2ZTEA

Mtruva form iv
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
133
structure length
133
Chain Sequence
EFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 27
structure length 133
sequence length 133
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2zteA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zteA01
3TFRA 2NZOA 1WCMH 4JBKA 4QW8A 3HFZB 3SGIA 4LFBQ 2VANA 1JE5A 4F91B 1PH8A 4F4KA 4AYBG 8ICPA 3FKIH 1ZYQA 3F2CA 5EOZA 4F92B 3PUYA 2NVYH 4X65L 5L1KA 5AJ3Q 5JJKA 4Z6FA 4I2BA 3PX0A 5M5WH 2F3IA 5CB1A 3TEHB 4HJAA 3SZ2A 3H15A 3CCEA 1Q8KA 1SLJA 3CC7A 3IHQB 3I7FA 5IT9c 4UAZA 4XTCS 4DV3Q 2JA9A 3F2DA 4MEXA 3H0GH 3TQ1A 4RU9A 2UXCQ 4GNXC 1B22A 1B70B 3HKZG 5TZVA 2MO1A 3MDCA 5DG8A 4UP7A 5C4XH 2AGOA 5DDYA 3TRZA 1Y1VH 4EYHB 3PW5A 2NRXA 3CCVA 5KFHA 8ICZA 4DUZL 3PUXA 2BCQA 4RQ0A 4Q43A 4ECZA 1HZBA 4R4QA 1EUJA 4QZCA 2ISOA 5DGBA 4GS3A 1HNXL 1YITA 2C28A 4GOPC 4DOCA 5GAGC 2VUMH 2CWAA 2ZUCA 3UE1A 1NE3A 2KBNA 4OXPA 1P16A 2WAQG 1ZQCA 5C4XG 3JPNA 5C4JH 4FS2A 4DV7Q 2RF4A 4JBJA 2JEBI 4Z6EA 4A93H 3W1GA 1NJWA 5C3EG 4DL6A 4P2HA 4GXKA 2UXCL 5J0RA 4DUYL 1KL9A 4DSLA 4QZFA 3IM1A 4X64Q 2ZM6Q 1HUZA 5KFOA 4F50A 3TAPA 1ZQTA 2R8KA 3HKSA 4GLXA 1YJWA 1LUZA 3BQ2A 2JA7H 5EWFA 3CCLA 4DR2Q 2AQ0A 3RBDA 2OQ0A 2Z6KC 4YCVA 1IBMQ 1VQ7A 3W5OA 4DV7L 4P73A 5D4BA 1WYDA 4DF8A 3TREA 2B21A 4BY1H 4YCUA 4BWJA 5IILA 1UT5A 4F2SA 3PX4A 2MQHA 4UBBA 3CW2C 5DB6A 3PMNA 3S1RH 7ICHA 4NLZA 5L1IA 4F4XA 3AFQA 1SL2A 1HJPA 2VA8A 2ZUDA 1AROP 3T1HQ 1A62A 3JPPA 4NXML 2RHSB 2PFQA 1CKOA 4YCWA 3KJPA 2N8NA 3TS0A 3J7A5 2UVRA 1D8LA 3S16H 2BDPA 1YHBA 2PMZE 4ECXA 4KLGA 4MEYA 1KC8C 4JI5L 1TAQA 5J0XA 4GXIA 4DAYB 2UUBQ 7ICUA 3KHHA 3U58A 2D62A 3DLLA 2UUCQ 5J2BA 1JT8A 3LWLA 2UXBQ 2XGTA 2VS1A 4PGXA 1A8VA 2RDIA 5BPCA 4DV2Q 1WOCA 4DL3A 3VDYA 3PR5B 1VQ4A 2AWOA 3HKZE 2VQEL 4DV6Q 8ICLA 1PV4A 3EW9A 3EN2A 1OXTA 2EQSA 3JAMi 4A3EH 4Y52H 5GAEC 1QZGA 3HOWH 3OJSA 2HVHA 4HIDA 4GOPB 1TK8A 2VQEQ 3HWTA 3L2PA 4DV6L 5DQGA 4J9RA 3HOYH 3THVA 4X65Q 3HOUH 1XC9A 2WAQE 3B0YA 1K3RA 8ICNA 1KFSA 3NELA 4KLFA 3I4OA 3UE0A 1E7ZA 2NN6I 3RRHA 4PZ8A 2VY3A 1UE5A 4PHPA 4UQGA 5EAYA 4EZ9A 4GOPA 4RPZA 4R66A 4QZEA 3C2MA 1A0IA 1NJZA 2AGPA 2ES2A 2NN6G 2FMPA 3MEFA 2BCRA 4LF5L 2PFNA 4B3ML 4CCHA 1XS9D 2YYZA 4A3GH 1U47A 3MGIA 1U49A 1VQCA 5KFZA 4P72A 4KHPL 4DUYQ 3RTVA 1Y88A 4XQ8A 5KG6A 4YFKA 3TFSA 1KRSA 3RJJA 4LNQA 3ICEA 1WFQA 4A3BH 4R64A 2HHXA 3Q8RB 4ECVA 4ECTA 3GILA 4I2IA 4QZAA 4IQWA 5M3FG 4O3QA 1NMFA 4LZGA 4KLUA 4I27A 1S0OA 1Q46A 1BPXA 1T4GA 1P8LA 3HT3A 1KRTA 8ICUA 1L2FA 4C2MH 5KT6A 5M5YH 2XCAA 4BY7G 1Z00B 3GDEA 3ETLA 5KT4A 1K9MC 3PF5A 2BCVA 4A3DH 3PO2G 1ZQBA 5IIMA 2Y0SE 2JA8H 2PNHA 3RR5A 8ICEA 1VQDA 2AMCB 3PIPA 4BA2I 2P6RA 4ED3A 4K0KL 4KTQA 2QEXA 4RQ3A 2ZJRA 4BXOB 8ICBA 4NXNQ 4KHPQ 3G48A 1Z00A 3A0JA 3OYYA 4JBWA 9ICSA 1X9MA 2I5LX 3FHWA 4UB1A 4L5SA 4LF9Q 1ZJMA 4J9NA 1IM4A 5KFLA 1VQAA 5JEAJ 3OSNA 1S0NA 3E9HA 2IY5B 5IP7G 4M9NA 5J2AA 5DLFA 2HHUA 5E7NA 2KN7A 4NLKA 4R4CA 4P4PA 4YWKA 1RZTA 5IY0A 4JI2L 4LF7L 4M9JA 3GQCA 5J2HA 3UQ0A 5C44H 1L5UA 3SYZA 3HX0A 4F3OA 4BBRG 4ED8A 5GROA 1KSPA 4YWLA 4B9NA 2BH8A 1KFDA 1HR0Q 4KLQA 4B9MA 3A74A 1PH9A 1S0VA 5J2DA 3GIKA 3ISDA 3HOXH 3CXCA 1K83H 4J9LA 1ZQYA 2UVWA 4TQSA 2L15A 1CUKA 2HVIA 4QWCA 4DO9A 3H40A 3UPQA 1PH4A 5KFSA 2FPLA 1TFRA 1QUQB 4EX5A 3GTLH 4M47A 1TWGH 3D31A 1K73C 3PW0A 1Q12A 2UUAQ 5ELOA 4UAYA 9ICIA 3PUVA 5KTQA 2Q2TA 1H38A 3HOVG 1U9LA 2JEFA 2PQAB 4LUZA 3PO4A 7ICJA 2I0QA 2ZM6L 4KLEA 2W9BB 3U4ZA 3MR6A 4YR2A 1NK8A 4I2AA 4DF4A 3GV7B 5HNKA 1HNXQ 2JJQA 4YY3L 2NRWA 1T3NA 4GLAC 4DK3C 3MBYA 1VQKA 1ZQUA 5KFPA 1VQPA 4DV4Q 2KCTA 2Y0SG 4XUSA 4KI0A 1XPOA 4JYAQ 5J2FA 4RQ6A 1Z3EB 1OXSC 1S0MA 1S72A 2R93H 4DV4L 4OO1I 4YQWA 1K0RA 3H8JA 2C35B 2EXDA 1TKDA 1IYJB 2W9BA 2E5LQ 3RR7A 3V72A 9ICMA 4M6WA 5GAHC 3PCOB 3S24A 5C0XI 4DQRA 3GIJA 1MC8A 4IQUA 3JPTA 2KENA 4GNXA 4B3MQ 1KEJA 5IP9H 3FKIG 4JI3Q 4EZ6A 5LMNW 3FDSA 1SKSA 4JCVE 4FBUA 2PI4A 2D0OA 3AEVA 4KLHA 2ASLA 1L3SA 5KFTA 3EPIA 4IR9A 1N33L 5BR8L 4LUVA 4A3LG 3AU6A 2HHVA 4MFCA 3KTQA 4O5KA 4P71A 1X3GA 1EFWA 9ICPA 1HR0L 1EQQA 1NK5A 4DR5L 2Z6KA 1Q1BA 3GIIA 4L5QA 2JA7G 5J0PA 4HIMA 4BBRH 5IYBG 9ICRA 2ZTCA 2A8VA 4LF6Q 5IYCG 3OHAA 3H8SA 1IBLQ 7ICQA 3GFKB 2K4KA 1FJGQ 1AH9A 4BY1G 4IO9A 4EBCA 2F1IA 1NMGA 4K4IA 5IP7H 2I1QA 4MNOA 3I2ZA 4DLEA 2IX0A 4YN4A 2J6SA 8ICFA 4P74A 3J81j 1NK7A 4A4IA 1FGUA 1UWVA 5HMMA 1TWHH 5CR0A 1KD1C 3MABA 4LF4L 3HOWG 4YCXA 5J2CA 3ORYA 2NVXH 4JI7L 4M9HA 5KG4A 3RJGA 1X65A 4YVZA 1SKRA 2IHNA 4LFCL 3ZD8A 4QZIA 1E24A 3S17H 2GVAA 2ATWA 4RNNA 1PH7A 4MFAA 1EQRA 4DFKA 1ZQGA 1U0LA 3WWVA 1PH3A 1B7YB 4GKKQ 3BQ1A 8ICIA 4L5TA 1LYLA 2OQKA 2BQ3A 1MJEA 4C8MA 4ALPA 4NXNL 4QWDA 9ICKA 1UEBA 4KLOA 3PVXA 7ICTA 1JB7A 4Q8FA 4O5EA 4GKJL 5IWAL 3G6XA 1LB2B 3BQTA 4HJ8A 3BU2A 1K8AC 5KG5A 1VQ6A 5KFCA 3KF6A 2Z0SA 1QTMA 3B0XA 2KZMA 2R8HA 2KCMA 1ZQQA 2NVTH 3ZDCA 4UP9A 3TQYA 4O0AA 3CC4A 3H7IA 1X56A 3HOYG 1JMCA 2AGQA 4QL5A 1QVFA 1JJ2A 3UXOA 4DV5L 4YR0A 4ED6A 2E8GA 2PFPA 4BA1I 3MR2A 3EIVA 2FMQA 4BWMA 3B6YA 4IOCA 1K8GA 1IXRA 4F93B 1G6PA 4X66Q 2GWSA 4H02A 4X62Q 3RZOH 4OWXB 1B43A 4J9QA 1N48A 3MR3A 1EYGA 2KZ3A 4MF8A 4QW9A 1SN8A 4Y7NH 4B3RL 3STBD 2FLLA 1X55A 4NM1A 1KDHA 4O3RA 2PI2A 2W9AA 4RNMA 5FLMG 4F4ZA 2ALZA 5KG1A 2R7ZG 4UP8A 1HUOA 2R8GA 3UDFA 1L1OC 5DDMA 4KHZA 1COOA 1UA0A 5J0OA 4A3CG 3ULPA 3UXPA 2ZTDA 4PGYA 3TI0A 1SZPA 1S76D 4IRCA 2HHHL 1QSSA 5KT2A 4DL7A 1ZQWA 4AYBE 3C5FA 4AIMA 3V7LA 1SFOH 5DBBA 2ATLA 1IZ6A 3CCSA 5JJLA 3GTGH 4I2JA 4NLNA 5BR8Q 1NK6A 1A76A 2BA1A 4GKKL 1ZQAA 3GD7A 1VQ9A 2VA2A 4DR3Q 4BXXG 2HT1A 4QWAA 1UT8A 3C23A 1D8YA 5KFIA 4C3HH 1VQNA 1YNXA 4IFDI 9ICLA 4DR1Q 3BQ0A 3RB4A 5IINA 5J0QA 1N32Q 2W8KA 3KJOA 3CQZH 8ICCA 1XPUA 2C2EA 2V1CC 3H0GG 4BDPA 2B63H 4B3TQ 4RT3A 2R92H 1JXLA 1XO1A 4F4YA 5HHIA 4MF2A 1RL2A 2BHNA 2BQUA 2P6UA 4F5QA 4JV5Q 2JZBA 2ASDA 1UE6A 4C8NA 2DPJA 2FLNA 4DFJA 3EWAA 1WJJA 1C0AA 1U45A 1ZJNA 1BPEA 4GC7A 1TVAA 3RH4A 4POFA 1MIUA 3N4MB 4DS5A 4DR4Q 4YD1A 4J9MA 5J3BA 2Q2HA 1SMXA 2B3GA 4YMNA 5H1SE 2ASJA 4RUAA 4KLIA 2XCPA 3SV4A 3V6HA 3G4SA 1BBUA 4HYKA 4QQBX 2W9CA 7ICLA 2VUMG 1XU4A 2CQOA 1XSLA 4K4GA 4I2HA 2QGQA 1RPLA 2NRZA 1JJGA 2BPGA 4PG3A 1E1OA 2MUTB 2GN5A 1T8EA 1XPRA 3SV3A 4PH5A 4R4IA 3GTOH 4KLLA 1PH5A 3HOUG 2UXDQ 3J7ZC 2LXKA 1JX4A 3RJHA 1DOQA 3CCJA 2Y1IA 4MFFA 3ZJYC 3CCQA 4R4OA 3KHLA 3C5GA 2ZJ5A 4C3JH 2PQAA 4IFDJ 3E2EA 1NJXA 1C9OA 2OTLA 9ICOA 1SL1A 4NLGA 4F5PA 3LDAA 1UA1A 1XJVA 4F5OA 4J9KA 1MJCA 4RG1A 5FLXc 4B9UA 1UE7A 1OXVA 3H4BA 4B3SL 3BJUA 2K14A 4YMMA 3LWMA 4KITB 5BOMA 1VCIA 3KHRA 1GKHA 1GM5A 4DSEA 3BJYA 3RJEA 4QWBA 1VQLA 2KFZA 1HZAA 4UY8C 3PMLA 1TXYA 4P4OA 1JN3A 4FDBA 5J0SA 3E9IA 9ICBA 1RXWA 4IRDA 1TWAH 4DOBA 3JPOA 4F5NA 1S77D 2BR0A 2PFOA 8ICAA 4ED0A 1SKWA 4TUSA 1Z9FA 3PSIA 4J15A 1XMQQ 4JI0Q 1ZQHA 4YWMA 2NVQH 1Q82C 2GVBA 5KG2A 4DV5Q 3CC2A 3Q8SB 5D49A 2I5MX 2OTJA 1KXLA 4JWNA 5DB7A 5KFJA 4ED1A 2E2HH 1EWIA 1VQJA 3RAXA 4B3RQ 2IBKA 2MAXA 2F52A 2HHHQ 3FP9A 1TWCH 3M9BA 1J5EL 1PVOA 9ICTA 3KOJA 2UUBL 3QEBZ 1C7YA 3PO3G 2AWNA 2ZTEA 1VQEA 1S40A 1S9FA 3W1BA 8ICTA 4QJFA 4BGDA 2PI2E 8ICMA 4ED2A 4DNIA 1TAUA 3RAQA 5KFMA 5KG0A 2ISPA 2YTVA 4DFPA 4YMOA 4F5RA 5IYDG 1NJYA 4LWCA 2VQFL 2UVVA 1XMOQ 3OHBA 4C8KA 4I2CA 3S2DH 4X6AH 5IYCH 5C5JA 5IWAQ 1NKBA 1QUQA 4DR5Q 4DL4A 3UXNA 1G51A 4XA5A 2NZHA 1LV5A 3JPRA 1MKHA 4AH6A 5DGAA 2F1JA 3H3VI 1JXEA 3J81i 1FJGL 4EQ5A 3K8AA 4JI6L 1ZQOA 3OTOQ 4JOIA 4PPXA 2WP8J 2MFIA 4J9PA 4P75A 2CWPA 3MFIA 4ECRA 5J0YA 4DPGA 3RLFA 2A1AA 4A76A 4OO1G 3JAMc 4M9GA 4DR6Q 4UBCA 2IA6A 4LF4Q 1ASZA 3ERSX 4RQ1A 4NXZA 1RIPA 2K75A 3KF6B 2N3SA 1BPBA 4A3FH 4DV1Q 4KLJA 1ASYA 3ISBA 3MXNB 4JI2Q 1S3OA 5FLMH 3CP0A 2AKWB 4Q8EA 4DV0Q 1XNRQ 4O3SA 4A3JG 3CF5A 4I2FA 3ZDBA 1LTLA 2XY5A 3PV8A 4EEYA 2PI5A 2JA5G 9ICJA 4RT2A 1XSNA 4JYAL 2A19A 1PZNA 4HIKA 4A3KH 3KHGA 4YHHL 8ICVA 1OTCA 1QVCA 4PGQA 2XGPA 2C2DA 3K0XA 7ICRA 2C22A 5CHGA 1X9SA 3H3VH 1KRPA 2BKEA 4A3FG 3QZ7A 3L7ZC 3M4PA 3I55A 2E5LL 1I94L 2K5HA 4A3LH 3T1YQ 1XSPA 1YEZA 1NK4A 3CMAA 4M2YA 3ISCA 3GTKH 5L1JA 2UUCL 5M5XH 3RJKA 3M9NB 3V7KA 3BDPA 4Q45A 3HP6A 3C2LA 3GTQH 4M0AA 4ELUA 3A5ZB 4A3MG 1NY4A 3V7JA 2N78A 4G3IA 1NBWA 9ICXA 2JEJA 3CCRA 4HIOA 2BGWA 3S2HH 3K7UC 4DFMA 4OX9L 2PXIA 5IYBH 4TUQA 9ICHA 4XRHA 5KG7A 7ICVA 3K75D 4LFBL 3CPWA 4Z6CA 3I56A 1IBML 4LF7Q 4RQ4A 4JI4Q 3PGZA 3H8WA 4JI5Q 4LW1A 2K5NA 3NTUA 2VQFQ 1XTDA 1CKNA 2R92G 4ECQA 5IYDH 3CD6A 1YBYA 3PUZA 3KDFB 2VA3A 1N36L 4GN4B 3PF4A 2AQ4A 3NGDA 2JQOA 1OXXK 3AU2A 3UQ2A 1VQIA 3H4DA 1EIFA 5GQOA 2NRTA 2ZJQA 4BBSH 5JUMA 1VQBA 3GTJH 5FJ8G 4AQYQ 1S10A 2XO7A 3K4GA 2BQRA 2DPIA 5J0TA 4I29A 4B3TL 4QZ8A 3RJIA 3QEAZ 1Q1EA 4IPGA 1AE3A 1E1TA 1WCLA 1L3VA 2J6TA 2YV5A 4R8UB 4A93G 2Q2IA 2F1HA 2XC9A 3ER0A 1JJCB 1HNZL 7ICIA 1NK9A 1QZHA 2AU0A 4F2RA 1T7PA 9ICQA 2CCZA 4JOIC 1ZQSA 1QLNA 4AQYL 1NKCA 1X3FA 4L5RC 2NRVA 4PZ7A 1ZQDA 9ICWA 2HHTA 3M7NA 3PNCA 1EOVA 1QSYA 9ICAA 1ZQRA 5LMUL 2JEGA 7ICFA 3OJUA 8ICRA 1YZ6A 4R8UA 3AFPA 3IRBA 3I4MH 3PO3H 2JA8G 2JE6I 4IPCA 4A3IH 4I28A 3PR4A 2K52A 4JV5L 4RQ5A 3HOVH 7ICNA 5HY6A 1IL2A 4M04A 5IIIA 5DB8A 3UDIA 8ICYA 2CKZB 2XY6A 4JUZA 3V6JA 4NM2A 2FPMA 2ID0A 5KFYA 4P4MA 2RHQB 1ZQXA 3FYHA 1IBLL 3BZCA 4GN5A 3KFUA 2ZJ8A 2AJQA 1YI2A 4LFCQ 1YJNA 2F4VL 4JI4L 5IIJA 2AHOB 3AUOA 2R93G 3HPOA 3ULJA 4A3IG 1Q86C 1V9PA 3T5LA 1NOMA 4KLKA 3UDXA 3MDAA 5J2EA 9ICNA 4GKJQ 4J9OA 3Q8QB 4IRKA 2A1JB 4XIGS 1KHIA 3F1ZA 4ME3A 5J2JA 4JI0L 3JPQA 1CSQA 4DS4A 4PHEA 1X2IA 3T5JA 3PIOA 1SL0A 2I5HA 7ICEA 1TK0A 1SR3A 2HQLA 4K0KQ 2CFMA 3DM3A 7ICMA 4O5CA 3RNUA 2R7FA 5IP9G 4QZHA 5KFFA 2H5XA 2N49A 4OONA 1ZQIA 5AJ3L 4QZ9A 2HIXA 4QWEA 2M9NA 1PH2A 1CEZA 4IR1A 1Q7YC 3PY8A 1XWLA 4KN4A 4JV1A 1OXUA 4RPYA 4NY8A 1KQSA 3C1YA 1R9TH 3Q8LA 1ZQJA 3PW4A 1D9DA 1O7IA 5J2KA 3T5HA 4UB5A 2D0PA 1HH2P 2ASBA 3OSPA 2WB1G 5KFKA 4DKAC 3N97B 5KT3A 4JV0A 2LYHA 1ZQZA 5CP2A 1N34Q 1FL0A 4LF6L 4PZ6A 4ECYA 4IQVA 3GV5B 1PHJA 4DSJA 4DV1L 3HW8A 4DSIA 5CJ7A 1I50H 5L9XA 2W9MA 4GXJA 4IJHA 2JEAI 5DBAA 9ICFA 3TANA 1KFTA 4C3IH 4UB3A 4R63A 5J29A 1VQMA 4ELVA 5DG9A 2P66A 5KFRA 4YR3A 3CCUA 3G71A 3PX6A 1VQ5A 4Z6DA 4JI6Q 1JIHA 3EPGA 5LMUQ 1BBWA 4DL5A 2ALYB 1PA6A 1N8RC 4RQ2A 4DR2L 2XTIA 4RZRA 4DV3L 3M4OH 1IBKQ 3M3YH 1E22A 3RB0A 4JI8L 4KLSA 3LGJA 4GC6A 2Y1JA 4I2DA 1X3EA 3PO2H 4O3OA 4RPXA 1MQ3A 2JA6H 3TARA 3U4VA 1HNZQ 3KF8B 5C3EH 4X5VA 5HGQA 4UAWA 3RB6A 1XNQL 2ZJPA 1NK0A 1BKBA 1ZQVA 2UU9L 1H95A 2B63G 1I3QH 3PV0A 2FPKA 3L0OA 3GTPH 3PO5A 3D0FA 4TVAB 4J9SA 2F4VQ 3I4NH 2LXJA 4DR3L 5IIKA 1U5KA 4DEZA 4BBSG 2YU9H 3C21A 4QY7A 3PW2A 4GNXB 2XGQA 3CCMA 4B9TA 1L1OA 3QZ8A 2VW9A 1SROA 4B3SQ 4BY7H 4RQ8A 3TS2A 4PHDA 1U48A 3RJFA 1MQ2A 2YTYA 4YG2A 3PUWA 2JA6G 3HOZG 2IHFA 4YP3A 2HHWA 4PHAA 4C8LA 4R1JA 4DR1L 2HHQA 4JK1A 5M3FH 3T5KA 2B29A 4JBMA 4X66L 2E2IH 4JWMA 1K1QA 2HHSA 1XNRL 4ELTA 4I2EA 4YXJA 1FVIA 3OTOL 4WJ4A 5KFWA 1SE8A 4OWWB 1QVGA 4UB2A 1BGXT 4GN3B 1N9WA 3G6YA 4RMFA 1M90C 4DR7L 3BZKA 4KLDA 4ZH4A 3E0EA 4M6WB 4RUCA 3RLNA 5KG3A 3M8SA 5C44G 5DKWA 4B9SA 5DQHA 4RQ7A 1G291 3EZ5A 4A75A 5KFQA 1NKEA 2IHEA 8ICOA 2WTFA 5DLGA 5KFDA 3ZDDA 1BPDA 3J81c 5HP4A 2HIVA 2EIFA 3S1QH 4JI8Q 4QIWE 4R4TA 4YHHQ 4BXXH 5KFUA 4DQSA 4LF5Q 1MSWD 3RH5A 5KFGA 4EBEA 4A3CH 4KLMA 3I4MG 4IQTA 4DAMA 4DR4L 1ZETA 2IT1A 1UE1A 4TUPA 3GIMA 1XMOL 2UU9Q 7ICGA 2V4QA 4O2DA 1ZQPA 1RXVA 5F9LA 3JPSA 4MZ9A 4A3EG 1U4BA 1A63A 3CPFA 4IFDG 4POGA 5K36G 1AE2A 4ECUA 2Q2UA 3KDFA 1PH6A 3I4NG 4DWIA 4ECSA 3NEMA 9ICCA 4A3KG 4DSFA 1CSPA 3SI8A 2HW3A 1IBKL 1N34L 1KIXA 4IPHA 1EIYB 2KHJA 3Q8MA 4MTNA 5C0XG 1HNWQ 1V43A 5EWEA 1NJIC 2YTXA 3U50C 2I9GA 5J2IA 2DFLA 2KHIA 5D46A 2FXQA 2J6UA 1HZCA 1B8AA 4KLTA 3T3FA 1ZQMA 8ICWA 1WI5A 2FLPA 4DV2L 2DGYA 2JA5H 1BVSA 1X6OA 5L1LA 3PW7A 1ZQKA 1VQHA 5CA7A 1ZQNA 2V4RA 4DL2A 3AYHB 1Z47A 1XMQL 3CMEA 3RZDH 1PH1A 5KFBA 4UB4A 4ECWA 1PFSA 4LF8Q 8ICKA 5LMNL 8ICHA 2V9WA 4NXMQ 1W3SA 1I5FA 2W8LA 1VQFA 1VQ8A 9ICGA 1BPZA 1K1SA 2KZZA 1X9WA 1WCMG 8ICQA 5EWGA 1EXNA 4DSKA 3M85A 4HJ9A 4HJ7A 2R8IA 2BPFA 3HOXG 2OWOA 4DQQA 5DLQE 3ZDEA 5JJIA 3Q8PB 5F9NA 1HNWL 2BCUA 3S1NH 5KFAA 4OWTB 4X62L 3K80C 4LZDA 1TV9A 4LFAL 1KAWA 2RDJA 1BPYA 3GV8B 4UPAA 4C8OA 4APVA 4JV2A 5DG7A 4A3DG 1X54A 3K7AH 4R65A 4JI1Q 3M9MB 4E0DA 1GD7A 4O9MA 3QE9Y 5KFNA 3F8TA 4A3JH 5M3MH 1XNQQ 4A3MH 8ICJA 1WCNA 1RYSA 4M9LA 1J6QA 1I6HH 3ZDAA 2ZJAA 3M9OB 1Y14B 3K81C 1SRUA 3RBEA 1LM0A 5BOLA 4GLVB 3S14H 5DQIA 1Q81C 4JI3L 4DQPA 4LUOA 2UVUA 2WB1E 5KFEA 4JI1L 2BCSA 1CKNB 2K50A 2R7ZH 9ICVA 8ICXA 2KTQA 2MNAA 4YD2A 3UDGA 3V6KA 3GO5A 4KMUA 3KLWA 1NTGA 1L3TA 3GTMH 2ZUBA 2UUAL 1D7QA 1S97A 5J0WA 3JC66 2BA0A 3LK9A 4BXOA 1DGSA 1T9HA 1Y1VG 3RN5A 7ICOA 4RNOA 3M4QA 4K4HA 4EYIB 3Q8KA 3G6EA 5DBCA 4O0IA 4YY3Q 4IPDA 4DR7Q 4QZDA 4DLGA 1E3PA 3RLOA 4QGUA 2MUTA 2KFNA 4X64L 3GDXA 1VQGA 4A3BG 3HOZH 4F8RA 7ICSA 2LSSA 1RYRA 5M3MG 9ICUA 4B9LA 3C2KA 1TWFH 1PYSB 4IOAA 1JMSA 5KT5A 2JZBB 1N56A 4DOAA 3MGHA 3NBHB 2JK8A 2JEIA 3RH6A 2IMWP 3EYZA 1V1QA 3C1ZA 5FJ8H 4B9VA 3RB3A 2QA4A 5CWRA 4EBDA 1I94Q 4LF9L 1HZ9A 2MO0A 2UXDL 3RN2A 1TK5A 3J80i 2FMSA 4NB3A 3S15H 1D9FA 4DK6C 1N33Q 2R7DA 3ZD9A 1X9NA 3MFHA 2W9CB 8ICSA 3CAMA 3S1MH 4NPSA 4JI7Q 1M1KC 1L0WA 2IX1A 5KFXA 3ULLA 4QZBA 1Y1WH 3M8RA 4TURA 3NENA 1L3UA 1YHAA 3F2BA 4JC0A 1KLNA 1HR0W 3KYHC 4F4WA 3OGUA 1VQOA 3MR5A 5KT7A 4OX9Q 2E2JH 4IJLA 1GVPA 1VS0A 4Q44A 5J0UA 2WFWA 1A77A 2A1JA 3Q8DA 3OW2A 1N36Q 5HHHA 4I2GA 1L1OB 2XY7A 4DUZQ 5JEAG 4KN7A 3RRGA 2R8JA 4LF8L 3J80c 5C0XJ 3T1HL 1Y1WG 2OCEA 2VZAA 7ICPA 3G6VA 8ICGA 3AQQA 4LVSA 1ZQFA 5J2GA 1GO3E 2K5VA 1QSLA 4FS1A 4A3GG 2DUDA 4YXMA 1YIJA 1CKMA 3RR8A 1N32L 1W2BA 2VL6A 3A5UA 4O3NA 9ICEA 4QZGA 1KTQA 5HMLA 4DQIA 1PYBA 4ED7A 4TQRA 4TQUS 2VNUD 1ZQEA 3T1YL 5KFVA 2R6GA 5IE8A 2RCNA 4DV0L 4FBTA 3STBC 1YJ9A 4WJ3M 1YVCA 3TAQA 5GADC 5ELNA 5DB9A 4JG2A 2UXBL 3EBEA 4O3PA 4PMWA 2IHMA 2BH2A 4DR6L 7ICKA 4LFAQ 5IIOA 5LMNQ 2BPCA 2Q0ZX 1YHQA 1ZQLA 2C2RA 1J5EQ 4FO6A 4HJ5A
chains in the Genus database with same CATH superfamily
3TFRA 3BYYB 4X3SA 2HOFA 2GO7A 3ETRA 2KKVA 2NZOA 4L8JA 4CDDC 1WCMH 2M2LA 3GTJB 4Y2UA 3SK6A 4JBKA 4QW8A 3HFZB 3SGIA 4LFBQ 2VANA 1JE5A 4F91B 4F87A 1PH8A 4F4KA 4Y2XA 4FNFA 3RFAA 1RM6C 2G06A 4AYBG 8ICPA 3FKIH 3F2CA 1ZYQA 5EOZA 1KNEA 2DJFC 1UNSA 2BDUA 5ALWA 2PZTA 2RSOA 1MD2D 3OWFA 1EY5A 4F92B 1BNZA 3PUYA 2XICA 2BDOA 2NVYH 4X65L 1SSOA 2Z6BA 4CDEC 5L1KA 4HR7B 5AJ3Q 5JJKA 3F2UA 5I2YA 4Z6FA 4XQNA 4I2BA 1SNDA 3PX0A 2CH4W 5CV8A 5J39A 1ML0D 1QVFA 5M5WH 2F3IA 2NTTA 5CB1A 3TEHB 1LV9A 4HJAA 3SZ2A 1LO5D 2G5DA 4C3IG 3H15A 3CCEA 1Q8KA 1SLJA 1CK1A 3ND9A 3CC7A 4A3EB 2K04A 1SXDA 3NASA 3IHQB 1RHPA 2NB0A 3I7FA 2EDGA 2Y0SF 1DK2A 5IT9c 2O6KA 4UAZA 2E1FA 4XTCS 3GTOB 4DV3Q 2JA9A 3F2DA 1K5OA 1LKYA 3G7LA 3NTKA 4X3KA 5ALKA 3NTHA 1XXGA 3A54A 4MEXA 4G9BA 3H0GH 3TQ1A 4RU9A 3M6KA 2UXCQ 4GNXC 1AEXA 1B22A 1B70B 2OXPA 2P35A 2WAQC 5TZVA 3HKZG 3KUPA 2D6FC 2F0QA 2MO1A 3MDCA 5DG8A 2RRDA 4BUGA 4KX3A 4UP7A 1Y1WB 2G9HD 2SNSA 5C4XH 2G09A 2AGOA 2F0HA 5DDYA 3TRZA 2IX3A 1Y1VH 1TS2A 1DK3A 4EYHB 2B2YC 4S3SA 4XDXA 3PW5A 2NRXA 5M9OA 1PLFA 5I9OA 2F4IA 1STGA 5ALLA 5JPNC 2E2JB 3CCVA 5KFHA 8ICZA 4UB8U 4DUZL 1JI7A 3SMVA 2BCQA 1CM9A 3PUXA 3JAML 2HBLA 2NZ1D 4RQ0A 1L7PA 2OHFA 4Q43A 3ALRA 4ECZA 5AM1A 2Q8IB 1HZBA 1JROA 1IYVA 3U9SA 4R4QA 2QEJC 2IOFA 1EUJA 4QZCA 4A3GB 2ISOA 5DGBA 1PVRA 1QG7A 3E5SA 4GS3A 1HNXL 2X6GA 1YITA 1TT2A 2C28A 4Z9CB 4CGYB 4GOPC 1JWUD 4DOCA 4XYOA 5GAGC 3J7AV 5AIBA 3H3VC 1NNLA 1BNPA 1LT3D 2VUMH 2CWAA 5K5PA 2ZUCA 3UE1A 1NE3A 3L3OC 2HOQA 1U9RA 2KBNA 5AM0A 1HCZA 4NLBA 4CKBA 5ISRA 4OXPA 4A3BB 3HKZC 1P16A 2WAQG 1ZQCA 1UQVA 2Q8TA 4C80A 3JPNA 5C4JH 5C4XG 4FS2A 4DV7Q 1ZKOA 2RF4A 4JBJA 2JEBI 4Z6EA 1O7ZA 2WF6A 1SYDA 1NJWA 3URYA 3W1GA 3X3NA 5C3EG 4A93H 4DL6A 3W2DA 4P2HA 4GXKA 1ICWA 1LTAD 2UXCL 5J0RA 4DUYL 1YNJD 1PZKD 1KL9A 3CHBD 5EKIA 4DSLA 4QZFA 2KJ9A 3IM1A 1VF5C 5IGFA 4X64Q 2ZM6Q 1HUZA 3VCBA 5KFOA 4F50A 3TAPA 1ZQTA 2BCOA 2R8KA 3HKSA 3WK9A 4GLXA 1JOKA 4Y2RA 5ALSA 3BQ2A 1LUZA 5EWFA 1YJWA 2JA7H 3CCLA 4ZKBB 4DR2Q 2AQ0A 3RBDA 2OQ0A 2Z6KC 1Z4OA 1K8MA 4YCVA 3W5OA 1IBMQ 2PZUA 1VQ7A 5A2QL 4DV7L 4P73A 1F2LA 3A8KE 3C46A 2EAPA 5D4BA 1WYDA 5GTIU 4DF8A 3TREA 3IG5A 1TS5A 4C3JG 4RFBA 3KLRA 2B21A 4BY1H 4YCUA 4BWJA 5IILA 1TWCB 1UT5A 5J22A 4F2SA 5ALGA 1URJA 3PX4A 1OUQA 2MQHA 1ENAA 4UBBA 3CW2C 5DB6A 3PMNA 1SE3A 3S1RH 2DL0A 7ICHA 4NLZA 2B2WA 5L1IA 4F4XA 3AFQA 2QW7A 2WB1B 4XQQA 1DOMA 1SL2A 4QIWC 1I4HA 1HJPA 3NVZA 2XVTA 1OO9B 2F77X 1IHZA 1ZQ1C 1AQ6A 2KJXA 2VA8A 1KLGD 2ZUDA 3QNMA 2XVSA 1AROP 3T1HQ 1A62A 3JPPA 4NXML 3FC4A 1QQ5A 1F9QA 2PFQA 1CKOA 2RHSB 4YCWA 5K36H 3KJPA 1N5WA 1RDFA 3K1RB 2QKQA 2N8NA 2NN6H 3TS0A 1RDPD 3J7A5 2UVRA 1D8LA 3S16H 3U9OA 2KVMA 2BDPA 1YHBA 2PMZE 4ECXA 1B4OA 4KLGA 4N8X1 5C5MA 4MEYA 1KC8C 4JI5L 4UARA 1TAQA 5J0XA 4GXIA 4DAYB 1BUVT 2UUBQ 7ICUA 3KHHA 3U58A 2D62A 2W7PA 4CE6A 3DLLA 2UUCQ 5J2BA 3FKIB 1JT8A 1KW4A 4DXFA 3LWLA 2UXBQ 2XGTA 2VS1A 4PGXA 3NE5B 1WWUA 2RDIA 1A8VA 1HUMA 1JR0D 2TMPA 4H44C 5BPCA 1D2BA 5KL8B 1Q3UA 4DV2Q 2F0LA 1WOCA 4R8IA 4DL3A 1JWMD 3VDYA 3PR5B 4C3IB 1KAAA 1STAA 1VQ4A 2AWOA 3HKZE 3O0FA 2G5IB 2Q4TA 2VQEL 4DV6Q 8ICLA 5HR7A 1PV4A 3EW9A 2CVRA 1PRTF 1QOHA 4K14A 3EN2A 3K58A 5IGBA 1OXTA 2EQSA 3JAMi 4A3EH 4Y52H 5GAEC 2A68D 2ICIA 4BWGB 5E1FA 1QZGA 3HOWH 3OJSA 4ICAA 2HVHA 5C3XA 1DGJA 5AKIA 1C8CA 2K5DA 4HIDA 3M3YB 3MVVA 2HUGA 4N9PA 4GOPB 4UDUC 5IGEA 1TK8A 2VQEQ 4CF4A 3HWTA 3L2PA 4DV6L 5DQGA 4J9RA 1HPCA 4LAAA 4B6JA 4CJ2C 3HOYH 3THVA 1TWGB 4X65Q 2Z7JA 2V4DA 3NP8A 5G5HA 2L11A 3U26A 5C3EB 2GA4B 3HOUH 1XC9A 1X3PA 2WAQE 3B0YA 1K3RA 2W04A 8ICNA 3SENA 1KFSA 3NELA 5C4XB 2K4EA 4KLFA 1QCBD 1QQ6A 3I4OA 2MP1A 1STNA 1Y1VB 1E7ZA 2R61A 2NN6I 3TN2A 3UE0A 2PNRC 5LL6X 3RRHA 4PZ8A 2YB4A 3PZPA 1A15A 1UE5A 2VY3A 1A6XA 3NPPA 4PHPA 4UQGA 5EAYA 5IT9L 1F2YA 5ELCA 1SAPA 3V96A 2NUCA 4FYDA 4EZ9A 3QUQA 4GOPA 2EJMA 3DUZA 4RPZA 3A0HU 4R66A 3C3LA 4QZEA 3C2MA 1A0IA 1V97A 4QF4A 1DJRD 2YN4A 1NJZA 2AGPA 1Y8NB 2NN6G 2ES2A 4OL7A 2LM4A 2FMPA 1BXTA 2YU9B 3DWAA 1Z4NA 3MEFA 2WAQB 2BCRA 2FDRA 1B3AA 4LF5L 2PFNA 4B3ML 4CCHA 1M6YA 1XS9D 2YYZA 1AN8A 5C4HA 4A3GH 5J8YA 3MGIA 1U47A 1U49A 1EIGA 5KFZA 1VQCA 4HAEA 4P72A 3I28A 2OEOA 3UI2A 4KHPL 4DUYQ 4C4RA 3RTVA 1Y88A 5E79U 4XQ8A 5KG6A 4YFKA 1Q3VA 2PW7A 3TFSA 1KRSA 3RJJA 4LNQA 3ICEA 1WFQA 1Q8IA 3SAHA 4A3BH 2A68C 4R64A 2HCCA 1PXUA 5M3FB 2HHXA 3Q8RB 1B0XA 4ECVA 4ECTA 1EY8A 3GILA 4FXGC 4I2IA 4O3MA 4QZAA 4IQWA 3NUCA 5M3FG 4O3QA 2HCIA 1NMFA 4LZGA 4KLUA 2EH9A 4I27A 1S0OA 1CHPD 2HD3A 1EZ6A 1Q46A 2RHFA 1BPXA 1IYUA 1T4GA 1EU4A 3F53A 1AZPA 1P8LA 3HT3A 1KRTA 8ICUA 3TZDA 1R4PB 1L2FA 2QARB 4C2MH 3SEIA 2HCFA 5KT6A 3QB3A 5G3LD 5M5YH 2XIWA 1CI3M 5T1IA 1JQYD 2XCAA 3NVYA 2JYOA 4BY7G 1Z00B 3V05A 4ZUIA 2Q8RE 3GDEA 3ETLA 5KT4A 2W03A 3PF5A 2DBYA 2BCVA 4M8AA 1K9MC 1JORA 3NWTA 4A3DH 3PO2G 3S2HB 2K4PA 1ZQBA 3EFXD 1RJTA 5IIMA 1CHQD 2Y0SE 2JA8H 1RG6A 2PNHA 3D4DA 3RR5A 8ICEA 1VQDA 2AMCB 3L3FX 3PIPA 4BA2I 2P6RA 4ED3A 4K0KL 4IUTA 1QILA 3NXWA 1Y8OB 4KTQA 1BDOA 2EYPA 2F0UA 2LY7A 2QEXA 4UASA 5JOBA 4RQ3A 2ZJRA 1SNPA 1RF2D 4BXOB 1MN8A 2KIVA 8ICBA 4LMQD 4NXNQ 1HA6A 4ZQ3A 4ZK9B 4KHPQ 3G48A 1Z00A 3A0JA 3OYYA 4JBWA 2ZXIA 9ICSA 5JPMC 1X9MA 2I5LX 3FHWA 2EY1A 5KRUA 4UB1A 5EGTA 2YQEA 3BQ7A 4L5SA 4LF9Q 1ZJMA 3P7JA 1ENCA 4J9NA 1IM4A 2KK0A 5KFLA 1VQAA 5JEAJ 3OSNA 4CKEA 1KDCA 1S0NA 3H94A 3D2QA 2LYBA 3E9HA 3TP8A 2IY5B 1FYCA 5IP7G 4M9NA 5J2AA 5DLFA 2B0CA 1LT6D 2PMZC 2HHUA 4ILWA 5E7NA 2DKXA 2VIXA 2KN7A 1GUWA 4HMIA 4NLKA 4R4CA 4P4PA 2N88A 4YWKA 2X69A 4FF4A 4K6LA 1RZTA 1Z1VA 1UPHA 1GOZA 5ALEA 1MA7A 4M9JA 5IY0A 4JI2L 1ZYRD 4LF7L 4IL6U 3GQCA 5J2HA 3UQ0A 3NQIA 1ILPA 5C44H 1L5UA 4FO2A 3M1YA 3SYZA 3HX0A 4F3OA 3GP7A 4BBRG 4ED8A 5GROA 5AK4A 1KSPA 4YWLA 4B9NA 3CP8A 3TKAA 1KFDA 2BZFA 2BH8A 3NK9A 1HR0Q 5AKJA 4B9MA 4KLQA 3A74A 1S0VA 1PH9A 3S17B 5DEHA 5J2DA 4HTHA 2F0WA 1SYGA 3GIKA 3ISDA 3K57A 1SMYC 2IWHA 2KG5A 2KHVA 3IP4B 1K83H 3HOXH 4J9LA 3CXCA 1ZQYA 4JI5Q 3HOWB 2UVWA 1TKWB 4TQSA 3WOEA 1TR5A 1I4RA 2JH1A 2L15A 1CUKA 2M00A 2HVIA 5KEEA 4QWCA 1ENFA 4DO9A 3H40A 1H9SB 3UPQA 4CRXA 2ENBA 4OIJA 5KFSA 1PH4A 2FPLA 1TFRA 1D5XC 1QUQB 4EX5A 2E74C 3GTLH 4M47A 1TWGH 3D31A 1K73C 2M0NA 2ZXRA 3PW0A 1Q12A 2F3VA 2HDOA 2UUAQ 5ELOA 2WB1F 2ES6A 4UAYA 9ICIA 1BCPB 5KTQA 1A3VA 3PUVA 2Q2TA 4OIKA 2JXJA 1H38A 4EELA 3HOVG 4RKLA 3D6CA 1U9LA 2JEFA 3MC1A 2PQAB 2YMQA 4LUZA 3PO4A 3IRUA 2X6LA 7ICJA 1O7LA 3J7YW 3EA6A 2PCFB 2N1RA 2I0QA 2ZM6L 4KLEA 2W9BB 1ONLA 3U4ZA 3MR6A 4YR2A 1S5LU 1NK8A 4DF4A 4I2AA 3GV7B 5HNKA 1HNXQ 5ALHA 2W55A 1FFVA 2JJQA 4ZUJA 2NRWA 4YY3L 3RZDB 1H9SA 1T3NA 4O1NA 4GLAC 4DK3C 1CA6A 3MBYA 1VQKA 1ZQUA 5KFPA 1VQPA 3D8GA 4DV4Q 1PK1A 2KCTA 2Y0SG 4XUSA 4KI0A 1XPOA 1EIHA 4JYAQ 5J2FA 4RQ6A 1Z3EB 1C48A 2FJ6A 1OXSC 5AI4A 1S0MA 1S72A 1HFNA 2R93H 1PTOH 4DV4L 4OO1I 4KK7A 3WK5A 1B44D 4UAVA 4YQWA 1OXJA 1S4ZA 1U4MA 1PMRA 1K0RA 2ZIWB 3H8JA 2C35B 1X32A 2EXDA 1TKDA 2W9BA 1IYJB 1BF4A 2E5LQ 2FJ2A 3RR7A 1DCZA 3H91A 3V72A 9ICMA 2XI9A 3E0JA 4PJ0U 2K1BA 3BDOA 5CV6A 4M6WA 5GAHC 3PCOB 3S24A 3HJEA 3SDZA 5G5GA 5C0XI 4DQRA 3BZDB 3GIJA 1MC8A 3T51B 4IQUA 5JTIA 3JPTA 2KENA 1HHVA 5D3DA 4GNXA 5AKYA 4B3MQ 1KEJA 4MTKA 3T79A 5IP9H 2YX8A 1JALA 3E6ZX 4RAUC 2KEDA 3FKIG 4JVZA 4JI3Q 4EZ6A 4DK1A 4EENA 4J03A 4C2MB 3FDSA 5LMNW 1SKSA 2ZT9C 4JCVE 4FBUA 3S6JA 2ZIWA 2PI4A 3AEVA 3KFUF 2D0OA 4KLHA 2ASLA 1L3SA 1KN5A 5KFTA 4RGNA 3EPIA 4IR9A 1N33L 1EU3A 5BR8L 4KY7A 4LUVA 5B66U 3CRXA 1A3TA 4A3LG 4A3MB 3AU6A 2HHVA 4IS7A 4MFCA 3GQBA 1G6ZA 3KTQA 4O5KA 1LT4D 4P71A 2H4OA 2VJ4A 1X3GA 1EFWA 9ICPA 1SFOB 1HR0L 1EQQA 3D2SA 4CF3A 2F0FA 4EQOA 1WVLA 4J1MA 1NK5A 4DR5L 2Z6KA 2ICEC 3NUQA 3E0FA 1Q1BA 2JHDA 3QU2A 3GIIA 4L5QA 2WF9A 2EVBA 2JA7G 5J0PA 4HIMA 3H09A 4BBRH 5IYBG 2WIIB 9ICRA 2ZTCA 4RHRA 4XQJA 2A8VA 3A7AB 4LF6Q 4IC9A 4MHVA 2QDLA 5IYCG 4OO1H 3OHAA 4AYBF 1CQFA 3H8SA 4C3HB 2R7ZB 2RSNA 1JB3A 1IBLQ 3MXUA 7ICQA 1HEKA 3GFKB 4QJFB 2K4KA 4ZCKA 1FJGQ 1RD9D 1V1PB 5AI6A 4BY1G 1AH9A 4IO9A 4EBCA 3MFGA 2F1IA 1NMGA 4K4IA 3WK4A 5IP7H 2KECA 2LKYA 2I1QA 3CQZB 3I73A 1IKMA 3MC0B 3RUZA 4MNOA 3I2ZA 4DLEA 2IX0A 3KBXA 4YN4A 2J6SA 8ICFA 3J81j 4P74A 1NK7A 2R18A 4A4IA 2DGZA 1FIQA 3T4AC 1MSHA 1FGUA 4K5VA 1UWVA 5ALJA 5HMMA 2MA1A 3F5EA 4OCZA 1TWHH 5FO9B 5KYLA 5CR0A 1RTNA 3MABA 1KD1C 2F2AB 2IPKD 4LF4L 3HOWG 4YCXA 5KAIU 5J2CA 3ORYA 2NVXH 1K28A 3KOOA 4JI7L 4M9HA 5KG4A 3RJGA 1EY0A 1X65A 1UEAB 4YVZA 1SKRA 2IHNA 4LFCL 3ZD8A 1O03A 1BQQT 4QZIA 3DM1A 1E24A 3S17H 3MEHA 2GVAA 1L7NA 2ATWA 4RNNA 3N52A 1PH7A 4MFAA 3DWQA 1EQRA 2F0MA 1ZD4A 4DFKA 2J4XA 1ZRNA 1ZQGA 1B3QA 1U0LA 2WHEA 3WWVA 3HG9A 2K28A 3DXJC 1B7YB 1K83B 1PH3A 1EQVA 4GKKQ 3BQ1A 8ICIA 3M4OB 1STYA 2D3DA 4L5TA 1LYLA 2OQKA 2MRLA 2BQ3A 1Z7TA 4C8MA 1MJEA 2EQYA 2K8CB 1CZGA 5FLXE 1TWFB 4ALPA 2H3ZA 2LKVA 4NXNL 1X42A 4QWDA 9ICKA 1CA5A 1UEBA 3PO2B 4KLOA 2CQAA 1VMCA 1SEBD 3PVXA 7ICTA 3K5NA 1JB7A 4Q8FA 4O5EA 4GKJL 5IWAL 3NRWA 3G6XA 1LB2B 3BQTA 5FP0A 1V8QA 4HJ8A 3BU2A 1K8AC 5KG5A 1KNAA 3OTQA 4KD4A 1VQ6A 3AN1A 1XO0A 5KFCA 2P5ZX 5JRTA 1EFID 4PL2A 4Y2SA 3KF6A 2W11A 2Z0SA 1QTMA 3VYUA 3IKJA 3B0XA 1F77A 2KZMA 2IL8A 2R8HA 2KCMA 1ZQQA 4B9WA 2EYFA 2NVTH 3ZDCA 2C9OA 3BDCA 3WKEA 3DEOA 3MXNA 4UP9A 4O0AA 3TQYA 3H7IA 3CC4A 1X56A 1D8BA 1KKXA 3HOYG 1AW7A 1G8ZD 4Y2PA 2AGQA 4QL5A 5H2FU 1JJ2A 3UXOA 1JCKB 1U4PA 4DV5L 1JMCA 4YR0A 4ED6A 2E8GA 2PFPA 1E0BA 3OMCA 3SR1A 3MR2A 3EIVA 3T13A 4BA1I 3K5MA 3S1MB 1Y8PB 2FMQA 4FZLA 2K8AA 4BWMA 3B6YA 4IOCA 2WFAA 5CMDA 1IXRA 4F93B 4DF7A 1K8GA 1G6PA 4X66Q 2GWSA 4H02A 3TADA 2PW5A 2R93B 4X62Q 2F0VA 3RZOH 3TADC 5ALFA 4OWXB 3LNNA 5CBAE 1B43A 4NW2A 4J9QA 1N48A 3QOJA 2F0DA 3MR3A 1Q3LA 5C5LA 1EYGA 2KZ3A 4MF8A 4EX7A 4QW9A 1SN8A 5FO8B 4Y7NH 4NDXA 2E8PA 4B3RL 3H0MB 3HKZB 3STBD 5A0LA 2EOTA 1EWCA 2FLLA 1X55A 4NM1A 3ICXA 1KDHA 4O3RA 1DONA 2PI2A 3L4PA 2W9AA 4RNMA 4RA8A 3P1HA 5E4WC 4C7ZA 5FLMG 4F4ZA 2TSSA 2ALZA 1X6JA 3BVZA 5KG1A 2R7ZG 4UP8A 1HUOA 2R8GA 1OW5A 4P0PB 3UDFA 1NR4A 1L1OC 1HXYD 5DDMA 1SYCA 5CV9A 4KHZA 5CBEE 1COOA 1UA0A 2OF1A 5J0OA 5I6YA 4KN4C 5AI8A 4A3CG 5CV4A 1SNCA 3ULPA 1F2MA 3UXPA 2ZTDA 2PMZB 3I90A 4PGYA 5AK5A 3TI0A 3A0BU 4ZLTF 1SZPA 1S76D 4IRCA 4E6IA 2HHHL 1QSSA 1FNVA 1G2TA 4FZMA 2OM6A 4F72A 5KT2A 4N8FA 4DL7A 2DKZA 1SBBB 3J7AF 1ZQWA 3MTSA 1EY4A 4AYBE 1TWAB 1PK3A 3C5FA 3BS5B 4AIMA 1WWVA 3V7LA 1ICFB 1SFOH 5ALNA 5DBBA 2ATLA 2FFKB 1IZ6A 3CCSA 3VYSA 1EWHA 5JJLA 3GTGH 4I2JA 4NLNA 1SE2A 1J97A 2QARA 1X6IA 5BR8Q 1HIWA 4DNRB 2KE7A 4DXGA 1NK6A 1A76A 2BA1A 4GKKL 1ZQAA 3GD7A 1VQ9A 2VA2A 4DR3Q 4BXXG 2HT1A 4QWAA 1UT8A 3C23A 1D8YA 2VKQA 2RVLA 1KBUA 5ALMA 1FFUA 1N2XA 5KFIA 4C3HH 4BX9C 1S5CD 1VQNA 2NV3A 4NL9C 4HSPA 5ELDA 1YNXA 2A74C 2BDNA 4IFDI 2XN9C 9ICLA 4DR1Q 3BQ0A 3RB4A 2H3IA 5IINA 1STBA 3I72A 5J0QA 1N32Q 2W8KA 2ZXHA 3CQZH 3KJOA 8ICCA 3K5LA 2MUYA 1XPUA 2C2EA 2C5CA 2V1CC 5CV5A 5AHXA 4OO1J 3Q24A 3H0GG 4BDPA 2B63H 4B3TQ 1LVHA 2DJGC 4RT3A 2R92H 5EBCA 1JXLA 2G07A 3F5AA 2NO4A 5EE9A 1XO1A 4F4YA 5HHIA 4B3TL 4MF2A 3ONAB 1RL2A 2BHNA 1PDQA 1TWHB 5FK9C 3C1EA 1KDBA 1PRTD 2CW0D 2BQUA 2P6UA 4F5QA 4JV5Q 2JZBA 2ASDA 1UE6A 4C8NA 2DPJA 2FLNA 4Y2TA 4Y2JA 3EWAA 4DFJA 1PZJD 1S5FD 2LPEA 1T5EA 1WJJA 3I70A 3NBHA 1U45A 3TDQA 3V2TA 1ZJNA 5LHY1 1BPEA 4DAVA 4GC7A 1TVAA 3RH4A 4POFA 1BNOA 1MIUA 5KYIA 3N7RC 4CDCC 3KLSA 1HQRD 3N4MB 4DS5A 4DR4Q 4HCSA 3GV6A 3GU3A 4YD1A 4J9MA 5J3BA 2Q2HA 2KOLA 1SMXA 4OEMB 3C2PA 2B3GA 1SWWA 1WTRA 4AP9A 4YMNA 3VR3A 3KZXA 5H1SE 2ASJA 4RUAA 1K8OA 2RQ5A 2B2YA 4KLIA 2XCPA 3BVMA 4ME5A 1WD0A 1S8OA 1YT3A 3SV4A 3V6HA 1O80A 2HDLA 1BBUA 4HYKA 1X66A 3G4SA 4QQBX 2W9CA 2KICA 7ICLA 3WK8A 2VUMG 1XU4A 2CQOA 3OWEB 1D5ZC 4B08A 1XSLA 5AM3A 4K4GA 3K5OA 3VA7A 4I2HA 2QGQA 4MHEA 4C1NI 1RPLA 1PVQA 3CRLC 2NRZA 4HSVA 1JJGA 2BPGA 4OJ5A 1E1OA 4PG3A 5JJZA 2MUTB 3QUBA 3BS1A 3AU7A 2GN5A 1FGBD 1T8EA 4GZYC 1XPRA 1F9SA 1L6NA 1IG6A 3SV3A 4PH5A 4R4IA 3GTOH 4KLLA 5ALVA 2XRQD 4BS9A 1PH5A 3HOUG 4NWIA 3R93A 4QNLA 1SNOA 3HEJA 4EVOA 2UXDQ 3SK5A 3J7ZC 2LXKA 3TBIB 5CYUA 5JVG3 1JX4A 3MHBA 3RJHA 5ALUA 4ID6A 5K4LA 3QU4A 1DOQA 2F0GA 3OHXC 3CCJA 2Y1IA 4MFFA 3ZJYC 2B8GA 3CCQA 2F1MA 1GXDC 2AUKA 4WFN3 4R4OA 3KHLA 3RZOB 5KNDA 3C5GA 2ZJ5A 3DEPA 5COYA 2F0NA 4C3JH 2PQAA 2RA4A 5GTHU 4IFDJ 1FD7D 3E2EA 1A6SA 1NJXA 3SAGA 1MI2A 1C9OA 5L1MA 1EL0A 2OTLA 9ICOA 1SL1A 3KBBA 2QCPX 4NLGA 4FFDA 2SDFA 4F5PA 1SNQA 3BS7A 3LDAA 1UA1A 5CC4A 1XJVA 2L0CA 3IDWA 1J2NA 1WTHA 4C4TA 4F5OA 4J9KA 1MJCA 2Z1CA 4RG1A 5FLXc 2LHTA 4B9UA 1UE7A 2CCZA 1OXVA 5HGTA 2BE5D 3H4BA 4B3SL 3NTIA 3QR8A 3N28A 3BJUA 4IZ8A 2K14A 3WKBA 1IV8A 2LBOA 4TKOB 2K5QA 4YMMA 1PVPA 3QIAA 3LWMA 4KITB 5BOMA 3X3MA 1VCIA 3KHRA 1GKHA 4ABNA 4DSEA 1GM5A 3BJYA 3RJEA 3HZXA 4QWBA 1UAPA 1VQLA 2KFZA 1HZAA 4X3UA 2ZIVA 3I76A 4UY8C 3PMLA 1TXYA 2G0AA 4A3JB 4P4OA 3K59A 1JN3A 2KEEA 3OW7A 4FDBA 5J0SA 2E8NA 3E9IA 4USAA 5DNFA 9ICBA 1LTSD 1RXWA 4IRDA 5C4JB 1LTID 3OIQA 5DM73 1IW7C 1TWAH 4DOBA 2EE1A 1EQTA 3JPOA 1D5MC 4F5NA 1S77D 2KA7A 2VB3X 2VB2X 3T56B 3MZ5A 3S1RB 4A93B 3J81L 3C1FA 1ZXIA 2BR0A 2XIDA 2PFOA 3GTGB 8ICAA 3S14B 4XT3B 3WDNA 4ED0A 3PSIA 1UCVA 4TUSA 1SKWA 1Z9FA 2L1BA 4J15A 1XMQQ 1B50A 4JI0Q 1ZQHA 4YWMA 2NVQH 1Q82C 4C4SA 2GVBA 5KG2A 4DV5Q 4DK0A 2LS01 1Q90A 2CHBD 3TZUA 3CC2A 2D8CA 5HURA 3PIO3 3Q8SB 5D49A 1EEFD 5JVH3 4PL1A 1X9XA 2I5MX 3P75A 2OTJA 3Q6SA 4JWNA 2EYHA 3Q23A 1KXLA 5DB7A 4CJ0B 5KFJA 3H0RB 4ED1A 2J0TD 1EWIA 1H9RA 3RAXA 1VQJA 2E2HH 4B3RQ 2IBKA 1G91A 2MAXA 3QUTA 2F52A 2HHHQ 3FP9A 1TWCH 3M9BA 2B2TA 1BCPF 1W6JA 2MGSA 1J5EL 2B63B 1PVOA 1PRTB 1EY9A 2FMCA 2D2CC 9ICTA 3KOJA 2UUBL 2PQEA 3QEBZ 5IOCA 1C7YA 1CI4A 2KJ5A 3PO3G 2AWNA 2ZTEA 2E75C 4I7ZC 1VQEA 3VR5A 2DY8A 4M1UB 5F2DA 4DN4M 2Z9HA 2AH5A 4Y2YA 4K8IA 5EPLA 1S40A 3QU7A 1S9FA 3W1BA 3NWSA 3AB9A 1STHA 1WD1A 3KKAC 8ICTA 2KP7A 1CFMA 4QJFA 4BGDA 2PI2E 2ZXOA 8ICMA 4C7YA 4ED2A 3SAFA 1XWEA 1K3BC 1PTOD 4DNIA 4US9A 1TAUA 3RAQA 5KFMA 5KG0A 4BBSB 2ISPA 5T1GA 2YTVA 4DFPA 2RKSA 3QJYA 4HMJA 4YMOA 4F5RA 2DWQA 1II3A 5IYDG 1NJYA 4LWCA 3HOZB 1U4LA 2VQFL 2B6GA 2UVVA 1XMOQ 1C0AA 4NLCA 3OHBA 1ESFA 1E2VA 4C8KA 4I2CA 5E4XA 3S2DH 3N7SC 1MGSA 2KSOA 4X6AH 1LKYB 5IYCH 5C5JA 1PRTC 1NKBA 1QUQA 3KD3A 1TVXA 5IWAQ 4KX5A 3CYMA 5ELFA 1P7DA 4DR5Q 4DL4A 4KMUC 1EYAA 3UXNA 3L9AX 2GH1A 3NHHA 4KKTA 3TP6A 1G51A 4XA5A 2NZHA 1LV5A 1LTRD 5EBDA 4CBVA 3JPRA 1B9MA 5C3WA 1L7OA 1MKHA 4AH6A 5DGAA 2F1JA 4CKCA 3H3VI 1JXEA 2EAMA 3TP7A 1TE2A 2JGAA 1H9JA 3J81i 1FJGL 2YMPA 3BVGA 3VA5A 4EQ5A 3RF9A 3K8AA 2QLTA 1ZQOA 1JOOA 4JI6L 3EQLC 3OTOQ 3C28A 3OOCA 4JOIA 1TAMA 4PPXA 4LJZC 2WP8J 2MFIA 4J9PA 2D5DA 3VC8A 1HTLD 3NS1A 4P75A 2CWPA 1N5XA 2XRSD 4DAPA 3MFIA 3K1ZA 4ECRA 1EY6A 5J0YA 4DPGA 2KNJA 3RLFA 2A1AA 5AKXA 4A76A 4OO1G 1CZWA 3JAMc 4M9GA 4DR6Q 2B2UC 5AKKA 4UBCA 2IA6A 3FMCA 4LF4Q 5JU5A 4U68A 4UB6U 1ASZA 5AI9A 3ERSX 4RQ1A 2W3RA 2EY5A 2FE9A 2K4IA 4NXZA 1RIPA 2K75A 3KF6B 4C3JB 3LX0A 2N3SA 1BPBA 2JR5A 4A3FH 3HOVB 2AQ3B 4DV1Q 4CJ1B 4QCLA 4QIWF 4KLJA 1ASYA 3DHQA 3ISBA 3MXNB 4JI2Q 1S3OA 5FLMH 3CP0A 1SXTA 2AKWB 4Q8EA 2KHSA 4DV0Q 4PNYA 1VF7A 3OIPA 1XNRQ 4O3SA 4A3JG 3CF5A 2OEHA 2XWJB 4I2FA 2PKEA 5EQ0A 2H3FA 3ZDBA 1LTLA 2MJ8A 2XY5A 3PV8A 4EEYA 2PI5A 2JA5G 9ICJA 4RT2A 2WF8A 1XSNA 4OJ6A 4JYAL 4K2LA 2A19A 1PZNA 4JK1C 4HIKA 3VR6A 3KHGA 4A3KH 4YHHL 8ICVA 1OTCA 2HDMA 4XYQA 2ZIUA 1NNXA 1QVCA 2KQ3A 4PGQA 2XGPA 2C2DA 3K0XA 4KY5A 1HRJA 1YNNC 5AI5A 7ICRA 1XX8A 2EZXA 2C22A 4V0BA 5CHGA 1QCKA 1YZ7A 3HGBA 5IGCA 1WTWA 1X9SA 3H3VH 1KRPA 2BKEA 4A3FG 3QZ7A 3L7ZC 3M4PA 3I55A 4WJWA 2E5LL 1V38A 3P20A 3EJIA 1I94L 1PTOC 4EQPA 2K5HA 4A3LH 3T1YQ 1XSPA 1YEZA 1ESRA 3SE0A 1NK4A 1RCVD 2K5WA 4UW9A 4M2YA 3H6MA 3WKAA 3ISCA 3CMAA 3GTKH 2A6HC 5L1JA 1Y69U 2K32A 4EGVA 4P0PA 2UUCL 5M5XH 2EZZA 3RJKA 3M9NB 3V7KA 3BDPA 2ZIUB 4Q45A 5M5YB 3HP6A 3C2LA 3GTQH 1F9PA 4M0AA 3ERQA 4ELUA 3A5ZB 4A3MG 4JMUA 2WKDA 1RQNA 1NY4A 3V7JA 1TS3A 2N78A 4G3IA 5KAFU 4IUQA 5TISU 1NBWA 9ICXA 4NP5A 2JEJA 3CCRA 1E2WA 4HIOA 2BGWA 5AFWA 1DD2A 4H13C 3S2HH 3K7UC 2E2HB 3BS5A 3SD7A 4DFMA 2JXMB 4OX9L 2PXIA 5IYBH 4TUQA 2NTSA 1SGGA 2L9HA 2EDUA 2K01A 1F44A 9ICHA 4XRHA 1B4FA 1HUNA 1JC7A 1K0SA 5KG7A 7ICVA 1DOLA 2KMDA 3K75D 4LFBL 3CPWA 4Z6CA 3I56A 1IBML 4LF7Q 2WF7A 4RQ4A 4RCOA 3PGZA 3H8WA 3KKAA 4JI4Q 1JRPA 4LW1A 2K5NA 3NTUA 3A56A 2VQFQ 1XTDA 4CDGA 1CKNA 1N61A 1R9TB 2R92G 2EYLA 1L0YB 4ECQA 3FPUB 5IYDH 1AP0A 3CD6A 4HJ5A 1TS4A 3J80L 1YBYA 3PUZA 3KDFB 2VA3A 2EXZA 4GN4B 1N36L 1ZD5A 5AI0A 2AQ4A 3NGDA 3AL0B 1XTCD 3IG8A 2E3TA 3IV6A 1W6KA 2JQOA 1OXXK 2NYZD 3AU2A 3UQ2A 2ZXPA 1F0MA 5J1ZA 1VQIA 3H4DA 1EIFA 1RKNA 4KV6A 4KKUA 3ONNA 5GQOA 5KNIA 1GUOA 2NRTA 1YNND 3NSWA 2ZJQA 4BBSH 2G08A 4NV0A 5JUMA 1VQBA 1WCMB 2A69C 5FJ8G 3GTJH 4AQYQ 2EANA 1S10A 2E5SA 3VR2A 2XO7A 1SWVA 4U7CA 3K4GA 2BQRA 2DPIA 2KUMA 3LWUA 2MU2A 1L8LA 1NAPA 3M7GA 4NMZA 5J0TA 4I29A 1SV0C 3H8MA 4QZ8A 3RJIA 1WUDA 3QEAZ 1Q1EA 2PZWA 4IPGA 1EYDA 4XXEA 1AE3A 1E1TA 4X3TA 5C44B 2NVYB 1WCLA 1L3VA 4AQYL 4ZYSA 4UATA 2J6TA 2YV5A 2KCNA 3MXPA 4R8UB 4A93G 3NVWA 3T53B 2F0KA 3ITPA 2Q2IA 3QG1A 2F1HA 5D3IB 2DNCA 2XC9A 3ER0A 1JJCB 1HNZL 1MSGA 2E1EA 5A2QE 7ICIA 1NK9A 1QZHA 3ND8A 4QUCA 2AU0A 4F2RA 1T7PA 9ICQA 2L5YA 2DNEA 3D6JA 3CRKC 4JOIC 1V1OA 1ZD2P 1ZQSA 1QLNA 2R3ZA 5IGDA 4QB4A 1NKCA 3UMCA 1X3FA 4DAYA 1O7YA 3HOXB 4L5RC 2NRVA 4PZ7A 2G9DA 1ZQDA 3SK8A 3FVQA 9ICWA 2F03A 2HHTA 3M7NA 1WG8A 3PNCA 1EOVA 2VXWA 1QSYA 9ICAA 1ZQRA 5LMUL 1LTTD 1EOTA 2JEGA 7ICFA 3WOFA 3OJUA 8ICRA 4RKBA 1YZ6A 3H0GB 1GUNA 4R8UA 3AFPA 1GHKA 3WK7A 3EROA 2LYAA 3IRBA 1N63A 1ZXTA 3I4MH 5KIXA 4Q0FA 2E2DC 2HI0A 3PO3H 2JA8G 1F2ZA 2JE6I 2XNAC 4IPCA 4A3IH 4I28A 3PR4A 2K52A 2RQXA 3ZYYX 4CF5A 5C6AA 4CDFC 4JV5L 3S9WA 3O13A 1I3QB 3PSPA 4RQ5A 4ULLA 4ZAIA 3HOVH 7ICNA 4A3FB 3D6WA 3MAQA 5HY6A 1IL2A 2GLEA 4M04A 3GTPB 5IIIA 5DB8A 3UDIA 8ICYA 2CKZB 4F71A 2XY6A 2AXTU 1QWYA 4Y2QA 4JUZA 3V6JA 4NM2A 3K6OA 2RLTA 3PF4A 2FPMA 3I4NB 2ID0A 3G6JB 1QE6A 5KFYA 4P4MA 2RHQB 4DGZA 1ZQXA 3TMEA 1LTBD 2Z4HA 2HQEA 3FYHA 3ED5A 3NBIA 1IBLL 3I91A 3BZCA 5IGGA 4GN5A 3LVWA 3KFUA 2ZJ8A 2AJQA 1YI2A 4LFCQ 3DDHA 2PYKA 2DF4B 2YMLA 2EJGC 1WTXA 1H9KA 1YJNA 3D3RA 4BY7B 2WF5A 1VMPA 2Y9TA 2E8MA 1XNSA 5IIJA 2KHQA 4A3KB 4JI4L 2F4VL 2AHOB 3FAHA 3AUOA 4RCNA 2KJ8A 2R93G 5ALTA 3HPOA 1QB5D 3ULJA 4A3IG 2VUMB 5AKZA 3E3XA 4C1NK 5AM2A 4MIUA 1Q86C 2AQ1B 3QWNA 1V9PA 5D65A 3AQFA 3T5LA 2K89A 1NOMA 4KLKA 3UDXA 3MDAA 3QUCA 5J2EA 9ICNA 2EYOA 4J9OA 4JPBW 4GKJQ 3Q8QB 4IRKA 2A1JB 3AQEA 4XIGS 1KHIA 1E2ZA 3F1ZA 5T14A 5EE3A 1WTPA 4DFDA 3QU5A 4ME3A 5J2JA 3OMGA 1RODA 4JI0L 5M5XB 1J2MA 3JPQA 4RHSA 1CSQA 4DS4A 2F0TA 2JMGA 4PHEA 1X2IA 5CV7A 3T5JA 3PIOA 2I5HA 1SL0A 7ICEA 4IUVA 1TK0A 1SR3A 1STEA 2HQLA 4K0KQ 2CFMA 3DM3A 3TP5A 1S5BD 7ICMA 4O5CA 2FI1A 3RNUA 2R7FA 3DMUA 5IP9G 4QZHA 1MBYA 5KFFA 2H5XA 2N49A 4OONA 1ZQIA 1CT1D 4QIWB 1L7MA 4K2KA 5AJ3L 3Q22A 1Z19A 4KY6A 4QZ9A 5I4DA 4BY1B 2HIXA 3A8JE 4QWEA 2M9NA 1PH2A 1CEZA 2NYVA 4IR1A 4H7BA 1Q7YC 4C3HG 2Z4IA 2KVSA 3OPXA 3PY8A 2K7VA 3LVVA 4JW0A 1XWLA 4KN4A 4JV1A 3PSFA 1C4QA 1DXMA 1DRGA 1OXUA 4BBRB 5CEHA 4IUNA 4RPYA 2YY6A 4NY8A 1KQSA 1QQ7A 2H3QA 3C1YA 3KZIU 3S1QB 4P2CB 4RWSC 1A2UA 3Q8LA 1ZQJA 5CORA 1R9TH 3NRZA 3PW4A 3CU7A 1D9DA 1O7IA 5J2KA 3T5HA 4RGTA 5AKLA 4UB5A 2D0PA 4KHVA 1HH2P 1LABA 2ASBA 2F8KA 2ZG6A 3OSPA 2WB1G 5KFKA 4DKAC 3N97B 5KT3A 4JV0A 2LYHA 1ZQZA 1O08A 3WK6A 1S5DD 4G4KA 3OSOA 5CP2A 3S16B 1N34Q 1FL0A 2K33A 3A7LA 4G57A 4HEDA 2DN8A 4LF6L 2FHTA 4PZ6A 4ECYA 4IQVA 3VYTA 3GV5B 1D1IA 3FRPB 4DSJA 1PHJA 4DV1L 3HW8A 4DSIA 5CJ7A 1I50H 5L9XA 2W9MA 4GXJA 4IJHA 2JEAI 2SEBD 5DBAA 9ICFA 1WTOA 2MSNA 3PQIA 3TANA 5IIFA 4ZKCB 1VLBA 4OD0A 4GIBA 3AMUA 1CQVA 3S2DB 2I07B 2WB1C 1KFTA 4C3IH 4UB3A 3KF8A 4R63A 5J29A 5AKEA 1VQMA 2YMMA 4ELVA 5EKLA 4FXDA 5DG9A 2P66A 2NO5A 4P0QB 2F0SA 5KFRA 4YR3A 3CCUA 1A2TA 3RD4A 5I2XA 3G71A 3PX6A 2LMRA 1VQ5A 1CRXA 4Z6DA 4JI6Q 1JIHA 3EPGA 2B2VA 1BBWA 5LMUQ 4DL5A 2ALYB 1PA6A 1N8RC 1GO3F 4RQ2A 5C0XH 4DR2L 2XTIA 4RZRA 1UUPA 3W3AA 4DV3L 1IBKQ 1RTOA 3M4OH 3M3YH 1E22A 3RB0A 4JI8L 1ET6A 4KLSA 1PYWD 3LGJA 2K60A 4FF3A 2RDFA 4GC6A 2Y1JA 4I2DA 1JE4A 1LT5D 1BOSA 2YB1A 1X3EA 4RQNA 2A6EC 3NQTA 2OT2A 3PO2H 4O3OA 2QB0B 4RPXA 4L6TB 3SXHA 1COKA 1MQ3A 3HOYB 2JA6H 3TARA 2EY2A 4DCCA 1I4QA 3U4VA 3MXGA 1VJ5A 1HNZQ 3KF8B 4DFAA 2KKPA 3QOLA 4X5VA 5HGQA 5C3EH 4UAWA 3BG3A 3RB6A 3HOUB 5ALDA 3I3CA 4NKLA 2ZJPA 4RGOS 1XNQL 3I4MB 3PO3B 4FZNA 3VR4A 1NK0A 2HSZA 1BKBA 5ALYA 1SYBA 3AMZA 1ZQVA 4A3IB 4H0LC 4G7ZC 2UU9L 1H95A 2B63G 1I3QH 1L8OA 1FR3A 3PV0A 2CXYA 2FPKA 3L0OA 2NVTB 3GTPH 4F7XA 3PO5A 3MA2B 2L4NA 5JAVA 3D0FA 4TVAB 4J9SA 2F4VQ 1QNUA 1SDFA 2LXJA 3A8IE 4DR3L 3I4NH 2PO4A 1SXEA 5IIKA 2QB0A 2H1EA 3HRDD 1U5KA 2EYMA 4DEZA 5I6WA 4BBSG 3SEBA 3JAME 2YU9H 3C21A 4QY7A 5IT9E 1J9OA 2DY7A 3PW2A 4GNXB 1UHUA 2XGQA 3CCMA 4B9TA 1L1OA 3QZ8A 2VW9A 1SROA 1A0PA 4B3SQ 4BY7H 3R8BA 4F8MA 4RQ8A 4OJLA 3TS2A 1T3QA 4U6PA 4PHDA 1U48A 1MQ2A 3RJFA 2YTYA 4YG2A 1AFPA 1SNMA 3PUWA 4EQNA 4RQMA 2RP5A 2JA6G 4WORA 3HOZG 1ZEQX 2IHFA 4Y7NB 1TIID 3DEEA 4YP3A 4RGMA 2HHWA 3FEWX 4PHAA 4C8LA 2CRXA 4R1JA 2NBFA 2HHQA 4DR1L 4JK1A 5M3FH 2HBJA 3T5KA 2B29A 4JBMA 1PK1B 4G7OC 5CRXA 1SYFA 3VYRA 4X66L 3BYTB 2E2IH 4JWMA 3FDTA 1K1QA 3LYSA 2HHSA 5EE0A 4ELTA 5AKGA 4I2EA 4YXJA 1FVIA 1GUGA 5ELEA 1XNRL 3OTOL 4WJ4A 4XT1B 1JOQA 1PTOF 5EPKA 1BBXC 1VDVA 5KFWA 1SE8A 4OWWB 1QVGA 4WJ3B 4UB2A 4HCEA 1BGXT 4GN3B 1KLUD 4R9WA 1N9WA 5KNCA 4C0ZA 3G6YA 1DM0B 4RMFA 1M90C 2B2VC 4DR7L 5M3MB 3BZKA 4KLDA 4ZH4A 3E0EA 4M6WB 4RUCA 4DNTB 4A3DB 3KLSX 3RLNA 5KG3A 3M8SA 1PUZA 3QXGA 5ALPA 5C44G 5DKWA 1NZPA 4B9SA 3HRZC 5DQHA 4RQ7A 1G291 1KDAA 3EZ5A 1T5XD 2JN4A 4A75A 2JA8B 2I6XA 3R2IA 5KFQA 1NKEA 2IHEA 8ICOA 2WTFA 3LWEA 5FO7B 5DLGA 4OJOA 5KFDA 3ZDDA 1BPDA 3J81c 4Q5VA 4OHJA 5HP4A 3IN5A 2W3SA 3GZFA 3QYPA 1EZ8A 2F0EA 2HIVA 2EIFA 3S1QH 4JI8Q 2OYYA 4QIWE 4R4TA 4YHHQ 2K4HA 4BXXH 5KFUA 4DQSA 4LF5Q 1SJED 1MSWD 1O78A 3RH5A 2O4XA 5C4ZA 5KFGA 4EBEA 4A3CH 2E76C 4KLMA 3I4MG 2SNMA 4IQTA 2Y0SB 1RQLA 4DAMA 4DR4L 2WV6D 1ZETA 2IT1A 2HMXA 3ZI4A 1UE1A 4TUPA 2EPBA 2JRZA 2YTUA 4K5XA 3GIMA 4K5WA 1XMOL 2UU9Q 7ICGA 1I50B 2V4QA 1BCPC 4O2DA 3RMHA 1ZQPA 1RXVA 4C56C 5KGUA 5F9LA 3JPSA 4MZ9A 1TQOA 2G5HB 1PFMA 1U4BA 4A3EG 5L37A 1A63A 1X40A 4BJQA 3CPFA 4IUPA 1KTKA 4IFDG 1U4RA 3R3OA 5AK6A 4POGA 1N62A 1D1KA 2Y9UA 1QJOA 5K36G 1AE2A 4ECUA 1Z6HA 5CR3A 2Q2UA 3J80E 1VDZA 3KDFA 5B5EU 1PH6A 3I4NG 4HN7A 4DWIA 4ECSA 2B2WC 3NEMA 9ICCA 5E3FA 4A3KG 4DSFA 1CSPA 4R8NA 4I65A 2A69D 3SI8A 2HW3A 4O42A 1IBKL 4FP5D 1N34L 1KIXA 4IPHA 1EIYB 2KHJA 3Q8MA 4MTNA 5C0XG 2K6AA 1HNWQ 1V43A 5EWEA 5BN3A 2HBMA 5FLXL 1NJIC 1IIPA 2YTXA 3U50C 3AM9A 4IURA 2I9GA 1SJHD 2KCCA 5LL6S 5J2IA 2DFLA 4KMOB 4FF1A 2KHIA 5D46A 1HTPA 2FXQA 2J6UA 3PSTA 2OXOA 1HZCA 2W54A 4KLTA 1A3UA 1B8AA 3DWPA 3WU2U 1KQQA 2JA6B 5F3XB 3GTLB 3T3FA 1ZQMA 8ICWA 3MFYA 2B2UA 1WI5A 2FLPA 2QDBA 3PMFA 4DV2L 2DGYA 2F0PA 2JA5H 1ZOLA 1TY2A 1BVSA 3UMBA 5AM4A 1X6OA 4QMGA 5L1LA 4KKSA 3PW7A 4ZOHC 2F8LA 4G7HC 1ZQKA 4PV1C 5ALIA 1VQHA 5ALQA 5CA7A 1ZQNA 2LFNA 3QU9A 3Q0AA 2V4RA 4DL2A 2AUJD 3AYHB 5AK3A 1Z47A 3IFDA 3S15B 1XMQL 5AM5A 1DXSA 3CMEA 3M6ZA 3J81E 3RZDH 4F88A 1PH1A 5KFBA 4UB4A 4OELB 4ECWA 1H9MA 1PFSA 4LJXA 1IKLA 5D14A 4LF8Q 8ICKA 4CGZA 2QILA 5LMNL 8ICHA 1L0XB 2V9WA 4NXMQ 4UHVA 1W3SA 1I5FA 2W8LA 1VQFA 1VQ8A 9ICGA 1LACA 1BPZA 4UAUA 1K1SA 2ESEA 1PTOB 2A6HD 2KZZA 2EY6A 1X9WA 5I9PA 2XWBB 2F3NA 1SB3C 1WCMG 1TU2B 3MWYW 3TSSA 8ICQA 5EWGA 5EPJA 1EXNA 3CNHA 3D2NA 4DSKA 3M85A 4HJ7A 1NUCA 1HA5A 2R8IA 4HJ9A 4IFDH 2O5JC 2F3WA 2L55A 1ILQA 1PFNA 2BPFA 1F5SA 3HOXG 3EVQA 3DV9A 4YIJA 1GJXA 2OWOA 2ODGA 4DQQA 5J8YC 4FXKC 3ZDEA 5DLQE 3Q8PB 5F9NA 3QO2A 4KN7C 5IODA 5JJIA 1HNWL 2PMZF 3EUB2 2BCUA 2O2LD 3S1NH 2SOBA 5KFAA 4OWTB 1B9NA 2E2IB 4X62L 3K80C 4LZDA 1TV9A 2I46A 4B9XA 2JV3A 4LFAL 5EKKA 1KAWA 1ZYRC 1KABA 2RDJA 1BPYA 3GV8B 2QKIC 1WTQA 2K03A 4UPAA 4HAIA 4C8OA 1LLRD 4APVA 4JV2A 1PFBA 5ALZA 5DG7A 2B8FA 4A3DG 1X54A 3K7AH 4R65A 2MPMA 4JI1Q 3M9MB 4E0DA 1GD7A 4O9MA 3QE9Y 4IUUA 5KFNA 3F8TA 4A3JH 5M3MH 1FO4A 2D9UA 4PMCA 1X3QA 1XNQQ 2WINB 2AQ2B 4A3MH 3BDLA 8ICJA 1WCNA 1RYSA 3OPOA 4IALA 4M9LA 4QUFA 2ZIXB 5KL1B 1J6QA 5DAUA 1BO0A 1NSNS 1I6HH 2DUYA 3ZDAA 2M9VA 2ZJAA 5AKHA 4KJNA 3M9OB 1Y14B 3K81C 3SQIA 3CKIB 1SRUA 3RBEA 1LM0A 5BOLA 4GLVB 4MN3A 5DQIA 3S14H 1Q81C 4JI3L 4I7AA 4DQPA 5HR6A 4LUOA 2NVQB 2UVUA 2WB1E 3A55A 2K05A 5KFEA 1T94A 4JI1L 1C20A 5FKAC 2BCSA 1CKNB 3FM9A 4L63B 2K50A 2FINB 2R7ZH 3HP3A 1NZBA 2DQNB 1BCPD 9ICVA 3SK4A 8ICXA 2L5TA 2ZIXA 2KTQA 2MNAA 4YD2A 3UDGA 3V6KA 3GO5A 2Z8LA 4KMUA 3KLWA 1Z1BA 1NTGA 1I4GA 1B1ZA 1L3TA 4EX6A 3GTMH 1SZHA 2ZUBA 2UUAL 2IOHA 1D7QA 4FVMA 1S97A 5J0WA 1SYEA 3JC66 4DU9A 3E58A 1QNKA 2BA0A 3TACB 5BN4A 3LK9A 4BXOA 1FNUA 1DGSA 2F0JA 4OGQC 4PQXA 1T9HA 2F0IA 1Y1VG 3RN5A 3R9KA 2IW3A 2NVXB 7ICOA 5TSSA 4RNOA 1JICA 2XSCA 2A5HA 4K4HA 4EYIB 3Q8KA 3M4QA 2EZYA 2IJ0A 3G6EA 5DBCA 1JWSD 1NR2A 3IL8A 5AIAA 4O0IA 4YY3Q 4IPDA 5DM63 2A3VA 3KBGA 5C0YA 4DR7Q 1ECWA 4QZDA 4DLGA 4TSSA 2K8BB 1S5ED 3I8ZA 1E3PA 2LI6A 4NL9A 3RLOA 1EY7A 5G3LF 2CH4A 4U673 4QGUA 2PPBC 2MUTA 2KFNA 4X64L 1SV4A 3GDXA 2Y0SC 1VQGA 4A3BG 3HOZH 1ET9A 4F8RA 2QF7A 4N9TA 7ICSA 3GV3A 2LSSA 1RYRA 5M3MG 9ICUA 2RDGA 1DZ1A 3UM9A 4B9LA 3C2KA 4CNQA 2LM1A 1TWFH 1PYSB 4IOAA 1GUTA 1JMSA 5KT5A 2JZBB 1N56A 3SHLA 4ZRZA 4DOAA 3MGVA 3MGHA 5ALRA 2B2TC 2B39A 2JSOA 3KK7A 3NBHB 2JK8A 2FMMA 3D4RA 2JEIA 3I4LA 3N6RA 3RH6A 2IMWP 3R2TA 3I1YA 4KTAA 2JA5B 3EYZA 1V1QA 3C1ZA 4JB3A 5FJ8H 1ZD3A 4B9VA 2KD1A 2WKCA 3RB3A 5M5WB 3C29A 3T16A 4J8QA 2QA4A 4US8A 5CWRA 4IN3A 4PZOA 4EBDA 1I94Q 4LF9L 4J6HA 2IOFK 1HZ9A 2MO0A 2UXDL 3RN2A 1DOKA 1TK5A 2KOBA 2L12A 4K8JA 2FMSA 1HQMC 3J80i 4NB3A 2OH2A 3S15H 1D9FA 2JP1A 3M4YA 4DK6C 2E8OA 4AYBC 1N33Q 5A35A 2KV2A 1I4PA 2LMCB 2R7DA 1I6VC 3ZD9A 1X9NA 3MFHA 1F9RA 2W9CB 1D6EC 3HS0C 2QB1A 3K0YA 1YNJC 2F0OA 8ICSA 3CAMA 3S1MH 4NPSA 3N7PD 4K6DA 2GOLA 1I4XA 4JI7Q 1B2TA 2BOSA 1M1KC 1L0WA 2IX1A 2RDHA 5KFXA 4FF2A 1FNWA 3WKDA 3ULLA 4QZBA 1R4QB 2CW0C 1Y1WH 3M8RA 2CPRA 4TURA 1HFGA 3NENA 1SMYD 3F2BA 1L3UA 1YHAA 4A8EA 4JC0A 2WACA 4CHTB 3M7DA 1KLNA 1HR0W 3KYHC 5KNBA 4F4WA 2ZIVB 3OGUA 4DA2A 2WAQF 2MHVA 1VQOA 3MR5A 5KT7A 2RBMA 4OX9Q 4UAIA 2E2JH 1J8IA 4IJLA 1GVPA 1NI3A 2KIWA 5ELBA 2J7ZA 4RH6A 2CN1A 2EAOA 3SVMA 1VS0A 4WRDA 4Q44A 5J0UA 4PMBA 2WFWA 1A77A 2A1JA 3Q8DA 2HBKA 5AICA 3FPPA 1B53A 5EJWA 3OW2A 1N36Q 5HHHA 3S1NB 2KEYA 2A73B 4I2GA 3IFTA 2KVCA 1L1OB 2XY7A 4DUZQ 5JEAG 1WYGA 4KN7A 3RRGA 2N55A 4Y2VA 1CTMA 2R8JA 3B9JA 4LF8L 3J80c 2BE5C 1BR9A 5C0XJ 3T1HL 2RCFA 1WTVA 2EYJA 3WKCA 3H0LB 1Y1WG 5NUCA 1IL8A 3K7AB 3D4WA 4EEKA 2OCEA 3L5KA 2JH7A 2A6ED 4ACOA 2VZAA 4PZNA 7ICPA 3G6VA 5ALOA 8ICGA 1IW7D 2EJFC 4LK1C 3AQQA 4ODGA 4LVSA 1ZQFA 5J2GA 1GO3E 2K5VA 1QSLA 4FS1A 3HILA 5FOBB 2EZVA 3NVVA 4A3GG 2DUDA 4YXMA 5EE1A 1YIJA 1FEZA 1I6HB 1RYUA 1JUDA 1CKMA 3GTKB 3RR8A 1DYQA 3PIP3 1N32L 2F44A 1W2BA 2VL6A 3A5UA 1XYIA 2O5IC 4O3NA 3GTQB 4V190 9ICEA 4QZGA 1KTQA 5HMLA 4DQIA 2JA7B 1M8AA 1PYBA 5ALXA 4KJOA 1AZQA 4ED7A 1V85A 1NCVA 4TQRA 2NWGA 4TQUS 5JEAH 2VNUD 1ZQEA 3T1YL 5KFVA 1QH9A 1ZRMA 2R6GA 1EYCA 5IE8A 2RCNA 2HOIA 4DV0L 4GFJA 4FBTA 4IQZA 1SE4A 3QX7A 3STBC 1YJ9A 1GUSA 1SIJA 1N60A 4WJ3M 2W7OA 1YVCA 3GTMB 1TY0A