The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
133
|
structure length |
133
|
Chain Sequence |
EFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb |
| molecule keywords |
Holliday junction ATP-dependent DNA helicase ruvA
|
| molecule tags |
Dna binding protein, recombination
|
| source organism |
Mycobacterium tuberculosis
|
| total genus |
27
|
| structure length |
133
|
| sequence length |
133
|
| ec nomenclature |
ec
3.6.4.12: DNA helicase. |
| pdb deposition date | 2008-10-01 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01330 | RuvA_N | RuvA N terminal domain |
| A | PF07499 | RuvA_C | RuvA, C-terminal domain |
| A | PF14520 | HHH_5 | Helix-hairpin-helix domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | DNA polymerase; domain 1 | 5' to 3' exonuclease, C-terminal subdomain | ||
| Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | Nucleic acid-binding proteins |
