH 3QHFL 3TBSB 1F11A 1XCQA 2Y0SA 4UT9A 4YHZH 2ESVB 2F19H 4JANA 2PO6D 4OD3H 4XRCA 4WI0B 5HVHB 4LF3A 5LQBH 2COVD 3C5JA 4N0FA 5KSBB 2E7LC 2VXQL 1JZ7A 1ZT4B 3ABZA 2YGNA 4WUUE 1HL5A 4P2OA 1SVCP 1TZIB 4QCIB 4OT1L 1FA4A 4YO0B 1L9QA 5E9NA 1GZHC 3ABMB 1IAKA 2AKRB 3FB8B 4NI6A 5SWZD 4A38A 2F8IA 4HIIA 4MNGA 3LOWA 1F3JB 1JV2A 1BF5A 3S0PA 1C9SA 1ORQA 4YPGB 4BDVA 2QJDA 3ILPA 4OI8A 3T3PE 3GEWB 1S7WA 3UBXG 4AL8C 3RTQB 2O5XL 3B6SB 2KLRA 5LMNC 3VI3A 2RB8A 5KVEE 4G8GD 3U4AA 4YK4B 3OKNA 2VM3A 5C0JA 2J5WA 3BPLC 1Q94B 4B9YA 5AVXB 1WV7T 5AZ2H 2FK9A 2A77L 5I16A 3FTWA 4II3A 4K73A 2YOCA 4U4IA 2X3CA 4YBQC 4FI7A 2UVFA 1TFHA 3PL6D 2UZYA 3OG4B 1T7XA 2ZD0A 3TEZA 2ESVD 5ADPH 3WDJA 1VZGA 5F88B 1G7LB 1EEZA 1LK2A 2CDEA 1NCGA 2CA3A 4BKSC 4KITB 5JZ7C 1Q0YL 4LQFL 1I8LC 1FGNL 4OV5A 3MX0B 1JIBA 1Z9SA 4L37B 5DUMH 2Y5TB 3L95B 4H88L 2A6IA 3VFSB 3K6OA 4WHYG 4AIEA 1FHNA 4IBVA 3ENEA 1E42A 3MV7D 4R6UA 4XMLH 3QYMA 4PLKD 3J2PA 4A55A 3QZBA 4DW2H 1OK0A 1CYGA 4X4MA 3EOTL 4QJ4B 3K8KA 3KYDB 3LRSA 4G80B 1S7QA 5KYXB 1FJ1A 1V3MA 5F7KC 5MENA 2O5YL 3FB8A 3RIKA 1DJIA 2Z8VC 5ALBH 1T3FA 2DLEA 1MWAH 2ICEC 1JTTA 1G9MC 1TZIA 2CIIB 2GUOA 3VSUA 3ILQD 2A4CA 3OR6A 5BS0A 1FBIL 4QTFA 2K6WA 2EABA 1FIGH 4YDMA 4OFIA 3T0DA 5KSBA 4AENA 3HE7D 2QVIA 5E8PA 2X6MA 9PCYA 4A7TA 1AGFA 3KPSB 3L9RB 2DI8A 3NEXA 5IWLC 3PWJB 1HE8A 5L8KB 4CSTA 3EFFB 4W4OA 1XCQB 5T33L 1K72A 4OLXH 4DV0D 4FL4B 3VWJD 3APDA 4Y1SA 2VMCA 2BFVH 1LDPH 2XN9A 1RIVL 3DSFH 3HLKA 1H3UA 4MRBA 5K39A 1E5YA 4AJVA 4A66A 4BK5A 1XGUB 4NC2B 4OGYH 3FTYA 5K69A 1K4DA 3DIFA 3NIFE 9CGTA 1A7NL 1BLIA 2NXZD 2DLIA 1CFQB 2WK2A 3V5HA 2CRZA 3N44B 1U8QB 1NL0L 1QWNA 4R7DB 3WEAA 4M29A 4J6IA 2LLNA 4PRHD 1SMAA 3RL1A 3QH3B 4BFFA 1D2OA 3I50L 2BSED 2FCBA 3EG9B 3F5WA 4ORZC 2AI0H 2BSCA 3DMMD 4M5ZL 4PJ5B 1GR7A 1RV6X 3ESNA 2DDQH 1A2YA 1FL3B 1ORSB 2VLKB 1HIML 2VM9A 3RY4A 5LJYH 3L3KB 2I25N 3TT3L 5JHLA 4GKSB 4I18B 3M1BB 2XFGB 4FFYA 1RSFA 2XC8A 3IMVA 2A9ML 5DRXB 5I0ZA 5AW0B 1PJ9A 1QFUH 4XVSL 4K3JL 5E2WH 4HETA 4Z78B 2RHEA 4PJDE 1CE6A 1CPUA 1PNCA 2X4OA 4LLMA 4JPVL 4NUGH 4NQVB 1BIHA 1RUPL 3S3SA 3DETD 1KBBA 2X4SA 3L7FA 4NC1C 4ODXA 1MRCH 4MCMA 4PYGA 2N7SA 4FULA 3ES6A 1IBKD 2PYEA 4ABVA 4UANA 3IGAA 1PX8A 4DP7X 4IU3A 3CBJB 1W16A 1DLFL 4NJ9L 3QQDB 2F7PA 4HT1H 4ERSH 2W88A 3HZMA 4F7MA 3HB3D 1IC1A 1V3KA 2A4ZA 4RGNB 3HW7A 2V2TA 3WELA 4XBGA 5D96B 4GRMB 3EYUH 1TJXA 3VFWA 2G2RB 3FC8A 1GTFA 3L3OC 1KT2B 3ATDA 5J13B 1HZKA 1WT5A 1RZKC 4KRMB 2PXYC 3B1UA 1CVSC 3E2HB 1IQDA 3OWEA 4KFMA 5DMGD 3DHJA 5CD3B 4KJWD 1XGZA 5JXEA 2YZ8A 5CHNA 5F0PB 4ONGL 1I8AA 3L13A 4HIEA 1R3LA 4BGDA 2CG9X 4GG6F 4AZ8A 5BMFH 5FC9A 2R1WB 2XQ0A 4WO4A 1RL1A 3SEPA 4F3FB 4C83A 2CJ3A 1P1ZA 3RWGB 3RZCC 3FSWA 3V6OC 1FL5B 2VIRB 1IGJA 3FB6B 3EW3B 4MJ4A 2H1XA 3GMNA 4RFOL 5HYJE 3JV6A 5BR8D 3RY6A 1E7UA 5DZ9A 4YIQA 2Q7YB 2A6KA 2XA3A 3DVGB 4GW5A 1JF5A 1JNLH 3CFJA 2KQMA 4FABH 3H9YA 1N34D 3ARGD 3HN5A 4XMVA 2VM4A 3K0WA 2A0LD 5LGKA 4NQEB 2WINB 3ME0B 4JO2L 5J4MA 5IB1B 1D5MB 1ZA3B 3CLFH 1T6VN 4KQ3L 1F2QA 5E5RB 4OZHF 2ITDA 5F6HI 1OB0A 2DWSA 1RIVH 3DSFL 3MOAH 1PU0A 1D9KB 5GRVK 1MCWM 5I0VA 4PRBA 5AVTB 3HRZB 4LLYA 4F33A 1R34A 3T8MA 2W0PA 2ZOKA 2MNJB 4WIQA 1QEWB 2EIDA 3NG5A 2F19L 1A7OL 3C6LA 5FUCC 1SN5A 4Z77B 1Q72H 2YN3A 4PJCF 4LBAA 4U6HB 1UH4A 2D7MA 1XGTB 1GC1L 4AUJA 1NDGB 3FTGA 3IU3A 3U48A 5KBMA 4JFEB 3UJIL 3VXUE 5G4NA 3C60D 1XFPA 2E7DA 1LP9E 4P3DB 4NNJA 1RZPA 1S7UB 1XGQB 1CLZL 2HTKD 1OAYL 4A1RA 1ID2A 1NGWB 4OM0H 3VD5A 3Q44A 3V52L 4JEGB 3BGMA 1RERA 1DM9A 1T04A 1IGIL 2EDNA 2ZKMX 4LEXH 3VRIA 5TPWL 3HNVL 5FKAB 1IAMA 3QDJA 3QIBB 3X1FA 3HE6D 2UY7A 5LLIC 2OCFD 3QQXA 5BUAA 1C5CL 1D6EB 1AO7D 2NXZC 3CH1B 3QA3B 2N4IA 4ZPVA 5FUZL 5CEZL 1RUQH 5TFSL 3JSSA 4G3YL 3VG0H 4JPVH 4NUGL 2GY7B 3LNHA 3HI1A 5IWAC 4EO5A 1DEEB 5FR3A 1UWGL 4XMUA 1LP9B 2OMUA 2C3XA 4Z3HA 3GRGA 4PVBA 3FRPG 2XWCA 4H8WC 2KTLA 1JAEA 4K7PH 1I4FA 2J73A 2F74A 2JSFA 1FNHA 4TLUA 2W38A 3K72A 1NGPH 3Q43A 4XCNB 1BBJB 2PYEE 4MJ2A 1J1OL 3D07A 1HHHA 2AXFA 4FZEH 4YR6A 1TZHB 3LIZL 5HD8C 1I7RA 3D39A 1QSFE 5ICXA 2J8OA 1MG3C 5HYEA 4QRTA 1CR9H 2VLKD 2JJTC 4D0BA 1TTAA 4L4TA 3D0LA 3OWRA 1AQKH 1JGUL 1SLXA 5BZWA 1MVYA 5JQHC 3AQYA 3PHOA 1AXTH 4JDTL 4LSQH 3PWNB 3FU3A 2AQRA 4BE5A 3ZE2F 4NENB 1BZDA 4HJ1A 1OIOA 1JZ6A 2FZ3B 4DESA 3D0AA 1XL4A 1AACA 3H6JA 1H6EA 3NJNA 5D4IA 1EEQA 5GZOC 2F54A 5AOKA 1J5ED 4CW1B 3GS7A 4YE0A 1L7IL 3AJ7A 1ACYL 2ZCHL 5KOMC 1TVHB 2OMXA 2JK5B 4MWFA 5EN2A 4H44C 4OB5L 3ZRCC 4B5ZA 3MUGB 4LVHC 4PRIE 4DV4D 2BVTA 3DUSB 2CGRL 1WT5C 2G3XA 4XCFH 5A16A 2X9ZA 4Y0GA 1NAML 1OT1A 1XQ4A 2Z4QA 1M6OB 1NC4D 5CWSA 4AW7A 5AB0A 4KQ4L 4KKCD 2MQCA 3ULVH 3E38A 3GIVA 4FL4C 5DJCB 1MI5A 4EZKA 2G5RA 3HG1A 2M83A 1OCZB 4DFHA 4OZGF 5TF0A 3T8XB 5I8CB 3QUGA 5I30L 1MOEA 4Z7VA 5T3XL 3CFEB 4YSAA 2IV8A 1CLYL 1F0LA 3RZCD 4NNYA 4B5EA 5D7KE 1FO0A 3THMH 5H8DA 4HXAL 2B3IA 3KXFE 1X5LA 2Y4SA 4IHBA 4PG9B 5FA4A 4L29A 1YYCA 3VRLE 4XODA 5JDSB 3AGVA 2J57A 2NNAB 4FNLH 4PBXA 3BPOC 3D2UD 4UV7L 4AIOA 4NKOB 1TCRB 15C8H 4HA1A 2X7LA 4XHJD 3L5HA 3TLRA 2MOGA 5FFLA 1TZGH 3G5WA 1IC4H 3O3UN 1TKWB 2FGWL 4TQEH 5EFIA 4FTVB 3B7UX 4YSDA 1I85A 5B38A 2W0KA 1FNSL 3RB5A 4QRUB 4RQQA 4YPJA 5D2LE 4QHUB 2CO1A 1JNNH 5E00B 2PWFA 3P30H 2WTRA 3LH2H 2WXMA 1BAFH 1MNUL 4F8NA 1FYTE 1CLOH 1EDHA 1LEKB 1LGVA 3PL6B 3WV0A 3ZX1A 3RBSA 1LHZA 2RMNA 2ZNWA 3C6LC 1WCQA 4KMTH 4OUUB 1R0AH 2CCWA 3STZA 3KBEA 3O6MH 5IMMB 3UJTL 1U3ZA 3F7KA 5I71B 4L48A 1X5YA 2CQVA 2OMBA 5IWLA 2EZ0C 1HAWA 4LXFA 4TXVB 4ZJ9A 4L9LB 5CSZA 1FG2B 5MERA 4P5TC 1CGWA 4OQ1A 1HCVA 4JG5A 2RTTA 2YEZA 4ZT1A 2NX5E 2JKTM 1DYZA 2FJGB 4IK6A 3QFJB 2FSEA 5FLXE 4HG4J 2P80D 2A73B 4WKZB 2X1PA 4FXGC 3HNTH 5T1KA 1T20B 5K9OB 2ARJB 2W0FB 1NWPA 1QACA 1C8QA 2BLFA 3WTTA 1IVTA 3ZYZA 4CMHC 1E4WL 1MPAL 2HRGA 3HI5L 3HG2A 4C4KO 3CN4A 4EIBA 4NJAH 2VLRA 3DX9A 2CO7B 3HAEG 4HJIA 4F7TB 4Y5VA 3U0WL 1NOLA 5A40E 1XV8A 1V27A 1GY2A 1OGAA 4O2CB 1LO3H 2OTUA 3PGFH 3O4LA 5B4MD 1TNMA 1M7DA 1NANH 4KV5F 4I9WE 2P5WB 1E4KC 4G8GE 2VLLA 2XT1B 4P2YA 4LPUA 3KWWB 4Y16C 3VQ2C 4XAWH 3BKML 2K8QA 5F71A 2VDML 4JI5C 4XBMA 2EAEA 1S9YB 1JZ8A 4AIZA 3MTXA 4JI6D 1ED3A 1LXMA 1XGYL 2CE6A 1CO1A 3NZHH 2ZUXA 1XMQC 1SOKA 4H26B 1BFVH 2C3VA 3G6AB 2ITEA 4EDWH 1ACXA 4RNRA 3TJPA 5DS8B 4G70B 5IFJA 3DOIA 4EI0A 5C0DB 1P5UB 3BI9X 1J5IA 5KYWB 2UUAC 2XN9E 4LNRB 5GS0C 2IAMB 6FABL 3VYOA 4NXMC 3EUUA 3ZXAC 3LN4B 2WVSA 3QSKB 4IMKA 3GZKA 1OOWA 3I6LD 4ANUA 2O26U 3VQLA 1UWGH 2AZUA 2GJZB 1VZIA 2IOIA 2APFA 2W07B 3LY6A 4OIIL 4YHNA 5ENWA 3E9UA 3UPRA 2BVUA 4MAYC 1J5DA 2A74B 2IPKA 2BNQA 4PJCB 3FQWB 4XTRC 2NX5D 4OAWA 3W39B 1SHXA 4XNBA 1AP2A 5F1SA 1B0RA 2QL1A 3ILDA 1G7MA 3RIAK 5C0ND 1TPXB 3VD7A 3BVNA 4NLAA 3HNVH 4X6DE 4D94A 1KTBA 4KRPD 4K8RD 4FA8A 1QLFB 1ZKAA 4GKOA 2BSBA 2H3NA 4GKJD 3KYKL 3P9LA 3ULVL 2YD2A 2GPZA 1BM3H 3T3MB 3PWPD 1XF1A 2ENQA 4LHUA 1E8WA 1PKQA 3N1FC 4RFEB 4CN6A 5M95B 4BH8A 4PG2C 1L9OA 1YVLA 4WU7A 3VG0L 2PMZA 5ERWB 3ZE0F 4E9YA 1QA9A 3QG6B 3V2AR 4TRPH 2G75B 2X4RA 1EERB 2VZUA 1QFOA 3JTSB 4YDKL 1YNKL 1XBDA 3L81A 1RHHA 5F7YC 3UCQA 2VXQH 5DRWA 1S8DB 1AH1A 4OVVA 3ZO9A 5KSBE 2VC2B 2WLZA 2YO3A 2FEJA 3OAWA 1EZSA 5GGUA 1BWMA 2OW6A 2D03H 5J57B 4XZUB 1SOSA 5FYKU 3L4ZA 3MJGX 3P73A 3P3SA 5GGRB 4CVZA 4CSZA 5K5YA 5IJKA 5IT9E 1FL6B 1O7DE 4JDEB 4W1TA 4JRLA 1EXGA 2EDLA 3V6ZB 3U7YH 3HS0C 1TJHH 3LRGA 1FNFA 1CT8B 1QP1A 3MV7B 4NZFA 4AEIL 4AEFA 1JK8B 4QAMB 2FWUA 5JMOC 4JL1A 4BGLA 1B0GA 4KK5D 3T0EA 4Q0XL 5CEXB 1VGKA 1IM3D 3QEQB 4U3CA 1OVZA 4AQZA 3B3IA 1KCLA 1F13A 2YJQA 4Q58C 2A9DA 4F2MB 4JI8D 2WXPA 2D3VA 4BA0A 4M3KB 2CGZA 2WXKA 3RWFB 3ROOA 3L3JA 3GZPA 4UQ2B 4L0YA 3CFCH 1V7MH 3F83A 1BJMA 4MA8L 4JFED 3DI2B 3WXWL 3O4LE 1HDMB 4DV6D 2DWEB 3HZ3A 1ANUA 1Z9OA 3VG9C 2X2JA 2IQAA 3EYFA 2IQ9H 3F2LA 4GS7C 3IDGA 1CU4H 1U8OB 4OFKA 4GG6B 3ALPA 5C70A 4F57H 3NIDB 4M8RA 3QJSB 3AFLA 5D70H 3SOTA 1UFUA 5DVLA 1QPXA 2H1PH 3HS0A 4M7LH 3RA7H 1T4KA 4QXTA 3PWPE 4V1DD 4M8VA 5JIKA 2ENSA 4JREB 4YFEA 4DIXA 3ARGB 5TH2B 5D93C 3ZZQA 1IEAA 3SBRA 2AAAA 4XO3A 3F58L 4FNSA 4AKOA 4Q0XH 1JV5A 1UVQA 2IDUA 1IBMC 2OTWA 1CDUA 5K1JA 2EO1A 2VXTH 3ZQWA 4EN3A 1F1AA 1SDDB 5HYFA 4M56A 1AOZA 4AYDC 1A7OH 3R06A 4DEPB 2CR6A 3FQ4A 3RNQB 1LO4L 1XIWA 1MDAA 5FDYA 5IQ9B 4Y2OB 3WFHA 4YHHC 1GYCA 3UAJA 4MTMA 3AMKA 1QEXA 4LF7D 3ZYOA 5MHSD 4HAGA 3QDJE 4X6EB 2HUEA 1IFGA 3RX9A 5GS0H 4XPHL 2NY6C 2XFXB 1KV3A 3ZE0E 1J5OL 2B20A 1LO0L 3FB7B 1VKXB 5IB3A 4LF6C 2ZWLT 3OMIB 3LD8B 1PNDA 4TUJA 2E6PA 1IUZA 1JDDA 4AITA 4BQ9A 1CU4L 3DWTA 3EJUA 1KBGH 1QG3A 3LH2L 4FQJL 3BUYA 4PJEB 5MI0B 2XZAH 3MV8A 4L8SC 1RZ8B 5JW5A 2E5LC 4MNQE 1MUJA 4BKLB 4ADIA 1T66D 3STLA 1KNOA 4YSPA 4FG6C 4HKXA 1RSYA 3ZTNH 2ZUUA 5FK9A 1H6UA 1CFVH 2OSLA 3C8KB 3WL9A 3A4FA 1AD9B 3VA2C 4ZUTA 4ZMYA 4NPYB 3I9GL 2EIBA 3VMPA 3S36L 2RCSL 3P3YA 4GKJC 3EJSA 2WN3A 2AAVA 3N40P 1USQA 4S2SA 3U2IA 3GINA 3VXQB 4GO9A 1UB6A 4NN7B 2HJKB 3NVQA 4NEHB 1FNAA 4Z7IA 1PZ5A 3TT1L 4CMHB 1U8IB 3LQAH 2QSCH 5F96H 3VFNA 1KXVA 1QLEH 5D7SH 5TJWK 1QUPA 4JFFB 1GGBL 4QF1A 3U4KA 3GSQB 3IT8D 3QISA 4UTBA 2BP0B 4LSUH 4NO0D 1TJIH 2VO8A 4POZC 1WO2A 4Y2DB 5IMOB 5HHNB 2A83B 4YXHL 2Q8AH 2CKBA 4TQIA 3TBVA 4KJYB 3H9HA 5TDOB 3H3BC 4Z7OB 1Q9WB 3FOLA 2PW2B 1MHPH 1WVZA 3D3VB 3QUMA 3FQNA 2XG5A 4JVWA 2JTDA 3L3GB 3ZZ1A 2OQJB 1IGML 3SDAA 4ZTOL 1MDTA 1F41A 1KXTA 2IGFH 5EA0H 3UXFA 5GIRB 4PWIA 1JZEA 3PWVB 3BKMH 3EJYD 3IXAB 4EUPB 2XY1A 3ZL4L 5I1KH 4V2CB 5D70L 3ECVA 3K2IA 2BNRE 1BYNA 1KMGA 3TASA 3VXSB 3S2AA 4YDVA 4S1QH 1NDTA 3H2WA 4C56A 2YPVL 5JIDA 2VLJD 3FW6A 3G6DL 2OV0A 4F8LA 2BOCB 3QPQD 4QOKB 2XRAL 1KXHA 5B8CA 1FQ9C 4JG0L 4A2EA 2R0KL 4OJYA 5C8JA 5C08A 1VFBA 1DN0A 4GW4B 1V7ML 5D8JL 4TLKA 4TUKL 5DGQA 5T1LA 3DTXA 4XNUL 3HOGA 3OM3B 3NSCA 1ASPA 2FX9H 1WGOA 4IIZA 3E8UH 5A6IA 5SWQB 1L6PA 3JTTA 3BKYL 1MXGA 1VF5C 3OC5A 4AQAA 2P1YA 3LRKA 3WXVL 1X9LA 4M61A 4DKFL 2CMRL 5CZXD 2QKIB 5CJOH 5AYUH 1A7RH 3VD2A 2HLEB 5F3HA 1W0WB 5T3ZH 5CFHA 1IGYA 4QRPD 3D33A 2UYLB 4UT6H 3OHXA 2QHRH 4G3YH 1HSBB 3ZMRA 2VDMB 3SGKA 4BD4A 5IKCA 1BP3B 3BPNB 3CMOL 3MBWA 3F12A 4BM7A 3ZTJH 4LGRB 1O75A 1KLGA 4W9EC 2WUCH 5SX5H 1URIA 3QUYC 1BAFL 1MNUH 2PP9A 2UY6B 3EO0A 2J44A 4FJYA 1BQKA 4YL9A 3HC3H 3II3A 4F7PA 2G5BA 2ZF9A 3Q8EA 4CAGA 4KZDL 4X6FB 2AJSH 3PDOB 3CE1A 1MCCA 4PJEF 3OTOD 4K5LA 5D7IB 1BFOA 3BIKB 4GBXC 2VXVH 5FYLE 3LV3A 4LSRL 1T7ZA 2OK0L 3KDMA 1I82A 4JS7A 3EJZC 1T1ZB 5C0AB 1PZAA 1I3GL 1RLBA 5LAPA 4IOIA 1LL1A 4F15B 5HPMA 5I9QC 4XXDA 1MELA 2VJXA 3REVB 1LTXA 3MR9A 5GJTL 1GW6A 4TQPA 3MLSL 4ZMQA 5CLZA 1I1AD 1HI6B 1XXDC 2ENPA 2C3GA 3D09A 4HDIB 1B4RA 5E4IA 3C5XA 4KROD 4YVUA 1BZ7B 1MAMH 4JFQA 1IO4C 1IC7L 4LQ1A 3SODB 2Q8BL 3MLRH 4BFOA 4CN1A 1KIUB 3HUJE 4N9GA 1NEUA 2AJXL 4DK6A 5FUCE 1WGVA 5DHDA 1OAXL 3FUDA 1OP9A 1KGYE 4PJHB 2VUKA 1HHKB 5D2LA 2H0JA 3G7TA 3DJZA 2DQDL 1OHQA 3GBNL 4WI9A 1ITCA 3IWVA 3LEYL 1HR0D 2ZUQC 4DPCX 5E8EA 2QV4A 1KB9J 3GMMB 4AV5A 1U8CB 3X14A 3BPCB 3ARWA 2J8UE 3A5VA 4IJTA 3ELQA 3GC3A 5F9JA 1G7QB 5EO0B 1U4EA 4Y5YA 3BAIA 2M8XA 2FNWA 4OCMC 1NC2B 1V8HA 1JHTB 2WTPA 4E0RB 3QJHA 4ODVL 2X6BA 1G7PA 1JPFA 4UILH 2BP8B 4HLZH 4R0LB 2A77H 2UUBC 3DPBB 3HC4H 3SE4C 1M3JA 3CFDA 1DSYA 2DLHA 4JAMA 2MQGA 5GHWH 3LMJH 3MV9D 5IVXA 3R1GH 4D9QE 3G6JF 1W91A 1J8KA 4JCWA 4PJXB 1GW0A 5F1NB 2ICWI 3DH3A 1IC0A 3CSGA 3MA9L 3L3HA 5C09D 1J0IA 2JNZA 3DK2A 2YR3A 2W0LA 2OPCA 1AY1L 3CSPA 4FKEA 5DYOA 3QXAA 4HJSA 3PWLB 2ZKWA 2OR7A 4OZFH 1I1YB 1YUHB 3WGVB 3CNKA 4MNQB 4KKLC 2IADA 4FDWA 3U30C 4CGUB 2VN4A 3PNWB 3X1BA 4W9KC 5BQ7A 4Q56A 3DX2A 3RWEB 1ZVSA 4OCRL 1TTUA 1J18A 1JMZA 3W5MA 5CEZH 1GOHA 2WBJD 4PJEE 3N41F 2CALA 1AI1L 2CLVB 4JO5A 1Z3GH 1CG9A 3QRGH 3BRGC 1GHFL 3NQKA 3ULAB 2Z7YA 4G7RB 5AD0B 1LEGA 5ILTL 1CFSB 2DIBA 1CGSH 2JKNA 2XTJD 1NFDB 4G1EB 4PRNB 5JR1L 4RLDA 3H4HA 4A67A 4JY4A 1SLWA 4HISA 1AC0A 3U0TB 2YRZA 2KI6A 3B56A 3MREB 4K3HA 3HNTL 5C3LD 1HZHH 3GD1C 3IU4H 4FS0A 3IDYB 5D71H 3NABH 4Z7UB 1KFGA 1ECZA 2MCPL 2A6DA 3P1VA 2H32H 5DJ0B 5EO1A 3QNZB 1MRFH 3HCVB 2B59A 5IFAH 4FFWC 1CDJA 2ZICA 5FGCE 1E43A 5DJ8A 3O6KH 1MRDL 1RU9H 5HVGB 2WO3B 4P5TD 2H47C 5JO5A 3B9EA 2XXMB 1FDLL 2OJEB 4RMTA 5CF3A 4APQD 2D31B 2VERN 3OX8A 3BUQA 4K7FB 1FVCB 1T6BX 3L7EA 1OTUC 4H8WL 2F7OA 3NEEA 1BD2A 5BOJA 1NZRA 1FFPB 3D4GA 4PJIB 2W59A 3TF7C 4TULH 3QJZA 2XZCH 2ITCA 3QIWD 5LXGH 4QRRB 4X4KA 1DO6A 1X5HA 3RE0A 1DFBH 3QDGE 3H2QA 2FHFA 1NGXB 1RK1A 1PZDA 4N0RA 3KYKH 2JCCE 1S5HB 1ES0A 3BP4A 4GRLB 2BOLA 1SJEA 5ILTH 1DSFL 4TPRL 5TTRA 1HNWC 1PEWA 2FYYB 3WLWC 5IOPB 2XWJA 3GWJA 5A2CA 3NIGE 1IB5A 4PJ8C 1U41A 3CN3A 4UTCA 2FWOA 5A2JH 2F4VC 4M3JA 2CPUA 4XHJC 3D51A 4R90L 1J5OH 2BS8A 2ZOWA 1YEWA 5EU3B 5C97A 2X0VA 1II4E 2A4EA 4APXA 2E4FA 2H4EA 3FT9A 4LDLB 5DQDH 3NCJH 2R2BB 1DUYA 1F45A 2EINB 3AREC 3NJVA 3TCXA 4D0DB 4ZUUA 4D0DA 4UDUB 3FUJA 1C8PA 3ARFD 4PGBB 4X5LA 3GZOA 4IGBB 4N90D 3WJJC 1RZKH 2LW3A 3ECBA 2E74C 4H1LH 4OVUA 4HJ0C 3REWA 4FCAA 3ARSA 2BINA 5E2UH 5JW4N 1DUZB 4HAKA 1YGTA 2VMFA 3U4EB 2I9LB 3NZHL 1GH7A 3QO1B 5KUKA 5E6RB 1O6SB 2FYYA 4NN6B 1R3JA 3ZE1F 3QEHB 3IJ7A 4DV4C 2K45A 2JJTA 1XGRB 4FQHB 4FZEL 5IM7A 1U92A 1DQLH 1YN7A 3VW3H 1S5HA 4G5ZL 4Z7VF 1B4JL 2NQDA 1UA6H 2PCFB 2YC1B 2YBGA 1SUHA 3QJOA 1KSLA 4FLOA 1UTDA 3CPLB 2NMSA 3FS9A 2ITCB 3QJXA 4NRZA 1KB3A 1EJOL 2FBRA 3MRBB 2FQGA 2NQCA 3UCRA 2IFFL 3KPOB 4DVRL 3WEMA 2ZZUT 2E75C 4NSKB 4NO3B 4EIZC 4XN9A 3GGWB 2VAJA 4GFXA 4DK5A 3BAEH 4UUJB 2R0WH 3UBFA 4LRNH 3OX8B 5I1JH 1X4YA 5TQ0H 1Q0XL 3EFOA 3JYBA 1XH0A 2OP4L 4E41D 4Z3TA 1IGMH 2I24N 4UNVA 2ZG3A 3CFKA 3OLEA 4JBSA 4DP5X 5A2FA 1T83A 4IDJL 3S3CB 1H9VA 1INQA 1FP5A 3M6DA 4X6BB 5MP6H 2Y23A 4I48B 2GQHA 2XA8L 3VH8B 5HD8D 4ODHL 1A3RL 1BQHA 3HCVA 8CGTA 1RZKL 5C07B 4DO6A 1AYRA 3SCMB 3MV7E 1U93B 3S37L 1EJ8A 3FCGA 3CMGA 4Z7UA 1P84K 1G6VK 2ERJC 2F15A 3IFLL 5E5UB 3U0TA 2FE0A 1U3HA 1VFMA 3LQAL 1BQ5A 1HWWA 5GJTH 5JDJA 3L2LA 3SE8L 2WMPA 4WWKD 3E3QE 3S98A 2DQCL 5D93B 2QSTA 3IFPA 5EEXA 1HAUA 3N6YA 1T4WA 2Z65C 2WXOA 4QRQA 5FLXD 1EGJH 2EVHA 4PTUB 3BISA 2OMTA 5D7HA 1NKGA 3WFEH 4NQXA 3I75B 5D1XB 5IHZB 1QSEA 1JMXA 4Q7DA 1ZVSB 4XOAA 3J81D 4TPRH 2RR3A 1UM4H 1HH6A 2HTLD 3H0TA 3RTQC 4C4BA 3H56A 3STBA 3HE7C 4O9HL 1XMEB 4CRPA 2ZKYA 4IHOA 3UYRL 4TOYH 4PJBF 1J1PL 4JPKL 1DEDA 2YWZA 5E6UB 1QHOA 1CS6A 5GRZA 4NWTL 5D2NB 1GYUA 1UZGA 5DT1L 2KZWA 1Z7JA 3T1YD 4B3EA 1YUKB 2IG2L 1IEHA 5DK3A 3FFCD 1ICTA 1FLRH 3QP3A 1EBPA 5H37A 2Z93A 1WITA 4FQIL 4ES8A 3IFPB 4W6YB 4YLQT 5D6CA 4YEFA 4Y4HC 4L9LC 3L3OA 4ETQB 1FC2D 1MSPA 4HHAB 5I71C 1G7PB 1WICA 4LE8A 1L9RA 5B7MA 5L7XL 3KL0A 4L4JA 4RGOL 4J2XA 2XA8H 2R0LH 2RACA 4TM9A 4LO9A 5HPOA 3EOBA 1XZWA 5F9JB 3QBTB 4JKPL 3PL6C 2CJTA 3Q8BA 1A7PH 1AHKA 2NUTA 2FWLB 4BXVA 1NGYA 4B50A 3CDGA 4I2XB 3X14B 3IJEA 1NH6A 3SYPA 2ODIA 1T0OA 5GGVL 2P45B 3VI4A 1UCBL 5LGJA 2CPCA 2H2PC 3QDGB 4OZHA 4K3EL 3APMA 4X6DA 5D2LB 1IIKA 4ZX3A 1YPZF 5ICYA 3H3PL 3L6FB 5K9KA 2OSYA 3C5ZD 4JFFD 3ZDWA 1WDAA 4MQXD 1JPGB 2J20A 3DOSA 2WPGA 1YY9D 2NZ9D 3ZKQD 1E30A 4MLIA 2CM5A 4XX1E 4JZJB 1HESA 1ETA1 1IQWH 5LG6A 2ZP8A 5D7JA 2ZWSA 2ZXGA 2NCEA 1CL7I 3SDDD 4DP9X 5H4ZA 2DQTH 3ULVC 4I0PC 2PCFA 1S4IA 4XCEA 5C86A 2HT3D 5EU7C 2VLMD 3KPPA 2G2NA 1IZJA 4NKMB 3TBWB 2WLLA 4XXDB 1QFWH 2VQEC 5HPMB 5CJ8A 2APSA 4LLQB 1NC2D 3RWCB 2KPWA 4OCYH 5FCUH 1WE5A 2AFNA 4E9XA 1MFBH 4PVMA 2J8HA 3BGAA 4YWGH 1A6PA 1GZQB 1KGCE 2BVYA 2C4FT 4GEIA 2NNXA 2D3LA 2DAVA 4OLUH 1Y1DA 3REWB 3T2OA 3PABA 4KJPC 2CLZA 2ZWYA 1J9TA 4WGWB 2MMXA 4XNMB 1H0DA 2LU3A 4HIHA 4X4XA 1ZLWH 5IP4A 3BH9B 5AB2A 1NFDE 4Z7NB 2FHBA 1WS7A 4F7PB 1LK3H 1HEHC 5BXFB 5CZVH 4QRBA 2HFEB 4GUPB 2UY6A 4K7PX 1P7KA 1E2WA 1IKNA 1BQSA 4PRDB 5GGTL 1TG8A 4MA8H 2XWRA 4IDLA 1FV1B 3NCEB 1DDHB 2ATKA 1IBZA 2WW8A 5IR1A 3MBWB 3JWOC 3ARFB 5HYJA 5F97E 3ZO0A 3FFDA 1OALA 5CSGA 5LCVH 2J8UB 4DUWA 4UM9D 2UYLA 5KW9H 4P4RB 1IGYB 4FRWA 3CLFL 5IOPA 3EGXB 4KTYA 4WK4B 1U8MA 5CJQH 5JHDA 2K3HA 1A0QL 1A9EB 1KCUH 2QDVA 4HX1A 2WQWA 1BXVA 3T6QC 3BQUA 2XX1A 3IDNB 3EO1A 1MAML 4HK3J 2WQ8A 3C75A 3HUJB 3O11B 4QRRA 3FQXA 2AJVL 2OMWB 4ZXBD 3WD5L 4GY4A 5SWQA 2YAEA 5FHBL 1IKFL 3OAUL 4G9FB 1E27B 3K2UL 1D5BA 1G94A 4UNUA 1MLCA 1R1CA 3IDXL 5GSVB 1ZLSL 2KS0A 3WJLA 1A6AA 3V9EA 4K9JA 2ATPA 5AW6B 4DETA 4I0CC 4LF4C 4QOKA 1ZTXH 3QUXD 4BH7B 3WN5C 2DPKA 1PZBA 5EORL 5FFOA 4KKZA 3ARBA 1CCZA 3X1NA 4C56B 2PWGA 5T3ZE 1FVDB 1DBAL 2IDTA 3ESVF 2HXAA 1U8NB 2B59B 1OM3L 2NSXA 5EOQL 3CQPA 3DIVA 4NC0B 3GKZA 5AVWB 1T22B 3QAZC 3SO5A 1UHVA 5GRXG 4AZUA 4P5TB 5EO9A 3GZQA 4CJ0A 4FA7B 4OKVB 4JRXB 4HMDA 4NNPL 4JG1H 4DP2X 3MBED 3MRMB 2Y2TA 4WI8A 3LZQA 1ODAA 4B3TD 3ZSTA 2H26B 4L8BB 1UD5A 4JY4B 3VWKC 1PG7L 2VQ1A 5IT2L 3SDAB 1NCDL 4MMXB 5IQMA 4ELDA 1CFSA 2H6UA 2EDMA 4XCYB 4EN2A 1W15A 1F4AA 2HJFA 3MV9E 3PHQA 5D7EA 4N0CD 1FPTH 1QPKA 4Y2DA 3LB6C 1CYXA 3E6FA 4IBWA 5CJOL 4X7TB 5CS7A 3WXWH 4YSUA 4Z8FL 3U30B 2YJLA 3HRZC 5IV2A 1JOIA 3HC0A 3PNRB 3TTYA 1W72H 3IJYB 1HXKA 4RAVB 4TTDD 1JGEB 3NN8A 2FX8H 4X99B 2DMKA 1L5GA 1UCTA 4HT1L 1OP3K 4OLWL 4AYBA 5HHME 1UGNA 1LEIB 4JM4H 1NFDF 4GKZB 4Q6YA 4S2SB 2D7TL 3APCA 4R4ND 3BEWB 4U1GC 2APWA 3L3HB 4YSEA 2GI7A 1OCRB 1OAKH 2E8ZA 3E6HB 4NQDE 5AKVA 1ZDSA 4NQCD 4MD5A 1AD9A 2ZXAA 2WZPD 2JTYA 2UZIL 1A3LH 1QSVA 3CZLA 4BFBD 1I85C 3GDCA 3V6BR 4JCMA 1MFMA 2Z9TA 5IVXB 1KFAH 3ZHKA 3BP7A 3N43B 4TLTA 5EBLB 1X7TA 3KG5A 4P46D 2Q20A 4NP4H 3CFDB 3MV8B 5JW5B 4KTEH 3DPBA 5E9DE 1CI5A 5GGRY 1XF2B 1JPFB 4P57A 4A2DA 1G7IB 3QEGL 4HD9A 1GVIA 4OF5A 5DUJA 3U6XA 3BD3A 4CNIA 3CHXA 2NY1B 4YXLH 1T7YA 1IFRA 3FB7A 4RZCB 4P46C 3SDCA 4K9EH 1FJGD 1WA2X 4N8CH 4WFHE 5C0BB 4X0KA 4X6EA 2XKNB 3JXAA 1WG3A 1HX0A 1WD8A 4L9DA 4M6MH 3ZDZE 1YMMA 4CMMA 5HY9B 4CSSA 1NQBA 1MEXH 1XIWB 1KPVA 5BQDA 4XX1G 4CN4A 5KANI 3HZYA 4OCSL 3R06B 4UQ9A 4E5XA 4Y88A 1JGLH 1JDCA 3MN8A 1A7NH 1G0DA 5CZRA 2OMZB 3I3EA 2ITFA 1F3DH 4N9GB 2FQDA 2OZ4A 3WTXA 3LKQA 2NY5L 3DX6B 3OB0H 1A7BA 3UO1L 5DC2A 2XX0A 3FN0L 1HI6A 1N0LB 2YXFA 5CXPA 4MAUL 2BXYA 3MRQA 1M7UA 1OPGL 3FT3B 4LCIL 2F7RA 4HXBL 4EKXA 5M94B 5KJRH 1AXIB 3DV4B 3TV3H 2NY3D 3REVA 1WA0X 1T7VA 5I6KA 2WWNA 1EAPB 2RQ8A 1WFJA 4H5SA 4ZUWB 3ZYIA 2R59A 4KJPD 5AAWC 3H8NA 4WNQA 1QW9A 4ELMF 1CTNA 3FSVA 2IQAB 4LCWD 4M7JL 3KCWA 3WD5H 4ZAKA 2JJUA 3UTQB 3ZTNL 2H1LM 2MQ3A 3PPSA 5ID0A 4AQEB 4TNWF 2YZ1A 4KKAD 2IGLA 5T1JA 5EU6B 7TAAA 2BHYA 5IROD 4WDIA 2CBTA 1LMIA 3DDGA 4IBUA 4MD0B 2BY2A 4BWTA 2OYPA 2IWGA 4L5FH 1FCCA 4LLUB 5HHPA 1P53A 4PJFA 5DI8A 1KLGB 4PH8A 2J5LC 4UIMB 2WLHA 3QXVA 2GJPA 1MCSA 1E5BA 3BO8B 2PO6A 2OS7A 3FZUD 4PJAF 4XN1A 1IVLA 5FYJU 4X62D 5IKCB 2Y1VA 1DANT 3PV7A 2LR4A 3OHXB 3U1PA 3ARPA 1JGDA 3DBSA 3LSOB 1JK8A 5DUPL 1KGXA 1AANA 1FZKB 2CU9A 3N9GH 5E8OA 3V0WH 3MV7A 5JYLA 1RCYA 2W9DH 4IEFA 1LVEA 4N6RA 5F0JB 3UROR 4Z7NE 1RJCA 1JZ5A 3BDBA 3RWJB 4O02A 2FB4L 2Y6SD 1UOVA 4JL2A 3ULVF 1KG0B 1OZUA 2E0PA 1L0YA 4ELKB 3U9UB 4KHTH 4J8RA 4RRPA 5B1CA 5TE7L 4L3FA 3W3BA 3R8QA 2BY1A 1MRCL 1R5IB 4PY8J 5FOBB 3MKKA 1MCPL 2CRYA 3I2CL 4HS3B 5HGDA 2R0KH 3HLAA 1EDYA 2YHGA 3UZEA 1KACB 4GW4A 2WVTA 3L2MA 4PJDB 1C5BH 4UQBA 3UACA 3ASNB 1QA9B 5LWYH 1QSEE 5B8CB 2AQTA 3UTTA 4XNZB 2X1WL 1XB3A 4G8GA 1NLDL 3U1SL 4GXUM 2X9WA 3MJ8B 4FQPA 4IRZH 5FO9A 1VGEH 2F1BA 3TT3H 2CRMA 3VYNA 4HUVB 2WANA 1YNLH 4BK8A 5ID1B 4IBQA 1I8KA 2IALB 1AKJA 5I1LA 5GS3A 4F93B 1L3WA 3IF1B 1Q1JH 4ZO7A 1B0RB 4CC4C 1UWFA 3TIDA 3WNMA 4LOFA 4AYMC 1UWXK 1JHLL 3BLKA 3PXLA 5GS1C 3BW9B 4QY8A 4E5XG 2BNQB 4PJCA 3GUTA 4U1MA 3ZE0B 4Q2ZA 1R24B 1MFCL 1B88A 1ZLDA 2NY4B 2UUDH 3ZIMA 2CJUL 3ZT7A 5J56B 4K2UL 3RJDA 4DPAX 3CHPA 3MA7A 4HWZB 3LKRA 2GJZA 2QPDB 3FOLB 3WIFB 1BA9A 1G9EA 1N6VA 4GP5B 5GHWL 3H9HB 1OAYH 3ZDXF 2JQMA 5IG7A 3HBQA 4TQHA 4YDJB 2QSCL 3QDMD 1K85A 5IMOA 4KXCA 1UGKA 5AZUA 3S4SB 1SN2A 3N42B 4DHLA 3ATFA 5EORH 5DC4B 1KWKA 1HEZA 3X13B 4JFFA 3T0VA 4WFFE 2AERT 5E94B 2C3VB 4OD1H 4TSCH 1FWXA 2AK1H 3MACL 4AGNA 3PWPB 4R26H 1NOFA 4NN7C 2HRPL 4MQSB 2WO2B 1RULH 1V7NL 3VXQA 5D7JD 4ZFFA 1X9RA 1JNNL 3QULB 4FG4A 2WVVB 1IIIA 2E7MA 4LHQB 4U0QB 1FO0L 3SJVA 4YDKH 1KDIA 3GSRB 3QZLA 4Y1TA 3C8KA 4QJ5B 5C09E 2Z91A 4LEBA 4J7RA 2KLTA 1U8JB 1KNOB 3MBXH 5LBGA 2WVVA 4MJJA 5DA4A 4ABQA 5HVHC 2GJRA 2GK0B 4G71B 2BCMA 4F7TA 4K23H 2ZKHL 3FB5B 4DR7C 5ITBH 3RPKA 4M5YH 3MCG1 4KNUA 1UT1A 4I2XE 3P9MB 5SWSE 1VKXA 1OE1A 5AOMA 3WS6C 5AAWA 2BWQA 3JUZA 5T1KB 1J87A 4G6AC 2C3WA 4HH8A 3N1GC 4GKLA 5BJTA 5ETUB 5E2VH 2WLMA 3WFHB 2FSEB 2W9EH 4JDTH 2X70A 4LSQL 1NANI 2FJGA 2I27N 1ZTXE 5I17B 1THAA 2DQEH 3LKSA 3F7RA 4PRPD 2X6UA 4NPJA 4EVNB 4R5XA 5DEGA 5MERB 1IU1A 5HI4C 3CVHH 4PBVC 2W5PA 4JI1D 3FQTB 3R8BB 1QI5A 1TJMA 3D08A 4JRYA 5AYQA 1PLCA 5J6GA 3TH3T 5JHDD 1WWWX 1AZBA 2Z31D 4LFHG 3CMMA 1Q0XH 4J1UA 2YRLA 5IMMA 1I1CA 5EG6C 3ARGA 1WJ3A 2BWDA 5F7DA 3QK0A 5I1LB 1C1EH 4X4ME 2AEOA 4F91B 1LEKA 1T21B 4HCGA 2DMGA 3NJKA 1T4KB 4YSQA 4F57L 4OD2B 5E00A 1LO2H 2CHWA 1DFXA 3V4PH 4RQQB 1IL1A 2IMMA 5KTEL 1UT2A 2V5MA 4X42A 4W9IC 5EFIB 5FS5A 4BFIA 1E9OB 2PCPB 3W0WD 3EYFB 5J7CC 5F6IB 2EEXA 5AW8B 4V2BA 3D18B 4J39A 4YBHA 3DKHA 3D4CA 3DJSA 1TCRA 3ZDXE 2H6PB 2GTWA 4N2BA 5K9QI 2VMJA 1MCPH 4UQ2A 3C2SA 4ELKA 1KG0A 3ROOB 3HFML 4ZQTA 4KZCA 3OJMB 2WXFA 4N2AA 5MEPA 1OZTG 2HTKC 3AADB 1SOQA 4JJ5A 5MEQB 1AR1B 1JXGA 3S5LG 5H37G 3Q6GL 4BHUI 1A02N 1R75A 5EWIH 4CU7A 1UXWA 1DL7L 2WQVA 3EHBB 3QDJD 3QEQA 1OHZA 1FZKA 3AM8A 3HG1B 4OFYD 3KLQA 3T8XA 2WBWB 2XI9A 1MHHA 1VSCA 1WZ1H 3AY2A 4CADA 1MHHB 2NNCA 4JK0D 1SFHA 5DRZB 4PCKA 4KQ0A 1TQCC 1WEJL 5A16B 3TEXA 3ONGA 5EU6D 4MQTB 2J6EH 3DGGB 4L3ED 2XWBA 4JR9L 3UJTH 5IBTH 1KB5L 4DQAA 2YMXL 3H53A 5EN2B 5G2NA 1QYGH 4M03A 4QTHB 1YNTF 1MHEB 2Q2LA 5HI3D 4YDLC 1IGFH 1P69B 2NT0A 2V7NA 2Z1KA 1BJ1J 2DQDH 3GBNH 3R18A 1IT9L 2EUWA 1NUGA 2P24B 1TU2B 2F6AA 3BIBX 1URLA 3ZKNC 4K94C 4ZODA 1AQ8A 1RZFH 2Z34A 4O2FB 3UAEA 3V4VL 5ERWA 1HNYA 2UWEF 4U1KA 4H5SB 4ZUWA 5IF0A 1F8TH 3QYNA 2EDTA 2GITB 3DV4A 4OD2A 1UM6H 2HRPH 3A23A 4QRTB 4TVPH 3LQMA 1UJTA 1QFWI 2R2HA 3MLYL 2QVFB 2DI7A 3S6CA 4YR6B 3DGDA 2AXFB 5HJGA 1G7MB 3WSQH 3WTWA 4HQQH 1D7CA 2X44D 3K2UH 5L4MA 3LMJL 3IBEA 1SY6H 2PXYD 4RAHA 1Q8MA 3EBGA 2A74A 2VGLM 3KEDA 4PCYA 4LASH 4BIKA 1I3VA 3HE6A 1ZAGA 4L1BA 4HKZA 4Z7UE 3JWDL 1QRND 1WEJH 1F4YL 3HB3C 2W07A 1E4HA 4A6YH 4AY0A 4EVNA 3LZOA 3OLDA 2AJSL 4QJ3B 5IT9D 4Z3FA 5E9DA 3TNNA 3VCLA 3BKYH 4X6CF 4ZAKC 4NFCA 5L9DL 4M1GH 4HKJB 4UIKL 3NJFA 2FSDA 2GTZB 3KH3A 1BAGA 5C0BA 2YFNA 4UZUA 3NCYS 3PJSA 4JI7C 1HH9B 3J8F7 2J88H 4NAJA 1JFQH 5HDLA 4OB5H 1G7IA 3DXAB 5EU6E 1S9YA 5I1EH 3VFMB 3BGMB 4PMFA 4LU5H 1QFHA 3IPFA 5BZDB 1NFAA 1IX2A 1HHJB 4PB0H 3QR1A 1IEBB 4HOXA 3LPOA 1SVZA 3D39D 5JIHA 5H94A 3PGFL 2YQ3A 2Z7WA 4PP1D 1U8JA 2VRKA 1NDGA 5J89A 3GSRA 1MZZA 4K5MA 4MD5B 4U6HA 3DMMC 4P9HC 4KGJA 4Z18A 3CVIL 1J8RA 5JHLL 35C8H 4EI5D 1MW0A 3GIZH 4GKZA 4LLWB 2WXRA 5E70A 2CO7A 4MA3B 2ZX6A 4QTIL 2DQTL 5TQ0L 1EEUA 2BW5A 3IJYA 2R0LL 4WI6A 3J7AD 1Q4NX 2X42A 3JV0A 4IOSA 3E6FB 4L1SA 4OCWL 4P5SA 2O93L 1FZOA 1I1AC 2WBJC 3V0JA 3N9GL 3V0WL 3I84A 3ESMA 4GEJA 1A3ZA 3WCYA 2Q7YA 4ZMVA 2YEZB 2XXCB 5J12B 3LKRB 4H1LA 4JB9H 1SXBA 2J6EA 3MA7B 2CA4A 3SIKA 3RFRA 4QLWA 2X89D 1IGJB 1MJ8L 1AS7A 3DECA 3FB6A 4M1CC 3COOA 3ARZA 2FIKB 2VDPB 4JRFA 2H26A 3NJJA 3GUTB 2EDDA 2F18A 3KPTA 1IFHL 4OZHE 3BW9A 3V6OA 4KMTL 5C0FA 5C0IA 5G5DB 3FF7A 3VMNA 3D7PA 5CHNB 3B5TA 4YDIH 3LEYH 3QAZB 5CD3A 2I7OA 3P9WB 4A04A 5B7FA 1EXHA 2AANA 4GI9A 1Z9PA 3JVFC 3UG5A 2EH7L 1TQBB 4I1RA 1OM3H 3T2PA 2F8OA 4QHUA 3SDYH 1QLEB 3LKOA 4NBYB 1EK3A 5AAMA 4FXTA 1ZIBA 4D0CB 4N8PA 1JXJA 3TT1H 1NTDA 3ARBC 4CBZA 2VR4A 5LNDA 2MKWA 3DHMA 3SPVB 5CR1A 1CDGA 3FT1A 3HLAB 4KZ0A 1MLCB 4KH2A 4NGHH 4OR1A 5D1ZD 2X2HA 1QRKA 1Z5HA 4HS3A 4A2LA 4G9FA 5ITFA 1QD0A 3FN0H 3L5WB 1KY7A 4NQQA 2YLHA 2FJHA 2OMWA 3U9UA 4XGZB 1VEMA 4UM9B 5A2AA 1KCKA 1RD6A 4WUKH 3P0GB 3BQUB 5GZND 4O02B 1FO0B 1KULA 1ZVYA 1HR0C 4EPSA 3TF4A 3B5GA 1NCOA 4K3GA 1BVOA 4LHJB 3HIZA 2XN1A 1G5AA 1DL7H 3EGXA 1XVSA 2GHZA 3LSOA 5E8OB 5AW9B 1A1MA 4QAWA 3L5IA 1BM3L 1MHCB 4DR5D 5HYJB 4H25B 2KKQA 5F9WB 1J1XH 2PO6B 4QYAA 3UABA 5BRZE 4DV1D 2VDQH 5D6DA 4K71C 4NPKA 5J8OA 3QPQC 4AQ8A 1RZJC 2H0EA 3POHA 3L9BA 1MW2A 2NNRA 1XGYH 5D7KD 4XXCC 1DJYA 4R7DA 4M5TA 5T1KD 4MD0A 3WFCL 1NC4B 4DZBA 5KSAB 4Q9QL 4WDIB 1Q1JL 2EUZA 3BZEA 4KVNL 5DLLA 2F54B 2GFBB 3PGCB 1LK3L 1NA8A 2N56A 3B8SA 4C59B 2AABH 2XV6B 4ODUA 3EJZD 3IJ9A 2EADA 5HJBA 3H9SE 4RVBA 1XGUA 2Q8BH 4ODHH 4NENA 1GZQA 1J10A 4N0YH 1MCBA 2AEPL 2DQIL 4AEHL 1KEMH 1UFGA 3T1HD 4JQVA 4JYAC 3Q6GH 5IBLC 4DV2D 3PHOB 1BOYA 2MWCA 3AUWB 2ZYRA 2QQQA 2XETA 3JAME 4JGMA 1GSMA 1OSPL 4NKMA 3TBWA 1P4LA 1CYWA 4XCEB 5KS9B 3K5SA 3ULUL 3TWYA 1NFKA 1OLZA 3MRQB 5CAYB 4GKNA 5TD4A 3D39B 3DROB 3T6XA 1TZHA 1CE1L 4IRJC 5D7JB 1HHHB 1QFWL 1FNGB 3GT6A 4NZRH 5K9QG 4G7SB 3OAYH 4XCNA 1QABA 4WI2A 3OMAB 3SDCC 3VVVA 1KYUA 1IILE 1GS7A 1M05B 4UILL 4W9LC 2PN5A 3DO3A 4Y16A 5MENB 5DO2C 1PD1A 1E6OH 1FJ1B 3MLWL 2OMZA 5B38G 4X65D 3SOBL 2O72A 4QXGH 3L6FA 3JQOB 5K9KB 5JIIA 5E99L 2QQNL 2DQUH 1ZDQA 4E5XB 4IYKA 3UO8B 5BOZG 4OTXH 3QDGA 2DQGH 2VSCA 3G5XA 3UAFA 2MNWA 1E6JH 4WI3A 4MZIA 4BK5C 2HWZH 2D4FA 1WFMA 1UATA 3D34A 4PRPA 3UADA 1OO2A 2NUTB 2XKNA 3TM6A 3D69A 4D8OA 2AI0L 3TESA 3L95A 3TN0D 1UJ3A 3WI9A 4EXPX 3GSVB 2XIBA 5KVFL 2F8XC 1A3QA 3Q7JA 3MX0A 2UY7B 1YA5A 3IMBA 2ZKHH 3VWJB 3IDIA 2CDEB 2UWEB 1V10A 4S1SL 4CNIB 5EEZA 2NYYD 1BCIA 1HFUA 2RA1A 3VRIB 2UZYB 1J0KA 3BSZA 4F58L 2Q8AL 1NGWA 4AGPA 2D3NA 1ZV9A 2V5SA 1IGTB 1S78D 3BP5B 1GYWA 2HMIC 1A65A 3F8UB 2R8SL 1CD1B 4JFEA 2XWEA 4RRPG 3VXRD 1N9PA 2DTMH 3MLSH 2HG0A 2YXWA 3K0YA 3RJQB 5LXVA 3OKNB 3VVWA 4WJG3 1JBJA 1DVFB 4HPYH 4HG4K 1YPZE 5EEVA 3MMEA 2UXCC 3FZUC 1SQ2N 4PWEA 1UXLA 1S78C 4YQXL 4F33B 2QVTA 5JW4R 2O6PA 1OGAE 2R23B 3ILPB 3OZ9L 4MAZA 1DQDL 2ZWNA 4BDVB 2JKJA 3H7LA 2IC2A 3O2VH 1QBMH 1CD0A 3IU4L 3RYMA 4Z3EA 4QXWA 1D5MA 1ZA3A 3HC0B 5DYFA 1HH6B 4Y1AE 3U4BH 1TO5A 4MNGB 5IEKB 1KCBA 2O5YH 5IHZA 1XD1A 5D1XA 3SBWA 1FO0H 1MWAL 5I23A 2MJWA 4QCIA 3CFNA 2HJFB 4XVUD 1QTPA 2A6KB 1PQZA 4DZ8B 3DYPA 2KLSA 4YIQB 2H7WA 1W72A 5ISZA 2QT6A 4GIOA 4XCYA 2ZKXA 4WEBH 3TWCH 4I0PA 2XQBH 3OKOB 4N0FB 4FTDA 5A2QE 4C47A 1FL5A 5I75B 4ZFQA 3VI3E 4C4UA 2VQ1B 1IM3A 4ZTOH 2VH5H 3ETBJ 2HVKB 4ZZKA 1N4XH 5FF6A 2ESVA 5J1SC 1PGRB 4YSSA 2DBLL 4UBDD 5F7NC 1FRGL 1FZMA 4RGND 3UO1H 2BH0A 3AC0A 4AV0A 3J80E 4YSTA 1UKTA 2G60H 3QORC 4P5RA 5AEAA 3QWRA 5C07A 3KJ6L 3TO4D 3U1SH 3QVAA 1BZOA 1BQHG 3BXNB 4QMEA 4X7SH 3KPRA 3LVEA 3VYPA 4X6BA 1INQB 1T5WB 4GRMA 1S7SB 3VFWB 3KYNA 1A6UH 2W92A 2PR4H 5CN1A 4L0ZA 3FN3A 4NHCL 3WTYA 5JPMC 3TPKA 1COBA 4HCRA 4J27A 3OG6B 2OFQA 3L1GA 5IBLD 2EE3A 1AG6A 3GM0A 3NCFB 4HOMA 3PREA 1CN4A 4KK5C 4NO3A 3K2MC 4GLRI 4UB0L 2D7TH 2ZUWA 4BINA 3SKJL 4OZGA 4MCYA 2YS4A 1M4KA 4YHKH 1EPFA 2XVBA 3RIAF 2K7PA 1M6UA 1K8DB 4BZ1H 2YMOA 3Q9PA 1EHKB 5L6YH 2EE0A 1VEOA 4NQVA 3CPLA 5CUSL 1ZHBB 5F9OH 1PLGL 3MO1A 2VW4A 4Z95H 4IKNA 5IM7B 3CX2A 4PJ5D 5JHDB 4BKTC 1QBML 4HWEH 1ADWA 2YGPA 3M1BA 5E0QA 1P6WA 2P49B 3U4EA 1X5XA 1DUZA 3BVTA 4YC2C 4WV1C 3FPXA 4NO0A 1PD0A 5CBAA 2DB8A 1G7JA 4O2EA 4MXVF 3ZRSA 5IR1B 3UP6A 1ECYA 1A2YB 5ECJE 3ECBB 4E36A 1G84A 2AQ1A 3PAVA 4FE9A 3F5WB 4R4NC 1EV2E 5GISH 2Q7NA 4PRDA 5KVGL 1X5AA 4UDUA 3FCBA 2OCJA 3ISYA 1FGVL 1JI1A 4X8GA 3VGAC 1KGJA 1YEFL 4P2RB 4PRHA 2I9TA 8FABB 1NGQL 3FT0A 2VISA 1EA9C 2H8PA 2PETA 1GGBH 2IGTA 3KLHD 1IAIM 5EU3A 3FO2A 2N0KA 1UA7A 3PABB 5D1ZC 1J05B 4OV6F 2CCVA 4JV5D 4A63A 2XN9B 4X66C 1GAFH 2Z6FA 3KR3H 2NXYC 4GUOA 5CEYB 1KJ2H 5CJXA 4X8CA 3O2WL 1J9QA 1U4FA 4XVUC 4OCXL 4OGQC 4HVBA 2BOBB 3BZFA 4TS6A 5IW3A 3EFFA 2WLLB 3KPPB 2VLJA 1ES0B 3BP4B 2PTTA 3MRNB 3Q01A 3RI5K 3KPSA 3L9RA 2HA1A 2E7LA 1AGFB 2WLYA 4XP1H 3KPQA 1UH2A 3OJDB 1H5BB 3PYCA 2PG1E 1ZSDA 3BN3B 4EI5A 3VFVB 1HNXC 3FMGL 2DOCA 3QHZL 1FFPA 1YO4A 2DWTA 3T4AB 1IMHC 2J43A 3L7EB 5HYSB 3H42L 4FERA 1KBGL 4JN1H 4G43A 2UXCD 5IMLB 1KWGA 1HL4A 2R7EB 2DYRB 4XWOD 5ISZE 2EEFA 5LGHH 3W57A 2NW3A 4YQXH 4JHAL 5KJRL 4XMTA 3RPIB 3LNFA 1BXUA 2EC9U 4WSJA 2ZE0A 4YUEH 3LPFA 4JHBA 3FO0H 3WG7B 4LF4D 3ESUF 3ZL2A 4HGMA 3MROA 3S36H 2DICA 5FYLL 4JKWA 4WHTB 3ARDA 3SB3A 2QADB 2XV2A 3O0RL 5K1NA 3Q1EA 4BV1A 4CILA 3DBXA 5I76A 4L3CA 3T3MF 1D5XB 5EZOL 2VQFD 3EOBB 3DUUB 5C07E 1IE5A 1IAOA 1BJ8A 4KK8C 3MLPA 4F1ZA 1Y0LA 1F4XL 4FP8H 3DX8B 3V6FA 1VIOA 1HT6A 2WN2A 2X41A 3SPGA 2NUPB 3T71A 2NOYA 5DJDA 2IH1A 5CEZE 4FQCH 4TYUA 5I75C 1NFDA 5J5EA 3LYRA 4EI5C 2ZYHA 3GXDA 1F1DA 4P5KA 4IOFD 35C8L 4Y2LA 5JR1H 4C56D 3PY9A 1KPRB 1NCCH 1QTSA 3LZFL 4KRPC 4NZTL 1AQDB 3VACA 3U0PB 4LSTH 3WIAA 3BRDA 3TO2A 2I7SA 1T2XA 4F9LA 3MQIA 1E6JL 3SJVE 5M7QA 3B6SA 4K23L 1BX2B 4MNQA 1QWHA 1KEGL 5IQLA 2EZ0D 4ONFH 4NAQA 4B0MM 1ZHLA 5I1EL 4Y4FA 2P5WE 2AMUA 4GRWE 1KLFA 1CUOA 2DQHL 1GS8A 4X98B 2Q87A 1OARL 5C0EB 4XMZA 1MN4A 5DYOB 1T1YB 3QI9B 4YFDB 1F3JA 1NLDH 1HINL 3GSXA 3QQ9D 2X3BA 2ZCLH 1QSEB 3FMGH 2AKRA 3C6LD 4NXMD 4JVUA 4GMTH 3BDXA 2CO2A 5L8JB 4PJXA 5DS2A 1V7NH 1RZ7H 3NJXA 3FHEA 3MCLH 5EZLA 1B4TA 1PG7H 4Y9EA 3INUH 4QRQB 4BCYA 4RBPH 3Q3GA 3LKPB 4LESA 3C60A 1G1CA 5HTSA 4Z3GA 1PY0A 5KYYB 3LZPA 2X28A 5J11B 1NMAH 1CICD 4M4PA 1PJWA 1NFIA 4U1IB 2XN0A 2WXIA 3GI9L 1U3HB 4MHHG 3SPJA 5SWSD 1A6ZB 3AREA 4NM4L 1RUKL 5HBBA 4XPFL 5TGBA 1F11B 4S1DC 4JI5D 4OKDA 1KSVA 1UUSA 2VZVA 4Y5YB 2R29L 4D9RD 4NERA 4NDMA 3NIDF 2YIHA 1CK0L 2YKKA 1BQHB 3A6CH 4JQIH 1ZJAA 5FO2A 3BPCA 5DJXA 2P5EB 4LHUG 4X2UA 5DJYB 5EEUA 3TH2T 1VDGA 5T1MB 3F6JA 3KAAA 3BCDA 3U46A 1UH3A 2VXSL 1L9SA 1L7IH 1PG7X 1U8PB 2VLJE 2HFFA 4OQTA 3UG3A 5FEBA 5J06A 1N68A 1RFDL 5I24A 3UGEA 5JHDE 2H2PD 1LJMA 2V7HA 3WFZA 2F7IA 1J1XL 4LP5A 4MS6A 4QT5B 3VFOA 1SXCA 1BZ7A 3TVMD 3NIFF 3G5ZA 3KPOA 2CH8A 4UAHA 3MRBA 4OLZL 4F8OA 4QRRE 5C0AD 2XZCL 4NRZB 2W1NA 4MMYA 3HBPA 1E9PB 3DV6B 4LKCA 2IH3A 4Y4KB 1CBVL 1KPUB 4JN2B 4YBLB 1OP3H 3LIUA 1A64A 3VXNB 2Y06H 5CCKH 1U92B 4L4TD 3SKOB 1AR2A 4GRLD 1KBPA 2VE6B 1L6ZA 5D1QE 1XDTT 4DV5D 4P23B 2VZOA 5GZOD 2BSRA 3QO1A 1HXYA 4PG2A 1E4XL 5DUBB 4BYHA 4LVOB 4PUBH 8PAZA 3VXUA 1FN4B 4LAQL 4JO2H 3J7HA 5HDRA 2CKBL 4FFYL 3PDOA 1A6UL 4IGBA 3FAWA 4X6FA 1ZHKB 5E8NA 4OX9D 4R2GD 2UXBD 2TRYA 3B8YA 3GJFK 3ORJA 6FABH 2B9BA 4FADA 2DKSA 4H1LG 2R2BA 1MCLA 3ZQ9A 4APXB 2WOBA 3EADA 1NPUA 5I8KH 4P9ML 5JOEA 4NWUH 5DTFB 1XSOA 4MHHI 4MX7B 4I77H 3ARDC 1CF8L 1N26A 3QCTH 4GRWF 2VSMB 3ABKB 1HSBA 1XH3A 3H9SD 1CIDA 2LU5A 2JI3A 3CVCA 2FR4B 4K9EL 3BZDA 1SJEB 2GAZB 3I6LE 2OJZL 3RZCA 1RURH 2AEIT 1FKAD 5TQ2H 4ZX5A 2FUTA 4ZW8A 3TURA 1JN6B 1LO2L 4APQA 3V0DA 5HGAB 3B7SA 3S5LA 1PZ2A 3OXSB 1U33A 3QORA 2N3JA 4G8IB 4PJ6A 3GSOA 2PPCA 1A5FL 1NMAL 1FGVH 4UU9B 1ZJBA 4K7FA 2XZQH 4QXUL 3MUJA 3LQAC 3V4UH 4LFBC 2DWYA 4GUQA 5D1XD 3EGSA 5JHLH 4ZSOE 4LAJH 2I07B 1Q9OA 3GIZL 5SX4I 3IE9A 4AMKL 4ZX6A 3RWIA 1L0PA 1INDH 4KK9C 1C7TA 3P2TA 3S35L 4KVCH 3ZPDA 4G7QB 2DQHH 4WTZG 3VXSA 4WFGD 4NCC2 3IM1A 1YY8A 5EU7E 3H9SB 3HP7A 1T0MB 5FWQA 4AG4H 5EZOH 2FDBP 2PW1A 1KGCD 4RGMB 1OCWL 5IW1B 2JE8A 4PP2B 5DZJA 3D6GA 3J27A 3WNOA 3D25B 4DKTA 1K6QL 1QRNE 3JWDC 3RAJH 5I19H 2OBGA 2OQJA 3BWUF 4PGEA 2XG5B 2DDQL 1D7DA 5CIPA 4DAGH 5AVSB 4DGWC 5E2TL 1LEGB 1C08B 5AD0A 4DUZC 2A0LC 4DR3D 1X7QB 2IBZY 3BT0A 4X9BA 1AOHA 4UDTB 3TA3D 5IBTL 5KSAC 3AG3B 2YD7A 4G7VH 4TSBH 4PJFE 3QUXB 3QZPA 3D0VA 3QUKA 2OR9H 3RU8H 3GSQA 3RWEA 1N64L 4QF1B 4LB8A 4HJ0D 3V52H 4N8UA 1PDKB 3D12B 4QLRA 3PUCA 4UNTA 5IW6A 1MFAH 1U8IA 3MHZA 4PJAB 4UQAA 4ZBJA 1PZ5B 4PQXA 3F7VB 2HHHC 1WC7A 4X4YB 1BVZA 2EILB 1KUMA 4H2AA 4UOZA 4KVPA 4LT7A 4JM2F 4N5UA 4TSAH 4B6ZA 4LAQH 1U91B 5ESVA 4P2QD 1JXKA 4EXKA 2G0LA 2MPAH 3ABLB 3UZQA 3FJTA 2X1QA 3L45A 4ZUTB 3MLYH 43C9A 3S8WA 2YK1L 3PG2A 2OSLB 2PUQT 4LCCA 3RG1C 4Q97A 5GS2H 4JAMB 1MUJB 3BCFA 3HE6C 2Q5BA 1RZ8A 5CSBA 1DJHA 3WO4C 2VCOA 1YQVL 3FUFA 4E41A 3ISWA 2UUDK 4KUCF 4OCLC 4NI3A 1A4BA 1DHKA 4A68A 2V5RA 2AEPH 1S3KL 4TUJB 3QJHB 2NY3B 4HK0B 4PFEA 1NDMA 2KMWA 1ND0A 4LFHD 3NCXA 3FHAA 4Y4KD 1THCA 4Z7UF 1DANU 3MJWA 1HSAB 4WFGE 3CCHB 4OD1L 4TSCL 1SYVB 2WLIB 2IDSA 2WM0A 3GMMA 4L4VB 2YD3A 5E8EB 5I1JL 1AMYA 4N4YB 4X6CE 5BV7C 3L16A 4LFCD 2YPKB 3RAJL 4PD4J 4PWFA 3TNMB 1SJHA 3CBRA 3P0YH 4BFRA 1S7RB 5K93A 3GK8L 3SKNB 3O3EB 1JP5A 1KBWA 1WWCA 4LSDA 2ARWA 4TNGA 4PRHE 1GGIH 1PMYA 3APNA 3T1FA 3ZR6A 2J3SA 5DJAB 2DEWX 3K6DA 3M1OA 3Q6FB 4Z9KB 1JTPA 5TH2A 4PJBB 5GISL 2WLKA 2X6AA 5KVGH 3ARGC 3SSGA 2EYRB 1NLBL 5EB9A 4FQQB 2IOMA 3SDDB 3HJEA 1KXQE 4K07A 4A7GA 2V2XB 4PM1A 1XH2A 2Y6SC 2PCYA 4HC1H 5IVZA 3UEZA 3KE0A 1LM8V 3CAFA 4XO4A 2YQBA 1QKZL 3HZVA 4TL4A 5HHMD 4F92B 3K71A 2MKLC 4RX4D 1Z0NA 4KUCD 4EBQH 3LV3B 2DYPD 3SO3C 2QSVA 4P48A 3EFDL 4H0IA 3FFCA 2HN7A 3TZVD 4NO2A 4MBRA 1SPDA 1ZWIA 3BQVA 1F00I 4YHIA 4HK3N 1MIML 1Q9KB 2G5BB 3II2A 1UA6L 5I66B 1QBBA 2BP5M 3QI9D 4RFNC 4Y4FC 3QJUB 3PAZA 2EVFA 1P5VA 3NSXA 3B2MA 1CR9L 4KV5E 4U6XA 3HVNA 3T4YB 3WMQA 1X44A 1LE9B 1PZ3A 1MHPL 1CQYA 1GZPA 1RJZA 4XCCH 4Y89A 1KTLA 5CCHE 1H15A 3B3IB 2NYKA 3FU8A 4JGNA 4B3MC 3NIFB 3F12B 3N0PB 5LG1A 2H45A 5CGBA 3UJJH 1KCRH 1FAIH 5CKAA 3T65A 4H8QA 4OIFA 3I50H 1LNUB 3UC2A 4KNQA 3LS5H 4D9LL 1QWUA 3NJHA 5EUKB 4UT9L 5T1DL 3U4BL 3CSYB 1AHMA 4GXVH 5TQ2L 4LASL 5L7XH 4OIAA 3P73B 5GGRA 4CVZB 4WWNA 3TV3L 3TXAA 3QQ3B 4MJHA 5MEND 5L4FA 3NBNA 2GSGA 4B0MB 3T2QA 3PDGA 4G42A 1R3KA 1YAIA 2VB5A 5LGHL 5C6PB 1W0VA 4QHLA 1DN0B 1VFBB 2XVGA 4LVOC 4U6TA 4NS0A 3QG6A 4LARL 5C8JB 4NGHL 3RKDC 5EEWA 5EUOA 4HBQA 3HE7A 5JNYA 4YBQD 3RU8L 3D85B 4PV8A 3SYAA 3WUWG 3L5XH 4E41E 3CFBA 4FQJH 4PI2A 4IIQC 4ZO6A 3WOVA 2EYSA 1DBAH 3BH4A 2ARJQ 1DQML 2XN9D 2A2QT 4N2NA 2VMDA 3KYAA 4NZUH 1ZLUH 3ZKMD 4AXWB 4EUPA 4UV7H 5G55A 4KK8D 5E23A 5I1GH 2L3BA 2ZWZA 1CE1H 5E8DL 3TBYA 2IO5A 1GOFA 3U1QA 4NB7A 1A9BB 3ULUE 5IJDC 3EGDA 1A47A 1LWJA 1NICA 3IDJB 1YJDH 3CJJA 3IETA 3O4OB 4OJDH 2R8SH 3MNWA 3LN4A 4KJYA 5HGHB 5GSRA 3MLWH 1I31A 2CKBB 2RAMA 4F9PC 4DCQB 1YEHL 4S0SD 1CC3A 2JV6A 4JMNA 4OGYL 4U7SA 5TE4L 4FEIA 3VFNB 3ILQC 3B9VA 4PJGA 1XBRA 3G6AA 2DY2A 2WQAA 3OTOC 4JG9A 4N5EC 4OJFH 2OX5A 5GSRB 2P5ED 3IGKA 5DD0L 3LNGA 4UF7C 2HJKA 3UAAA 4U0RC 1A6WH 4NKDB 1KJ2A 1U8HA 4GAFB 4TTDC 1S9VB 4X5PA 2QMKA 1KGWA 2Q6WB 3F64A 2Q76B 1VFUA 4WZ9A 2OMVB 5DK0A 1U3YA 4JFHD 4B7IA 1KYFA 3O45B 4RMVA 3WL9B 2AXGA 2F7QA 1O7VA 4Y1AA 5EC1B 4DV5C 3MOQA 5BO1H 4X66D 1NBYA 1IBLC 4EI6A 3RVUC 3RFZA 3P02A 5ANMB 3AU1B 1QR4A 5DMIL 4Y5VB 2HLFD 4WK0B 1B6UA 2EYSB 2FEEL 5CP7B 5AOIA 2J1KA 2VLRB 3P0VH 3VWKD 4KTGA 3RTLA 3T09A 4Y2NA 3U2SA 4NWUL 1L0QA 2ZCZA 5AL8A 2GBUA 2CBQA 2R69H 2VR8A 3ZE1B 4XBPB 2NRDA 3FTVA 1GZHA 2A73A 2VABB 4TVUA 5DZNA 3TO4B 7FABL 4ILDA 4NRYA 4TUKH 3B2DC 4O58H 4PSRA 2D7QA 2DYSB 2NY7L 2MH4A 1TJGH 2D7OA 2V8LA 3CLEH 1UC6A 3FQUB 4WO4D 4A6YB 5AENA 5HXMA 3S7GA 5DD1L 1WA1X 3QQ3A 2ZG2A 1TQVA 5ADPL 4X62C 4BQCA 1AZNA 1BGXH 1JWSA 4ODVH 4IBSA 4GXUN 4M7ZC 5IHWA 3QJQB 3CSYA 3KS0J 5I1IL 4GRWH 1P4IH 1IEAB 1YYMH 5BV7H 1WAAE 4OUUA 4HPOL 1MQKL 3BUDA 5C92A 3T65B 4QRRD 2QVKA 3EJYC 2QR0B 1QBLH 1JWUB 4AM0Q 4NHUB 2WTRB 3DPDA 4JFUA 1H15B 2WY3B 1MCNA 4LF9C 3HHRB 4KX8A 4QHNA 5CNHA 3U7AA 3VNYA 3US1A 4JHZA 1NAMB 4N2MA 2XZZA 1RPKA 1EHLL 1GGUA 1T2QL 4FTVA 1ET8A 4GUCA 4WAFA 1RVFH 4GI8A 3P0VL 3IDGB 4J3WA 1TKWA 3FULA 4FP8L 5A7EA 5IVXF 3U9PL 1EANA 2CDFB 4KZDH 4HUNB 5C08D 4Z5RA 3CQFA 4YHIB 4PY7A 5KEZA 2YD9A 1CLVA 1F58L 3AABA 3KWXA 3G04B 4NKOA 3FFCB 1P9MC 3IPEA 2BM3A 2NSMA 1EO8L 3WY3A 3F7LA 4HPYL 4LCWB 3TO4C 2V9UA 5KZCB 5JDSA 5DFTA 3VXSD 5FA4B 4ONHB 1HCZA 4XC1H 3HZVB 1RZQA 3GRWH 3B2VL 4NFBA 2WYZA 2UU9D 4AKQA 5E51A 5JPNC 2CO4A 4F2MA 5L2JA 4OZIE 5FW8A 3TYGH 3LEVL 2ZOTA 1ZE3H 1Y18B 2XTLA 2CIKB 1GGTA 1JK9A 2ZQKA 1U8KA 4KY2A 1DVUA 2NR6D 4N2HA 2DLFL 5DJCA 2EXSA 5JHAA 3T0EB 4LF5D 5EU5A 3ZLQC 1DVFD 1NCIA 1J0JA 3BSZH 3KGSA 4XN5A 1NCWH 3MRIB 4OUDA 1CT8A 2NX5B 3Q6FA 1YEGH 3J07A 3O0RH 4PWKA 1ET7A 2V2WA 4YY3C 3QCVL 4DP1X 4DGVH 1RFDH 4OGAD 5F8QC 2BRRL 2XICA 3F6IA 4JDEA 4JZNB 4G8AC 5FOJA 2DW5A 4ANVA 5JIMA 3SDXB 4XZUA 5J6GB 2JK5A 4U0RB 4LCVA 4JDVA 1BEYH 4AMXA 3BH8A 4G9DB 4OTXL 2YPKA 1AZRA 1S8DA 2MIZA 5DMKA 3GKWH 1ZANL 4UQDA 2FZ3A 5LGYA 3G5YB 5IFHH 2NZ9C 3PCYA 4ZW5A 3G08A 2EH8L 4XB7A 4O00A 1DJWA 2YA0A 3GTNA 2ZUSA 5HHVL 3SCMD 1U3NA 3NZSA 1YEKH 3PWNA 5DD3H 5IB4A 1OD9A 2Q10A 4N87A 4R97C 2YKLL 1OOAA 4M7LT 5GGQL 4OGXL 4LSSH 4F24A 1CFTA 1PKQB 4RFEA 1ND0B 3GHEL 4W6WB 5AAMC 4W9FC 5B39B 3WHE0 5L6YL 5LXGL 1NPJA 4U6VL 2ZSVB 3IKCA 1C7SA 1NOAA 4L4TB 4RIRA 4ACTA 2HMID 2H3NB 3RZWA 1U9KA 2GJ6A 3A47A 5FYJH 4M8QB 4L8SA 3A4AA 3CLEL 1KGUA 1F6AB 3ARYA 3CV5A 4WV1B 1AP2B 4XE5B 5I8OL 4OAWB 3W39A 4P07A 5K9JL 4LCCB 3QEUB 3O6LL 2PLTA 3G5VB 3RVUD 5AKRA 3UPRB 5KOVC 1CFMA 3LB6D 1YEGL 3QJTB 3WAKA 3G6DH 1DBMH 2OMUB 3BAYA 4C8XA 1OCCB 1KGIA 2NXYD 4P99A 2J12B 1AZUA 1F56A 3B34A 1K4CB 4Z95L 2WJ7A 4DKAA 4R4BB 2GUYA 2Z8SA 2ADYA 3L4WA 4ZPTA 1C06A 3F7VA 2M1KA 4XMPH 3CIAA 5DDHA 5IGXH 1ML0A 5IW6B 4TL5A 5AOZA 2C9PA 4R5TA 5DO2D 5T8IA 4NQCE 4U1SB 3QUKB 3WKPA 5DS8A 3TBCA 3M46A 5AVRB 3FH5A 4QIRA 2WYTA 3EHBD 3MUY1 3ZTCC 1AHWB 4Y19D 3UYOD 3EJCA 4JPSA 3JWOL 4FQXB 2ZYIA 1P6FA 3ZKXB 2ZP0T 5CIPB 2VDQL 4F7EA 3WIHA 4J3OG 3DO7A 1F4XH 2DH3A 5BZZA 1HJCA 1M9WA 2YA1A 4FFTA 1KN2L 4O9HH 4LIQH 4P3DA 4BRVA 3UGUA 4P2QE 3UTSD 2P5WA 1HQ4B 3AT9A 4DUXA 4RMRA 1T2JA 2P8PB 2ADIA 1QOKA 3R0NA 4TQ8A 1NCUA 3X1GA 4OW6A 1OGAB 5EOCL 5DU7A 4KXAA 3TYGL 1TSRA 2ZXQA 3O2WH 1OP4A 5E6ZA 3RWIB 1RUMH 4LRIC 5E6SB 3FONB 1ZXKA 4YHYC 3QIUD 1CF1A 5C7XH 4NCDA 3MJ9H 1KC5H 3AXLA 3HZKB 2BS71 2WINA 2PABA 3I2CH 3ME0A 3WNNA 1TSHA 4ZS7H 2Z4TA 5DRNB 4UV4L 2EH7H 2W94A 5FUOL 4DV1C 2WBJA 3A24A 2XG4A 5T5NF 3DVGA 4PJIF 4BELD 2EDQA 3OXSA 1N3NB 4PJAE 2DIJA 3IMRA 3MGTB 4AL8H 2NDFA 2VDKH 4HUXA 3BWZA 5CSZB 4APQB 3JWOH 3L1FA 4JLRA 2VUOA 1P1ZB 3RWGA 3AS2A 5DHVA 5FW7A 4F3FA 3RZCB 1Z9NA 2N01B 4KI5F 2ZPKL 2C7UA 3UBXB 3BX7C 5E1AB 3GS0A 4L5FE 1R3LB 4NLHA 2YPLB 2H1PL 5LBSL 3VD1A 3PHSA 4OFVA 5DGRA 7PAZA 1NMCC 2F2HA 2W8CA 1GXEA 1IQDB 5I6MA 3QPXH 4XP4L 1ZEAH 5F7MC 2EIEA 4XP5L 4LCYB 4Y2DC 5BRZB 5DXWA 3LHPL 1CK0H 4B3RD 2W60B 3AS1A 2CO6B 2DWDB 4D3CH 3T1WA 1Y6MR 4J3TA 1FH5L 1NSNL 4ALAL 2UZXB 4N22A 4NN5B 3NRQA 3FU6A 3VFRB 4RWHA 4ELMB 4MJID 3SYCA 5D1QA 2X7LB 3MNVA 1NEZG 3RWHB 2PYEB 2UUAD 2XN2A 4JFEE 3ISRA 3VXUB 4GKKD 3BUBA 1W6LA 2W9LA 1MFBL 3MCKA 1QSFA 2NNAA 3R7QA 4JPQA 2DTML 2DRUA 1JHKL 4Q89A 1LYQA 2BSRB 1OQOA 1YY9C 2AK4D 2NZ1A 3WTVA 1VRSA 3GLEA 4ZUSB 4BSZA 2BCKB 2VKWA 1TT6A 1MCJA 4MQXC 1DN2A 3ZIYA 4FLQA 4BSVA 3BWAB 1I9EA 3C5ZC 3QRFM 1U21A 1JSYA 3RGVA 4KKQA 3ONHA 1ZGLM 3V4PL 4KNSA 5DS1A 3C9NB 1BQLH 5DD5L 2Z4QB 3FSAA 4MXWL 2WNWA 1EO7A 4UV4H 4PS7A 3G5ZB 1J5HA 4YDIL 2G4GA 3SGJA 1NGZB 3FOMA 2JCCA 5B4MC 5DURB 3QXDB 3HPJA 3MV9B 1OCOB 3EG9A 1ZT1B 4KX7A 1ET5A 3ULUH 1R3HA 3QH3A 5GGVH 2F58H 5CN2A 2CBPA 2CUHA 4NO5B 1BEYL 4XC3L 3V5HB 3MJ7A 4FFVD 3MLXH 3GLAA 1A8ZA 4A6YL 4OFDA 1NLBH 2Z31A 2P5EA 4NOFA 3GSNA 4NQSB 4PHXA 3UAJC 2WVUA 3L5XL 1IBHA 4YXKL 4IMKC 3C09C 4LFCC 4HYTB 3MRPB 4LCCC 3RWDB 2F1AA 5BUPA 4X65C 2LOEA 3I85A 5TGBB 2OXGA 4PP1C 4P2OD 5DD6A 1TEYA 5IHLB 1TXKA 3PWJA 1ZLSH 1JTOA 4Y1AD 2VC2H 1OANA 3RDTB 4XZ4A 1J8SA 5CCKL 2QMJA 4J6RH 4Y4KC 2ALAA 2QV2A 3O8XB 4AENB 4LNVA 5KYYA 1OTSD 2HX9A 1DJZA 2GKIA 5C9KA 5JA8B 1R46A 5C0CD 3BJ91 3Q3GB 3CXDL 5EC2A 1BBJA 4PRAA 3AY4A 5TDNA 3OR6B 3ALXA 1KIQB 2DBJA 5BS0B 1QPPA 2CIIA