2ZTEA

Mtruva form iv
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
133
structure length
133
Chain Sequence
EFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
total genus 27
structure length 133
sequence length 133
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2zteA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zteA01
8ICEA 2NVYH 4B9SA 4JV5Q 2PI2A 1U5KA 3T1HQ 2PFQA 4B3MQ 3TARA 5KTQA 1VQBA 4YG2A 1AE2A 3PIOA 1OTCA 5KFFA 1COOA 1L1OA 3TAQA 4JV0A 3JPRA 1RXVA 1ZQKA 2F4VQ 3H4BA 1NE3A 4JBWA 2XO7A 1EXNA 2WB1G 4X66Q 3H8WA 5LMNQ 3PF4A 3CQZH 3HOVG 5C3EG 1UA0A 4R66A 3LDAA 3U4ZA 4IQVA 3ETLA 5DG7A 2VA2A 1OXXK 4HJ5A 4A4IA 2VUMH 1BKBA 2BHNA 2NRTA 4K0KL 1XWLA 1H95A 3PY8A 5C0XI 4C8MA 4M0AA 3OGUA 2CCZA 1QZHA 3C23A 4DSLA 4I2HA 1YBYA 3THVA 3HFZB 1I50H 3JPQA 5CP2A 2A1JA 4PZ8A 3AQQA 1GD7A 2PFNA 1IZ6A 2KCMA 4IRKA 2ASDA 4ECQA 5D4BA 5IP9G 2RDIA 3GD7A 2Q2UA 2R8JA 1SROA 3PGZA 4UB3A 1QVGA 4RPXA 3J81i 1XS9D 1UWVA 3M8RA 2BH8A 2JA5G 3FKIH 5E7NA 3OJSA 5DQIA 7ICGA 2D0OA 4FBTA 5IYBG 4F2RA 3C5FA 5EWGA 3RR7A 1VQOA 1SKRA 4KLHA 9ICQA 2HT1A 1S76D 4A76A 3LK9A 4C8OA 2KFNA 3CF5A 3HOYG 4KN4A 3IRBA 4J9MA 2FLNA 2K52A 3GTOH 4DV4Q 4Z6EA 1Z47A 3PW0A 4A3KG 1L0WA 3T5HA 1QSYA 4JV1A 2KFZA 2HHTA 3ZDEA 3RH6A 5IIOA 5HP4A 3I7FA 3J80i 4AIMA 5C3EH 4RQ6A 4DR7L 3RLOA 4YR3A 2Q2TA 5DBBA 5KT2A 4RZRA 3K7UC 4PGQA 2WTFA 3EYZA 3U4VA 4ECUA 4P75A 1A0IA 3EIVA 2ASLA 5DDMA 4R63A 3H0GG 3EN2A 5KFTA 1L3VA 1EYGA 3W5OA 3GTQH 1HUOA 3RBDA 4J9PA 4DK6C 1SLJA 3CC7A 4NLNA 2C28A 3UXOA 4I27A 5M3MG 3M9MB 5J2EA 5GROA 5J0TA 4RQ1A 1Y88A 1PHJA 4X64Q 4GNXA 3CXCA 2XY7A 2IA6A 5IP9H 4ELTA 4BXOA 1HZAA 4OWTB 1N56A 1TK0A 3RJEA 5IWAL 1LTLA 4PZ7A 4RG1A 1XMOL 2JA5H 1JXLA 2KHIA 1KRPA 4B9NA 2I5MX 4A3EG 3S2HH 5IYBH 4DOBA 3OTOQ 4ED2A 4I29A 2J6SA 4QZEA 2LSSA 1NK8A 2JA8G 2JA6G 1PFSA 1NK7A 3HOYH 7ICMA 3FYHA 2UXDQ 8ICRA 3PW7A 4IRCA 3C1YA 4A3KH 3MBYA 4DSFA 2HVIA 3GDXA 1NMFA 4HJ7A 1NK4A 3W1GA 4K4GA 1NK6A 1IBKL 4POGA 3STBD 4Y7NH 4JI6Q 1W3SA 2VA8A 3CC2A 1A63A 2HVHA 5KFJA 3GTKH 2HHHQ 1ZQRA 4B9LA 5D46A 5BR8Q 1Y1WG 1GKHA 2PQAB 3UXPA 2ATLA 4BGDA 4IQUA 3CD6A 1KQSA 5IIIA 3UE1A 4GS3A 2MUTB 9ICLA 4A75A 1NK0A 5M3MH 4QWEA 3W1BA 4Q43A 2KTQA 3ISDA 2PI5A 1N34Q 3Q8QB 2AHOB 1ASZA 2CWPA 4UQGA 3Q8RB 1ZQMA 1IBMQ 4YR2A 4F91B 5J2FA 5KFRA 1WYDA 2UUAL 1H38A 4UB1A 8ICBA 5EWEA 1JB7A 1G6PA 3MDCA 4PGXA 1ZQOA 5M5XH 1KTQA 1BBUA 4A3EH 4KLTA 5C0XJ 2ES2A 2R6GA 2GWSA 4ECZA 4A3GG 3BZKA 1FVIA 1ZQLA 2Y1JA 3JPNA 4O9MA 1KFSA 2JA8H 2JZBB 1PVOA 3HOZG 1KEJA 4B9TA 4UAYA 1SL0A 4GN3B 1N36Q 9ICNA 3GIJA 2E8GA 1SL1A 1RXWA 8ICAA 8ICTA 3J7A5 1HNXQ 2ZJRA 3C21A 4I28A 1JMSA 3PW4A 3PNCA 4F4YA 1X9NA 1Q1EA 3M9BA 3PO5A 4XIGS 5KFVA 5BOLA 3BQ0A 3UE0A 4PHDA 3HOUH 1S40A 1L2FA 8ICJA 1Y1WH 4NLKA 4OX9Q 3EZ5A 4JYAL 3JPOA 2BCVA 2NRZA 1UE6A 1EIYB 4GLAC 9ICIA 1N33L 3UDXA 1WOCA 1JT8A 4DL6A 3PMLA 5JEAG 3SGIA 1D8YA 3ER0A 5J29A 3RLNA 3N4MB 5IYCG 2K4KA 4QWAA 8ICMA 1ZQHA 4DV1L 1N32Q 3STBC 1V9PA 4TUSA 1ASYA 1U48A 4ZH4A 5KFSA 1HR0W 4IJHA 3KHLA 1CKNB 4ELUA 1QUQA 4PGYA 3RN5A 1IBLQ 3HKSA 4DS5A 4M9JA 3QZ7A 1XSLA 5IYDG 3HOZH 5KT5A 2AGOA 4A3IG 4YHHL 1NOMA 2V4QA 2V4RA 3KF6B 1YIJA 4DKAC 1NJWA 1X6OA 4LFCL 3CCVA 3SZ2A 3KDFB 1XMQL 4F5QA 2KN7A 4YVZA 1TK8A 3RH5A 3KLWA 5JEAJ 1Z00A 4X6AH 2P6UA 2WAQG 1PA6A 2MQHA 2E2JH 1LM0A 4NPSA 3CMAA 9ICCA 1M1KC 4KHPL 3SYZA 1Z9FA 2ZJAA 3M9OB 4M47A 1R9TH 4RQ7A 4LF8L 2IBKA 4JBMA 3RB0A 4HJAA 4KLEA 2Q2IA 2Q2HA 1ZJNA 1VCIA 2VQFL 2LXJA 4ECWA 5IYCH 4QJFA 1Q82C 3B0XA 1I6HH 3BDPA 1WJJA 1YHBA 5HMLA 1X9MA 4DSIA 5J2AA 4DV0Q 4YCVA 4ECVA 4GXJA 5L1KA 4NXNL 1SKSA 1XNQQ 1X56A 2YV5A 4A3BG 1ZQGA 3PUZA 3F2DA 1O7IA 1KLNA 3HW8A 1VQHA 4O0IA 4NM2A 3RB6A 4A3IH 4A93G 3PIPA 3HOWH 3HKZE 5J0OA 1HNZL 1SRUA 3TS2A 3KJPA 3H15A 5EOZA 3UDFA 4DV2Q 4B3TQ 4JI8Q 4RT3A 1NK5A 1AE3A 4YWMA 3GTGH 3PV8A 2BDPA 3KOJA 2IMWP 3QEBZ 1Y14B 2UUBL 1NY4A 4RT2A 3BZCA 5IT9c 5M5WH 5IIJA 2E5LL 2NN6I 4DFJA 1VS0A 2RHSB 1FGUA 4ECXA 1TK5A 4UAWA 4X65L 4Q44A 3J81c 2DPIA 3G4SA 4FS1A 3H7IA 2F3IA 2V1CC 5GAGC 1XPOA 2IHNA 5J2HA 1U49A 4DV3L 3NENA 2VANA 3N97B 2OWOA 2C22A 5TZVA 4RUCA 4LF5Q 4LF7L 4A3MH 5KG1A 1VQDA 4IFDJ 1ZQEA 2P6RA 2VQEL 1NJIC 4DNIA 1HR0L 3NGDA 3BQTA 3K75D 5GQOA 3KTQA 5J0UA 2H5XA 4A3BH 3C2KA 3PR4A 3J80c 1GM5A 5ELOA 2MO1A 1AROP 3I2ZA 1B70B 2VY3A 4A93H 1IXRA 2AJQA 3RJHA 1K8GA 4DO9A 2K75A 3T5LA 3RB4A 4DR6Q 4YMNA 1RZTA 2AQ4A 3M4PA 3RB3A 2FPLA 1OXTA 1HUZA 1TWCH 4YY3L 5GAEC 4NXMQ 4FS2A 3G71A 3MDAA 4I2CA 5HHIA 3OSNA 7ICNA 5DGAA 4DR5Q 4I2FA 2DGYA 3KHRA 2IX0A 4X66L 4JI2L 4H02A 1Q1BA 9ICUA 2NVTH 3GV7B 1HH2P 5LMUL 1YZ6A 1SE8A 4OWWB 1EQQA 1TWGH 5IIKA 3ORYA 2UU9Q 4YD1A 4HIMA 7ICUA 3ZD8A 1YITA 1MJCA 1BPZA 2KZMA 1TXYA 5KG3A 3VDYA 4LFAL 3MGIA 2NVQH 3OJUA 1KRTA 5KFDA 1RPLA 1TAUA 3CCUA 1VQIA 5DKWA 2W9CA 5KFOA 9ICHA 1L3SA 3M8SA 1V43A 4GN5A 4IOAA 4J9NA 4GLVB 2UXCQ 4DWIA 3DM3A 4MEXA 2DUDA 1PH3A 1UA1A 4QWBA 4YP3A 1OXSC 4P4OA 4R4CA 1JXEA 1TWAH 4XA5A 2JA9A 4DV7L 4C2MH 4XUSA 1PYBA 4BY1G 4MFAA 4DUZL 4O5CA 4EBEA 5EAYA 4DV6L 2BGWA 1VQ8A 5IY0A 4BXXG 4DK3C 3QZ8A 3Q8PB 4LFBL 1YVCA 5F9LA 1NJXA 2IHMA 2YU9H 4JOIC 2F52A 4Q8EA 1YNXA 1MJEA 4ED7A 4I2EA 1X55A 2Y0SG 1K3RA 3PUWA 2I9GA 4IPHA 4YD2A 2OQKA 1KAWA 2B21A 1KD1C 1SR3A 1S10A 4ALPA 4ME3A 3JPSA 3KHGA 1X9WA 3PVXA 4A3CG 4DAYB 1XNRQ 5J0XA 4IPDA 4KLFA 9ICGA 4JI3Q 2PXIA 3L2PA 1ZQZA 2R8HA 5DQHA 4FBUA 1P16A 5J2DA 3TQ1A 1B7YB 5DG8A 3M4QA 2C2EA 4KLGA 9ICEA 1L1OB 4TQUS 3Q8DA 2DPJA 1HZCA 3ERSX 4J9KA 4FO6A 3KJOA 2JEJA 2HHUA 1UT5A 1SFOH 4DQIA 4YXJA 2E2IH 1ZETA 3HP6A 4C8KA 4O5KA 1NBWA 2XTIA 4PG3A 1W2BA 2IX1A 4GLXA 4BY1H 4O3SA 1VQ4A 2RF4A 3OTOL 2N3SA 7ICEA 4BXXH 1NK9A 5KFLA 2W9AA 1I94L 4JI0Q 4EZ6A 2BKEA 1ZQVA 4O3NA 4F92B 9ICPA 2ZTEA 1L1OC 2UXDL 2ZJ5A 1ZQIA 4F3OA 4LF4Q 3ZDBA 4YMMA 3E2EA 4ELVA 4O2DA 5KFPA 2ZTCA 3U50C 1A62A 4MNOA 3C1ZA 1RYRA 4IQWA 8ICPA 1X2IA 5M5YH 4YQWA 4Q45A 2R8KA 1IYJB 3RJJA 3AU6A 3V6JA 1CEZA 4A3CH 1K8AC 2XCAA 5KT7A 3MR5A 4DFPA 1C7YA 3HOVH 5DQGA 5J2GA 4Q8FA 2HHHL 3S16H 4TUQA 2PI2E 3S1MH 4GOPA 4OO1G 3PW2A 2W9BB 1ZQDA 1I5FA 4PHEA 1TAQA 1PH7A 1JMCA 4NB3A 2P66A 2PNHA 8ICVA 4A3FG 1N34L 4RNNA 4ED8A 4O3RA 2JQOA 4IPGA 2PFOA 4JV2A 3S14H 2V9WA 4JK1A 3H3VH 4EBDA 4UAZA 5KFMA 4B3RQ 3CCRA 4BBRG 4QIWE 1QTMA 2EQSA 4GC6A 4NLZA 4UB5A 4LUZA 2JJQA 4YR0A 4DAMA 4LF9Q 1JIHA 4BY7G 4DSEA 3V72A 4MTNA 4DQQA 4DQRA 1MIUA 1N36L 4QZ9A 2Q0ZX 5M3FG 2C2DA 1HNWL 4RMFA 1HNXL 1C0AA 2KHJA 4BA2I 4YWKA 4G3IA 2OQ0A 4LZDA 1A77A 3Q8SB 1Q7YC 5L9XA 5CWRA 5C0XG 4B9UA 1JJGA 4OX9L 4WJ4A 2B63G 1S3OA 4C3HH 2UVWA 4KITB 4I2BA 3GV8B 9ICVA 3H0GH 4EZ9A 8ICOA 4F4WA 9ICBA 1TWHH 2PQAA 4NXZA 4JWNA 4LW1A 2MUTA 4A3FH 2XGTA 4TURA 4GNXC 2K50A 3A0JA 4DOAA 3TANA 3EBEA 3S1QH 1DOQA 2FPKA 2OCEA 4JI4L 1NKBA 3H8JA 4P4PA 4DR7Q 1PH5A 2BH2A 5CB1A 4BBRH 3AFQA 5DG9A 4MF2A 1K83H 5JJIA 4AQYQ 1YI2A 4DEZA 1IBLL 3PMNA 1PZNA 4I2JA 4F2SA 3L7ZC 1BPEA 2ASJA 3U58A 4UP8A 3TEHB 2ALYB 2JA6H 3PX6A 1L5UA 4DV5L 1YHAA 5M3FH 1VQNA 4AYBE 2AQ0A 2HIVA 4F5NA 3LGJA 4BBSG 2NRWA 4OXPA 5KFZA 1TVAA 4IR1A 4PMWA 3RTVA 1ZJMA 5KFNA 7ICIA 9ICRA 4L5SA 3V7JA 3TI0A 1OXUA 2ZM6Q 7ICJA 1BBWA 4M2YA 4KI0A 4GN4B 4P72A 1XTDA 4QW9A 3K80C 2GN5A 2UXBL 1CSPA 3T3FA 5DB6A 4WJ3M 4KLOA 3ULJA 4DV0L 4ED0A 4KLDA 3EW9A 1IBKQ 9ICOA 4C8LA 4KHZA 4PZ6A 5J3BA 4O0AA 2UUCL 1BPDA 2BQUA 4AH6A 1ZQWA 4R8UB 5J0SA 1VQ5A 4LUVA 3RR5A 4DUYQ 2HHWA 2Z6KA 1Y1VG 1BVSA 1CKOA 4A3JG 4R1JA 8ICXA 1NJZA 4DR3L 1ZQCA 4X62L 8ICYA 3ZD9A 4A3GH 1T7PA 2B3GA 3F8TA 4IPCA 1VQAA 3IM1A 7ICHA 3G6YA 7ICPA 2ALZA 4JI8L 3PO4A 3BQ2A 4DR4L 4P73A 1J6QA 4BBSH 4IJLA 3EPGA 2BCQA 2Z0SA 4UPAA 2UUAQ 2JEIA 3KDFA 2XY6A 2NZOA 1KDHA 5AJ3L 4QZ8A 3UDIA 5J2CA 4IO9A 2WB1E 1VQ7A 5J0WA 4I2GA 7ICVA 3PUXA 4QL5A 4JI5L 3RRGA 1QLNA 2QEXA 1X3GA 4ECRA 3RZOH 2BPCA 3PCOB 4POFA 5LMNW 3MABA 3NEMA 4I2AA 4OONA 3UDGA 4LNQA 4LF5L 1FJGQ 3PUYA 1HJPA 3GV5B 4QWDA 4DR1Q 4GKKL 4TUPA 2ID0A 2A1AA 2QGQA 5KFIA 1VQGA 2ZJQA 4R4IA 1XU4A 3MFHA 3FDSA 5CA7A 5J0YA 1S0VA 3G6XA 3AEVA 7ICQA 1AH9A 4DR2Q 1IM4A 1Y1VH 1Z3EB 4Z6DA 4JYAQ 8ICHA 4A3JH 2R8GA 1KC8C 1N33Q 2JA7G 7ICRA 3KYHC 1E22A 3B0YA 1N8RC 2R8IA 3BJUA 5DB8A 5IYDH 4RNMA 4ECSA 1ZQSA 5J0PA 4KMUA 4MFFA 4IFDG 4QW8A 4DV1Q 1N48A 2BQRA 5DB7A 4MZ9A 2FLPA 5BPCA 5KFAA 2I5LX 5J2IA 4P71A 9ICTA 4UY8C 5HY6A 8ICZA 4KLSA 3V7LA 2BPGA 2XGQA 3CCEA 1S0NA 1EIFA 3PUVA 4JI1L 4DFKA 4B9MA 2UU9L 3T1YL 3CW2C 4YHHQ 3NELA 5J0QA 5KFHA 4C8NA 2M9NA 3HPOA 1S97A 1PYSB 4LFCQ 9ICAA 4IRDA 4UP7A 1XMQQ 1TWFH 4EX5A 1CUKA 3T5KA 3FHWA 4F4XA 4TVAB 4KLQA 5J2KA 4EQ5A 3F2BA 4GKJL 2HHQA 1I3QH 5J0RA 4M6WA 4TQRA 4QZBA 1YHQA 2JA7H 2BCUA 2VA3A 3TFRA 1SN8A 4F5PA 4ED6A 5KT6A 4O3PA 2VQFQ 7ICSA 1L3TA 2BPFA 2FPMA 2JEGA 4QZIA 4QZHA 2R93G 2ZJ8A 1WCNA 3NBHB 5GAHC 2K14A 3JPTA 4JV5L 3T1HL 5CR0A 2YTYA 2FLLA 4B3ML 1VQPA 2R7DA 1KSPA 4R65A 1S9FA 1TFRA 3RLFA 3Q8LA 2PI4A 3GIMA 5IE8A 1XPUA 4Y52H 4JI7Q 2UVRA 5L1LA 3ZDCA 4QQBX 1UEBA 3DLLA 1XSPA 2F4VL 3GFKB 2DFLA 3S2DH 5LMNL 2I1QA 1J5EQ 3CCMA 4B3SQ 3S24A 5KFBA 3KHHA 8ICIA 2LYHA 3GDEA 1EWIA 4ECYA 1KIXA 1X3EA 4J9SA 1MC8A 1VQFA 4KLKA 1S77D 3HT3A 1KFTA 3MGHA 4YMOA 2YTVA 2E5LQ 2J6UA 2NRXA 4HIDA 3ZDDA 4X65Q 5FLXc 2I0QA 4EYIB 3RH4A 4YCWA 1D8LA 4RQ0A 3HOXG 2E2HH 1XC9A 2R93H 2PMZE 2FMSA 1X54A 4DPGA 1B43A 5C4XG 3CC4A 3UQ2A 4O3QA 4LF4L 1KL9A 3PW5A 1HR0Q 2VZAA 1BPYA 5C5JA 5C44G 4F93B 4DV4L 4MF8A 2MNAA 3F1ZA 2HHXA 4HIOA 4R4QA 1QSLA 3T5JA 8ICFA 2XGPA 3A5ZB 1XPRA 1PH1A 3GILA 1S72A 2AGPA 3FKIG 3V6KA 5KG7A 3H8SA 2QA4A 5GADC 3RJIA 5JUMA 4UBBA 2WP8J 5HMMA 4YY3Q 3M7NA 4M9NA 3RJFA 1PH8A 2ATWA 2R7FA 5DLGA 4RUAA 2EXDA 4JBKA 3UPQA 4DL7A 3JAMi 5F9NA 4JI2Q 3GIKA 4X64L 1K0RA 4Z6CA 3TREA 5LMUQ 5KFXA 4A3LG 4UB4A 4B3RL 4QWCA 9ICWA 3H4DA 1NMGA 3HOXH 3GQCA 1K73C 3CCLA 1B8AA 4LFAQ 1D9DA 4M04A 5C4XH 4LF9L 5K36G 4LF6Q 2C35B 2I5HA 3K8AA 1D9FA 2A1JB 5C44H 1DGSA 4UB2A 3MR6A 4J9QA 1D7QA 2WAQE 4DOCA 2AU0A 2HQLA 7ICKA 1YJNA 2GVBA 1MKHA 2L15A 4DV7Q 4QY7A 7ICLA 4JI6L 2W8KA 4DF8A 4DV6Q 4DUZQ 5DDYA 3BJYA 2CWAA 5KG6A 5KFCA 3D0FA 4BDPA 3K0XA 4LFBQ 2AGQA 3HKZG 5BR8L 3PR5B 2W9BA 2HHVA 3E0EA 4UBCA 4APVA 5HGQA 3I56A 1YJ9A 4HJ9A 2WFWA 5L1JA 4J9LA 4M9HA 1ZQNA 2RDJA 2N78A 3RZDH 4K4HA 1T4GA 1MQ2A 2KZZA 8ICQA 1T9HA 2NZHA 3S1NH 5IP7G 1VQKA 2A19A 3S1RH 4O3OA 9ICSA 1QVFA 1IBML 4A3LH 5KFUA 4GOPB 5L1IA 1GO3E 4AQYL 3MR2A 1G51A 2VS1A 4DQPA 1NTGA 3K4GA 2UVVA 2YYZA 2NRVA 5KG2A 2IT1A 3K7AH 2ISOA 1EQRA 1SKWA 4YCUA 3G6VA 4LZGA 4GXKA 4K0KQ 5FJ8G 5J2JA 5KFKA 4QZGA 4GC7A 4NM1A 4BA1I 3MFIA 1RYSA 4GNXB 5IINA 1K1QA 5KG5A 3OHBA 4BXOB 8ICKA 4RQ5A 4KLUA 3NTUA 2RHQB 3RBEA 4KLJA 4F50A 2KCTA 3RAXA 4JWMA 1SMXA 4GOPC 2OTLA 5ELNA 2ZM6L 1ZQYA 1VQ9A 3L0OA 5IILA 1U45A 1I94Q 4L5TA 3CP0A 3TRZA 3PV0A 3S15H 3RN2A 1U4BA 4I2IA 4JC0A 2F1IA 1U47A 1LB2B 1WCLA 2ZUDA 4R64A 5KG4A 3RRHA 5IP7H 3CCQA 4QZDA 4RPZA 4YN4A 3RAQA 4HJ8A 1UT8A 2CQOA 1CSQA 4CCHA 2JEBI 8ICWA 4IR9A 1ZQJA 8ICGA 1N32L 2AWOA 1YEZA 3HOUG 4F4KA 4DUYL 2JK8A 1X9SA 3GTLH 3JPPA 1TKDA 4BWMA 3MEFA 1ZQFA 2FMPA 3M9NB 5FJ8H 5KT4A 1UE7A 1MQ3A 1VQMA 3TFSA 2ISPA 1T3NA 4BWJA 4HIKA 4BY7H 1PH9A 3FP9A 3RJKA 1MSWD 2VW9A 2F1HA 1K1SA 4JG2A 2JZBA 8ICLA 4MEYA 3KF8B 1ZQTA 9ICKA 1PH6A 2IHEA 3I55A 2XCPA 4X5VA 2BQ3A 2R92G 3C5GA 4O5EA 1XSNA 2AMCB 5IWAQ 5KFGA 1HZ9A 3OSPA 2BCRA 2D62A 5EWFA 4RNOA 4YWLA 3TAPA 4KN7A 1XMOQ 3WWVA 2B63H 3PO3G 2PFPA 3OW2A 3SI8A 4F4ZA 3KFUA 3GTPH 4Z6FA 1K9MC 2AKWB 3G6EA 1PH4A 2B29A 3E9HA 2F1JA 1KRSA 3ICEA 3B6YA 1FJGL 1ZQUA 1HNWQ 1ZQPA 4DR1L 4IQTA 1X65A 9ICFA 4IFDI 3BQ1A 1T8EA 1S0OA 1E7ZA 4JCVE 3GIIA 4JUZA 1VQ6A 4DR2L 4P4MA 2BR0A 2IHFA 1Q12A 1Q8KA 1XNQL 1EFWA 1BPXA 1WI5A 4R8UA 3CMEA 1NKCA 3C2LA 3H40A 1VQJA 2ZUCA 3D31A 1VQCA 1CKNA 4QZFA 4R4OA 1SZPA 3I4NG 4EBCA 2K5HA 3PSIA 4DV2L 4B3TL 3UXNA 3A5UA 4LWCA 4JI4Q 4F8RA 3CPFA 1BGXT 2Y0SE 3M3YH 4M9GA 3KF6A 4C3IH 5CJ7A 8ICSA 1SL2A 3SV3A 1JN3A 4GXIA 2BCSA 2R92H 3TQYA 3J81j 3CPWA 3HX0A 2K5VA 1U9LA 1QUQB 9ICMA 2XY5A 3V7KA 2HHSA 3GTMH 3PO3H 3LWLA 3ULLA 4L5QA 1IL2A 3HOWG 4PHPA 4RU9A 2VL6A 2CFMA 2BA1A 4MFCA 3GTJH 4DV5Q 4LVSA 1P8LA 3J7ZC 4DFMA 1Q46A 2KBNA 5JJKA 1XO1A 4DL3A 1Z00B 2D0PA 2A8VA 3M4OH 5DLFA 1L3UA 4J15A 9ICJA 4DL4A 3ISCA 4RQ3A 1E1TA 4J9RA 4PHAA 1RIPA 2Z6KC 3EWAA 1A8VA 8ICUA 2JEAI 3A74A 3JC66 3SV4A 3ULPA 4RQ8A 4J9OA 1ZQXA 3G48A 2HIXA 2LXKA 3AU2A 2MO0A 3PO2G 1JE5A 4C3JH 1XJVA 2GVAA 2RCNA 3ZDAA 4YXMA 3LWMA 5JJLA 2UXBQ 3I4NH 5FLMG 1G291 4KLMA 4QZCA 4A3MG 3QE9Y 4UP9A 4DR6L 4TQSA 3QEAZ 3M85A 1LV5A 3S17H 3TS0A 8ICNA 2UUCQ 4NXML 4YFKA 4DSJA 1ZYQA 1LYLA 1KFDA 3JAMc 4ED3A 1WCMG 2VNUD 1QZGA 3AUOA 4P74A 4JI7L 3MR3A 5C4JH 4DR5L 4PH5A 4M9LA 1LUZA 4DR3Q 4RPYA 4DL2A 4X62Q 1J5EL 4B3SL 5KFWA 2ASBA 3Q8MA 4FDBA 3I4MG 5J2BA 1A76A 4ED1A 1FL0A 4DR4Q 2N49A 1HZBA 4OWXB 2CKZB 4XQ8A 5DGBA 1UE5A 3ZJYC 4NLGA 5HNKA 1ZQQA 2JE6I 9ICXA 1NJYA 3RJGA 4QZAA 4F5RA 7ICTA 2MFIA 4XTCS 1E24A 4P2HA 4E0DA 4I2DA 5AJ3Q 2R7ZG 2JEFA 5KFYA 4B9VA 1Q81C 7ICFA 1YJWA 2ZTDA 2W8LA 2UXCL 4JI5Q 2FMQA 1U0LA 3EPIA 4ECTA 3IHQB 4A3DG 4KHPQ 3PO2H 1N9WA 2Y1IA 2FXQA 1TV9A 1QSSA 4YCXA 4LF8Q 5HHHA 2J6TA 4DS4A 3AYHB 1GVPA 5FLMH 3PX4A 2MAXA 1PH2A 4GKKQ 2N8NA 2K5NA 1JX4A 5H1SE 4M6WB 1JJ2A 1CKMA 3OHAA 1EOVA 1WCMH 3UQ0A 4DSKA 3BU2A 4NXNQ 1X3FA 4DL5A 3CCJA 4PPXA 4DF4A 3MXNB 1BPBA 1B22A 5KG0A 4HYKA 4R4TA 2EIFA 1KXLA 3I4MH 1E3PA 2HW3A 4DQSA 1OXVA 3Q8KA 1PV4A 1XNRL 2XC9A 3H3VI 4XRHA 4KLIA 1V1QA 1HNZQ 4DLGA 4JI3L 1Q86C 4RQ4A 5DBAA 3V6HA 3RNUA 1ZQAA 4KTQA 3E9IA 4EYHB 1QVCA 4AYBG 1M90C 2W9MA 3I4OA 4KLLA 2ZJPA 1JJCB 3GO5A 2R7ZH 3PF5A 2UUBQ 4L5RC 4K4IA 4JOIA 4DLEA 5CHGA 5DBCA 3PX0A 2C2RA 2YTXA 4A3DH 1RL2A 3CCSA 1VQLA 4JI1Q 2NVXH 4JBJA 1EUJA 2OTJA 3T1YQ 5KT3A 4F5OA 5DLQE 5KFQA 3CAMA 2IY5B 5IIMA 8ICCA 1C9OA 2VUMG 1E1OA 4LF6L 2AWNA 4LUOA 4DV3Q 3OYYA 2KZ3A 4JI0L 4LF7Q 5DB9A 2W9CB 1UE1A 3HWTA 2KENA 4OO1I 2VQEQ 1ZQBA 4NY8A 2NN6G 4GKJQ 2BA0A 1NKEA 1VQEA 1WFQA 3K81C 3AFPA 3F2CA 1S0MA 7ICOA 4QGUA 3ISBA 5BOMA 3C2MA 3RR8A 4RQ2A 4IOCA 2UVUA 5D49A 5KFEA 1KHIA 4EEYA 2ZUBA
chains in the Genus database with same CATH superfamily
3WOEA 3UMBA 8ICEA 2NVYH 4DAYA 4B9SA 2Z9HA 2KIVA 1EWCA 4JV5Q 3SAFA 1FR3A 2PI2A 3WKEA 3F53A 1U5KA 3K0YA 5EPLA 1J9OA 3UM9A 3T1HQ 2PFQA 4FNFA 4B3MQ 1S4ZA 5CORA 5AKGA 3TARA 2QEJC 1TWFB 3MC1A 5FO7B 5KTQA 1DYQA 4YG2A 1VQBA 1RDFA 1AE2A 3PIOA 2HQEA 1OTCA 3GZFA 5KFFA 1NSNS 2QCPX 1COOA 1L1OA 4RKLA 3TAQA 4CJ0B 4JV0A 2B2VC 3PSPA 1ESFA 3JPRA 1RXVA 4O42A 1ZQKA 2EZXA 2F4VQ 5ELFA 3H4BA 4IUUA 1NE3A 4JBWA 2XO7A 1EXNA 1YT3A 2RRDA 3H8WA 2WB1G 4X66Q 5LMNQ 5B66U 3CQZH 3HOVG 2WF8A 5C3EG 1UA0A 3PF4A 1T3QA 4R66A 3U9SA 3LDAA 3BG3A 3U4ZA 4IQVA 3ETLA 2OT2A 3ONNA 3TADC 2KCCA 2KIWA 2JA7B 5DG7A 2VA2A 1LTID 1OXXK 4HJ5A 4A4IA 2X6LA 4LAAA 2VUMH 1IKLA 4XT1B 1BKBA 1I4PA 2BHNA 2NRTA 3IG5A 2A68D 4K0KL 1XWLA 1H95A 3PY8A 2XWBB 5C0XI 1QQ7A 5CMDA 1HEKA 2XI9A 4C8MA 4M0AA 3OGUA 2CCZA 1QZHA 1C8CA 3C23A 4DSLA 3Q24A 2CHBD 4I2HA 3CRXA 2DY7A 1YBYA 2W7OA 3THVA 1RODA 2NN6H 1H9RA 4QMGA 1TKWB 1I50H 3JPQA 3HFZB 3DV9A 5CP2A 5L1MA 5IGCA 2A1JA 4PZ8A 3AQQA 1GD7A 2RBMA 2PFNA 1IZ6A 2KCMA 4IRKA 4R8IA 2VJ5A 4ECQA 5D4BA 2ASDA 1PRTF 3VYTA 1Z4NA 2RDIA 1O08A 5IP9G 3GD7A 4Y2VA 4NJ8A 2R8JA 1SROA 2O2LD 3PGZA 4OJLA 2Q2UA 3CU7A 2EVBA 4UB3A 4XYOA 1QVGA 3D4WA 4RPXA 3J81i 4J1MA 3FPUB 2CPRA 1XS9D 1UWVA 3ERQA 3M8RA 2BH8A 4FVMA 4OJOA 3S2DB 5J8YC 3BS5B 2XWJB 2JA5G 1A15A 2WF7A 1RTNA 4RGNA 3FKIH 3QNMA 3SAHA 1SXDA 1SYEA 3OJSA 5E7NA 5DQIA 7ICGA 2D0OA 4FBTA 3N52A 5IYBG 4FXDA 4F2RA 1SV4A 3C5FA 4HSPA 2K01A 2AQ3B 5EWGA 3RR7A 3CP8A 1VQOA 1SKRA 4KLHA 3HZXA 9ICQA 2HT1A 1S76D 4X3KA 5J39A 2L5YA 3LK9A 4C8OA 2KFNA 2QDLA 3CF5A 4KN4A 3IRBA 4KX3A 1GUNA 2IX3A 4J9MA 2FLNA 2K52A 5CV4A 2F0MA 3GTOH 4DV4Q 4Z6EA 1Z47A 3D6JA 3PW0A 2DBYA 4A3KG 1L0WA 2RDHA 3T5HA 1QSYA 3M6KA 4JV1A 2WINB 2KFZA 2HHTA 3ZDEA 4JW0A 3RH6A 2HCCA 5IIOA 5HP4A 3I7FA 3J80i 4AIMA 5C3EH 4RQ6A 4DR7L 3QJYA 3RLOA 5ALWA 4FZLA 4YR3A 2Q2TA 2W11A 3FM9A 5KT2A 5DBBA 2XN9C 4RZRA 3K7UC 4PGQA 2WTFA 3EYZA 3CRLC 3KUPA 3U4VA 4ECUA 1K8MA 4C3HG 1PRTD 1QQ6A 1RCVD 4P75A 1K3BC 2ZG6A 1A0IA 3EIVA 2GO7A 3ND9A 2ASLA 1YNNC 2JXJA 5DDMA 4R63A 1UUPA 3EN2A 5KFTA 3H0GG 1L3VA 4X3UA 1EYGA 3W5OA 3GTQH 1HUOA 4N8X1 5AK5A 3RBDA 3QXGA 4J9PA 1H9SA 4DK6C 1SLJA 3CC7A 4NLNA 3FAHA 1A6XA 2C28A 2F03A 3KBBA 3UXOA 2VIXA 3FPPA 4I27A 5M3MG 2XRQD 3M9MB 2A6HD 4QCLA 5D3IB 5J2EA 5GROA 1N63A 5J0TA 2B6GA 4RQ1A 1Y88A 2OXOA 1PHJA 1ENFA 4X64Q 4GNXA 2W54A 2XY7A 2IA6A 1TY2A 5IP9H 4ELTA 4BXOA 3CXCA 2I46A 2MSNA 5KIXA 1HZAA 1F0MA 3IDWA 3KFUF 1SIJA 1B2TA 3G7LA 4OWTB 5JPMC 1Q3LA 2DNCA 1Q3VA 3H6MA 1N56A 1TK0A 3NRWA 1V1PA 4CJ2C 4CF5A 4PV1C 3H09A 3RJEA 5IWAL 1EYDA 2IOFA 3T79A 4OJ6A 1LTLA 3I28A 3OTQA 1CZGA 2VXWA 4I7AA 3I8ZA 1HQMC 1JXLA 1KKXA 2KHIA 1KRPA 4B9NA 2I5MX 4RG1A 1JROA 4A3EG 3L9AX 1KTKA 1LO5D 5C5LA 3S2HH 4FYDA 2Z8LA 3QX7A 4DOBA 1SYGA 2A69D 4ED2A 4I29A 4OL7A 2J6SA 4QZEA 5CV6A 3OTOQ 2EQYA 4DNRB 2LSSA 2WFAA 1NK8A 4US8A 4B08A 1PFSA 3SQIA 2JA6G 1NK7A 2JA8G 1D2BA 3HOYH 2JN4A 7ICMA 3A8IE 2KICA 3FYHA 4DCCA 2UXDQ 4WJWA 8ICRA 1WTVA 4UHVA 2KKVA 3WK4A 3PW7A 3C1YA 1J2NA 4IRCA 4A3KH 3MBYA 1VLBA 4DSFA 2HVIA 5KGUA 3GDXA 2FI1A 1NMFA 5AKHA 4K5VA 3KD3A 3WK6A 1NK4A 3LVVA 1Q8IA 4K4GA 1NK6A 1B9MA 3W1GA 4HJ7A 1IBKL 4Q5VA 4POGA 1C4QA 3STBD 2MRLA 1SGGA 4RQMA 5EE1A 3CQZB 2G08A 4Y7NH 4JI6Q 1W3SA 2VA8A 1PRTB 2K4IA 3CC2A 1A63A 2HVHA 1CA6A 1C48A 5KFJA 3GTKH 2L11A 2HHHQ 3UMGA 5I9OA 3HKZF 2QDBA 1ZQRA 4KY6A 4KJOA 2ICEC 4B9LA 5D46A 3URYA 5BR8Q 1GKHA 1Y1WG 2PQAB 3UXPA 2ATLA 3NRZA 4BGDA 4IQUA 3CD6A 1KQSA 1NZPA 5IIIA 3UE1A 4GS3A 2MUTB 9ICLA 4A75A 1NK0A 5KNBA 5M3MH 4AYBC 5E3FA 4FFDA 4QWEA 3W1BA 5CBEE 4Q43A 4RGTA 2KTQA 4UAIA 3CYMA 3ISDA 2PI5A 1N34Q 3Q8QB 2AHOB 1ASZA 2CWPA 4UQGA 1GHJA 5C44B 3I76A 3Q8RB 4IALA 1ZQMA 3NTHA 4HR7B 3E6ZX 5IT9L 1IBMQ 4YR2A 4F91B 1GUGA 1L0XB 3KF8A 5EKLA 5J2FA 5KFRA 2K32A 3UI2A 1WYDA 2UUAL 2PPBC 1H38A 4UB1A 8ICBA 5EWEA 1JB7A 1G6PA 3MDCA 4PGXA 1ZQOA 5M5XH 1KTQA 3WK8A 5KYIA 3Q0AA 4USAA 4K8JA 1Z19A 1BBUA 3CNHA 2EZVA 2F0TA 4A3EH 4HAIA 4KLTA 2E2DC 1FYCA 5C0XJ 4A76A 2ES2A 2JA5H 2AUJD 2GWSA 4ECZA 2R6GA 2M2LA 4A3GG 3BZKA 3I1YA 4DFDA 3FKIB 1FVIA 3HOYG 1ZQLA 4DXFA 5DM63 2K05A 2Y1JA 3JPNA 2GOLA 1L7NA 1KFSA 4O9MA 2JZBB 3H0MB 1ICFB 2JA8H 3HOWH 1PVOA 3HOZG 1KEJA 1TS2A 4B9TA 2E8NA 4UAYA 1SL0A 4GN3B 1MN8A 1RHPA 5ALPA 1Z6HA 1N36Q 4NKLA 2EXZA 3ONAB 4P0PA 9ICNA 3RZDB 3GIJA 2E8GA 4K2KA 5ALSA 1SL1A 2OXPA 1RXWA 3K5OA 8ICAA 8ICTA 3J7A5 3LYSA 1HNXQ 5E4WC 2MP1A 2ZJRA 3S1RB 3NVVA 3C21A 4I28A 2YN4A 4UDUC 1JMSA 2Y9UA 3PW4A 3PNCA 4F4YA 1B4FA 1X9NA 1Q1EA 3M9BA 1BO0A 1D5XC 2K4PA 3PO5A 5KFVA 5BOLA 4XIGS 3BQ0A 3OOCA 1VMPA 3UE0A 4PHDA 3HOUH 1S40A 1L2FA 3U26A 8ICJA 1LT4D 2QARB 1NCVA 2O4XA 1Y1WH 4NLKA 4OX9Q 3SHLA 3EZ5A 4JYAL 1ZD4A 2K4EA 3JPOA 3ED5A 2BCVA 1V97A 3PZPA 2NRZA 1UE6A 2L55A 1EIYB 4GLAC 5M9OA 3GTQB 4S3SA 5ALDA 9ICIA 1U4RA 1HTPA 1N33L 3UDXA 1WOCA 1JT8A 4DL6A 1ZRMA 3PMLA 1F2ZA 5JEAG 3TACB 2HMXA 3SGIA 4F87A 1SNOA 4HCEA 1D8YA 1SYDA 5J29A 3ER0A 3I70A 3N4MB 3QOLA 3RLNA 5IYCG 2HOIA 2K4KA 4IQZA 4M1UB 3MZ5A 4QWAA 5I6WA 3CHBD 5ALZA 1MI2A 8ICMA 1ZQHA 4DV1L 3HG9A 1EY7A 1N32Q 4MHEA 4MIUA 1GUTA 2NB0A 3AMUA 3LWEA 3STBC 5DEHA 1V9PA 2WB1C 4TUSA 2F0NA 1ASYA 4KN7C 1U48A 4JPBW 4ZH4A 5KFSA 4O3MA 1HR0W 4IJHA 3KHLA 1CKNB 4ELUA 1QUQA 4PGYA 3RN5A 1IBLQ 2JA5B 3OMCA 3HKSA 1FNVA 4UASA 4EELA 4BS9A 4DS5A 4M9JA 3FVQA 3DEPA 2F0IA 1ONLA 1IW7C 3QZ7A 1XSLA 5IYDG 3HOZH 3HKZB 5KT5A 2B8FA 2AGOA 4A3IG 1CHPD 1W6KA 4YHHL 1NOMA 2V4QA 4ZK9B 2V4RA 3S15B 3KF6B 1DK3A 1YIJA 4DKAC 2WKDA 4PZOA 2XVSA 3S6JA 1NJWA 1SXTA 3E5SA 1X6OA 3QWNA 4LFCL 3CCVA 3SZ2A 5HGTA 3I3CA 3KDFB 1XMQL 4F5QA 2KN7A 4YVZA 1TK8A 3RH5A 1EEFD 3KLWA 5JEAJ 2E76C 1Z00A 4CKBA 4X6AH 2F1MA 2P6UA 2WAQG 3EVQA 2YMQA 2YMPA 5EPKA 1PA6A 2MQHA 2E2JH 1RYUA 4A8EA 3QU2A 1LM0A 4NPSA 1NAPA 4Y7NB 2IWHA 3CMAA 1CTMA 9ICCA 4FZNA 1M1KC 3GTKB 4KHPL 3SYZA 1Z9FA 4GIBA 2ZJAA 3M9OB 3P1HA 4M47A 2N88A 4RQ7A 2NZ1D 1R9TH 3H0LB 4XDXA 4LF8L 3GTLB 2IBKA 3WKAA 5IT9E 1FO4A 3RB0A 4L8JA 3ZYYX 4HJAA 4JBMA 4KLEA 2Q2IA 2ZIVB 2Q2HA 1A2UA 4Y2QA 1SV0C 1ZOLA 1ZJNA 1VCIA 3HKZC 5M3MB 3K5MA 2F0UA 4ECWA 2LXJA 2VQFL 3SE0A 3WK7A 5CRXA 5IYCH 1LTAD 4QJFA 1HQRD 3PMFA 1NNLA 2PZUA 5CYUA 2EY6A 1Q82C 3B0XA 1I6HH 2K4HA 3BDPA 1WJJA 1YHBA 5HMLA 1X9MA 4DSIA 5ALNA 5J2AA 4YCVA 4DNTB 4DV0Q 4ECVA 4GXJA 4V190 5L1KA 1HHVA 5AM5A 4NXNL 1SKSA 1XNQQ 5M5XB 1X56A 2YV5A 1JRPA 4A3BG 1ZQGA 5TISU 4QF4A 3LX0A 4G9BA 3PUZA 3F2DA 1PZJD 3RUZA 4NWIA 2KJ8A 1O7IA 4IS7A 1KLNA 3HW8A 1VQHA 1EL0A 4O0IA 5ISRA 3PSTA 4NM2A 3RB6A 4A3IH 4A93G 2B2WA 1DOLA 3PIPA 3QIAA 3HKZE 5A2QL 5J0OA 2CH4A 1SRUA 4U68A 1HNZL 3KJPA 4CJ1B 3H15A 5EOZA 3L3OC 3UDFA 3GTPB 3HGBA 5KRUA 4DV2Q 4B3TQ 1ZXIA 1KN5A 2MU2A 4RT3A 1NK5A 1AE3A 3KLSX 4YWMA 4JI8Q 3J80E 3GTGH 3PV8A 3HRDD 2LMCB 1JOQA 2BDPA 1GJXA 4LJXA 2DGZA 2IMWP 3KOJA 4RWSC 1ZQ1C 3QEBZ 3C46A 3WKBA 1Y14B 3ETRA 4F71A 2UUBL 2PZWA 5IGGA 2CVRA 4CKEA 1MSGA 1NY4A 3F5AA 3BZCA 4RT2A 2JXMB 5IT9c 2R61A 5M5WH 1KNAA 5IIJA 2E5LL 2EYHA 2NN6I 3MA2B 4DFJA 1VS0A 2ZXPA 2RHSB 5AFWA 1HIWA 1FGUA 4ECXA 1L8LA 3HOUB 1BCPC 1TK5A 4UAWA 1EOTA 5FO9B 4X65L 5KL8B 4Q44A 1X40A 3J81c 3BS7A 2DPIA 3G4SA 4FS1A 1V1OA 3H7IA 2PYKA 2F3IA 2V1CC 1X3PA 5GAGC 3SEBA 2FMCA 1UCVA 1XPOA 2IHNA 2DJGC 2F0KA 5J2HA 1U49A 3SENA 4DV3L 1L6NA 3NENA 2VANA 3N97B 2OWOA 5C3WA 2C22A 5TZVA 4RUCA 4LF5Q 4LF7L 4A3MH 5KG1A 2CQAA 2MPMA 1VQDA 1S8OA 4IFDJ 1ZQEA 2P6RA 1HTLD 2VQEL 4TKOB 4ACOA 2MHVA 1NJIC 5F2DA 4Y2UA 3M3YB 4DNIA 1HR0L 3NGDA 3BQTA 3KKAA 1SSOA 5ELDA 2R92B 3K75D 1GUOA 4B9XA 5GQOA 3KTQA 5J0UA 2H5XA 1ET9A 4RHSA 5HURA 4A3BH 3C2KA 4FXKC 1EY8A 3PR4A 3J80c 1VDVA 1GM5A 5ELOA 2YMLA 1X42A 1LKYA 2RQ5A 2MO1A 5JJZA 2E1FA 3MXNA 2LM4A 3SK4A 2BDUA 3D4RA 1AROP 3GTMB 3I2ZA 1B70B 2VY3A 5CEHA 4A93H 3E0JA 1MD2D 1IXRA 3X3MA 2AJQA 3WKDA 3RJHA 2ESEA 1E2VA 1STNA 1K8GA 4DO9A 2K75A 1EZ6A 3T5LA 3RB4A 2RSNA 4DR6Q 5ALKA 4YMNA 2KV2A 1KDAA 4RH6A 1DOKA 1RZTA 2AQ4A 3M4PA 4JB3A 2FPLA 3RB3A 1OXTA 2L0CA 3VC8A 1HUZA 2DQNB 3TZDA 1GUWA 1TWCH 2E3TA 4YY3L 5GAEC 4NXMQ 4FS2A 3G71A 3MDAA 4I2CA 2WF6A 5HHIA 2BE5C 4CGYB 3OSNA 7ICNA 5E4XA 1UAPA 2ZIWA 5DGAA 2LHTA 3WOFA 4DR5Q 5CR3A 4I2FA 2F0JA 2DGYA 4QIWF 1D1IA 1V38A 3NE5B 3KHRA 2IX0A 4X66L 2G07A 4H02A 3AM9A 1Q1BA 9ICUA 4HCSA 4JI2L 2NVTH 3GV7B 1HH2P 5LMUL 1YZ6A 2RDFA 1R9TB 2KG5A 1SE8A 4OWWB 4NV0A 1EQQA 1G2SA 1T94A 3NVWA 1TWGH 5IIKA 3ORYA 2UU9Q 4YD1A 4HIMA 7ICUA 1B53A 4N9PA 3ZD8A 4IZ8A 1YITA 4C3JB 1MJCA 1HPCA 1BPZA 2D8CA 2KZMA 2F0GA 1TXYA 4XT3B 5ELBA 5KG3A 4Y2JA 2H3IA 3VDYA 4LFAL 3I4NB 3MGIA 2NYZD 2NVQH 3OJUA 1KRTA 2IL8A 5EJWA 1T5XD 5KFDA 1SNCA 1F77A 1RPLA 2PKEA 4NL9C 1TAUA 4HSVA 3CCUA 2HBKA 4RQNA 5DKWA 2W9CA 1VQIA 2B2YA 4RFBA 5KFOA 9ICHA 1L3SA 3M8SA 1V43A 3NQTA 4GN5A 4IUPA 4J9NA 2KP7A 4GLVB 2B0CA 4DWIA 4IN3A 4KY5A 5D14A 4IOAA 2UXCQ 1Z1BA 3DM3A 2KNJA 2F0SA 4MEXA 2DUDA 5A2QE 1PH3A 1UA1A 3MWYW 2BDOA 4QWBA 4YP3A 2B8GA 3VR2A 1W6JA 1OXSC 1HXYD 2K5WA 4P4OA 2RDGA 4R4CA 1JXEA 1TWAH 4KD3A 4XA5A 2JA9A 4DV7L 4C2MH 1X9XA 4XUSA 4A3IB 1PYBA 4BY1G 3HOWB 2KK0A 4MFAA 4O5CA 4EBEA 3BDCA 5EAYA 4DUZL 4DV6L 4QUCA 3J7AV 3SEIA 2BGWA 1H9JA 1VQ8A 5IY0A 3GTGB 4BXXG 4DK3C 2H3ZA 3QZ8A 1JWUD 1YNND 1ZD5A 2JRZA 3Q8PB 4LFBL 1YVCA 5F9LA 1NJXA 4TRDA 2IHMA 2O6KA 2YU9H 4JOIC 2F52A 2FJ6A 4Q8EA 1YNXA 1MJEA 3IL8A 4ED7A 4I2EA 1X55A 1TE2A 5K5PA 2Y0SG 1K3RA 2A73B 3PUWA 3AMZA 2NTTA 2I9GA 4IPHA 3K1RB 4YD2A 2OQKA 3QYPA 4C1NK 1KAWA 5M5WB 2B21A 3NBIA 1KD1C 1SR3A 4EQNA 1S10A 4ALPA 5LHY1 3DM1A 4ME3A 3JPSA 3KHGA 1KABA 4EEKA 1DD2A 1X9WA 2VJ4A 3N28A 3PVXA 4A3CG 4DAYB 1MA7A 2JV3A 5IOCA 1XNRQ 5J0XA 3EJIA 3OMGA 2Q8IB 4OJ5A 1FFVA 4IPDA 3RD4A 3PO2B 1SNDA 4KLFA 1N2XA 9ICGA 4JI3Q 2PXIA 1RM6C 1ZQZA 2R8HA 2LKYA 5DQHA 4FBUA 1CK1A 4LK1C 3L2PA 1P16A 5J2DA 3TQ1A 4AYBF 2YTUA 2N55A 2FJ2A 1B7YB 5DG8A 5KL1B 3M4QA 2C2EA 4KLGA 2ZXRA 4A3MB 9ICEA 1L1OB 4KX5A 4TQUS 4ZUIA 3AQEA 1PXUA 2DPJA 1HZCA 2PW5A 4J9KA 2VB2X 3ERSX 2Z7JA 4FO6A 3Q8DA 1EY6A 2B2UC 2Z4HA 4KK7A 4B9WA 2JEJA 3FEWX 4O1NA 3KJOA 2HHUA 1UT5A 2ES6A 1SFOH 4DQIA 2OH2A 1PTOH 4YXJA 2E2IH 5CBAE 1ZETA 2P5ZX 1D6EC 1QB5D 3HP6A 1G8ZD 2EE1A 1LT5D 1WCMB 2MA1A 2NTSA 4C8KA 4O5KA 2K5QA 1NBWA 3NUCA 1PFBA 3F2UA 5ALVA 2KJXA 4XYQA 4FZMA 2XTIA 4PG3A 1W2BA 1UHUA 2IX1A 3M4YA 4QIWB 3H0RB 5AM1A 2DNEA 4GLXA 4BY1H 4O3SA 1VQ4A 2RF4A 5LL6S 3I4MB 2Q4TA 5D65A 3OTOL 3K58A 2N3SA 7ICEA 1SJED 4BXXH 1NK9A 5KFLA 3BS5A 2W9AA 2A5HA 4J8QA 4EQOA 1FNUA 1I94L 4EZ6A 1PYWD 2BKEA 2K03A 4JI0Q 1JE4A 1ZQVA 4C4TA 4O3NA 3VR3A 2BCOA 1PFNA 3N7RC 4F92B 9ICPA 3IKJA 1PTOF 1J8IA 1STEA 2ZTEA 1ZXTA 1L1OC 2UXDL 5AI8A 3VR6A 2ZJ5A 1ZQIA 4F3OA 1IYUA 1LTTD 3ZI4A 3ZDBA 4YMMA 1GXDC 3OHXC 4LF4Q 3E2EA 4ELVA 5G5HA 1O7LA 5DM73 4O2DA 2R7ZB 5KFPA 2ZTCA 3U50C 1A62A 4MNOA 3C1ZA 1RYRA 4IQWA 8ICPA 4HMIA 1K0SA 1X2IA 3O13A 5C4ZA 1GUSA 5M5YH 5C5MA 4YQWA 4Q45A 2R8KA 1IYJB 3RJJA 3AU6A 3V6JA 1CEZA 3VR5A 4WJ3B 4A3CH 2DWQA 1KLUD 4A3DB 5EE3A 1K8AC 2XCAA 5KT7A 3MR5A 4DFPA 1C7YA 3HOVH 2ZXIA 5DQGA 5J2GA 4Q8FA 1TWGB 2HHHL 2NVXB 1FGBD 3S16H 4TUQA 4QIWC 2PI2E 5KNIA 3S1MH 1A0PA 4GOPA 4C1NI 1YNJC 3PW2A 2W9BB 4OO1G 1ZQDA 3D2QA 4PHEA 1I5FA 3M1YA 1TAQA 3IG8A 1PH7A 1JMCA 2ICIA 1KLGD 1XTCD 4NB3A 2AQ1B 1N60A 2GH1A 3HS0C 2P66A 2PNHA 8ICVA 4A3FG 2YQEA 1N34L 2XIDA 1KQQA 5AM3A 4RNNA 5ALFA 4ED8A 2GA4B 4O3RA 2JQOA 4IPGA 5CV5A 2PFOA 2G9HD 5BN4A 2WB1F 4JV2A 3S14H 1CI4A 5ALQA 3BVMA 4KV6A 2G5HB 3TP7A 2V9WA 4JK1A 3H3VH 2M00A 4EBDA 4LJZC 4UAZA 1NNXA 1SYBA 5AK3A 5KFMA 5ALGA 4B3RQ 5IGBA 3CCRA 2J7ZA 4BJQA 4BBRG 2L1BA 4QIWE 3NP8A 1QTMA 2EQSA 1L7OA 4WRDA 4GC6A 4NLZA 4UB5A 1QNUA 4LUZA 1HFNA 2JJQA 3T53B 2F0EA 5EE0A 4ID6A 2FMMA 4YR0A 1SE3A 4DAMA 1B44D 4LF9Q 1JIHA 1SAPA 1SWVA 4KN4C 4BY7G 2NVYB 4DSEA 3T56B 3V72A 2QB1A 1DRGA 4P0QA 4DQQA 4MTNA 3L3FX 4AYBB 4OO1J 4DQRA 1MIUA 2DY8A 2K6AA 1N36L 4FE3A 4QZ9A 5AKJA 4K2LA 2Q0ZX 2E74C 5M3FG 1DZ1A 1V1PB 5IGFA 2C2DA 1HNWL 2EJGC 4RMFA 1HNXL 1C0AA 2EOTA 2KHJA 4BA2I 4MTKA 4YWKA 1MSHA 4G3IA 2OF1A 2OQ0A 1QH9A 4LZDA 4HN7A 1A77A 1TVXA 3Q8SB 1Q7YC 5L9XA 5CWRA 1WTWA 2ZT9C 5C0XG 1FNWA 3TMEA 4B9UA 1JJGA 4OX9L 4WJ4A 2B63G 1S3OA 2TMPA 2EZZA 1PK3A 4QB4A 4C3HH 2UVWA 2YB1A 4KITB 2I07B 2JYOA 3W2DA 4I2BA 3CRKC 3LNNA 3GV8B 9ICVA 3H0GH 3I4LA 4EZ9A 2VUMB 8ICOA 4F4WA 9ICBA 1TWHH 1DGJA 1WTHA 1XXGA 4NXZA 1EFID 2F0QA 2PQAA 4CDFC 1EY0A 4JWNA 4LW1A 1IW7D 2MUTA 4A3FH 2XGTA 4TURA 4GNXC 2K50A 3A0JA 4DOAA 1TR5A 4BWGB 3TANA 3EBEA 1A3VA 2JHDA 3S1QH 1DOQA 2QF7A 1D1KA 2FPKA 1PTOB 2D5DA 5G3LF 3BYYB 3Q22A 1I50B 1Y8NB 2OCEA 2A3VA 3A8JE 4JI4L 3DWQA 1NKBA 3H8JA 4P4PA 4DR7Q 1PH5A 1F9QA 3BVZA 1ILPA 2BH2A 2HDMA 1E2WA 5CB1A 3TS2A 4BBRH 4UB6U 3AFQA 3D2NA 5DG9A 4MF2A 2EPBA 1CA5A 1K83H 5EKKA 4AQYQ 1YI2A 4DEZA 1IBLL 1JI7A 4BY1B 5JJIA 1PFMA 3PMNA 2C5CA 1DK2A 1AZQA 1PZNA 4I2JA 1ET6A 5KYLA 4F2SA 3L7ZC 1AFPA 1BPEA 1NR2A 5EBDA 1CZWA 1HRJA 2ASJA 3U58A 4M8AA 3BYTB 2KJ9A 2W55A 2H1EA 1WTOA 1BBXC 2NO4A 4UP8A 4ZQ3A 3TEHB 2ALYB 2JA6H 2D3DA 3PX6A 1L5UA 1RF2D 4Y2XA 1SNQA 1YHAA 3TP8A 5M3FH 4AYBE 4DV5L 2AQ0A 3SXHA 4F7XA 1VQNA 2JH7A 1PVRA 1XO0A 1X6JA 2ZIXB 2HIVA 3RF9A 2KMDA 4C3IG 4F5NA 3J7YW 3LGJA 4XQQA 2EAMA 2NO5A 1X6IA 4BBSG 3GTOB 2B2TA 4C56C 2NRWA 1PTOC 2ZXHA 2KOLA 4OXPA 2F76X 1G91A 5KFZA 1DM0B 5ALEA 1TVAA 4IR1A 4OELB 5M5YB 4UARA 1BCPF 2F0PA 2FDRA 4PMWA 3RTVA 2WB1B 5C0XH 2EDUA 3HOVB 5C3EB 5G3LD 1ZJMA 5KFNA 7ICIA 9ICRA 4L5SA 3V7JA 2BZFA 3QUBA 3TI0A 3E0FA 1OXUA 1VDZA 2ZM6Q 1EU4A 3QUCA 1ESRA 7ICJA 1BBWA 4M2YA 3E58A 1LTSD 4ZUJA 4KI0A 4PQXA 5J1ZA 2VKQA 4GN4B 4P72A 3T51B 1ML0D 1XTDA 3DMUA 4QW9A 1QCKA 4U7CA 2C9OA 3K80C 2GN5A 1OW5A 5ELEA 2UXBL 5AIAA 1CSPA 2FFKB 3T3FA 2Y0SC 4Y2PA 5DB6A 4PL1A 2H3QA 2IOFK 2OYYA 4WJ3M 4KLOA 3ULJA 4DV0L 2QILA 2KQ3A 4ED0A 1HA5A 4KLDA 3EW9A 1IBKQ 2CW0C 9ICOA 4C8LA 4KHZA 1JOKA 4PZ6A 5J3BA 1Y8OB 4O0AA 2UUCL 1BPDA 2BQUA 3TSSA 1WUDA 5AKXA 4AH6A 1ZQWA 1SXEA 4R8UB 5J0SA 1CQFA 2K28A 4LUVA 1VQ5A 3RR5A 5JU5A 4DUYQ 1TS5A 3P75A 3N7SC 3PIO3 2HHWA 1FD7D 2Z6KA 1Y1VG 2KJ5A 5EPJA 1BVSA 2HSZA 4GZYC 1CKOA 4A3JG 2F0LA 4R1JA 8ICXA 4Q0FA 2K8AA 1NJZA 1GOZA 4DR3L 1ZQCA 5ALUA 1BCPD 4X62L 8ICYA 3ZD9A 3N7PD 1T7PA 1EYCA 4A3GH 2B3GA 1Z1VA 3F8TA 1BR9A 4IPCA 1VQAA 4DN4M 3S2HB 1XMOL 3IM1A 2RA4A 4HMJA 7ICHA 3G6YA 1TQOA 1B4OA 4UATA 7ICPA 2PW7A 2ALZA 4JI8L 3PO4A 3BQ2A 2JH1A 4DR4L 2PQEA 1OUQA 4P73A 1J6QA 4H7BA 4NMZA 3HOYB 4EENA 2I6XA 1BUVT 4IJLA 4BBSH 5F3XB 2EH9A 3EPGA 2BCQA 4EQPA 2ZIUA 1RTOA 2Z0SA 1I4GA 4UPAA 2UUAQ 1ZD3A 1PUZA 4A3KB 2JEIA 4DFAA 3KDFA 4K14A 1LABA 4MN3A 2XY6A 2NZOA 5AKIA 1KDHA 4XXEA 5EQ0A 3H3VC 1KAAA 2L5TA 5FLXL 5AJ3L 4QZ8A 3UDIA 3L4PA 5J2CA 4IO9A 2LYAA 1XWEA 2WB1E 1VQ7A 4OD0A 5J0WA 4I2GA 1OO9B 7ICVA 1LLRD 4U6PA 1PDQA 3H91A 4RA8A 3VYSA 3HRZC 3PUXA 4QL5A 5CV7A 4JI5L 1QQ5A 2A74C 2PMZF 3RRGA 1QLNA 1S5FD 3SK6A 4C3HB 2QEXA 1X3GA 4ECRA 1F9PA 3A56A 3RZOH 5H2FU 5KNCA 2BPCA 3H0GB 5CGKA 5AI6A 2DJFC 3PCOB 4POFA 5LMNW 3MABA 3NEMA 2GLEA 4I2AA 2B39A 4NW2A 4OONA 1JUDA 2ZIVA 5AKEA 3UDGA 1PK1B 5JEAH 4LNQA 4LF5L 1IG6A 3DUZA 3Q23A 1FJGQ 5D3DA 3PUYA 3BS1A 1LTRD 3TBIB 1HJPA 3GV5B 4QWDA 3A8KE 1SEBD 4PZ7A 4DR1Q 4GKKL 4TUPA 2JGAA 5KAFU 2ID0A 1EIGA 2A1AA 1S5BD 2QGQA 5KFIA 5AKZA 4ABNA 4FF2A 5T1GA 1VQGA 4F72A 2A6ED 1XU4A 4R4IA 2ZJQA 2DUYA 3MFHA 1YJ9A 3R8BA 3FDSA 5CA7A 5J0YA 2F0VA 1S0VA 3O0FA 3G6XA 3AEVA 2BE5D 7ICQA 1SB3C 3VR4A 1AH9A 4DR2Q 2EYJA 1IM4A 3HILA 1Z3EB 5AKKA 4Z6DA 1Y1VH 4JYAQ 8ICHA 4A3JH 1URJA 1BCPB 1CQVA 2SEBD 2R8GA 3OPOA 5JOBA 1KC8C 3VA5A 4NLCA 1N33Q 2JA7G 4F88A 7ICRA 3KYHC 4QJFB 2WV6D 4A3EB 1E22A 4B6JA 3B0YA 3HEJA 4RGOS 1N8RC 2R8IA 3BJUA 3DWPA 1QCBD 5DB8A 4K6DA 2EJMA 4ZKCB 4RNMA 4ECSA 5IYDH 3OWEB 1O7YA 3V2TA 2IJ0A 2JA6B 2JA8B 1ZQSA 4G4KA 3M7DA 5J0PA 5M3FB 4KMUA 4MFFA 1TS3A 4ZLTF 4QW8A 4IFDG 1CRXA 1U4LA 1GHKA 4DV1Q 1N48A 3S9WA 2RP5A 2SDFA 4FXGC 2BQRA 5DB7A 1NUCA 4MZ9A 2FLPA 4TSSA 2E75C 2K5DA 2E8OA 5C6AA 5BPCA 5KFAA 3NXWA 5KNDA 2I5LX 4DAVA 4ULLA 3D4DA 4WORA 3D6WA 3WK5A 1EU3A 4ZYSA 3OW7A 3SK5A 5J2IA 4P71A 3I91A 9ICTA 4UY8C 1K28A 1O80A 5HY6A 8ICZA 4KLSA 1BNOA 3V7LA 3GV6A 2HD3A 2BPGA 2XGQA 3CCEA 1ECWA 1MBYA 1SWWA 1S0NA 2JR5A 4I7ZC 1EIFA 3PUVA 5DAUA 1FEZA 2K33A 4JI1L 1S5CD 1Y1WB 2HBJA 4DFKA 4B9MA 2UU9L 3T16A 2KVCA 3T1YL 3CW2C 4YHHQ 1I6VC 3NELA 5J0QA 5KFHA 1G2TA 2XVTA 4C8NA 2M9NA 3HPOA 1S97A 2RSOA 2NBFA 1PYSB 5LL6X 2Z4IA 2XIWA 4LFCQ 4PJ0U 5FOBB 9ICAA 1K8OA 4IRDA 1CHQD 4UP7A 3MTSA 3OIQA 4N9TA 1XMQQ 1TWFH 4EX5A 1AZPA 1EEID 2WAQF 4PZNA 2QB0A 1B3QA 1CUKA 3QUTA 1QNKA 3T5KA 4CE6A 3FHWA 2F77X 4F4XA 2W3RA 4TVAB 1KDCA 4KLQA 5J2KA 4EQ5A 3F2BA 1TS4A 1WTPA 4GKJL 2HHQA 1I3QH 4HAEA 3NS1A 5J0RA 4C7YA 4M6WA 1B1ZA 2OEHA 3FMCA 3BDLA 4TQRA 1HCZA 1PZID 2G09A 2L9HA 4QZBA 1QE6A 2VB3X 1YHQA 2JA7H 2KOBA 2BCUA 2VA3A 2B2WC 1Y8PB 3TFRA 1ED1A 1SN8A 4F5PA 1R4PB 4A3GB 4ED6A 5KT6A 4O3PA 3EFXD 1CT1D 3A55A 3Q6SA 1U9RA 7ICSA 2VQFQ 1L3TA 2J4XA 2PMZB 2BPFA 4KTAA 4RAUC 2FPMA 2JEGA 3HOZB 4QZIA 4QZHA 1LT6D 1QG7A 2R93G 4IFDH 2G5IB 4ME5A 5FLXE 2ZJ8A 1WCNA 3NBHB 5GAHC 2K14A 3OSOA 3JPTA 1A3UA 4JV5L 3EUB2 4FF4A 2F4IA 3T1HL 1F44A 5CR0A 3I90A 1NZBA 2YTYA 2FLLA 4B3ML 4IUQA 1VQPA 4K6LA 4Y2RA 1RJTA 2L4NA 2A6EC 2R7DA 1F2MA 1KSPA 2EJFC 2LY7A 4R65A 3VA7A 1LKYB 3QB3A 1S9FA 2K04A 1TFRA 2W3SA 3Q8LA 3FDTA 3RLFA 2PI4A 3GIMA 3WU2U 2IPKD 5IE8A 1ENAA 4WFN3 3P7JA 1XPUA 2E2JB 4Y52H 4BX9C 4RCOA 3VYUA 4JI7Q 2UVRA 5L1LA 1STGA 3ZDCA 5CV8A 4QQBX 1UEBA 3DLLA 1XSPA 2F4VL 3GFKB 2DFLA 1ZYRC 3S2DH 5LMNL 2I1QA 1J5EQ 2F3WA 1SNPA 3CCMA 5I6YA 4B3SQ 4MHVA 3S24A 5KFBA 5GTHU 4R9WA 5EE9A 3KHHA 2RVLA 2QKIC 4H0LC 8ICIA 2LYHA 4IURA 3GDEA 4EGVA 1EWIA 4ECYA 2PMZC 1X3EA 4J9SA 4FP5D 1KIXA 1MC8A 2SNSA 4FF1A 1VQFA 5EKIA 4KLKA 3IAYA 1S77D 3HT3A 1KFTA 2KVMA 2LPEA 1RKNA 2JMGA 4C80A 3KKAC 1IV8A 1I6HB 3IN5A 4G7OC 1HUNA 3MGHA 4YMOA 1WTXA 2YTVA 1VMCA 2E5LQ 4QNLA 5E1FA 2BOSA 2J6UA 2NRXA 1SJHD 4HIDA 3C1FA 2F0WA 5ALJA 3ZDDA 2B2VA 4X65Q 2F8KA 3IRUA 3DEEA 3P20A 5FLXc 1WVLA 3K5NA 2I0QA 4EYIB 5ALYA 5AI4A 1JOOA 1LT3D 1WYGA 1I4QA 2NUCA 2N1RA 2KD1A 1PLFA 1STAA 3RH4A 2KSOA 4ZOHC 4RHRA 1VJ5A 2D6FC 4YCWA 1D8LA 4CDCC 3W3AA 4RQ0A 4UAVA 3HOXG 1TY0A 5AI5A 1XC9A 2E2HH 3D6CA 4X3SA 4EVOA 2R93H 2PMZE 2KEYA 3TADA 2HBLA 2KHQA 2FMSA 1UQVA 1MGSA 1X54A 2V4DA 4DPGA 1B43A 2KKPA 5C4XG 3CC4A 3UQ2A 1YNJD 2K89A 4O3QA 4LF4L 1KL9A 3PW5A 4Y2TA 1L7PA 2VZAA 1HR0Q 1F5SA 3MC0B 1BPYA 5K4LA 5C5JA 5C44G 1SYFA 5AIBA 3IFTA 4KY7A 1QJOA 4F93B 2WAQB 2ODGA 4DV4L 4MF8A 3S17B 1JR0D 2MNAA 4Z9CB 5AHXA 1A2TA 1SDFA 3F1ZA 1EQTA 2HHXA 2EANA 4HIOA 2IW3A 4R4QA 1QSLA 1O03A 2HUGA 3T5JA 4ZCKA 8ICFA 1UPHA 2XGPA 1AW7A 2W04A 1O78A 2Q8RE 3A5ZB 1XPRA 3K6OA 1PH1A 5AK6A 3GILA 2RQXA 1S72A 4CNQA 2AGPA 1PVQA 2WACA 3FKIG 5T14A 3V6KA 5KG7A 3H8SA 1I4XA 4L63B 2QA4A 5GADC 1M6YA 3QU9A 4JVZA 4KKUA 5J8YA 3RJIA 5JUMA 4UBBA 2WP8J 2O5IC 5HMMA 4YY3Q 3C2PA 3M7NA 2B2YC 3DHQA 4M9NA 3RJFA 2M9VA 3DEOA 1PH8A 2ATWA 1SMYD 4OHJA 5ALRA 4UW9A 2R7FA 2SOBA 1EQVA 1V85A 5DLGA 2EYPA 4RUAA 2EXDA 4LMQD 3MEHA 1A3TA 4JBKA 3UPQA 4DL7A 1I3QB 3JAMi 3OPXA 5F9NA 4JI2Q 3GIKA 2WAQC 4X64L 1WTRA 1K0RA 4Z6CA 3TREA 5C4HA 1PVPA 5LMUQ 5KFXA 3M7GA 1C20A 3SAGA 3WKCA 4DK1A 4A3LG 4J03A 4UB4A 1UEAB 5IODA 4B3RL 4A3BB 1E2ZA 4QWCA 9ICWA 1WD1A 3TZUA 3H4DA 1LV9A 4PL2A 1NMGA 4DK0A 2ZXOA 3HOXH 3NK9A 1JWSD 4Y2YA 3GQCA 5B5EU 3MVVA 1K73C 3CCLA 1B8AA 4A93B 2YMMA 3GQBA 1D9DA 4LFAQ 4M04A 5C4XH 4V0BA 4LF9L 5K36G 4LF6Q 4HTHA 2F8LA 3VYRA 1EIHA 2C35B 2I5HA 4IL6U 2E1EA 3R2IA 3K8AA 2NYVA 1TIID 3ICXA 1D9FA 1H9MA 2A1JB 5C44H 4CF4A 2KEEA 2JSOA 1FIQA 1DGSA 3KBGA 4UB2A 1TWCB 1X32A 5ALHA 3MR6A 4J9QA 1D7QA 2WAQE 3ND8A 4CRXA 1LVHA 4DOCA 2AU0A 2HQLA 5NUCA 7ICKA 5I9PA 3MFGA 1YJNA 2GVBA 1MKHA 4OIKA 3A7AB 2F3VA 2L15A 4DV7Q 3VCBA 1B9NA 4QY7A 5AK4A 1HUMA 7ICLA 2NVTB 2P35A 4JI6L 2W8KA 4DF8A 4ZRZA 4DUZQ 4DV6Q 4KJNA 5DDYA 5IIFA 3BJYA 2CWAA 5KG6A 4DGZA 5KFCA 2RLTA 3AB9A 2LMRA 3D0FA 3NQIA 4BDPA 3K0XA 3NWSA 3DWAA 1J2MA 2AGQA 3HKZG 5BR8L 4LFBQ 2HCFA 3PR5B 5EGTA 1SNMA 2W9BA 2KA7A 5ALOA 2HHVA 3E0EA 4UBCA 2Y0SF 4APVA 5HGQA 3I56A 2CN1A 2WFWA 2Z6BA 3AU7A 1L8OA 5L1JA 1M8AA 2QLTA 3FRPB 4J9LA 4M9HA 1ZQNA 4CDGA 2RDJA 3R9KA 2N78A 4K4HA 4KKSA 1T4GA 1MQ2A 2KZZA 8ICQA 3RZDH 2NVQB 3C3LA 5FP0A 1T9HA 2NZHA 4PMCA 2PCFB 3S1NH 3GV3A 5IP7G 1VQKA 3A7LA 1R4QB 2A19A 3PIP3 3S1RH 4O3OA 9ICSA 4KHVA 4PNYA 1QVFA 1ENCA 1IBML 5C0YA 1EY5A 4A3LH 4NDXA 2MUYA 5KFUA 2W43A 1PTOD 4GOPB 1UNSA 5AM0A 5L1IA 1GO3E 4I65A 4AQYL 3MR2A 1G51A 2VS1A 4DQPA 1NTGA 2EDGA 3K4GA 2UVVA 3SVMA 2YYZA 2E2HB 5ALMA 1TWAB 2NRVA 4EX6A 5KG2A 2IT1A 3NHHA 2R93B 3K7AH 2ISOA 1EQRA 2YY6A 1SKWA 2DN8A 4C2MB 5K36H 4YCUA 3G6VA 1I4RA 1H9SB 4LZGA 4GXKA 4K0KQ 5FJ8G 5J2JA 5AI0A 2EYOA 4QUFA 5KFKA 1SMYC 4QZGA 4GC7A 4K8IA 4NM1A 4BA1I 3HP3A 3MFIA 1RYSA 3NTKA 4GNXB 5IINA 5TSSA 1K1QA 5KG5A 3OHBA 4BXOB 2YU9B 8ICKA 1STHA 1SE4A 3KOOA 4RQ5A 4KLUA 5IGDA 1P7DA 5GTIU 3NTUA 1B0XA 1IHZA 3MAQA 1BNZA 4KD4A 3SDZA 2RHQB 3RBEA 1STYA 2Q8TA 4KLJA 5JPNC 1LACA 3C28A 2CW0D 2R18A 2KECA 4F50A 3A0HU 2KCTA 3RAXA 2H3FA 4JWMA 1JALA 4BUGA 1SMXA 4GOPC 2OTLA 5ELNA 2K8BB 2ZM6L 1ZQYA 2A68C 2D2CC 1WG8A 3L0OA 1VQ9A 4P0QB 5IILA 1U45A 1I94Q 2WHEA 4L5TA 2RHFA 3CP0A 3TRZA 1EY4A 4C4RA 5DNFA 3PV0A 4OO1H 1JC7A 3S15H 5CV9A 3RN2A 2OHFA 1U4BA 1VF7A 4I2IA 4JC0A 2F1IA 2PO4A 3V96A 1DXMA 1EY9A 1U47A 1B50A 3SK8A 3NVZA 1LB2B 2HOQA 4CGZA 1WCLA 2ZUDA 4R64A 5KG4A 3RRHA 2AQ2B 4RKBA 5IP7H 3B9JA 4L6TB 1OXJA 4QZDA 1DCZA 4RPZA 3CCQA 1SBBB 1JWMD 3M6ZA 1F9SA 4YN4A 1NR4A 4JK1C 3RAQA 2EAPA 4HJ8A 1UT8A 4US9A 1RQLA 1QWYA 4CKCA 3JAML 1SFOB 4CBVA 2CQOA 1CSQA 4CCHA 2FINB 1H9KA 1WWUA 2G06A 2FE9A 1B3AA 2JEBI 3I72A 8ICWA 2E2IB 4IR9A 1ZQJA 8ICGA 1N32L 3A54A 2CH4W 2AWOA 1YEZA 1L7MA 1KDBA 3HOUG 4F4KA 4DUYL 2JK8A 3X3NA 1X9SA 1D5ZC 3HOXB 3GTLH 2F3NA 1FFUA 3JPPA 1TKDA 1Z4OA 3TP5A 4BWMA 3MEFA 1ZQFA 3MXUA 2FHTA 5AKYA 2FMPA 3LVWA 3M9NB 1II3A 2J0TD 5C4XB 5FJ8H 1TU2B 2K60A 5KT4A 1UE7A 2E8PA 1COKA 3ALRA 1XX8A 1MQ3A 1VQMA 3TFSA 2ISPA 1T3NA 2HDOA 4BWJA 4HIKA 4BY7H 1PH9A 3FP9A 3V05A 3QU5A 3RJKA 1MSWD 1U4PA 2VW9A 2H3VA 2F1HA 1K1SA 4JG2A 2XRSD 2JZBA 1X3QA 8ICLA 2Y0SB 4MEYA 3KF8B 1ZQTA 3NPPA 1SE2A 9ICKA 5ALLA 2ZIXA 1PH6A 5T1IA 1LTGD 1PZKD 4FO2A 4HJ9A 2IHEA 3NSWA 1XYIA 4DF7A 2F0FA 2XCPA 3I55A 4X5VA 5JAVA 2BQ3A 2R92G 5HR7A 2KHSA 3J81L 3C5GA 2CXYA 4O5EA 3QU4A 1PRTC 1N62A 1XSNA 5FK9C 2CRXA 2AMCB 3I73A 5KFGA 1HZ9A 5IWAQ 3OSPA 2BCRA 5IYBH 2D62A 5EWFA 3IP4B 4RNOA 4YWLA 3TAPA 4KN7A 1HFGA 2EY5A 1XMOQ 2XSCA 3WWVA 2B63H 2PFPA 3AN1A 1TAMA 3OW2A 3PO3G 3S16B 4OCZA 4F4ZA 3SI8A 3EQLC 2W03A 1EWHA 3S1MB 3KFUA 3GTPH 4Z6FA 1QILA 1K9MC 3NUQA 2A6HC 2AKWB 2QARA 3G6EA 1EZ8A 4CDDC 1PH4A 3N6RA 2B29A 4P0PB 2F1JA 1KRSA 3E9HA 3ICEA 3B6YA 1FJGL 1ZQUA 3S1NB 3K1ZA 1HNWQ 1ZQPA 4DR1L 4IQTA 1X65A 9ICFA 2W7PA 3SR1A 3MFYA 4IFDI 1ZRNA 2WF5A 3J80L 2LYBA 3BQ1A 1T8EA 1S0OA 1E7ZA 4JCVE 3GIIA 2HOFA 1JICA 3S14B 4JUZA 1KNEA 1VQ6A 3U9OA 1D5MC 1ZD2P 4DR2L 4P4MA 2BR0A 2IHFA 1Q8KA 1Q12A 1XNQL 1EFWA 3E3XA 1BPXA 4RGMA 5BN5A 1WI5A 2A69C 2L12A 5A0LA 2M0NA 4R8UA 3CMEA 3KZIU 3EA6A 3K7AB 1NKCA 3C2LA 3H40A 1VQJA 5IGEA 2EY2A 2ZUCA 3D31A 5FKAC 3TP6A 1KBUA 1VQCA 1IIPA 1CKNA 4KMOB 2K1BA 4C3JG 2G5DA 4QZFA 4R4OA 1SZPA 3KLRA 1AP0A 2E8MA 3I4NG 2KVSA 4EBCA 2K5HA 2LFNA 5EBCA 2EZYA 2B2TC 3PSIA 4DV2L 1SV0A 4B3TL 3UXNA 4EX7A 2H4OA 3BVGA 4LWCA 3A5UA 4F8RA 3CPFA 4JI4Q 1BGXT 2Y0SE 3DXJC 3M3YH 4M9GA 3KF6A 3NWTA 4C3IH 5CJ7A 8ICSA 1SL2A 1IYVA 3SV3A 4IUVA 1JN3A 4GXIA 2BCSA 5BN3A 2R92H 1T5EA 3TQYA 3J81j 3D3RA 2LBOA 3EROA 3QR8A 3HX0A 3CPWA 2K5VA 1U9LA 1WWVA 1QUQB 4UB8U 3OWFA 5FO8B 9ICMA 2XY5A 3V7KA 4DAPA 3ITPA 5ALIA 1DXSA 1KW4A 3NVYA 2HHSA 3GTMH 3PO3H 3LWLA 1AN8A 2AXTU 1MHWC 3QO2A 3ULLA 4UAUA 4L5QA 3PQIA 1IL2A 3HOWG 4PHPA 4RU9A 2VL6A 2CFMA 3JAME 2BA1A 1I4HA 3R3OA 3NASA 4MFCA 1K5OA 3GTJH 4DV5Q 4LVSA 2ZIUB 2YX8A 1P8LA 2E5SA 4RCNA 4X3TA 5I4DA 1TWHB 3J7ZC 1YZ7A 3A0BU 2LI6A 4DFMA 3QU7A 1Q46A 2KBNA 5JJKA 1XO1A 4DL3A 1F2LA 4A3FB 1PK1A 1S5DD 1Z00B 2D0PA 2A8VA 3M4OH 5DLFA 1L3UA 3BDOA 9ICJA 2F44A 4J15A 4OGQC 4DL4A 3ISCA 3S1QB 2WKCA 4RQ3A 1S5LU 3TN2A 4C7ZA 2LM1A 1E1TA 4P2CB 1IL8A 3QOJA 4J9RA 2EYLA 4PHAA 1HA6A 1RIPA 3WDNA 2HCIA 1V8QA 2Z6KC 3EWAA 1A8VA 8ICUA 3K5LA 2JEAI 1ZKOA 3A74A 3JC66 3SV4A 3ULPA 4RQ8A 3L5KA 2KHVA 4J9OA 1ZQXA 2AUKA 3G48A 4OIJA 1U4MA 4BBRB 4G7ZC 2PNRC 4H44C 1DONA 2HIXA 1K83B 2LXKA 4ICAA 3AU2A 1J97A 1M4VA 2MO0A 3G6JB 1JE5A 2OEOA 3PO2G 2NWGA 4C3JH 1XJVA 2Z1CA 2GVAA 1ZYRD 3ZDAA 1Z7TA 2RCNA 4YXMA 3LWMA 5JJLA 2UXBQ 3I4NH 2X69A 5FLMG 4BY7B 5ALTA 1DJRD 3BZDB 2F0DA 1G291 3J81E 3HJEA 4KLMA 4QZCA 4A3MG 3QE9Y 5KAIU 1CFMA 1LTBD 4UP9A 4DR6L 4TQSA 3QEAZ 2DF4B 2K8CB 3M85A 2MJ8A 1LV5A 4HEDA 3S17H 4ZAIA 4DXGA 3TS0A 8ICNA 5G5GA 4DU9A 2UUCQ 4IC9A 2XNAC 3QUQA 1BOSA 4YIJA 3J7AF 3PSFA 4NXML 4YFKA 4DSJA 2KEDA 1ZYQA 3H8MA 1LYLA 5AICA 1Q90A 1KFDA 2EYMA 4ED3A 1WCMG 3QG1A 3JAMc 1QZGA 2VNUD 4R8NA 1X66A 3AUOA 4P74A 4JI7L 2KUMA 4ILWA 3MR3A 3RFAA 5C4JH 4DR5L 5ALXA 4PH5A 4M9LA 1LUZA 4DR3Q 4RPYA 1Q3UA 1SYCA 2RCFA 4DL2A 1AQ6A 4X62Q 2B63B 1J5EL 2LKVA 4B3SL 5KFWA 2ASBA 3Q8MA 5AM4A 4FDBA 1WD0A 3I4MG 5J2BA 1A76A 4ED1A 1CM9A 1FL0A 4DR4Q 1XNSA 2N49A 1HZBA 2YB4A 3MGVA 4OWXB 2CKZB 3UMCA 4OJPA 4XQ8A 5DGBA 3KLSA 1JQYD 2G0AA 1UE5A 2F2AB 3ZJYC 4NLGA 5HNKA 1ZQQA 2JE6I 9ICXA 1N5WA 2EAOA 5AI9A 1NJYA 3RJGA 3T13A 4QZAA 1G6ZA 3F5EA 4F5RA 7ICTA 3K59A 2MFIA 4H13C 2KCNA 4XTCS 1E24A 3R93A 4P2HA 3R2TA 4E0DA 2SNMA 1BF4A 4I2DA 2PZTA 5AJ3Q 1DOMA 2JEFA 5KFYA 4B9VA 1VF5C 1Q81C 2R7ZG 1BQQT 4AP9A 7ICFA 1BXTA 3BQ7A 3C1EA 2ZTDA 4NLBA 2W8LA 1YJWA 3H94A 1F9RA 2FMQA 4JI5Q 2UXCL 1U0LA 3SMVA 3EPIA 1PMRA 1NI3A 4ECTA 3IHQB 4A3DG 3KBXA 4KHPQ 3MXGA 4C0ZA 3PO2H 1N9WA 2Y1IA 2FXQA 1TV9A 1QSSA 4YCXA 4LF8Q 5HR6A 5HHHA 2J6TA 4DS4A 3T4AC 3TKAA 1JORA 3IV6A 3AYHB 1GVPA 5FLMH 4KMUC 4GFJA 3PX4A 1N5XA 2QB0B 1RG6A 2AH5A 2DKZA 2MAXA 1PH2A 5KEEA 4GKKQ 2K7VA 5JRTA 4JMUA 3GU3A 2N8NA 5C3XA 4FF3A 2K5NA 3RMHA 1JX4A 5JVH3 1BNPA 3NBHA 3D2SA 4C3IB 5H1SE 4M6WB 1JJ2A 3AQFA 5J22A 1CKMA 5I2XA 1L0YB 2IOHA 4BBSB 3OHAA 1EOVA 1WCMH 1ZEQX 2OM6A 5JTIA 4NL9A 3UQ0A 3LWUA 4N8FA 4DSKA 3BU2A 4NXNQ 1X3FA 4OEMB 5I2YA 1JCKB 4DL5A 2ENBA 4U673 3CCJA 3C29A 4PPXA 4DF4A 1GO3F 2O5JC 3KK7A 3MXNB 2Y9TA 3PO3B 1BPBA 1CI3M 1B22A 5KG0A 4HYKA 1E0BA 3MXPA 5CC4A 2KE7A 2EIFA 4R4TA 3I4MH 1E3PA 2HW3A 1KXLA 4DQSA 4ODGA 1OXVA 3Q8KA 5JVG3 1PV4A 1O7ZA 1XNRL 3RZOB 3GTJB 2XC9A 3H3VI 4XRHA 4KLIA 1V1QA 1HNZQ 4DLGA 4CDEC 1BDOA 2QW7A 4JI3L 4CHTB 1Q86C 4RQ4A 5DBAA 3V6HA 3RNUA 1ZQAA 1RDPD 2TSSA 4KTQA 1STBA 3E9IA 1Y69U 4K5XA 4EYHB 1QVCA 4AYBG 1M90C 1IKMA 3GP7A 2W9MA 3IFDA 4PMBA 5A35A 3M4OB 3I4OA 4C4SA 4KLLA 1RD9D 2ZJPA 1JJCB 2F0OA 3GO5A 2R7ZH 2ZIWB 2HDLA 3PF5A 2UUBQ 4L5RC 4K4IA 4JOIA 4IUTA 2BDNA 4DLEA 5CHGA 2EY1A 2RKSA 5DBCA 3PX0A 2C2RA 3WK9A 2YTXA 1SZHA 3NTIA 2DL0A 3SR6A 4NP5A 4G7HC 4A3DH 4IUNA 1S5ED 4E6IA 1RL2A 3CCSA 1VQLA 4JI1Q 3AL0B 4F8MA 2NVXH 2HI0A 4JBJA 1EUJA 4J6HA 2NV3A 1Y1VB 2F0HA 3CKIB 3T1YQ 5AM2A 5KT3A 2LS01 2OTJA 4A3JB 4F5OA 2G9DA 3SD7A 5DLQE 5KFQA 2JP1A 3CAMA 2IY5B 3OIPA 2XICA 3K57A 5IIMA 8ICCA 2WIIB 1AEXA 4DA2A 1C9OA 2VUMG 1QOHA 1RQNA 1ILQA 1E1OA 2D9UA 4LF6L 2X6GA 2AWNA 4LUOA 4DV3Q 3OYYA 2KZ3A 1F2YA 4G57A 1A6SA 5COYA 2DKXA 4JI0L 4ZKBB 5DB9A 4LF7Q 2EYFA 2W9CB 1UE1A 3HWTA 2KENA 4OO1I 5E79U 2VQEQ 4Y2SA 4KKTA 1ZQBA 4XQJA