2ZTEA

Mtruva form iv
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
133
structure length
133
Chain Sequence
b'EFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
total genus 27
structure length 133
sequence length 133
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2zteA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zteA01
1HH2P 3C5GA 5IWAL 1XMQQ 3PUZA 4JBJA 2UVRA 4LUZA 4JYAQ 3OYYA 3GTOH 1L1OB 2BDPA 3H3VI 2B29A 3S1MH 2K5NA 2MO1A 4EBEA 1NK6A 1NK7A 1QVGA 5IY0A 2MQHA 4LF4Q 1HZ9A 1K1QA 3GTJH 1X9NA 3JPQA 4BA1I 1X56A 3K7AH 3TQ1A 5IP9G 3E2EA 1WOCA 1UT5A 2Q2IA 1T4GA 1D9FA 1KFSA 4I2JA 1HZCA 2W8LA 1CUKA 1XMOQ 5C4XH 2R7ZG 4I2CA 4P2HA 2VNUD 4TURA 5M5YH 2NVQH 2JA8H 4JI8L 4AYBG 1L1OC 1Q81C 4IQTA 1XTDA 4DV5L 1BPDA 2JA9A 3BJYA 3CMAA 4A3JH 4MZ9A 3OTOL 1VS0A 2ZJPA 4RQ4A 5KFYA 4DLGA 3H0GG 4X65Q 4DO9A 1D8LA 4O0IA 3FKIH 3UDFA 1G51A 3KF8B 5J2BA 2E5LQ 3ZDEA 1VQ5A 3H4BA 1ZJMA 1PH9A 1SMXA 3CW2C 4P4PA 4JV1A 3RB4A 3LK9A 3M9BA 5KT3A 5C0XJ 2ZTEA 5DLGA 2HIVA 3OW2A 1XSLA 2PNHA 4B3MQ 1E1TA 4Z6FA 3C5FA 4YY3L 1HJPA 3Q8QB 4L5TA 2H5XA 1Y1WG 1NKEA 4LFCQ 3K8AA 4B9UA 1JB7A 1TWAH 3T1YQ 3JPNA 4R63A 2Y0SG 2IY5B 2RHQB 3H8JA 3KTQA 5J2KA 3K7UC 3LGJA 1XPOA 4ZH4A 9ICHA 3GTKH 3TI0A 3RNUA 3G6VA 3LDAA 2R93H 3CC4A 3PMNA 2UUBL 2R8HA 1E24A 1HNXQ 3HOYH 1KFTA 2Z6KC 5J0PA 4NM1A 5J2HA 3J80c 4JV0A 4F5QA 1X3FA 4UB1A 4RQ2A 2EXDA 1I6HH 7ICGA 3T5LA 4C8OA 3NENA 1XNQL 3HOWG 3MR6A 2WFWA 4DR3L 4DL4A 4JI5L 8ICXA 2WP8J 4DR5Q 4NY8A 4XTCS 2CFMA 1RXVA 4LF7L 5J2FA 3G6YA 4J9KA 4A3CH 4DL6A 3C2LA 4A3KH 3OJSA 2KCTA 4HJ5A 4ELVA 1ZQSA 2I5HA 2E2IH 5K36G 4A3EG 3GTLH 4QWCA 1W2BA 2C35B 4F5NA 5KG4A 8ICNA 4C8MA 1MSWD 3TARA 3J81i 2BCRA 5CA7A 1BPBA 1VQ9A 7ICFA 5ELOA 3D0FA 4UB4A 7ICPA 2BCSA 3KF6A 2BPGA 3QZ8A 4RQ8A 8ICZA 8ICLA 4NXML 3HX0A 2PFPA 7ICEA 4A3GH 4I2BA 9ICCA 3CCJA 1WCMG 3HOXH 4MTNA 2Q2TA 4F4XA 2NN6G 4JI8Q 4A76A 4QZCA 2IX1A 2F1IA 4RQ5A 5HHIA 4A3IG 4RUCA 3PX4A 3PF5A 4DV5Q 4M9NA 4GLXA 2ISPA 1K8GA 3RR5A 3TFRA 3KDFB 4JOIA 3OTOQ 4PHAA 5KFWA 4DV2L 5DGAA 4X64L 3GTQH 1ZQWA 5J0QA 4FBTA 4R4OA 1CKOA 5JEAJ 4BBRH 4JWNA 1ZQEA 3MR5A 4YQWA 1XSNA 1T3NA 2NRVA 5M5XH 4KLTA 1IM4A 4GKKQ 4YCUA 2BH2A 1KL9A 4DV7L 1Q46A 1JIHA 4YY3Q 1HNWQ 2FMSA 3V72A 4EZ6A 5KG3A 1OXVA 1WCNA 4CCHA 4MNOA 4IR1A 3QEAZ 2JEIA 4E0DA 1KEJA 2NVXH 4OO1G 4RT2A 1O7IA 3UPQA 3JAMi 4G3IA 1M90C 4APVA 1ZQPA 1QLNA 1B22A 3RR7A 1CKNB 1B70B 3W1GA 5KG7A 3RH4A 4B9TA 3W5OA 4L5SA 3RN5A 2EQSA 4DL3A 1SRUA 1QUQB 4ECQA 1LTLA 3Q8LA 3BQ1A 2UUBQ 1KRPA 4FS2A 3CD6A 3PSIA 8ICIA 3M9OB 4GKJL 1H95A 2V4QA 4O3NA 4DQRA 3ORYA 4HJ9A 1EWIA 4QZHA 3SV3A 4DL5A 1VQIA 4DSLA 4PGXA 3TAPA 2JZBA 4RT3A 5KFBA 4R4QA 3HPOA 1TAUA 4OWWB 9ICTA 4NLZA 1OXTA 4KLFA 3KHRA 3RJHA 4DV6L 4DAYB 3RJIA 4BBSH 5JEAG 2Q2HA 3CCUA 2HT1A 3Q8PB 3RB6A 4LF6Q 2R8KA 2B63H 4GNXA 2BA0A 2JK8A 3K80C 1JJGA 9ICLA 4ELUA 4DFMA 4O5KA 5KG5A 3HT3A 1S10A 1V43A 3I4OA 5M3FG 2GN5A 5DQIA 2YTVA 4PH5A 3PUYA 4UB3A 4QZEA 8ICAA 1I3QH 4EYHB 3F8TA 4P71A 1KFDA 3HOVH 5DDYA 4DSFA 1K0RA 2IX0A 2JA7G 3TRZA 4RPYA 3QEBZ 1YNXA 1ZQZA 4YCVA 1IBKQ 4KI0A 3IHQB 1S0OA 4UY8C 2UU9L 3PMLA 3UQ2A 1UWVA 4B3RL 1C0AA 2AWOA 2W9MA 4DQQA 4F4KA 2AJQA 4Q44A 2KZMA 1HUOA 4IR9A 4DF8A 2XTIA 1NK0A 4YHHL 1ZQAA 4BY1G 4RU9A 2YTXA 1JE5A 1Z9FA 3RJEA 4DV0L 3AEVA 1DGSA 4HJAA 4DV7Q 3MEFA 1G291 3HOUG 2QA4A 4KHPL 5H1SE 5BR8L 3H4DA 1NOMA 2BCVA 3I55A 1YEZA 4GC6A 4DL2A 2W9BB 3S24A 5J2AA 4RQ3A 1NBWA 5C3EG 1PH4A 1XMQL 5D46A 3AU2A 1S3OA 4R1JA 1Z00B 4PGYA 9ICKA 2ZJ8A 2OQKA 2PI4A 1AE2A 3RH6A 1S0VA 2HHVA 1QSLA 1Q1BA 1Q1EA 1K83H 3G48A 4LF4L 2ASJA 4LFBL 1TAQA 3GIKA 4GKJQ 3V6HA 4DQIA 2CQOA 1LB2B 1T9HA 1FL0A 3HKZE 5KFFA 2UVVA 3PO5A 1XJVA 1RYRA 4A93H 5DB9A 2DFLA 2A8VA 4RPXA 1H38A 1SL2A 4PZ8A 4DK6C 3H40A 3J7ZC 3PUVA 2WTFA 2MAXA 3I4NH 5EWEA 4XIGS 1N9WA 2ZM6L 3CC2A 4DV6Q 1YZ6A 3IM1A 3S1RH 1QVCA 2NVYH 1N36L 1I94L 4KLIA 4YMOA 1U0LA 4PGQA 1V9PA 2E2HH 1XC9A 2N8NA 1XPRA 2E5LL 5C4XG 2R6GA 3A74A 5HMMA 4KLSA 1TK8A 4NXNQ 5KTQA 2JA8G 1PHJA 1L3VA 4JOIC 3UE0A 2NRZA 5DB7A 3T5JA 2ATLA 4PPXA 8ICFA 1E1OA 4B9SA 4MF8A 4GOPB 4JI4L 4A3BH 4A3JG 5J2JA 4A3DH 1NMGA 1AH9A 3EPIA 2MNAA 1HR0W 4QZBA 1NJXA 3KLWA 4JG2A 3FKIG 3H3VH 8ICRA 1KHIA 5IIMA 4TUPA 1ZQFA 2IHNA 5BOLA 1OXUA 1UE5A 3PW2A 3KHGA 4A4IA 2J6TA 2FXQA 3OSNA 1FJGL 4LZGA 1K3RA 1XPUA 2BCUA 3EW9A 8ICPA 4DS5A 2K75A 3KYHC 1TKDA 2V4RA 4NXZA 1YHAA 5LMNW 4YHHQ 3ERSX 4F2SA 5J2CA 1ZQLA 1RZTA 3MR3A 3F2DA 5BPCA 4DV0Q 3ULJA 1ZQBA 4C3IH 2A19A 2AGQA 4QJFA 1E7ZA 4XRHA 8ICSA 4C3JH 1X3GA 5FLMH 3SYZA 5BR8Q 4ALPA 5KFEA 2MUTB 1XU4A 4OX9Q 3J81j 1N32Q 3U4VA 4GNXB 2UXDQ 3S2DH 2GVBA 9ICSA 4DR1L 4P75A 2R93G 2IT1A 1WYDA 4DR5L 4P74A 4J9NA 4BWJA 4ECSA 3HOYG 3S14H 3DLLA 4DR7L 2XO7A 2JEJA 1ZQQA 4POFA 2HVIA 3F2CA 5IYDH 1S97A 3CAMA 5DG8A 1TK0A 1YIJA 1QSYA 3TS0A 1HZBA 5HNKA 2D0OA 3JC66 1K8AC 2Q2UA 4LFBQ 3PX6A 1SROA 2XY5A 4I2EA 1C9OA 7ICQA 4IPDA 2I5LX 4GN4B 4EX5A 4A3CG 3J7A5 1TWGH 4KMUA 3K0XA 4H02A 4A3KG 4L5QA 4LF9L 1AROP 3MGHA 1JXEA 4R8UA 1X9SA 4GNXC 4B9MA 3GIJA 4EZ9A 3RZDH 3CP0A 4NB3A 4ECWA 3STBC 2ZJQA 1XWLA 1S0NA 5C44H 4K0KQ 5LMNL 3BDPA 5CB1A 1RXWA 5LMUL 9ICXA 3E0EA 1G6PA 2ZM6Q 4J9OA 1UA0A 1NKBA 2ALZA 1N36Q 5JJIA 3OGUA 1I94Q 4JWMA 3OSPA 2IHEA 3H15A 1NE3A 4M6WB 3PW0A 4QWBA 3OJUA 4A3GG 4OONA 1N56A 3HOXG 3MDCA 2HHSA 1BKBA 1IYJB 4YD2A 3TFSA 4F2RA 3PO2H 4JI4Q 3SZ2A 3U4ZA 4HJ8A 1Z47A 4GKKL 1VQNA 4WJ4A 2R8GA 1KRTA 2A1JA 3PR5B 8ICUA 1BBWA 2I5MX 1HNWL 3UXNA 3RRGA 4O5EA 1N8RC 1ASZA 3KOJA 4OWXB 5EAYA 4UB2A 2BA1A 5J2GA 5KG2A 4BBRG 3K81C 1FJGQ 1X55A 4F91B 3IRBA 9ICMA 2AKWB 4GXIA 1NK5A 2Y1IA 3V7KA 3RR8A 5CR0A 5J0WA 3GIMA 4F3OA 3ISDA 3UDGA 3RJGA 4WJ3M 4GXJA 4M9HA 4DLEA 4BXOB 2R92H 2IMWP 5L1JA 3PX0A 3K75D 1X9MA 4IPHA 5J0SA 3N97B 4DS4A 3I56A 4J9SA 4I2GA 4PZ7A 3PO3H 2ZJ5A 4JI7L 4KLDA 1L5UA 1N34Q 2JEFA 3V6JA 2JA5H 2ID0A 2F4VL 3A0JA 4DV3Q 4KHZA 4DR1Q 4DSJA 2ALYB 4UB5A 3CC7A 1IBLL 1Q8KA 5J2EA 3W1BA 3VDYA 4B3TL 4MFFA 2DPJA 4DR7Q 3GFKB 3HKZG 4DR4L 1HR0Q 1NK9A 5J0RA 1U47A 5C0XG 2E8GA 5KFPA 3MFHA 1IZ6A 1OTCA 4LF6L 1N48A 3MDAA 2HQLA 4QWEA 4IQWA 2GWSA 1VQCA 1NY4A 4RQ1A 4MF2A 3UXOA 2HHQA 1TFRA 4C8KA 3FHWA 4LF9Q 7ICKA 4BBSG 2K14A 5KFHA 7ICNA 4DF4A 1VQBA 4YN4A 1JMSA 1KLNA 5TZVA 3FP9A 4KTQA 5IIIA 4UP8A 3I2ZA 4KLUA 5DGBA 5LMNQ 3LWMA 4R65A 5LMUQ 2B63G 4I2DA 2KFZA 4GS3A 2JE6I 1TWCH 3L2PA 4GLVB 1PH6A 3ETLA 4BA2I 1JJCB 4DPGA 1IBKL 3ER0A 1HNZL 2IBKA 5EWGA 2OQ0A 1PVOA 4LUOA 3CCLA 3BZKA 3L7ZC 4QW8A 1SFOH 4DAMA 3KHHA 1IBML 4M2YA 5KFLA 3HOVG 4QZIA 4OWTB 1BPXA 2UUCL 5IIKA 2AQ4A 4IRCA 4KLKA 1TVAA 5C4JH 4DFKA 3C2MA 4I28A 4ED2A 4AH6A 3MXNB 2AQ0A 4R4IA 5KT5A 5F9LA 4O9MA 1VQ6A 1ZQDA 3UQ0A 2I9GA 5DQGA 3BQTA 1X2IA 4R8UB 1GKHA 4PMWA 3S16H 4YWMA 3M9MB 3RJFA 4IQVA 1ZQKA 1U48A 2A1AA 1BPZA 1S72A 1Q82C 4XUSA 1YI2A 3HWTA 8ICVA 2LXKA 1PYBA 4JI7Q 3AFQA 4GC7A 2PI5A 4C8NA 3QE9Y 2F4VQ 3RAXA 4YCXA 3I4MH 2VL6A 1MQ2A 2HHHQ 4LF8L 2AHOB 1IBLQ 2KN7A 4M9JA 4KLGA 4J9MA 4B3TQ 4DOAA 4F93B 2ATWA 2RDIA 4DR4Q 2K4KA 1JXLA 1X65A 3PW7A 3J80i 4DEZA 2AGOA 2ASBA 2A1JB 2C2DA 4A93G 4ELTA 2RF4A 4A75A 3PW5A 2UXCL 2FLLA 9ICOA 1X54A 2VQFL 3I4NG 5CJ7A 4I27A 2BH8A 4JUZA 4NXNL 5KFVA 3GIIA 8ICHA 4J9RA 4LW1A 3GILA 4JC0A 5KFMA 1S40A 3FYHA 3C21A 2LXJA 1IL2A 3FDSA 1K1SA 4F4WA 1VCIA 1TWHH 5CWRA 3JPPA 1VQ7A 1IXRA 4Q8FA 5D4BA 2JA6H 1ZQYA 4DR6Q 4TVAB 4NLNA 4B9VA 1COOA 2WB1E 4X62Q 4ECTA 1EQQA 2L15A 8ICBA 3SI8A 1S76D 9ICPA 1Q12A 4QZ9A 5J0XA 2I1QA 2OTJA 9ICBA 1HNZQ 7ICUA 9ICGA 4A3BG 2R7DA 8ICCA 5DLFA 4A3DG 2IHMA 4HIKA 1FGUA 4EYIB 5KFRA 3G6XA 3AU6A 1IBMQ 2HVHA 2BKEA 5C5JA 3EYZA 4DQPA 3PW4A 2UUCQ 3ISCA 4JBWA 1CKMA 3V7LA 4QW9A 4ED0A 3CPWA 2VA8A 3BZCA 3I7FA 4LF5Q 3RRHA 3GDXA 2VY3A 1SKSA 4YR0A 4QZGA 1P8LA 2WAQE 4MEXA 3V7JA 4DFPA 5KT7A 1TV9A 4OX9L 3HOZH 1N32L 2UXDL 5JJKA 2VQEQ 3EBEA 4P72A 5DBCA 4BXXH 4YCWA 1YJ9A 5KFAA 2W8KA 2F52A 3EIVA 3KF6B 4YFKA 4IPCA 4BWMA 2PI2A 2C28A 3TAQA 2YU9H 4KITB 1NJWA 1Y88A 5FLMG 4Y7NH 3OHBA 4X5VA 1VQAA 3MR2A 3U58A 2B21A 1JT8A 1VQFA 4JI1L 1WCLA 3M4OH 3RB3A 4X6AH 1LYLA 3TREA 1JJ2A 3BU2A 5HP4A 1YJNA 3A5ZB 1GO3E 2YTYA 1YHBA 5IYDG 3RLNA 1S0MA 4I29A 4Q45A 2PMZE 4O3RA 2B3GA 4LF8Q 4K0KL 3E9IA 2K5VA 5EOZA 2PFOA 1YVCA 1UEBA 3E9HA 3PV8A 3HFZB 4DQSA 1WFQA 1W3SA 4UP9A 4QL5A 1Y14B 4OO1I 3BQ0A 2UXCQ 5IIOA 7ICIA 3ULLA 5C44G 2MO0A 3ZD8A 5J29A 2VQFQ 3S1QH 5J0TA 4AQYQ 3ZDAA 5JJLA 4C8LA 3KJPA 1XNRQ 4A3MH 2UUAQ 2RCNA 1D9DA 4ECRA 2BGWA 3H7IA 2NZHA 1A76A 4JV5L 1E3PA 5DBAA 3GV5B 2ZJRA 3N4MB 1KDHA 4DNIA 4C2MH 2BQRA 5HHHA 1PH3A 4ECUA 1UE6A 3CCSA 1PV4A 2VA2A 3WWVA 3CCMA 1X6OA 5DBBA 4AIMA 1L2FA 1ZQCA 3G4SA 1L3UA 5DLQE 2PQAA 1T8EA 1UE1A 4ME3A 5KFNA 4YR3A 3PO2G 1ZQMA 2KHIA 4GN5A 3CCEA 1MJEA 4QQBX 1ZQJA 5IYCH 2VS1A 3S1NH 4P73A 1ZQXA 7ICVA 2JZBB 3ZD9A 3ZDDA 4F5PA 2EIFA 8ICEA 2HHUA 3ULPA 1C7YA 5HMLA 3F2BA 5DB8A 4DL7A 1ZQTA 1PH1A 4KLHA 4TQUS 1VQEA 1X3EA 1EYGA 4DOBA 3Q8SB 1SLJA 4JI6Q 4DWIA 1MC8A 1KC8C 5KFKA 4QWAA 1AE3A 4RNNA 5J2DA 1N34L 1U45A 3C2KA 3GTGH 1SN8A 5DB6A 4DV3L 2P6RA 4RMFA 5HY6A 4HJ7A 9ICUA 3CMEA 4IOCA 2R92G 4JI2Q 3QZ7A 1SZPA 2E2JH 4O3PA 5J0UA 1X9WA 1T7PA 5FLXc 3KDFA 5M3MH 1FVIA 3B0XA 4BDPA 1HR0L 1S9FA 3J81c 3PO3G 2QEXA 3STBD 4XA5A 3B0YA 3SGIA 1BBUA 2JA5G 4JV2A 2Y1JA 1ZQHA 1OXXK 1YITA 1KQSA 4JI1Q 1GM5A 7ICLA 4EEYA 3G6EA 3K4GA 1SL0A 2VZAA 4KN4A 4K4GA 4QWDA 4DUYQ 5J3BA 1UT8A 4A3LH 4F92B 2AMCB 4MEYA 3AYHB 3SV4A 4UAWA 4Q8EA 3EN2A 3HKSA 2ZTDA 1CSPA 3MBYA 1NJYA 2BQUA 4IJHA 5F9NA 2OCEA 2BR0A 3M85A 3AQQA 1CKNA 1DOQA 4QGUA 2HHTA 2BPFA 2YV5A 1J5EL 4NLGA 4F4YA 1Y1VH 2Z0SA 3RZOH 1SKRA 3CQZH 1I50H 1Q86C 4R4CA 3NEMA 4I2HA 2I0QA 3HW8A 2WB1G 3RH5A 1QUQA 3M9NB 5KFCA 5DG9A 4IRKA 4R64A 1U4BA 1RYSA 3EZ5A 8ICJA 2NZOA 1LM0A 2DPIA 8ICKA 4A3FG 1TXYA 4JV5Q 4RG1A 2F3IA 1N33Q 7ICJA 3MFIA 4IJLA 5HGQA 8ICYA 5L1KA 1K9MC 4DSEA 1VQGA 2Q0ZX 1B8AA 3F1ZA 5GAEC 3JAMc 1KAWA 3PO4A 5KFGA 3S2HH 3PGZA 4RQ6A 1VQ8A 4Z6DA 3JPRA 3G71A 5KFXA 2K50A 4DUZQ 1VQJA 4PG3A 1BPEA 2V9WA 3UDXA 4TUSA 1XS9D 2VUMH 5KFQA 5IILA 5FJ8H 4JK1A 5J0OA 2WAQG 3AUOA 4P4MA 4UQGA 3C23A 4DSIA 2UXBQ 5IP7H 4GN3B 5IE8A 4Q43A 4ED6A 1VQHA 2KTQA 4ECZA 2M9NA 3T5HA 4KLJA 4FBUA 1B7YB 4DK3C 3S17H 4NPSA 4JBMA 3ZDCA 1U5KA 4YVZA 1KTQA 3TANA 2F1JA 4F5OA 4LWCA 5IYBH 3TS2A 4QZDA 3PY8A 2HHHL 2VA3A 2HHXA 2R7FA 1R9TH 2ZUDA 3OHAA 2AU0A 8ICOA 4LNQA 5GROA 1U9LA 3ICEA 3CCQA 2PXIA 4I2FA 4XQ8A 4ECVA 1EQRA 1MIUA 4HIDA 2XGQA 1VQ4A 1GVPA 4LZDA 4IFDI 3UXPA 4J9PA 4F50A 2ASDA 8ICQA 3MGIA 3JPOA 4YWLA 3I4MG 3L0OA 1PH8A 3RBDA 4UAZA 3Q8MA 1HZAA 3C1YA 1D8YA 5IWAQ 1MJCA 3BQ2A 1VQDA 5IP9H 2DGYA 2R8IA 2FPLA 2UVWA 2PQAB 2JEBI 2BQ3A 4LVSA 4NLKA 3GD7A 1VQPA 4BY7G 2XY7A 1PFSA 3Q8RB 2ASLA 2D0PA 4RQ0A 4YP3A 4KLOA 2VW9A 2CCZA 2R7ZH 5KG0A 4ED1A 4DR6L 1KRSA 4YD1A 2W9BA 1RIPA 4X62L 1YJWA 1NKCA 1KXLA 2W9CA 3PR4A 4JI0L 3UE1A 4A3FH 4F4ZA 1Z00A 1J5EQ 3NELA 2UVUA 2NRXA 3H0GH 4TUQA 3NBHB 4Z6CA 7ICRA 5BOMA 1XO1A 2JA6G 2FLNA 3H8WA 2YYZA 3D31A 2D62A 5KG1A 3KFUA 4KLMA 2J6SA 1VQMA 5L1LA 4K4HA 3M8RA 4LF5L 1BPYA 2GVAA 4DFJA 4QY7A 1Y1WH 1KD1C 9ICQA 5DG7A 1V1QA 4M04A 2KCMA 2ZUCA 3RBEA 4FDBA 4I2IA 2RDJA 2VQEL 9ICFA 1RL2A 4LUVA 4O3QA 2JJQA 4X66L 2AGPA 3GTPH 2ZJAA 4ECXA 2HIXA 3M4PA 4DV4L 5KFJA 5J0YA 2FPMA 4O3SA 2KFNA 2K52A 3Q8DA 5AJ3L 3C1ZA 4DV1L 4FS1A 1E22A 4M9LA 4YWKA 1PH7A 2AWNA 4IOAA 1QSSA 3RTVA 1SKWA 2BHNA 1NJIC 4PHDA 3MABA 3HOZG 2VANA 5KFUA 4B9LA 3PF4A 4BXXG 4UBBA 2N49A 4GOPA 3GV7B 2PI2E 1QZGA 8ICMA 2JEAI 3HOWH 4ED7A 3GQCA 2J6UA 2N78A 5JUMA 4DKAC 4PHPA 4UBCA 2XCAA 4LFAL 3UDIA 3TEHB 1WI5A 4JBKA 5KFIA 4JI3L 3M7NA 5CP2A 3GDEA 9ICNA 5ELNA 3PNCA 4QZFA 3NGDA 5J2IA 4A3EH 4ECYA 4BY7H 2CKZB 4RQ7A 1XNQQ 1A63A 3EWAA 1NK8A 2ZUBA 2OWOA 4IQUA 4DR3Q 2C22A 2JQOA 4JI5Q 1ZYQA 5KFZA 4BGDA 2IHFA 4LF7Q 3PUXA 2HW3A 1J6QA 7ICHA 4AQYL 5DKWA 1OXSC 3ZDBA 3RN2A 1XNRL 1A0IA 2UUAL 4PHEA 2XC9A 7ICTA 5L1IA 2FLPA 3DM3A 2KZ3A 7ICSA 2MUTA 3AFPA 1SE8A 1WCMH 4F5RA 2KHJA 1ZQGA 3M8SA 3RJKA 3CPFA 5GAGC 2NRTA 7ICMA 1NMFA 4A3IH 3ISBA 2BPCA 2CWAA 4J9LA 4AYBE 4KLEA 4JI0Q 1ZQRA 4C3HH 4A3MG 4F8RA 3RAQA 1L1OA 2XY6A 3T3FA 1NK4A 2ES2A 3S15H 4NXMQ 5KT6A 1QVFA 1EIFA 5EWFA 2K5HA 3GV8B 1D7QA 4KLQA 4QIWE 4QZ8A 9ICAA 1TK5A 1PH2A 1EFWA 3ZJYC 4GXKA 5IINA 4NM2A 7ICOA 2MFIA 2XGPA 3A5UA 1KIXA 5C0XI 1ZJNA 3NTUA 2W9AA 4DR2L 5GQOA 4GLAC 2KENA 5KT2A 2PFNA 4UPAA 4DV2Q 4JI6L 5KFDA 5IIJA 2C2EA 5IYCG 4X64Q 1PA6A 4FO6A 4KLLA 2QGQA 1JN3A 3CCRA 3RLOA 4TQSA 3T1HL 4RZRA 2KZZA 3LWLA 1VQOA 9ICVA 4B3SL 1GD7A 4HIMA 4X66Q 5D49A 9ICIA 1Z3EB 5GAHC 1ZQOA 4JI2L 3KJOA 4I2AA 2Y0SE 5E7NA 4DV4Q 2DUDA 1EUJA 5AJ3Q 4YXJA 1JX4A 1MKHA 1SL1A 5IT9c 1LUZA 4DV1Q 2FMPA 2PFQA 4M6WA 2NN6I 4PZ6A 3U50C 2FMQA 3T5KA 5M5WH 3JPSA 2JEGA 1BVSA 5KFOA 4MFCA 1WJJA 3M4QA 1L3TA 1M1KC 3RJJA 3PIPA 1A62A 2W9CB 3CF5A 4TQRA 4RUAA 3PV0A 4JYAL 5KFTA 3V6KA 9ICJA 2F1HA 5L9XA 4R4TA 4YMNA 2Z6KA 4DUYL 5M3MG 2IA6A 4M47A 3PIOA 4YR2A 4IFDJ 1ZETA 2P66A 4LFAQ 9ICWA 1L0WA 1QZHA 4JI3Q 4YG2A 1NTGA 4O5CA 3RB0A 4HIOA 3GTMH 2KBNA 1ZQNA 1LV5A 4DOCA 4O2DA 2NRWA 5KT4A 3HP6A 4IRDA 4ED3A 3B6YA 4UAYA 4A3LG 1UA1A 4RNOA 1YBYA 1MQ3A 1S77D 1XMOL 5GADC 1YHQA 4ED8A 3Q8KA 4HYKA 1EXNA 1ZQIA 4BXOA 2NVTH 2XCPA 1CEZA 4JCVE 2OTLA 4Y52H 8ICWA 3BJUA 3RLFA 1ASYA 1A77A 5DDMA 3THVA 2RHSB 2R8JA 5M3FH 5CHGA 4YXMA 1P16A 1Y1VG 1N33L 3H8SA 4M9GA 4X65L 4EQ5A 5KG6A 4J15A 3PVXA 8ICGA 4OXPA 4O0AA 4POGA 1ZQUA 1KSPA 2JA7H 2FPKA 9ICEA 2LYHA 1VQKA 3CXCA 1TWFH 4DUZL 3TQYA 4RPZA 4B3ML 4YMMA 2N3SA 4IO9A 4RNMA 1XSPA 3JPTA 4O3OA 4LFCL 2UXBL 4BY1H 3T1YL 4IFDG 5KFSA 4B9NA 1BGXT 4K4IA 3CCVA 1EOVA 4DR2Q 1L3SA 4L5RC 4EBCA 8ICTA 2UU9Q 1ZQVA 3EPGA 3HOUH 4Z6EA 4M0AA 1EIYB 4B3RQ 2VUMG 4KN7A 2BCQA 1Q7YC 1U49A 5FJ8G 2P6UA 3PCOB 3GO5A 4DSKA 1NJZA 1I5FA 4UP7A 2HHWA 5DQHA 2C2RA 3T1HQ 1JMCA 2LSSA 4R66A 5IP7G 1K73C 1QTMA 4GOPC 4B3SQ 2V1CC 1HNXL 2ZTCA 5C3EH 1A8VA 1CSQA 1VQLA 3M3YH 2ISOA 1HUZA 2XGTA 4P4OA 1PH5A 1B43A 4J9QA 4IPGA 4KHPQ 3KHLA 4EBDA 1PZNA 2CWPA 1PYSB 4MFAA 1RPLA 9ICRA 1SR3A 4QZAA 5IYBG 3PUWA 1UE7A
chains in the Genus database with same CATH superfamily
1MSGA 3CQZB 5ELDA 2K01A 1HH2P 1I50B 3VA7A 3C5GA 1Z4NA 2WF5A 5IWAL 1XMQQ 3AU7A 3PUZA 4JBJA 2UVRA 4LUZA 4JYAQ 5KYLA 4RFBA 5T14A 3NVYA 3OYYA 2F0NA 5M5YB 2NVQB 3OIPA 3GTOH 1L1OB 2BDPA 3H3VI 2B29A 3S1MH 3AQFA 2K5NA 2MO1A 4EBEA 1VF5C 1NK6A 1NK7A 2BE5C 2RSNA 1PRTF 2MQHA 4C56C 5IY0A 1QVGA 1HZ9A 3BZDB 4LF4Q 5FK9C 1CA6A 1K1QA 2EYOA 3MXNA 3GTJH 4A3JB 1X9NA 1L7MA 1LABA 3JPQA 1B0XA 2O6KA 1S5DD 5JRTA 5ELCA 1LT6D 4BA1I 2YB1A 4BS9A 1X56A 3K7AH 4NL9A 5A35A 3TQ1A 5IP9G 3NRZA 5CV7A 5BN4A 2A68C 3E2EA 2NV3A 3KLSA 5IGEA 1WOCA 4PQXA 1UT5A 2O5JC 2XWJB 3S2HB 2AUKA 2Q2IA 1T4GA 1D9FA 4IQZA 1KFSA 1F2LA 1G2TA 2HQEA 4I2JA 5AI6A 2H3QA 4PL2A 3HRZC 3QUCA 5C3WA 1HZCA 2W8LA 1CUKA 1ET9A 1RODA 4XDXA 1XMOQ 5C4XH 1D1KA 2WV6D 2R7ZG 4I2CA 4P2HA 2VNUD 4TURA 5JTIA 2VUMB 5M5YH 2NVQH 2JA8H 2CN1A 2LYBA 4JI8L 4AYBG 1L1OC 1XX8A 4EEKA 1X40A 1Q81C 3ED5A 5FOBB 3T13A 3TZUA 4IQTA 2KKPA 1TU2B 1XTDA 4DV5L 1BPDA 2JA9A 1T3QA 1UCVA 4X3SA 3BJYA 3CMAA 4A3JH 4MZ9A 2NZ1D 4EVOA 2HBJA 3I76A 1VS0A 5CV4A 4RQ4A 5KFYA 4DLGA 2B6GA 1A15A 3N7PD 3H0GG 4DO9A 4X65Q 1QQ7A 5ALEA 1IV8A 2HCIA 1D8LA 4O0IA 3D4WA 3FKIH 3UDFA 1G51A 3KF8B 5J2BA 3FDTA 3ZDEA 4KK7A 2E5LQ 3Q6SA 1VQ5A 3UMCA 1BF4A 3H4BA 3QB3A 3S17B 3GTKB 2L5TA 5I6YA 1ZJMA 1PH9A 3CW2C 3PSTA 1SMXA 4P4PA 4JV1A 3HKZF 3RB4A 3QO2A 1GO3F 3LK9A 3M9BA 4DAYA 1TT2A 5KT3A 5C0XJ 2EYMA 4B9WA 2R93B 4DAVA 2ZTEA 5DLGA 1ZXTA 2HIVA 1A2TA 3OW2A 1ICFB 1OO9B 1XSLA 2PNHA 2QKIC 1E1TA 4Z6FA 1KLUD 2B2WC 4B3MQ 1KAAA 2NYVA 2FDRA 3C5FA 4YY3L 4K6LA 1HJPA 3Q8QB 1HUNA 4L5TA 2H5XA 1JRPA 1Y1WG 1NR4A 2ESEA 1NKEA 4LFCQ 4UDUC 3K8AA 4B9UA 1JB7A 1STHA 4H13C 1TWAH 1QG7A 3T1YQ 4A8EA 3JPNA 1F2YA 2SOBA 2L55A 4R63A 1HIWA 2Y0SG 2F0GA 2IY5B 2RHQB 3H8JA 2M0NA 3KTQA 5J2KA 3K7UC 3LGJA 2NB0A 4IURA 5ALXA 1XPOA 4ZH4A 2OF1A 3WK4A 9ICHA 1X3QA 3T56B 2D9UA 3TI0A 2EZZA 4IZ8A 4FF4A 3GTKH 2H1EA 4A3KB 3RNUA 4WFN3 1XWEA 4HCSA 3G6VA 3LDAA 3C46A 4V0BA 2R93H 5ALHA 3GTLB 2DJFC 3CC4A 2EE1A 2RRDA 3PMNA 2UUBL 3D2QA 2R8HA 1DOLA 1E24A 1HNXQ 3HOYH 1KFTA 2A6EC 2HSZA 3KBXA 2RCFA 2Z6KC 5J0PA 2R7ZB 4UATA 4NM1A 5J2HA 1JOKA 4HAEA 2GLEA 4JV0A 4F5QA 1KDBA 3E58A 3E3XA 3OHXC 4N9TA 3J80c 1X3FA 4UB1A 3DEPA 1EYCA 4RQ2A 4AYBB 2EXDA 1I6HH 1SXEA 4DN4M 5BN5A 4OJ6A 5AKXA 3PIP3 1X42A 7ICGA 3T5LA 4C8OA 5A2QE 1FEZA 4UB6U 3NENA 1XTCD 1XNQL 3NSWA 3HOWG 3MR6A 4S3SA 2WFWA 2N88A 4DR3L 2DKZA 5EPJA 4DL4A 4JI5L 3PIO3 8ICXA 2WP8J 3A8JE 1HHVA 4DR5Q 4C7YA 4NY8A 3LNNA 2AXTU 4XTCS 2CFMA 3WU2U 1RXVA 4LF7L 5J2FA 1B50A 1SV4A 3G6YA 4J9KA 3A7LA 4A3CH 4DL6A 2XIWA 3C2LA 4A3KH 3OJSA 2C5CA 2KCTA 4IUVA 4HJ5A 3G7LA 4ELVA 4AP9A 2I5HA 1ZQSA 2E2IH 5K36G 3DWAA 2MSNA 1HFGA 1DK3A 4A3EG 4QWCA 1W2BA 2HI0A 3GTLH 2C35B 5AI9A 4F5NA 5KG4A 3D4RA 8ICNA 4C8MA 1MSWD 4ACOA 4EELA 4NP5A 3TARA 1PFNA 3J81i 2K4IA 2BCRA 2ICIA 5CA7A 1JR0D 5FO9B 3EQLC 1BPBA 1VQ9A 7ICFA 5ELOA 2F0PA 3D0FA 3R3OA 4LJZC 1Y1WB 5EE0A 1MGSA 4UB4A 1B4OA 3MVVA 5KRUA 7ICPA 2K33A 2W54A 3I73A 2BCSA 1ZYRC 2PYKA 3KF6A 3C28A 2BPGA 3QZ8A 2EY5A 2Y0SB 4RQ8A 4BBRB 2DUYA 8ICZA 3PMFA 8ICLA 3GTPB 4NXML 2VKQA 3HX0A 2PFPA 7ICEA 4A3GH 4I2BA 9ICCA 3ALRA 2K5DA 3CCJA 2K8CB 5ALVA 1WCMG 3HOXH 4MTNA 2Q2TA 4F4XA 2NN6G 4JI8Q 4A76A 1QJOA 4QZCA 2IX1A 2F1IA 4RQ5A 5HHIA 1BBXC 4A3IG 1ML0D 5FO8B 4RUCA 3PX4A 1SYDA 3TP8A 3PF5A 4DV5Q 4M9NA 4YIJA 3LVWA 4GLXA 2ISPA 4ZQ3A 5AI5A 4C3HG 1K8GA 3RR5A 4DK1A 4CE6A 3TFRA 1GUOA 2F0HA 3KDFB 4JOIA 3OTOQ 5JJZA 1F9PA 2HDOA 4PHAA 2LKVA 5KFWA 4DV2L 5DGAA 3NS1A 4X64L 3GTQH 1ZQWA 1PRTC 5J0QA 2R18A 1L0XB 4FBTA 2AH5A 4R4OA 4E6IA 1CHPD 1NNXA 1QOHA 3DMUA 1CKOA 5JEAJ 1WTOA 4BBRH 2IX3A 4JWNA 1ZQEA 4Y2PA 3MR5A 4KN7C 4YQWA 1FR3A 1XSNA 4HAIA 1L6NA 1T3NA 2NRVA 1HA5A 5M5XH 4KLTA 1IM4A 4GKKQ 4YCUA 2BCOA 4MHEA 1KL9A 1IYUA 3NTHA 2BH2A 4DV7L 1Q46A 1S4ZA 1JIHA 2F0EA 2WKCA 4YY3Q 2FMSA 4PZOA 2CW0C 3H09A 1C8CA 1HNWQ 2BZFA 3V72A 1A2UA 4EZ6A 5KG3A 1KLGD 2K60A 2NYZD 2OXOA 2KVMA 2A6HC 1OXVA 4MIUA 1WCNA 3SAFA 4CCHA 4MNOA 4IR1A 3QEAZ 2JEIA 4A3EB 4E0DA 1KEJA 2XWBB 2NVXH 3DV9A 4OO1G 4RT2A 1O7IA 3UPQA 3JAMi 4CDDC 1V38A 4G3IA 1WTRA 1M90C 4APVA 1ZQPA 1QLNA 4XQNA 1B22A 2CVRA 3RR7A 1LT5D 1CKNB 1B70B 3W1GA 5KG7A 1L8LA 3RH4A 5ELFA 4Y2VA 5CEHA 2F0SA 2Y9UA 1O7YA 4B9TA 3W5OA 4L5SA 3WKEA 2XRQD 2AQ3B 3SD7A 3RN5A 1II3A 3E0FA 5D3IB 3IV6A 2EQSA 4DL3A 3H0RB 5L37A 1QUQB 4ECQA 1LTLA 1SRUA 3Q8LA 3BQ1A 2UUBQ 1DXMA 1KRPA 4FS2A 3CD6A 3PSIA 8ICIA 2N55A 5EPKA 2Q8IB 3M9OB 4GKJL 1H95A 2DKXA 5C5LA 3HKZC 2V4QA 4O3NA 1LTGD 1I4HA 4DQRA 1EEFD 3ORYA 3TZDA 4RHSA 1EWIA 4HJ9A 4QZHA 3L3OC 3TP5A 3SV3A 4DL5A 5IT9E 5C0XH 1VQIA 4DSLA 3Q24A 4A3IB 4PGXA 3TAPA 3C1FA 1LT4D 2JZBA 2KEYA 3M1YA 4RT3A 2K7VA 4C3HB 2KJ5A 2FMMA 5KFBA 1N63A 4C80A 3HPOA 1L7PA 2CRXA 4BJQA 1TAUA 4R4QA 3SK6A 3WDNA 3P7JA 5AKYA 3IDWA 1RKNA 9ICTA 1SAPA 4NLZA 1SEBD 4L6TB 4OWWB 1OXTA 4KLFA 3KHRA 3CNHA 3RJHA 4DV6L 1JT8A 2FMCA 4DAYB 1ENFA 3RJIA 2FJ2A 1Z1BA 4BBSH 5JEAG 2Q2HA 2ZIWB 4RCNA 3DWQA 3CCUA 4QF4A 2HT1A 5I6WA 3Q8PB 1F0MA 3RB6A 3N7SC 4LF6Q 2WF7A 2R8KA 2XRSD 2B63H 4GNXA 2BA0A 2JK8A 1SYEA 3MC0B 1E2WA 1DM0B 3K80C 1JJGA 4I7AA 4IN3A 1A3UA 1SYBA 1GUTA 2QEJC 9ICLA 5ELBA 4ELUA 4EQPA 5HGTA 2P35A 2IOHA 4DFMA 4O5KA 5KG5A 4BX9C 3HT3A 2VXWA 1S10A 1V43A 3I4OA 2LPEA 3R9KA 5IGDA 5IIFA 3RFAA 2B8GA 5M3FG 2GN5A 3R2IA 1JCKB 5DQIA 4J1MA 3OWFA 2B2TC 3ND8A 2YTVA 4PH5A 2JRZA 3PUYA 4UB3A 4QZEA 8ICAA 4K8IA 1I3QH 4EYHB 3F8TA 4P71A 1KFDA 1XNSA 3HOVH 5DDYA 3GV3A 4DSFA 1K0RA 2IX0A 2JA7G 3TRZA 3KBGA 2KVSA 4RPYA 3QEBZ 1YNXA 3DXJC 4CGYB 5CC4A 1STEA 1ZQZA 4YCVA 1IBKQ 2JMGA 3K5NA 1FNUA 1MI2A 2E75C 4KI0A 1RDPD 3IHQB 5ALWA 1TE2A 3UM9A 1S0OA 4UY8C 3DHQA 2UU9L 3PMLA 1EY7A 4HCEA 2IOFK 3UQ2A 1UWVA 3TKAA 4B3RL 5AKHA 2QDLA 1C0AA 2AWOA 2W9MA 5ISRA 4DQQA 4F4KA 2AJQA 2KMDA 4Q44A 3KUPA 2KZMA 1HUOA 1ZD2P 2B2WA 1O7LA 4IR9A 4DF8A 5B66U 2XTIA 1MHWC 1NK0A 4YHHL 2ZIXA 1SXDA 1ZQAA 4NLBA 4BY1G 5EE1A 2YX8A 1H9RA 4Y2RA 4RU9A 1K83B 2KV2A 1JE5A 2YTXA 3IKJA 1Z9FA 3RJEA 4DV0L 3AEVA 2KA7A 3C1EA 1WD0A 2LM4A 4R9WA 1DGSA 4QMGA 3WK6A 4HJAA 2EQYA 4DV7Q 3MEFA 1RD9D 1G291 5KNDA 3HOUG 1R4QB 2K5QA 3SDZA 2QA4A 4KHPL 5E79U 5H1SE 1GHKA 3KLSX 5BR8L 3H4DA 1NOMA 1ENCA 2BCVA 2M00A 3I55A 1KTKA 1YEZA 5AI4A 1JWSD 4GC6A 1F2MA 4DL2A 2OXPA 2W9BB 3S24A 5J2AA 4RQ3A 1NBWA 5CYUA 1UAPA 5IGFA 5C3EG 1PH4A 1XMQL 1FFVA 4XYQA 1PVQA 2B2UA 3CRKC 2KHQA 4Y2QA 1NNLA 5D46A 1E2VA 3MXUA 1JWMD 4RCOA 3AU2A 1S3OA 5CMDA 2NVTB 4R1JA 1Z00B 4ICAA 3HS0C 4PGYA 9ICKA 2QB1A 1N62A 2ZJ8A 2OQKA 2PI4A 2XNAC 4KJNA 1WTXA 1AE2A 3RH6A 3BS1A 1DXSA 4C3JG 1S0VA 2HHVA 2DY8A 1QSLA 1Q1BA 1Q1EA 1K83H 3G48A 3GP7A 4LF4L 2ASJA 3PZPA 3SR6A 5M3FB 4LFBL 2M2LA 1TAQA 3GIKA 1U4MA 4H0LC 2E2HB 5EKLA 4GKJQ 3V6HA 4DQIA 1HA6A 3T53B 4ZOHC 4X3KA 2CQOA 4CHTB 1LB2B 1T9HA 1FL0A 1TAMA 1VDVA 1AEXA 3HKZE 2JA7B 5KFFA 5ALLA 2UVVA 3PO5A 2RSOA 1XJVA 4IC9A 1RYRA 4A93H 3J81E 5DB9A 4CDFC 2DFLA 2A8VA 3QYPA 4RPXA 1SL2A 1H38A 2BDNA 2JH7A 4PZ8A 4DK6C 4RKLA 3H40A 3J7ZC 3PUVA 2WTFA 1TWFB 4G57A 4A3BB 2MAXA 3I4NH 5EWEA 4XIGS 1G2SA 1N9WA 1Q90A 4KD4A 1PZID 2ZM6L 1TS4A 4RHRA 3CC2A 4DV6Q 1YZ7A 3VR4A 1YZ6A 3IM1A 3S1RH 3OPXA 1QVCA 2NVYH 1N36L 1BCPD 2KK0A 4DNTB 4BY1B 1LO5D 2A3VA 1I94L 1EY9A 3AB9A 3HP3A 3R2TA 4KLIA 1C48A 4YMOA 1QWYA 4FF1A 1UEAB 3C29A 1U0LA 2R3ZA 4PGQA 4ULLA 1V9PA 3SXHA 2E2HH 1XC9A 2N8NA 1IW7D 1XPRA 5FO7B 4CDGA 4L8JA 1B3AA 1Y8OB 2E5LL 5C4XG 2R6GA 3A74A 3SEBA 5HMMA 3C3LA 3QU2A 1STGA 3MXGA 3D2NA 4KLSA 1WVLA 1TK8A 1O78A 4NXNQ 5KTQA 2F0FA 4CJ1B 1L3VA 1PHJA 2JA8G 4JOIC 3UE0A 3NVWA 2NRZA 5DB7A 3T5JA 2ATLA 4PPXA 8ICFA 1E1OA 5CBAE 1J9OA 3AMZA 4B9SA 4MF8A 1JC7A 4WRDA 4GOPB 1EY0A 4JI4L 4A3BH 4A3JG 4FZMA 5J2JA 4ZYSA 1NMGA 4A3DH 3EPIA 2MNAA 1EQVA 4QZBA 5C3EB 1HR0W 1AH9A 3DEEA 3BS5B 3QUQA 1NJXA 3KLWA 3MTSA 1XO0A 4JG2A 1NUCA 3FKIG 3H3VH 1K8MA 2QB0A 3H3VC 5ALMA 8ICRA 1S5CD 5JAVA 1KHIA 5IIMA 4TUPA 4OELB 1CZGA 1ZQFA 4C3JB 2ZIVB 2L9HA 2IHNA 5BOLA 1AQ6A 3ONAB 1UHUA 1OXUA 2ZXPA 5KNBA 1PYWD 1UE5A 3PW2A 1MBYA 3NVZA 3KHGA 1D5ZC 4A4IA 2J6TA 2FXQA 4JPBW 3OSNA 1FJGL 4LZGA 1K3RA 1PLFA 1XPUA 2CXYA 1TR5A 3QU5A 2YMLA 2BCUA 2MPMA 3EW9A 8ICPA 3S14B 4ZCKA 4ZK9B 4DS5A 2K75A 1SNMA 1STNA 3MWYW 3KYHC 4FXDA 1TKDA 2V4RA 4NXZA 1YHAA 2OEOA 3JAME 3GTOB 5LMNW 4DNRB 3S1MB 2M9VA 4YHHQ 3NRWA 5G5GA 1L8OA 3ERSX 4F2SA 5J2CA 3R8BA 1ZQLA 3F2DA 3MR3A 1RZTA 1D1IA 5BPCA 3NXWA 2WACA 4DV0Q 3RD4A 3ULJA 1ZQBA 4KKSA 4C3IH 2A19A 1ZD3A 2W43A 2AGQA 3SAGA 1QH9A 2KICA 2KEEA 4QJFA 1JORA 3MEHA 2FE9A 1E7ZA 2BE5D 4XRHA 8ICSA 3K7AB 4C3JH 1X3GA 5FLMH 3SYZA 5BR8Q 1STAA 5KFEA 4ALPA 2MUTB 1XU4A 4OX9Q 3J81j 2EOTA 1BXTA 1N32Q 3U4VA 4GNXB 2UXDQ 1WTHA 2BOSA 1B2TA 3S2DH 4B6JA 1JUDA 9ICSA 2GVBA 4DR1L 4P75A 2R93G 4OJ5A 2IT1A 1WYDA 3HGBA 4DR5L 3OWEB 4P74A 4J9NA 5HURA 4NLCA 5EBCA 3HZXA 3ETRA 4BWJA 4ECSA 3HOYG 3S14H 2HOIA 2A68D 5C4ZA 1TS3A 3DLLA 5C4XB 2SEBD 4DR7L 5DAUA 2XO7A 2JEJA 1ZQQA 2IJ0A 4POFA 2HVIA 3F2CA 2KP7A 2JA8B 5EJWA 2G5HB 4QIWF 5IYDH 1ZD4A 1DRGA 1S97A 3CAMA 5DG8A 4K14A 4RAUC 3K1RB 4N9PA 1DK2A 1TK0A 1YIJA 1QSYA 1ESFA 1HZBA 5HNKA 2D0OA 3JC66 3TS0A 1K8AC 1SBBB 2D6FC 2Q2UA 5D3DA 4LFBQ 3ICXA 3PX6A 1SROA 2XY5A 4I2EA 2DY7A 2B0CA 1C9OA 1DYQA 2WF6A 7ICQA 4KKTA 4CF3A 2ZIUB 2K28A 3FKIB 1YNJC 4IPDA 1U4RA 2I5LX 4GN4B 4EX5A 3J80E 4A3CG 3J7A5 1TWGH 4KMUA 3K0XA 4H02A 4NMZA 4A3KG 4L5QA 4LF9L 1AROP 2F8KA 3QU9A 3MGHA 4KD3A 1JXEA 4R8UA 1X9SA 2KUMA 3TP7A 4B9MA 2WAQF 4GNXC 3GIJA 1KW4A 4EZ9A 5AK4A 3RZDH 3CP0A 5AKGA 1QNKA 2KCNA 4NB3A 4ECWA 3KOOA 1I6VC 3STBC 2ZJQA 1XWLA 1S0NA 2F3VA 5C44H 4K0KQ 2HDMA 5LMNL 3BDPA 5CB1A 1RXWA 5LMUL 2Y0SF 9ICXA 2Z9HA 1FD7D 3E0EA 4DF7A 1G6PA 3J7YW 2ZM6Q 4J9OA 1UA0A 5A2QL 1CA5A 3VYRA 2O4XA 5JPNC 1H9SB 1NKBA 2ALZA 1N36Q 5JJIA 2K89A 3OGUA 1IHZA 2HOFA 1TWAB 1I94Q 4JWMA 4U7CA 3OSPA 1NZBA 4BUGA 2IHEA 2W7OA 4FO2A 4ILWA 4DFAA 3NWTA 3H15A 1NE3A 1SIJA 4GFJA 4M6WB 3PW0A 4QWBA 5EGTA 4X3UA 3OJUA 4JB3A 5B5EU 1PFBA 4A3GG 3OIQA 4OONA 1N56A 2OH2A 3HOXG 4CNQA 2MA1A 5ALTA 4Y2UA 3MDCA 2MU2A 2L5YA 2HHSA 2B2TA 1BKBA 3OSOA 1WTVA 1HRJA 3I3CA 2I46A 1IYJB 1N61A 4YD2A 3LWEA 3GV6A 3TFSA 4F2RA 3PO2H 1PFMA 1YNNC 2F3NA 4JI4Q 3SZ2A 3U4ZA 2PMZF 4HJ8A 1K8OA 1Z47A 3HOYB 4GKKL 2PW5A 1VQNA 4WJ4A 2YMPA 2R8GA 1KRTA 2A1JA 3PR5B 2JP1A 3I28A 8ICUA 5G5HA 1PVRA 1BBWA 2I5MX 1HNWL 3VA5A 3UXNA 3EJIA 3RRGA 2JGAA 4Q5VA 4O5EA 1I6HB 1N8RC 1ASZA 2A6ED 2K8AA 3KOJA 3CHBD 4OWXB 5EAYA 4UB2A 2BA1A 4C4TA 2JH1A 5J2GA 1LTBD 1HEKA 5KG2A 1GUGA 2DBYA 4BBRG 3K81C 1VMCA 2ZXIA 1X55A 3K6OA 1FJGQ 3HG9A 4F91B 1QB5D 3OOCA 3TDQA 4FXGC 2IW3A 3TACB 3D3RA 1RTOA 3IRBA 3U26A 9ICMA 1EWCA 2AKWB 2P5ZX 4GXIA 1NK5A 1NI3A 2Y1IA 5I4DA 1XYIA 3V7KA 3RR8A 5CR0A 5J0WA 3GIMA 5AICA 2D8CA 4F3OA 1V1OA 1X3PA 3ISDA 2QDBA 5FKAC 3UDGA 3MHBA 3RJGA 2E2IB 4WJ3M 2LMCB 2HBMA 2FI1A 4GXJA 4M9HA 4DLEA 2B2UC 4F8MA 1SV0C 1F9RA 4BXOB 1EY5A 2R92H 2IMWP 4DA2A 1N5XA 1Z7TA 1TQOA 1L7OA 3D6WA 5L1JA 3PX0A 3F5AA 2Z4IA 4XT1B 5AKZA 3K75D 1X9MA 1MA7A 4IPHA 1CZWA 5J0SA 3N97B 4DS4A 3I56A 4J9SA 3V96A 4I2GA 2LM1A 4PZ7A 3MXPA 3PO3H 2ZJ5A 5ALKA 3GZFA 1B9NA 4JI7L 4KLDA 2ZJPA 1G8ZD 1EYDA 1L5UA 1N34Q 2JEFA 3V6JA 2JA5H 2EJFC 2ID0A 2Z6BA 2F4VL 3A0JA 2CQAA 2QW7A 4DV3Q 4KHZA 4DR1Q 4DSJA 2ALYB 4UB5A 3CC7A 1IBLL 3NASA 5F2DA 5LHY1 1U4PA 1Q8KA 2VJ4A 5ALFA 5J2EA 1F44A 1GUSA 2F0DA 3W1BA 3VDYA 4MFFA 4B3TL 2KHVA 4A3GB 2DPJA 2WB1B 3VR5A 1ZYRD 3GFKB 3HOXB 4DR7Q 3FVQA 3HKZG 1LT3D 2O5IC 4DR4L 4KJOA 5G3LF 4EENA 2KQ3A 1HR0Q 1N5WA 3WKBA 1NK9A 2NUCA 5J0RA 1U47A 4G7OC 4TKOB 5AHXA 1LV9A 2E8GA 2X69A 5C0XG 4FYDA 5DM63 4K2LA 5KFPA 3MFHA 1IZ6A 1OTCA 3D6CA 3DM1A 4LF6L 1N48A 3I8ZA 1J2NA 2QB0B 3MDAA 2HQLA 4QWEA 1JICA 4NDXA 4IQWA 4KMOB 3FPUB 2GWSA 3N6RA 1VQCA 1NY4A 4RQ1A 4MF2A 2L0CA 3UXOA 2HHQA 5IODA 4RKBA 3GTQB 1TFRA 4C8KA 1PRTB 3FHWA 1Z19A 1ECWA 4B9XA 4LF9Q 3WK8A 2AUJD 1VF7A 7ICKA 4BBSG 3QG1A 5AKJA 1KNEA 2K14A 4JMUA 5KFHA 7ICNA 4DF4A 1VQBA 3IFTA 5CR3A 4YN4A 3U9SA 1WTWA 5A0LA 2EZVA 1JMSA 1KLNA 5TZVA 3FP9A 4KTQA 1GUWA 5IIIA 3QOLA 4UP8A 4US9A 2PZUA 3I2ZA 3AQEA 1PRTD 4KLUA 5DGBA 5LMNQ 3LWMA 4R65A 5LMUQ 5M5XB 2WB1C 3K1ZA 4GIBA 4PMCA 4I2DA 3WOFA 2B63G 1PDQA 3NVVA 1KABA 2KFZA 1E2ZA 4GS3A 2JE6I 5C4JB 1JROA 1BR9A 1TWCH 3L2PA 1J97A 4GLVB 4C1NI 1F77A 3LX0A 1PH6A 5KNIA 2FINB 3ETLA 2YN4A 4BA2I 1JJCB 4DPGA 1IBKL 3ER0A 1HNZL 1RDFA 2IBKA 2NVXB 3D2SA 5EWGA 2OQ0A 4OCZA 4CKBA 1I4RA 4QJFB 3DUZA 1PVOA 1YT3A 2CW0D 3BZKA 4LUOA 3CCLA 2EPBA 3L7ZC 4QW8A 2HCCA 4ABNA 1SFOH 1EZ6A 2A6HD 4DAMA 5ALYA 3KHHA 1HXYD 4QB4A 1IBML 3PSFA 4P0PB 3KZXA 4M2YA 5KFLA 3HOVG 3QXGA 2KJ9A 4QZIA 3T16A 2NO5A 1BPXA 1LLRD 4OWTB 1Y1VB 2UUCL 3S16B 5IIKA 3KKAA 2AQ4A 3T79A 2K1BA 3X3MA 4O1NA 4RGNA 4IRCA 4KLKA 2D3DA 1ILPA 2JHDA 2WFAA 1BNOA 1STBA 5ALIA 1SJED 1TVAA 1ONLA 2EXZA 2WAQC 3GU3A 3SEIA 3HKZB 5C4JH 4DFKA 2ODGA 5AKIA 3C2MA 1CK1A 4I28A 4CRXA 4ED2A 4AH6A 3MXNB 2VB3X 2XSCA 1I4GA 3QIAA 1LTRD 4RGTA 2AQ0A 4R4IA 1SWWA 5F9LA 5KT5A 1O80A 4O9MA 1VQ6A 3K0YA 1ZQDA 3ZYYX 1QCKA 2WF9A 1VMPA 3UQ0A 2XN9C 1SB3C 4HSPA 2HMXA 1DONA 4ZRZA 2WIIB 2I9GA 5DQGA 5I9OA 5JPMC 3BQTA 5AM1A 1X2IA 4OD0A 4H7BA 4R8UB 1GKHA 2NTTA 3KK7A 2W7PA 2X6GA 4PMWA 3S16H 4YWMA 1EY6A 3UMBA 1ENAA 2G9HD 4BBSB 4K5WA 1SDFA 3M9MB 3RJFA 3CKIB 1Q8IA 2A1AA 4IQVA 1U48A 1ZQKA 1BPZA 4MTKA 1S72A 1Q82C 5ALOA 4XUSA 1YI2A 2B63B 2GH1A 4KX3A 3SAHA 1QQ5A 4IUNA 1FO4A 3HWTA 8ICVA 2LXKA 3P75A 1PYBA 2I07B 4XT3B 4JI7Q 2F0UA 3KFUF 2G5DA 3A56A 3AFQA 3QNMA 4F87A 1YHQA 4GC7A 2PI5A 4C8NA 3QE9Y 4DAPA 2EDGA 4RQNA 2EZYA 2F4VQ 4G7ZC 2F2AB 2RQ5A 3RAXA 1V1PA 4YCXA 4QUCA 3I4MH 4U673 4OJLA 2E8PA 1MQ2A 2VL6A 2HHHQ 1SNQA 4LF8L 2AHOB 1IBLQ 3KZIU 3MC1A 4KMUC 2KN7A 5LL6X 4M9JA 4KLGA 1CQFA 3D8GA 4J9MA 4B3TQ 4DOAA 2KJXA 4F93B 2ATWA 2H3IA 2F0QA 2RDIA 1U9RA 4FXKC 1VLBA 2MRLA 1I3QB 1BCPF 4DR4Q 3HOVB 2K4KA 1EU3A 2XVTA 3WK9A 1JXLA 1X65A 3PW7A 2EY6A 3J80i 2QARA 4DEZA 2YMQA 2AGOA 2LY7A 2ASBA 2A1JB 2C2DA 2F0OA 4A93G 4ELTA 2K4HA 2RF4A 4A75A 1PTOF 5ALSA 3PW5A 2UXCL 2FLLA 9ICOA 2EANA 2KIWA 4GZYC 3TBIB 1PMRA 1DGJA 2Y9TA 3QWNA 1X54A 3QJYA 4ZKBB 2VQFL 3I4NG 3NHHA 4WJ3B 5CJ7A 1A3VA 4J6HA 4G9BA 4I27A 5I2YA 2BH8A 4JUZA 4NXNL 5KFVA 3J7AV 2OYYA 3GIIA 2RLTA 8ICHA 4J9RA 4LW1A 3SHLA 3GILA 4JC0A 5KFMA 4QCLA 2YQEA 4FP5D 4OEMB 1X6JA 1I4QA 4ZUJA 1S40A 4PL1A 3FYHA 2F03A 1H9KA 4C7ZA 1J2MA 1LKYA 2K8BB 3C21A 4QNLA 2N1RA 2LXJA 3FDSA 5EE9A 1K1SA 2EYJA 1IL2A 1DD2A 4F4WA 1VCIA 1TWHH 5EPLA 5KYIA 5CWRA 3JPPA 5EKIA 1VQ7A 1IXRA 4Q8FA 5D4BA 2NO4A 2JA6H 1ZQYA 4DR6Q 1Z4OA 3K58A 4TVAB 4NLNA 1RYUA 1COOA 4C4SA 4U6PA 4B9VA 5FLXL 5AI8A 2BDOA 2WB1E 4ECTA 4X62Q 2EAPA 3L3FX 4UAVA 2L15A 1EQQA 1SYFA 2CH4A 8ICBA 3SI8A 2QCPX 1S76D 3J81L 1UUPA 5C3XA 9ICPA 2PNRC 1Q12A 4QZ9A 2I1QA 5J0XA 2E8NA 2OTJA 9ICBA 1HNZQ 7ICUA 3SE0A 1AW7A 5ALRA 9ICGA 5TSSA 4A3BG 5C6AA 2R7DA 8ICCA 5DLFA 1Q3LA 2B39A 4A3DG 1LTSD 2IHMA 4HIKA 1FGUA 3LVVA 4EYIB 2DQNB 2EAMA 3E0JA 3QX7A 5KFRA 5IGGA 2F0MA 3G6XA 3AU6A 1IBMQ 3BVZA 5KL1B 1DCZA 2HVHA 1H9JA 1HPCA 2BKEA 5C5JA 3EYZA 4IUQA 4R8NA 4ID6A 2HCFA 3IRUA 4DQPA 1PXUA 3V2TA 3PW4A 2UUCQ 4ZKCB 2YY6A 2E8OA 2F8LA 3AN1A 3ISCA 4JBWA 3KD3A 1CKMA 3V7LA 4QW9A 2IOFA 4ED0A 4J8QA 3CPWA 3CRLC 2VA8A 3BZCA 3I7FA 3T4AC 3RRHA 4LF5Q 3GDXA 4Z9CB 4F88A 4HMJA 2VY3A 1SKSA 4YR0A 4G7HC 4QZGA 1RF2D 3DWPA 5ALUA 5K4LA 1P8LA 2WAQE 4MEXA 3V7JA 2HOQA 5KT7A 4DFPA 1TV9A 2Z7JA 4OX9L 3HOZH 1N32L 2UXDL 5JJKA 4TSSA 2VQEQ 1KDCA 4A93B 3EBEA 4P72A 5DBCA 3MAQA 5AFWA 4BXXH 2EDUA 4P0QA 1RCVD 4YCWA 2Z1CA 1YJ9A 3H0LB 3I4NB 5KFAA 2W8KA 2F52A 3EIVA 1SV0A 4C3IG 3KF6B 1SNOA 1AP0A 2F77X 4XYOA 4FFDA 4YFKA 1QNUA 4IPCA 3G6JB 4BWMA 2PI2A 4HTHA 4O42A 2C28A 3TAQA 2YU9H 4KITB 2E8MA 2DN8A 1KN5A 1NJWA 3WK5A 1Y88A 5FLMG 4C4RA 4HEDA 2K6AA 4Y7NH 3FC4A 3S1RB 2NVYB 3OHBA 4X5VA 5CORA 3AM9A 1VQAA 3MR2A 5ALQA 3U58A 2B21A 5E4XA 1VQFA 1O03A 4JI1L 1WCLA 3M4OH 3RB3A 1IL8A 2KOLA 1S5FD 4X6AH 1D8BA 1A6SA 2L4NA 1LYLA 3TREA 1JJ2A 3LYSA 4JW0A 3IFDA 2YTUA 3BU2A 1GUNA 5HP4A 3TS2A 1K3BC 1YJNA 2W3RA 5COYA 3JAML 2D2CC 1V8QA 3S1QB 1P7DA 3A5ZB 2G06A 1GO3E 2YTYA 5IGCA 1YHBA 5IYDG 2KNJA 2QLTA 5CV6A 3IG8A 2EY1A 1S0MA 3RLNA 4I29A 4Q45A 3TSSA 1BNZA 2PMZE 1J8IA 4O3RA 2B3GA 3OPOA 4LF8Q 3ZI4A 4K0KL 3BG3A 3VC8A 3E9IA 4K2KA 5ALPA 1FNVA 2K5VA 4B08A 4A3DB 1EEID 1F9QA 4C2MB 1DZ1A 5EOZA 2PFOA 4OJOA 1YVCA 5F3XB 4NJ8A 1EFID 1UEBA 3E9HA 2EY2A 3PV8A 3HFZB 4DQSA 5CGKA 4F72A 1RHPA 1WFQA 3Q0AA 2A69C 1W3SA 2KOBA 4QL5A 1Y14B 1GXDC 4UP9A 5J22A 4OO1I 1JWUD 1SXTA 3BQ0A 4USAA 5IIOA 2UXCQ 7ICIA 3ULLA 4ODGA 4HSVA 1C20A 4MHVA 5C44G 2MO0A 3ZD8A 5J29A 2VQFQ 1CTMA 1FGBD 3KLRA 3M6KA 5ALDA 5J0TA 1W6JA 3F2UA 4AQYQ 3S1QH 3ZDAA 5JJLA 4C8LA 1AZQA 3KJPA 1MD2D 2HDLA 1UPHA 1XNRQ 2YB4A 2XI9A 4A3MH 2UUAQ 2GO7A 2RCNA 2WF8A 1D9DA 3IN5A 4ECRA 1M6YA 2NTSA 2BGWA 3H7IA 1NR2A 1A76A 2NZHA 4NW2A 4JV5L 1E3PA 5DBAA 4UW9A 3GV5B 2ZJRA 3N4MB 5KNCA 1N60A 1AN8A 1KDHA 1XXGA 5I9PA 4DNIA 4C2MH 1CI4A 2BQRA 5J1ZA 5AIBA 5HHHA 2MHVA 1RQLA 1IKLA 1PH3A 2W3SA 4C3IB 4ECUA 1UE6A 3FPPA 3M7DA 1FYCA 1JQYD 1X66A 5AKLA 3KKAC 1ET6A 3M4YA 3CCSA 1ZEQX 2VA2A 3WWVA 1PV4A 4NWIA 2PPBC 1SMYC 3CCMA 1T94A 2ZXOA 1IKMA 1X6OA 3RUZA 5DBBA 1WUDA 4AIMA 1Q3UA 1ZQCA 1L2FA 3G4SA 2HUGA 5AM3A 1L3UA 1D6EC 5DLQE 2PQAA 3GTGB 1T8EA 1UE1A 2MP1A 4ME3A 3S2DB 5KAFU 2H3FA 5BN3A 5KFNA 4YR3A 3PO2G 4N8FA 1PK1A 3A8IE 1ZQMA 2KHIA 4GN5A 3CCEA 1MJEA 4QQBX 1RQNA 2I6XA 1ZQJA 5IYCH 2E2JB 2VS1A 1ZXIA 4P73A 1ZQXA 3S1NH 3BYTB 7ICVA 2JZBB 3ZD9A 3ZDDA 4F5PA 2EIFA 8ICEA 2HHUA 1TIID 3ULPA 1PTOH 1C7YA 5IGBA 2K32A 4PMBA 1PTOC 5HMLA 5KL8B 3F2BA 3TN2A 5E1FA 5M3MB 5DB8A 1B9MA 1EL0A 4DL7A 1ZQTA 1PH1A 2JV3A 3BS7A 4KLHA 2AQ1B 1U4LA 2K5WA 1PUZA 4TQUS 4Y2JA 2MGSA 5AK3A 1TS5A 1FNWA 1K28A 2YMMA 5KIXA 1HTLD 1KDAA 1VQEA 4NV0A 1X3EA 3DEOA 5EQ0A 1EYGA 4FF3A 4HN7A 4DOBA 3Q8SB 1SLJA 2L1BA 3H0MB 4DWIA 4JI6Q 1MC8A 1KC8C 2QARB 5KFKA 4QWAA 2F76X 1AE3A 4RNNA 3NBHA 1KBUA 5J2DA 3K5OA 1SZHA 2H3VA 3PSPA 3NUQA 2EAOA 1TWGB 1N34L 1U45A 3C2KA 3GTGH 1SN8A 4JVZA 1EOTA 5DB6A 1SGGA 5AM4A 4AYBF 4DV3L 2P6RA 4V190 4RMFA 1WWVA 1T5XD 3SQIA 1COKA 5HY6A 3RZDB 2DJGC 4HJ7A 9ICUA 3CMEA 1YNJD 4IOCA 2R92G 4JI2Q 4XQQA 3QZ7A 3MFYA 3URYA 1KQQA 5C4HA 1SZPA 2E2JH 2K4EA 5C44B 1G91A 2CPRA 4O3PA 5J0UA 4KY6A 5JU5A 1X9WA 4ZLTF 1T7PA 5FLXc 3KDFA 5M3MH 1FVIA 1SNCA 3B0XA 1X6IA 4BDPA 2ENBA 1O7ZA 1S9FA 3J81c 1HR0L 3PO3G 2QEXA 3O13A 4M1UB 3STBD 4XA5A 1R4PB 3B0YA 3F5EA 3SGIA 1BBUA 4IUUA 2JA5G 3QUBA 4JV2A 5J8YC 2Y1JA 3SK5A 1ZQHA 1OXXK 3K5MA 4M8AA 1T5EA 2CHBD 3P20A 1YITA 1KQSA 4JI1Q 2GA4B 1GM5A 7ICLA 1SSOA 2EYFA 3I91A 4EEYA 3G6EA 4PNYA 1M4VA 3K4GA 1G6ZA 4K6DA 1SL0A 2VZAA 3I70A 4KN4A 5ALNA 4K4GA 4QWDA 4DUYQ 5J3BA 1UT8A 5LL6S 5KAIU 2L11A 4F92B 3M7GA 4A3LH 1A0PA 2RA4A 2AMCB 4MEYA 4RGMA 3AYHB 5E4WC 3PO2B 3SV4A 5JVG3 4UAWA 4Q8EA 1EIGA 3EN2A 3HKSA 2ZTDA 1CSPA 3W2DA 3MBYA 1NJYA 5M9OA 3MGVA 2E5SA 2E74C 3IG5A 2BQUA 4IJHA 3TP6A 5F9NA 2ZIXB 4UAUA 2F0KA 4U68A 2OCEA 1YNND 2PCFB 3QU7A 4IL6U 1N2XA 1CFMA 2PW7A 4Q0FA 2BR0A 1EQTA 1X9XA 1MSHA 4EGVA 3AQQA 1BQQT 1CKNA 3M85A 1DOQA 4QGUA 2HHTA 2BPFA 2CH4W 2YV5A 4N8X1 4NLGA 4F4YA 5CRXA 1Y1VH 2Z0SA 1J5EL 3RZOH 1SKRA 1OUQA 3VR3A 3CQZH 1PVPA 1F9SA 1M8AA 1I50H 4US8A 1Q86C 4R4CA 4H44C 2H4OA 3NEMA 4I2HA 2I0QA 4KKUA 3HW8A 2WB1G 3RH5A 1QUQA 2Z4HA 5HR6A 3M9NB 1B53A 5KFCA 5H2FU 1FIQA 5JVH3 2A5HA 5DG9A 3TMEA 1WWUA 4IRKA 3I72A 4R64A 5EE3A 1U4BA 1RYSA 4P0QB 3EZ5A 8ICJA 2KVCA 2NZOA 1LM0A 2DPIA 2W11A 8ICKA 4A3FG 1TXYA 4JV5Q 3IAYA 4RG1A 2R92B 2F3IA 2SNMA 1N33Q 3EROA 7ICJA 3MFIA 3VCBA 1PZKD 5ALZA 4IJLA 5HGQA 2DWQA 3L5KA 8ICYA 3BDOA 5L1KA 1K9MC 2RQXA 2Q8TA 4DSEA 4FNFA 1VQGA 2Q0ZX 1B8AA 3F1ZA 2SDFA 5DEHA 5GAEC 3JAMc 2G09A 1KAWA 3PO4A 3PO3B 5GTHU 4FZNA 4IFDH 2MUYA 4KTAA 2XVSA 5KFGA 3S2HH 3ITPA 4KV6A 3PGZA 4RQ6A 1VQ8A 2JA5B 4Z6DA 1EZ8A 3JPRA 2Z8LA 5KGUA 2G07A 3G71A 1BDOA 3Q23A 4CF4A 5KFXA 2K50A 3E5SA 4OJPA 1VQJA 4DUZQ 1R9TB 1O08A 4PG3A 1BPEA 2V9WA 3UDXA 2ZIWA 3C2PA 4TUSA 1XS9D 2VUMH 2DGZA 5KFQA 5IILA 5FJ8H 2NBFA 3MA2B 4JK1A 5J0OA 2WAQG 3AUOA 4P4MA 2EJGC 1EY8A 4UQGA 4J03A 3C23A 4DSIA 3VYUA 2RDGA 3I90A 2UXBQ 5IP7H 4GN3B 3PQIA 3BDLA 5IE8A 4Q43A 2F0WA 1IIPA 4ED6A 3NE5B 5JOBA 4EQOA 1VQHA 1BOSA 2KTQA 4ECZA 2M9NA 3T5HA 1HQMC 4KLJA 3OMCA 3VYTA 4FBUA 4C0ZA 1RM6C 2XIDA 2F4IA 4K5VA 2C9OA 1B7YB 1EWHA 3SR1A 4DK3C 3S17H 4NPSA 4EQNA 4JBMA 3ZDCA 2EJMA 2VJ5A 1U5KA 3VYSA 4YVZA 1KTQA 3TANA 2F1JA 4F5OA 1B3QA 1D5MC 1B1ZA 4QZDA 3PY8A 4LWCA 5IYBH 2HHHL 2VA3A 3DDHA 3S6JA 2HHXA 2EVBA 2R7FA 4G4KA 1R9TH 2ZUDA 3OHAA 2AU0A 8ICOA 2F0JA 4LNQA 3CP8A 5GROA 5AI0A 3WK7A 1U9LA 4LMQD 2ZG6A 4PZNA 3CCQA 2PXIA 4I2FA 4XQ8A 3KBBA 1AZPA 3ICEA 4ECVA 2F0IA 1EQRA 4OGQC 4UAIA 2E3TA 1MIUA 1I4XA 2W03A 3BQ7A 1ZRMA 1TWCB 1SE3A 4HIDA 1EIHA 2XGQA 1VQ4A 1GVPA 3H6MA 4LZDA 4RQMA 2B2YA 4IFDI 3UXPA 4J9PA 4F50A 2ASDA 8ICQA 3MGIA 4A3FB 1JOQA 4CKCA 3JPOA 4YWLA 2TMPA 4UARA 4F71A 3I4MG 3L0OA 1PH8A 4IUTA 1MN8A 3RBDA 3H0GB 4UAZA 3Q8MA 1HZAA 3C1YA 1D8YA 5DM73 4QIWB 5IWAQ 1MJCA 3EVQA 3BQ2A 1CHQD 1VQDA 5IP9H 2DGYA 2R8IA 2RBMA 1V97A 3E6ZX 2FPLA 4CBVA 3S9WA 1SFOB 2UVWA 2PQAB 2JEBI 1L0YB 1VDZA 2BQ3A 4LVSA 1ZOLA 4NLKA 2HD3A 1PK1B 3GD7A 1WG8A 1VQPA 4BY7G 2XY7A 1PFSA 3Q8RB 2ASLA 2VB2X 1SNPA 4PJ0U 2D0PA 4RQ0A 4YP3A 3QR8A 4KLOA 4OO1J 1SYGA 2F3WA 3HJEA 3H94A 2VW9A 2CCZA 2F1MA 1S8OA 1JOOA 2R7ZH 2IPKD 5KG0A 4ED1A 4DR6L 3O0FA 1KRSA 4YD1A 2W9BA 1RIPA 2F0LA 3GQBA 5IT9L 4AYBC 2WAQB 4X62L 1YJWA 1NKCA 1LVHA 1KXLA 3NBIA 1VJ5A 3QOJA 2W9CA 3PR4A 4JI0L 3UE1A 4A3FH 4FE3A 4F4ZA 1Z00A 2Q4TA 2QKQA 4Y2XA 3M6ZA 4DFDA 2WINB 3NELA 4K8JA 1J5EQ 2UVUA 2NRXA 1A6XA 3H0GH 5CBEE 5AK6A 2X6LA 4TUQA 2FJ6A 3NBHB 4Z6CA 3HEJA 2KIVA 1KKXA 4QIWC 4Y2YA 7ICRA 5BOMA 1HQRD 4OIKA 5T1IA 4CJ0B 1XO1A 2JA6G 2FLNA 3H8WA 4KX5A 2YYZA 3D31A 5NUCA 2D62A 5KG1A 3KFUA 4RA8A 2FFKB 1DOMA 4X3TA 3K59A 2ZXHA 4KLMA 4P2CB 2J6SA 2QILA 1VQMA 5L1LA 4XQJA 4K4HA 3A0HU 3M8RA 1EYAA 1SJHD 4LF5L 1Y69U 1BPYA 2GVAA 2OHFA 4DFJA 3NK9A 4QY7A 4CKEA 1Y1WH 1KD1C 1ZRNA 9ICQA 5D14A 5K5PA 5KEEA 5DG7A 1V1QA 1HTPA 1RG6A 2KG5A 4M04A 2KCMA 2ZUCA 5GTIU 3RBEA 4I2IA 1CQVA 4FDBA 2RDJA 3HOWB 2PMZB 2VQEL 9ICFA 1RL2A 4LUVA 4O3QA 2Y0SC 4FZLA 2IWHA 5ELEA 2JJQA 4X66L 2AGPA 3GTPH 3I4MB 2RHFA 2ZJAA 4ECXA 1TY2A 3FRPB 3NWSA 3X3NA 4XXEA 2E1EA 2HIXA 3M4PA 1OW5A 3WKCA 2EH9A 5KFJA 4DV4L 2FPMA 5J0YA 4O3SA 3H8MA 2KFNA 2K52A 3Q8DA 5AJ3L 3C1ZA 3RF9A 4DV1L 4FS1A 1E22A 4M9LA 2DNCA 3N52A 1H9MA 4YWKA 1PH7A 2AWNA 2RDFA 4IOAA 1QSSA 2BDUA 3RTVA 1SKWA 2BHNA 1WYGA 4BY7B 1NJIC 4PHDA 3MABA 3A55A 3HOZG 2JYOA 4L63B 3TADA 2VANA 3F53A 2GOLA 5KFUA 2B2VA 4B9LA 2KSOA 1Z6HA 3PF4A 1LTAD 4BXXG 1CRXA 3NP8A 3NPPA 3NUCA 1ZD5A 4UBBA 2N49A 4OL7A 3GV7B 4GOPA 2JXJA 1ESRA 2PI2E 2HBKA 1QZGA 8ICMA 5CV5A 3NTKA 2JEAI 2G5IB 2KECA 3I1YA 2KHSA 4DXGA 3Q22A 3BS5A 4ED7A 3HOWH 3GQCA 4IALA 2PMZC 4Y2TA 2J6UA 2L12A 2DL0A 2N78A 2NWGA 3H91A 3VR6A 2EYHA 3J7AF 5JUMA 4DKAC 2LKYA 4PHPA 4UBCA 2XCAA 4LFAL 3UDIA 3TEHB 1WI5A 3ERQA 4JBKA 2HBLA 3MZ5A 5KFIA 3OMGA 2ZIVA 4JI3L 3M7NA 4KN4C 5CP2A 1TWHB 3GDEA 5T1GA 1WCMB 9ICNA 1WTPA 4OIJA 5ELNA 1HUMA 5J8YA 3PNCA 2JA6B 4QZFA 1QE6A 1Z1VA 4LAAA 4EX7A 5IOCA 3NGDA 5D65A 1RTNA 1OXJA 5K36H 4F7XA 3NQIA 1FFUA 5J2IA 1BO0A 4ECYA 4DK0A 4A3EH 2CKZB 4BY7H 4NKLA 1ILQA 3T51B 4RQ7A 2WKDA 4IUPA 1XNQQ 1A63A 3EWAA 5DNFA 1NK8A 1GOZA 2ZUBA 2OWOA 2B8FA 4IQUA 3SK8A 3WKDA 4DR3Q 3OTOL 2C22A 2JQOA 4NL9C 4JI5Q 1ZYQA 5KFZA 1BNPA 2F0TA 4BGDA 2IHFA 3S15B 1IYVA 4LF7Q 1A3TA 3PUXA 2HW3A 2F44A 1J6QA 2LFNA 1ICWA 3D6JA 7ICHA 4AQYL 5DKWA 1OXSC 3R93A 3ZDBA 3RN2A 1XNRL 1A0IA 2UUAL 1CI3M 4CDCC 3FM9A 5G3LD 1UNSA 1ED1A 4PHEA 2XC9A 7ICTA 5L1IA 2FLPA 2E2DC 3DM3A 2KZ3A 7ICSA 2MUTA 2J0TD 1URJA 2JXMB 1SE8A 1WCMH 3AFPA 2A73B 4CJ2C 4F5RA 2KHJA 3QU4A 5AM2A 1ZQGA 2NN6H 3M8SA 3RJKA 3CPFA 3VR2A 5GAGC 2NRTA 2O2LD 7ICMA 1NMFA 3OW7A 4A3IH 2LYAA 3ISBA 2BPCA 2KE7A 4J9LA 2CWAA 4AYBE 4KLEA 4HR7B 5CV8A 4JI0Q 1ZQRA 2DNEA 1SWVA 2G0AA 4C3HH 3HOZB 1QQ6A 4A3MG 5FP0A 4F8RA 1S5LU 3RAQA 1L1OA 2LBOA 2XY6A 3T3FA 1NK4A 1DOKA 2ES2A 3S15H 2V4DA 4R8IA 4NXMQ 5KT6A 1QVFA 1EIFA 5EWFA 1SYCA 2K5HA 3GV8B 3I4LA 4WORA 1D7QA 4KLQA 4DCCA 3V05A 4QIWE 4QZ8A 2K04A 9ICAA 1TK5A 1PH2A 1EFWA 4I7ZC 5CV9A 3ZJYC 4GXKA 4KY5A 5IINA 5AKKA 4NM2A 7ICOA 1LACA 2XGPA 2EZXA 2MFIA 3A8KE 2YU9B 2H3ZA 2ZIUA 3A5UA 5AK5A 1NSNS 1KIXA 1SE2A 4RGOS 5C0XI 5M5WB 1CM9A 4Y7NB 1ZJNA 3NTUA 2W9AA 4DR2L 5GQOA 4GLAC 2KENA 5KT2A 4JK1C 3N28A 2PFNA 3A7AB 2EYPA 2SNSA 1PZJD 3SENA 3M4OB 4UPAA 4DV2Q 4JI6L 5KFDA 3W3AA 5IIJA 1GJXA 1JE4A 2WHEA 2C2EA 5IYCG 4X64Q 1PA6A 3ONNA 1F2ZA 4FO6A 4KLLA 2QGQA 2TSSA 1JN3A 3CCRA 4IS7A 3RLOA 3EUB2 4TQSA 1SE4A 4RZRA 2PO4A 2PZTA 3T1HL 4OO1H 2KZZA 3BYYB 3LWLA 3SMVA 1VQOA 1L7NA 2LS01 9ICVA 4B3SL 1GD7A 5C5MA 4HIMA 4X66Q 5D49A 9ICIA 1Z3EB 1H9SA 2DF4B 1ZQOA 1LTTD 5GAHC 3KJOA 4I2AA 2Y0SE 5E7NA 4JI2L 4DV4Q 2DUDA 1WD1A 5AM0A 1S5ED 2K05A 1X32A 1EUJA 2PKEA 5AJ3Q 4YXJA 1JX4A 1MKHA 1SL1A 5IT9c 1LUZA 4DV1Q 2FMPA 5C0YA 4WJWA 1JI7A 2PFQA 4M6WA 2KJ8A 3IP4B 3L4PA 2NN6I 4PZ6A 4K5XA 3GTMB 3U50C 4UB8U 3KF8A 2FMQA 3B9JA 2LMRA 3T5KA 5M5WH 3OTQA 1S5BD 3JPSA 5AIAA 2JEGA 1QCBD 1BVSA 5KFOA 4MFCA 2KKVA 1NCVA 1WJJA 2FHTA 3M4QA 4HMIA 1L3TA 4C1NK 1C4QA 4UHVA 1M1KC 3RJJA 3PIPA 1A62A 2W9CB 3QUTA 1W6KA 4TQRA 4ME5A 4RUAA 2MJ8A 3PV0A 3CF5A 2B2YC 4JYAL 2K4PA 5KFTA 3D4DA 3V6KA 9ICJA 2F1HA 5L9XA 2A69D 4R4TA 4KY7A 4YMNA 2RP5A 2Z6KA 4ZUIA 5M3MG 4DUYL 2IA6A 4M47A 1TKWB 4YR2A 4BWGB 3A54A 3PIOA 1ZQ1C 4A3MB 3SK4A 4IFDJ 1ZETA 2P66A 3N7RC 5HR7A 4LFAQ 9ICWA 1L0WA 1QZHA 4JI3Q 4RWSC 2VIXA 4YG2A 5AKEA 1NTGA 3WOEA 2R61A 3IL8A 4EX6A 4O5CA 2ZXRA 4QUFA 3RB0A 1EU4A 4HIOA 3WKAA 1PK3A 3CYMA 3HRDD 5ALGA 3GTMH 1NZPA 2KBNA 1ZQNA 3K5LA 5JEAH 5FLXE 1LV5A 3UMGA 2ES6A 4DOCA 1D5XC 2J7ZA 4O2DA 3EA6A 2NRWA 5KT4A 3HP6A 4IRDA 4ED3A 2RVLA 3A0BU 3B6YA 4OHJA 1K5OA 4UAYA 1SNDA 1UA1A 4A3LG 4LJXA 1HFNA 1TVXA 2G9DA 4RNOA 1YBYA 1MQ3A 1S77D 1BCPB 5GADC 1SMYD 2A74C 4ED8A 3FMCA 1XMOL 3Q8KA 3FEWX 4HYKA 1EXNA 1ZQIA 4BXOA 2F0VA 2XCPA 1EY4A 1HCZA 2NVTH 1CEZA 4DGZA 4JCVE 2JSOA 2OTLA 3S1NB 8ICWA 3BJUA 3AL0B 3NQTA 3RLFA 4Y52H 1ASYA 3U9OA 3RMHA 1PTOB 1Y8PB 1A77A 5DDMA 1B44D 3CU7A 3THVA 1BUVT 2RKSA 2RHSB 1E0BA 2G08A 3NTIA 2KEDA 2R8JA 3FAHA 4CF5A 5M3FH 2PZWA 4RH6A 5CHGA 4YXMA 1P16A 1Y1VG 1N33L 2LHTA 3AMUA 3H8SA 4M9GA 4X65L 4ZAIA 2KD1A 3LWUA 4EQ5A 2OT2A 5KG6A 1QILA 1JB3A 4FVMA 4J15A 3PVXA 1PTOD 8ICGA 2KCCA 3J80L 2OEHA 4OXPA 4O0AA 4POGA 1ZQUA 3HOUB 1KSPA 2JA7H 4PV1C 2FPKA 1RJTA 2J4XA 1GHJA 3BDCA 2KSOB 9ICEA 1NAPA 2LYHA 1VQKA 2AQ2B 4TRDA 3CXCA 4KHVA 4Y2SA 2E1FA 1TWFH 4DUZL 3TQYA 1F5SA 1IG6A 1BCPC 4RPZA 4B3ML 4YMMA 3M3YB 3CRXA 2N3SA 4DU9A 5J39A 4IO9A 4RNMA 5L1MA 1XSPA 3JPTA 1TS2A 2OM6A 1V1PB 1IW7C 4O3OA 4LFCL 3HILA 2UXBL 1TY0A 4BY1H 3T1YL 4IFDG 5KFSA 3K57A 1Q3VA 4O3MA 4B9NA 1BGXT 4K4IA 4CGZA 4FF2A 1UQVA 1D2BA 3CCVA 1EOVA 4DR2Q 1AFPA 1L3SA 3L9AX 4L5RC 2W04A 4EBCA 8ICTA 4MN3A 2EYLA 1ZQVA 1ZKOA 2ICEC 2UU9Q 1K0SA 3EPGA 1STYA 3EFXD 4CDEC 3HOUH 4Z6EA 4M0AA 5TISU 3SVMA 1EIYB 4B3RQ 3MFGA 2VUMG 4KN7A 3TADC 3P1HA 2BCQA 4LK1C 1U49A 5EKKA 2B2VC 5FJ8G 2P6UA 1Q7YC 1DJRD 3PCOB 5EBDA 1CT1D 2IL8A 3GO5A 2XICA 4DSKA 1KNAA 1NJZA 1I5FA 3BVGA 2HHWA 5DQHA 2C2RA 4UP7A 3T1HQ 5ALJA 1JMCA 2LSSA 4R66A 3BVMA 5IP7G 1K73C 1QTMA 4GOPC 1B4FA 4B3SQ 1I4PA 2D5DA 2V1CC 1HNXL 2JN4A 2ZTCA 2RDHA 1A8VA 1CSQA