2ZTEA

Mtruva form iv
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
133
structure length
133
Chain Sequence
EFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 27
structure length 133
sequence length 133
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2zteA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zteA01
2NRVA 2R7ZG 5KFMA 4RQ5A 4P71A 1PH1A 1UT8A 3FKIH 3RR7A 3GIMA 9ICGA 3UQ2A 2V4QA 1OXXK 1QVFA 4X62Q 1X54A 1SLJA 1U4BA 3LWMA 1PHJA 1SKRA 5M5XH 4O3SA 4BDPA 3SV3A 4DV1Q 4IFDG 4Y52H 4M6WA 2KCMA 5IP9G 3H7IA 4DV6L 5F9NA 2PXIA 1PZNA 3CCRA 4DR5Q 4R8UA 3UXNA 3ER0A 4R1JA 5DDYA 5AJ3L 2E2IH 2YYZA 4MZ9A 3HOVH 4JV1A 1FL0A 4H02A 5L1KA 4DS4A 3HOYG 4BY7G 3UDGA 5FJ8G 1XJVA 4PZ7A 4QY7A 1U48A 4X66Q 5BR8L 5J0OA 4M47A 1VQ4A 4DR5L 1QSLA 3LGJA 3F8TA 4KLGA 3G6XA 4NLNA 2W9BB 3UQ0A 1BKBA 1ZQGA 1JJ2A 3H40A 3V7KA 4RNNA 3MABA 3RR8A 4PZ8A 3L0OA 1NK6A 2W9AA 4JV0A 4GN5A 5CWRA 4I2EA 4GS3A 4OONA 1PYSB 3ORYA 5HP4A 2JA7G 4C3HH 4YWKA 3Q8LA 2BCSA 1N48A 4ED6A 1ZQFA 3JPQA 4LW1A 1L2FA 1BPBA 1VS0A 4OWWB 4X6AH 2KHJA 2FLNA 1BPXA 1KHIA 4LFCL 4YCWA 4HJAA 4LF5L 2E5LQ 5HMLA 4LF8L 4F50A 4AQYQ 2Q2HA 2F52A 4A3JH 1K0RA 2PI2E 2OQ0A 1X9MA 1ZQXA 2ISPA 2KZMA 7ICHA 4B3RL 3AU6A 5DQHA 2KBNA 1W2BA 4UB1A 1VQOA 1P16A 1ZQOA 1A63A 4Q44A 5KT3A 2NRTA 4RPZA 4B9SA 2VA2A 4PHEA 1QVGA 5EOZA 3G6YA 3I4MG 2BKEA 4GC6A 3F1ZA 4X64Q 4BXOB 2RCNA 5KG0A 4A4IA 4M6WB 2C2DA 2KCTA 2LXJA 4OWTB 3I4OA 1XPUA 1N34L 5IIOA 3A5ZB 3GD7A 3Q8QB 3PF5A 2KFZA 1ZQSA 4DO9A 2IHMA 1VQFA 9ICXA 4DR2Q 2E2JH 1V9PA 2R93H 4POGA 4KHPL 3JAMi 2YU9H 2LXKA 3HOXH 4F4WA 1U49A 4JI4L 7ICJA 9ICPA 3RBDA 4JI1L 3WWVA 1R9TH 5J2HA 3MXNB 4A3CG 4A93G 2OWOA 1ZQBA 1S77D 2V1CC 1X56A 2VANA 3H3VI 3FHWA 1ZETA 3EBEA 4UP7A 4GXJA 3Q8KA 2C22A 1N36Q 3K80C 4MFAA 4P74A 5CHGA 4KLTA 5KG2A 2WTFA 4QZBA 2C2EA 2XGTA 4RG1A 4YG2A 2DGYA 1X9WA 1ZQTA 1NMFA 5L9XA 2BQ3A 4QWDA 1VQJA 5KT5A 2M9NA 5DLGA 3GDXA 9ICCA 4QW8A 1TAUA 2KTQA 3H15A 1K3RA 1XNRQ 4APVA 4JI5L 1UE5A 5GQOA 3EIVA 3UDIA 1VQNA 2JZBB 1NJYA 1VQBA 1KEJA 1NJIC 3ZJYC 4ECUA 9ICAA 1GM5A 1GVPA 3C2LA 1OXTA 4QIWE 4TQRA 4ECVA 1J5EL 1A62A 5KT4A 1B8AA 4HJ8A 1PYBA 2JEBI 4I2BA 1ZQCA 7ICTA 4P2HA 8ICFA 4LUOA 4UB3A 5KG4A 4DOCA 1ZQKA 9ICNA 2ZJQA 4MFFA 3RJIA 1S0VA 3TRZA 3KHRA 1EWIA 5IILA 1RXVA 5DB6A 4FS1A 2W9CA 4O5EA 3D31A 3K8AA 3MGHA 4A3MH 2Q2UA 4POFA 1KRSA 4TVAB 4GLVB 3H0GH 7ICVA 7ICRA 2RHQB 3CPWA 4RQ3A 2R93G 4J9QA 4C8MA 5KTQA 3GTOH 3MEFA 1Z47A 1JT8A 3THVA 3OJUA 4UB2A 5KFCA 2UVWA 4BBSH 4KLFA 3QZ7A 4J15A 7ICQA 1VQDA 4IPGA 1OTCA 1X9SA 3K81C 5DBAA 3CCQA 2IHEA 5LMNQ 4GLAC 4AIMA 1CKNB 8ICQA 5M3MG 2HT1A 2H5XA 3F2DA 3T5JA 1PH3A 3PO3H 1JN3A 3B6YA 2PFOA 3OW2A 4GNXA 4J9MA 5DDMA 5EWFA 2FXQA 2LSSA 1CKOA 1QSSA 4JOIC 2HHWA 1EQQA 5D49A 2C2RA 4PHDA 4YHHQ 3BQTA 2Q0ZX 2BA0A 2K75A 4YHHL 3NEMA 3Q8RB 1ZQQA 4LF4Q 3GTJH 3I2ZA 4KLDA 1MSWD 3GILA 2CFMA 3MDAA 1XPOA 4DK3C 8ICEA 4PZ6A 3CCVA 4JI4Q 1IL2A 2ZTCA 3RH4A 1V43A 4IQWA 9ICBA 4GOPC 3W1BA 4NXNQ 4DR3L 1N34Q 1KFTA 1MQ2A 4A3BH 2I9GA 1A76A 4GXIA 4KTQA 5FLMH 4KLOA 3JPSA 5KFFA 4KLEA 4YQWA 1QZHA 5DBBA 5KFRA 3T5HA 4X64L 1C0AA 2OQKA 8ICTA 5KFTA 1JX4A 9ICJA 2UVUA 1NOMA 2WAQG 1UWVA 4MTNA 4YVZA 5LMNL 4I2AA 4I28A 2AHOB 2JA6H 2NRXA 3CC7A 3TS2A 3A74A 3TS0A 3JAMc 5IYDH 4I2CA 3U58A 4LFAL 2K50A 5KFWA 3RZOH 1RPLA 1L5UA 3KJOA 5C44H 2CWAA 5KFUA 1KTQA 3G6VA 2W8LA 4UPAA 3TANA 4LF8Q 1UA0A 1ZQRA 3BU2A 5J2JA 4LNQA 4UQGA 2YV5A 4KI0A 4JI5Q 4DSIA 4ELVA 4NXZA 5J0RA 2UUCQ 3UDFA 1JE5A 3NBHB 1L3UA 1VCIA 5C4XH 3ZD8A 1X9NA 4O3OA 1IBKL 4IOAA 3DM3A 4DV2L 1TV9A 2RHSB 1UEBA 2ASDA 4ELUA 4JI0L 3RLNA 2UUAQ 1T3NA 1IBML 2FLPA 3S24A 1E22A 4KLUA 4AYBE 3HKZG 4TURA 2WFWA 2R8KA 1YNXA 4K0KL 1NMGA 1NK0A 4IRCA 3KF6A 2UU9L 3C1YA 4UP9A 4A3EG 2KHIA 4RQ1A 4FO6A 2F1JA 5HNKA 3UPQA 1RYSA 5DBCA 4DK6C 1A77A 1XNQL 1SRUA 9ICQA 3J81j 5KFZA 1ZQHA 3SV4A 2W9CB 3OHBA 3MDCA 3PW7A 2R8HA 4PG3A 3HOXG 3PGZA 1JMCA 1MIUA 3CCLA 3F2BA 3PV8A 1KFDA 3FDSA 3CMEA 3GIJA 4F91B 4RQ0A 3CQZH 4DV6Q 3G4SA 2FMPA 3EW9A 1CSQA 3SGIA 2WAQE 4MNOA 3QEBZ 3CF5A 2I1QA 4LVSA 3PNCA 2JA6G 2AJQA 3PMLA 1H38A 4C8KA 4B9LA 2NN6I 1B7YB 4JC0A 1N33L 1JIHA 2JA7H 4YY3L 4DV5Q 4GKKQ 4Z6CA 1CSPA 4QQBX 1ZQNA 2XGPA 1PH6A 1HR0W 3DLLA 2PI2A 3BQ0A 3SYZA 3UDXA 1SMXA 4EYHB 3V6HA 4B3RQ 2ZJPA 1T7PA 2NVYH 1L3SA 3RJKA 2ZUCA 4YR3A 2BCVA 4AQYL 3CPFA 4RT2A 2E5LL 5HHHA 4I27A 1IYJB 2KZZA 4F4KA 2IA6A 4YCXA 3RRGA 1S0MA 4BY1H 4P75A 3J80i 1UE1A 4DV4L 5ELNA 1ZQVA 1YBYA 1B22A 1K8GA 4DR6L 4P4OA 4AYBG 2MQHA 3I4MH 4LUVA 5DQIA 2C28A 2K14A 2UUBL 4DV7L 3PX0A 4XQ8A 2WB1E 4DV3L 4JK1A 3L2PA 2EXDA 5IIMA 5J2EA 4F5NA 4XUSA 4BBRH 4FBUA 3JPRA 1PH9A 4NLGA 2ASBA 1L1OB 4F3OA 4DF4A 3G48A 4GN3B 3FYHA 4YD1A 5IP7G 2AMCB 2YTXA 2VNUD 9ICEA 1NJXA 2FPLA 4QZ9A 1HNXQ 3RLOA 1BPYA 4M04A 2KZ3A 1Y1WG 2W9MA 4I2GA 3PUWA 3Q8PB 4WJ4A 2HIXA 5GADC 2ZJAA 4EYIB 1QVCA 4B3TQ 3QZ8A 2BQUA 1PVOA 1ASYA 2NZHA 1HH2P 4B3TL 1J6QA 1KRPA 4JBKA 3EPGA 2JEJA 2ZJRA 3I4NH 4ED7A 4ALPA 2ZM6L 3V6JA 4QW9A 4R4OA 4GOPA 4DOBA 2MUTA 4DWIA 1JB7A 4QZIA 3PO4A 1G6PA 3OSPA 1HZAA 2K5HA 4A3IH 1DGSA 4A3CH 4HIDA 3QE9Y 5JJIA 2A1JA 4ED8A 3HP6A 2AKWB 8ICKA 2UVVA 4Q43A 1Y14B 5BOMA 1HNZL 3S1RH 1TWFH 3PIOA 2ZM6Q 4KN7A 2PI4A 3KFUA 3PO5A 3AUOA 4ED0A 2K5NA 1ZQEA 3JPPA 1RYRA 4X62L 4GKJL 2AQ0A 4JBMA 4QL5A 3UE0A 5JEAG 2HHVA 3ISCA 4KLHA 1KD1C 4JI8Q 1MJCA 4ZH4A 1K83H 4QZ8A 3H4DA 1YJNA 3KF6B 3OHAA 1T4GA 1SL1A 3M4PA 1HNXL 4Q45A 2J6SA 4M0AA 4RQ2A 2R92G 2NVXH 4O0AA 4UB5A 2BH2A 4RQ4A 3FP9A 2VQEQ 3QEAZ 4GXKA 8ICVA 3S16H 2XC9A 3HPOA 1XSPA 5KFPA 9ICKA 4DV3Q 4O5CA 2CWPA 3M7NA 4DFKA 2MO0A 3CMAA 2VQFL 4A3DH 1AROP 5M5YH 3CD6A 8ICJA 8ICRA 9ICFA 3RAQA 3RJFA 4DV5L 4GKKL 2OCEA 2W8KA 1N33Q 3G71A 3TQ1A 1TWCH 5KFBA 4M9HA 4HYKA 3UE1A 1SN8A 2CQOA 1TK5A 4J9KA 1YITA 1YVCA 2ALYB 4MF8A 1Q46A 3M8SA 2V4RA 1PH7A 5L1JA 1EIFA 1SFOH 1XMOL 4P4MA 5IYBG 4J9SA 5GAHC 2E2HH 4YR2A 4NY8A 1CUKA 4DV0Q 2AWNA 3MFIA 5C0XI 4TQUS 4LFBL 4IQUA 4GOPB 4X5VA 2P6RA 3A5UA 2OTLA 4EQ5A 3V6KA 1MQ3A 1WYDA 2IX1A 1E1TA 3VDYA 8ICCA 2NVTH 1XWLA 3TFSA 4JI3L 4DQSA 4DEZA 3M9OB 5F9LA 1KXLA 1VQCA 3C2KA 9ICTA 3TAQA 4IFDJ 3HFZB 1LUZA 2KFNA 4BBSG 1YZ6A 4DNIA 2MFIA 2HIVA 2ISOA 3PY8A 4UAYA 2D0PA 1N32L 4K4IA 1TVAA 4HIMA 2ZTEA 8ICAA 1WCMG 1SR3A 4NPSA 1HJPA 1PFSA 2A8VA 2VUMH 4RUCA 3GTMH 5J2BA 3E9HA 4O3PA 1FGUA 4YXMA 1CKMA 1RL2A 1X3EA 2IX0A 8ICYA 3HOUG 1XPRA 4P4PA 1D7QA 4F5OA 3CCSA 3K0XA 4QJFA 5M3FH 1EUJA 1IBLL 4JWNA 1WOCA 4QZEA 3PR5B 2YTYA 3C1ZA 5KFVA 2JZBA 4JYAL 4R4IA 2UUAL 4DSEA 2UVRA 4YMNA 1D8LA 3V7LA 3GIKA 2GN5A 3GFKB 4R64A 4C8OA 7ICUA 2VL6A 5IWAL 4DV2Q 4QZGA 4DQPA 2MNAA 3GV8B 7ICKA 2IHNA 5LMNW 5K36G 3RB3A 3AQQA 4KLSA 2PMZE 2N3SA 5C44G 8ICNA 3ZDBA 4RZRA 5J0UA 5KFDA 2UUCL 1SZPA 1ZQAA 2ES2A 4I2FA 8ICIA 4JV2A 1ZQZA 1I6HH 1XU4A 3GTPH 4NXNL 4IPHA 9ICMA 4ECRA 1IXRA 2UXDL 4KLIA 3U50C 4B9NA 4DKAC 3OGUA 3J7A5 3GDEA 4P72A 1YEZA 5DLQE 3BDPA 3RLFA 1BPEA 4A3JG 4KITB 1S97A 9ICUA 3PUVA 3AU2A 2HHHQ 3RR5A 7ICOA 5CB1A 4LF4L 4R4TA 2EQSA 4DSJA 1I94Q 3A0JA 2NVQH 5FJ8H 1E7ZA 1OXVA 1MKHA 5DKWA 4M9JA 4JWMA 2MAXA 4YN4A 1Q12A 4GNXB 1Y1VG 3H3VH 2A1AA 3ERSX 4RNMA 2R7FA 3K7AH 4FS2A 5J0QA 7ICEA 3CCMA 5J0TA 3PW2A 4DS5A 5KT7A 1NKBA 4YWMA 4A3FG 1C7YA 5HMMA 2JA8H 1L3TA 1VQ5A 1Z00A 4DSKA 5JUMA 1HNWQ 4IR9A 4ECYA 1BBUA 8ICOA 4C2MH 4DR4L 4JV5L 2B21A 2PFPA 2AU0A 3KDFA 1Q1BA 4LF6Q 3E2EA 4IJLA 4J9RA 2JEAI 3W1GA 3RJGA 5IT9c 3IHQB 4KMUA 3PO3G 3RB6A 5IY0A 2BCQA 2DFLA 3KOJA 1Q86C 5IYCH 1XTDA 1TFRA 2BDPA 4UBCA 1ZQYA 4IOCA 3HOZG 4YMOA 2ALZA 3RTVA 5DG9A 4KN4A 9ICOA 1BBWA 4XIGS 2EIFA 2UXDQ 4F5RA 1TKDA 3T3FA 2JEGA 5CR0A 4GN4B 1Q81C 1XC9A 1HR0L 1VQ6A 1K9MC 2J6TA 3KHLA 4QZCA 3PX4A 1PH4A 2R7ZH 3ULPA 4J9NA 4QZAA 5DB9A 1H95A 3PX6A 1SL2A 1CEZA 1VQAA 4R4CA 3S1QH 4BY1G 4LZDA 4UY8C 5LMUL 1YIJA 1VQ9A 2UXBQ 4PGYA 2N49A 4F5QA 2HHQA 4ME3A 5HY6A 1ZQDA 4DR7Q 5KG3A 2BGWA 3MR6A 2BPCA 3ZDAA 4YD2A 4RU9A 4MFCA 1IBLQ 3KJPA 3RH6A 1O7IA 5IP7H 2MO1A 4LF6L 3RN2A 3BJYA 4B3ML 2AQ4A 5IYDG 2VW9A 4DL6A 5J2IA 1JJCB 2Z6KA 1XNRL 5DGAA 1DOQA 3S15H 4ECXA 4IPCA 1JMSA 4RMFA 1EFWA 1HNWL 4ECSA 1VQMA 2D62A 3PV0A 3W5OA 4JI3Q 5J2KA 4B9MA 3CAMA 4QGUA 2RDJA 4B9UA 5E7NA 2K4KA 5DB8A 3HKZE 1TWAH 3HWTA 5CJ7A 2P66A 5KFNA 3H8JA 3Q8DA 3TEHB 1XO1A 4DUYL 4DL7A 3BQ2A 3M3YH 4IFDI 2F4VQ 1HUOA 3PUXA 1KL9A 4B3SL 5IP9H 7ICPA 1K73C 2VZAA 1FJGQ 4DQRA 5C4JH 3S2DH 2R7DA 4O3QA 4ECTA 4A3IG 3GTQH 3OTOL 5KFGA 1D9DA 1S9FA 4I2JA 1K8AC 3PMNA 1A8VA 2IT1A 3ULJA 5GAGC 4C3JH 3ULLA 3I7FA 1A0IA 4DR1L 4DR2L 1MJEA 4JI7Q 1LB2B 5KFSA 1K1QA 1KRTA 3MBYA 2ATWA 4MEYA 3CCJA 4OO1G 1MC8A 1BGXT 4O3RA 5EWGA 4TUSA 5IWAQ 4DL5A 3C23A 4QWBA 2XY7A 4L5RC 1VQIA 3I55A 4DSLA 2DUDA 1BPDA 1NKCA 1Q82C 3JPTA 5L1IA 4QWAA 4KLKA 1JXLA 3JPNA 4YXJA 4Y7NH 4NM2A 3PUYA 1M90C 1ZQUA 3UXOA 9ICVA 1ZJMA 1P8LA 4L5SA 2FPKA 3HOVG 1T8EA 2K52A 3GTKH 4F92B 2BH8A 1XSNA 2Q2IA 1GO3E 2IBKA 4IO9A 3LK9A 4DF8A 4F93B 1HNZQ 1NJWA 1VQPA 4ELTA 4LFCQ 1X3FA 3KDFB 4A75A 3M9BA 3KHGA 3N97B 1I5FA 4RQ6A 1ZQLA 2MUTB 5HGQA 8ICGA 3MR3A 5KFYA 5KFKA 4YP3A 1LV5A 2C35B 4GKJQ 4BA1I 4UBBA 4IJHA 5CA7A 5DB7A 1EIYB 2GVAA 4MEXA 4A3BG 2FMSA 1N32Q 1JJGA 3S17H 1ZQPA 3RB4A 4CCHA 8ICHA 1SKWA 4KLQA 1D8YA 2K5VA 3PO2G 8ICZA 2F1IA 4PGXA 3PSIA 4RQ8A 2BPGA 4KHZA 4BBRG 1QUQB 4YFKA 5TZVA 3RJHA 2R92H 4KLJA 3PUZA 4X66L 5BPCA 5BR8Q 3L7ZC 2Y0SE 1JXEA 4A3FH 2JA8G 1LYLA 3HOWH 4OX9L 3KF8B 2QEXA 1NE3A 5KG7A 2WP8J 4GNXC 1IM4A 5BOLA 4IR1A 3FKIG 4A3KG 3E0EA 2R8IA 5AJ3Q 1Q7YC 2KN7A 3OYYA 1YHBA 1EOVA 3MFHA 3M8RA 5IIKA 4DAMA 2JEIA 1Z9FA 4A76A 4LWCA 1L1OA 4R8UB 5L1LA 1SKSA 1Y1WH 2RDIA 4QZHA 3GV7B 4DV7Q 1T9HA 3I56A 2B63G 4Z6FA 1PV4A 5J2GA 4YCVA 1VQ8A 3S1NH 1KLNA 2VQFQ 4PPXA 9ICWA 1VQLA 3KLWA 1K1SA 2FPMA 3HOYH 4BY7H 1X6OA 1COOA 2NRZA 4JI7L 3U4ZA 2BHNA 3PW4A 2BR0A 2HQLA 1BPZA 4DAYB 3EWAA 1S72A 1Z3EB 5IE8A 4QWCA 2XY6A 2B29A 2ZTDA 3MGIA 1RIPA 1HZ9A 5C4XG 1U9LA 3TQYA 3AFQA 4AH6A 4DUZQ 4JBJA 2A1JB 4R65A 4NXMQ 4DL4A 4XRHA 5J0WA 1ZQJA 4B3SQ 4TQSA 4DFJA 3M85A 2Z6KC 4F4YA 2B63H 3CCEA 1WCMH 4JI6Q 3RN5A 4A3LG 7ICLA 5J29A 4JUZA 3SZ2A 4EX5A 1GKHA 2Q2TA 3Q8MA 4EZ9A 5DG8A 1G51A 3PW5A 4BWMA 3CC2A 5J0PA 2V9WA 3D0FA 5M5WH 2GVBA 3H0GG 5DQGA 3C21A 4YY3Q 2JA9A 4R4QA 7ICGA 2UXCQ 4IQTA 3LDAA 3C5FA 2VA8A 4X65Q 4F4XA 2W9BA 4B9VA 1KAWA 4KLLA 1XNQQ 1W3SA 4LF7L 3HOWG 4TUQA 2ZJ8A 2UU9Q 3ZD9A 2ATLA 2E8GA 3STBC 3T1HQ 3AFPA 5M3MH 1NK5A 5J2FA 2JQOA 1ZQWA 4PHAA 4A3GG 3C2MA 4EBCA 3AEVA 1TXYA 4F2SA 4YMMA 1Y1VH 1BVSA 7ICSA 3PR4A 2BCRA 2UXBL 3LWLA 4HIKA 1S0NA 1NK7A 4BGDA 4DLEA 1PH8A 5KFEA 2QGQA 2BA1A 1G291 1LM0A 4K0KQ 3E9IA 4HIOA 4WJ3M 3U4VA 1WJJA 1EXNA 3J80c 3IM1A 1VQHA 3NTUA 4I2HA 5IIJA 1HR0Q 1ASZA 1Y88A 3CP0A 4BA2I 2AGQA 5EWEA 4DR6Q 1GD7A 3V72A 4DQQA 1EYGA 4BXOA 4ED2A 1AE2A 1L0WA 9ICRA 4L5TA 1KC8C 5C0XG 4R63A 3HKSA 4PGQA 3CXCA 5KG5A 3GV5B 2ASLA 4M9NA 5C3EH 3RRHA 1WCNA 5KFXA 7ICMA 5HHIA 4DR1Q 1C9OA 2P6UA 7ICNA 2HW3A 3HOUH 1ZJNA 4TUPA 1NBWA 4XA5A 4GC7A 3KHHA 3T5LA 1RZTA 4LFAQ 2R8JA 1ZQIA 2JEFA 5KFHA 3OTOQ 4LF9L 4A3MG 4Z6DA 4GLXA 2PQAA 1FJGL 5CP2A 2PFQA 1I50H 4NLZA 2CCZA 2IHFA 2I5HA 3B0YA 1KQSA 4RPYA 4B3MQ 3GQCA 4FBTA 2F4VL 1ZYQA 1RXWA 4DUYQ 4C8NA 3S14H 1M1KC 2HHSA 4O5KA 1HUZA 4Q8FA 8ICSA 4UAZA 4DLGA 2QA4A 1QLNA 1U47A 5JJLA 4NB3A 8ICLA 3Q8SB 4DSFA 3F2CA 2A19A 3M9NB 2FMQA 2I5LX 2ASJA 1N56A 3ZDCA 5J0YA 4F4ZA 5LMUQ 5GROA 5J3BA 1FVIA 2N78A 2HVIA 4EEYA 4UB4A 3AYHB 4JBWA 3S1MH 1NK8A 3SI8A 4FDBA 3T1YL 2JE6I 3MR2A 3M4QA 3BZCA 5M3FG 4DR7L 8ICMA 4JG2A 1E1OA 3BJUA 8ICBA 1IBMQ 1U45A 4HJ7A 1SE8A 3RNUA 2I0QA 4JI0Q 1VQGA 4JI2L 4O9MA 1KSPA 1PH2A 3GO5A 5IYBH 1L1OC 5IIIA 4F8RA 4DFMA 1X55A 3GTLH 4UAWA 4A3LH 4A3DG 1UT5A 4KLMA 1IBKQ 4JI2Q 3B0XA 4ED3A 5KFJA 8ICUA 1HZCA 4ECQA 2Z0SA 1LTLA 3RB0A 4M9GA 4EZ6A 5J2DA 3M9MB 5H1SE 3T1YQ 3HT3A 3HX0A 1X3GA 1XMQQ 3ISDA 1J5EQ 1U5KA 4ECZA 2PFNA 3J81i 8ICPA 4I2IA 4OWXB 4NLKA 2D0OA 4JCVE 5D46A 3C5GA 1CKNA 3JC66 1XMQL 1VQKA 4IRKA 2R8GA 3H8WA 2PQAB 1UE7A 1V1QA 1X65A 5C0XJ 2AWOA 2DPJA 3RJJA 1WI5A 3EN2A 3PF4A 1S0OA 1TWGH 1S3OA 5J2CA 5J0XA 1NTGA 4G3IA 2F3IA 4HJ9A 3UXPA 4DOAA 2OTJA 2JJQA 4C8LA 1N36L 4JV5Q 4NM1A 4OXPA 4DR4Q 2LYHA 3HW8A 5D4BA 1UA1A 4QZFA 3KTQA 4XTCS 2J6UA 1B70B 3ZDEA 3ISBA 8ICWA 7ICFA 1SL0A 5KG6A 1XSLA 1NK4A 4F2RA 4DR3Q 5KT2A 3PIPA 4RT3A 3TARA 2B3GA 3K7UC 3H8SA 2Y1IA 3G6EA 7ICIA 1Q8KA 1Q1EA 2HHHL 4A3KH 4LF9Q 2ZJ5A 4R66A 5KFOA 1QTMA 3J81c 4EBDA 5C5JA 1L3VA 3STBD 3N4MB 3PCOB 2ZUBA 4PMWA 4YR0A 1UE6A 3PW0A 4IRDA 3NELA 4IQVA 5ELOA 1E3PA 1I94L 4I2DA 2BPFA 5J0SA 1S40A 4A3GH 4MF2A 9ICIA 1TK0A 3JPOA 4JI1Q 3EPIA 3TI0A 1XS9D 4OO1I 1ZQMA 3GTGH 4ED1A 4K4HA 1IZ6A 3EYZA 3CC4A 2NN6G 3TAPA 2JK8A 3TREA 4KHPQ 2Y0SG 4A3EH 3CCUA 1TAQA 2AGOA 2F1HA 2YTVA 4ECWA 4O0IA 4K4GA 2GWSA 3RBEA 1YJWA 5C3EG 5FLXc 2NRWA 2XTIA 3PO2H 2XO7A 4J9LA 1I3QH 2PI5A 4JOIA 2L15A 2ZUDA 3EZ5A 5IINA 3ICEA 1TWHH 9ICLA 2IMWP 2JA5G 1WFQA 4YWLA 4JI8L 3RH5A 4PH5A 5GAEC 3NENA 4JYAQ 3T1HL 1QSYA 1OXUA 1QZGA 4BWJA 4UP8A 1KFSA 3BQ1A 1KIXA 5KFLA 4I29A 4M2YA 3K4GA 4LF7Q 1YHQA 4EBEA 4LF5Q 9ICHA 4X65L 4BXXH 3GIIA 1AH9A 1NY4A 2UXCL 4DFPA 5DG7A 2VY3A 3K75D 1NK9A 2HHUA 3NGDA 2PNHA 3MR5A 3ZDDA 1NKEA 3RJEA 3H4BA 4YCUA 4Z6EA 2VS1A 1PA6A 1B43A 2N8NA 1VQ7A 1QUQA 4LUZA 2Y1JA 1EQRA 1SROA 2IY5B 4Q8EA 3V7JA 2NZOA 1AE3A 3RZDH 4L5QA 4F5PA 4A93H 2HHTA 1YJ9A 1TK8A 4RUAA 5KT6A 2BCUA 2JA5H 4PHPA 3TFRA 1XMOQ 2XGQA 1Z00B 5FLMG 4IPDA 4NXML 4QZDA 4DUZL 4DV1L 8ICXA 5KG1A 5DLFA 5IYCG 1WCLA 2VUMG 5JJKA 2I5MX 1PH5A 3J7ZC 2R6GA 3KYHC 3S2HH 4DL3A 1VQEA 1YHAA 4DQIA 3OJSA 2KENA 4J9OA 2HHXA 5KFIA 4LFBQ 4BXXG 9ICSA 4DV0L 3RAXA 1U0LA 5KFQA 4QWEA 2XCPA 4O2DA 5KFAA 3CW2C 2VQEL 1D9FA 1X2IA 4RQ7A 2AGPA 2XY5A 5J2AA 1KDHA 2RF4A 2WB1G 3PVXA 5JEAJ 4JI6L 2UUBQ 5EAYA 3ETLA 4RNOA 2DPIA 4E0DA 2ID0A 1HZBA 2VA3A 3BZKA 4HJ5A 4B9TA 1S76D 2FLLA 2HVHA 3HOZH 4DV4Q 2CKZB 1N9WA 3I4NG 3M4OH 4RPXA 4J9PA 1YI2A 1S10A 1E24A 4DL2A 4P73A 3T5KA 2XCAA 4LZGA 4O3NA 1NJZA 2BQRA 4M9LA 4DPGA 3IRBA 1N8RC 3OSNA 1OXSC 4C3IH 5DGBA 4OX9Q
chains in the Genus database with same CATH superfamily
1JROA 3CRXA 2NRVA 3WOFA 2R7ZG 4AYBB 5KFMA 4RQ5A 5IGDA 4P71A 3QU7A 1PH1A 1UT8A 1EY7A 3FKIH 4FO2A 5IGFA 3RR7A 3GIMA 9ICGA 1IYUA 4P2CB 1ML0D 1PRTD 2CPRA 1GUWA 2Y0SB 3JAME 3UQ2A 2V4QA 2E8NA 4X3SA 2E2JB 1OXXK 1QVFA 4X62Q 3ED5A 1N61A 3S1RB 4LF6Q 1GHJA 1Z7TA 1X54A 2ZG6A 4NDXA 2BDOA 2VB2X 1SLJA 2OHFA 2HSZA 1U4BA 1SIJA 3LWMA 5C3XA 1PHJA 1DOKA 3N7SC 2JV3A 1SKRA 4O3SA 5M5XH 4BDPA 5CEHA 2A68C 3SV3A 3OMGA 4DV1Q 4IFDG 4Y52H 2LY7A 4M6WA 2KCMA 1H9MA 2KVMA 1PZKD 3BVZA 5IP9G 1B2TA 3E5SA 3H7IA 4DV6L 1CM9A 2WINB 5F9NA 5C0XH 2PXIA 1PZNA 3CCRA 4FF4A 4DR5Q 4R8UA 3UXNA 3ER0A 4R1JA 2EJGC 4NLBA 1ZD5A 4IALA 5DDYA 5AJ3L 2E2IH 5IT9L 2YYZA 1FFVA 4MZ9A 2MJ8A 3HOVH 4JV1A 2B2TC 1FL0A 4H02A 5L1KA 4DS4A 2CW0D 3HOYG 1DXSA 4BY7G 3UDGA 2ZXIA 5FJ8G 1XJVA 3NVZA 4RA8A 1ESFA 4PZ7A 4QY7A 1U48A 1Z1VA 4A3IB 4X66Q 4CDFC 5BR8L 3M6ZA 2FINB 5J0OA 5FKAC 4M47A 1RDFA 1VQ4A 1SYGA 5KYIA 4DR5L 1QSLA 3RFAA 1OUQA 4NMZA 3QUTA 3LGJA 4EQOA 3F8TA 4A3FB 4KLGA 4LAAA 2W7OA 3S15B 3G6XA 4NLNA 1IIPA 5ELEA 2W9BB 5LL6X 3NXWA 2N1RA 3UQ0A 1BKBA 3QIAA 1ZQGA 5CC4A 1JJ2A 3AL0B 3H40A 3V7KA 2YN4A 3U26A 3MABA 4RNNA 3RR8A 3L0OA 4C7ZA 4C0ZA 4JV0A 2W9AA 1NK6A 1ZOLA 5CWRA 1VMPA 4GN5A 1XYIA 4I2EA 2NO4A 3A8JE 2ES6A 4GS3A 1PYSB 4OONA 1IW7D 3ORYA 4NJ8A 5HP4A 2XN9C 2JA7G 3N7RC 4Y2VA 4C3HH 5JTIA 1HCZA 4YWKA 3Q8LA 2BCSA 4IQZA 1N48A 3KBGA 4ED6A 1ZRNA 2RQ5A 2JMGA 2CVRA 1SJED 1ZQFA 2EY6A 4LMQD 3JPQA 4LW1A 4QNLA 1L2FA 1BPBA 1VS0A 4OWWB 1SYCA 2XWBB 4X6AH 3KKAA 2KHJA 2FLNA 4G7HC 1BPXA 2XSCA 5IIFA 1I4XA 1KHIA 4LFCL 2HCCA 5ALIA 1E2VA 1D5ZC 4YCWA 2KJXA 4HJAA 4LF5L 2E5LQ 5HMLA 4LF8L 3KFUF 1PMRA 4F50A 4AQYQ 1ZD3A 2ZIXB 2NUCA 4ZYSA 2Q2HA 1EYAA 2F52A 2B2WA 5DEHA 4U673 2K8CB 4A3JH 1X6JA 1K0RA 2PI2E 2OQ0A 1X9MA 5IODA 4F7XA 4PQXA 1N2XA 3MXUA 3KOOA 1ZQXA 2ISPA 2KZMA 7ICHA 4B3RL 3AU6A 2Z7JA 3KD3A 5DQHA 2KBNA 2KEYA 5ALGA 5AKKA 2K05A 1UCVA 3KLSA 5G5HA 1W2BA 4UB1A 5ALPA 1JCKB 1PK3A 1P16A 1ZQOA 1VQOA 4N9PA 1A63A 1EZ6A 5CV8A 2H4OA 4Q44A 5KT3A 4XQJA 3BS1A 2NRTA 5AKHA 4RPZA 4B9SA 3L4PA 2VA2A 5EKIA 4PHEA 1F5SA 2FJ6A 1I6HB 5C4XB 1QVGA 4CNQA 1QCBD 4ZK9B 5EOZA 1WG8A 3G6YA 3I4MG 2BKEA 4GC6A 3F1ZA 2HDLA 1TWCB 1CZGA 1V8QA 1H9KA 4X64Q 3KBBA 3ZYYX 3J7AV 4OJ5A 5AI5A 4BXOB 3GV3A 4J8QA 2RCNA 3NE5B 2B2UA 5KG0A 4A4IA 4M6WB 2C2DA 2KCTA 2LXJA 1N63A 2TSSA 4KJOA 4OWTB 1SGGA 1DCZA 3J81L 1OW5A 3VR2A 5KNCA 5C3EB 4GZYC 1S5CD 4MHVA 2CQAA 3I4OA 1XPUA 3VA7A 5IIOA 3A5ZB 1N34L 5AI8A 3GD7A 3Q8QB 3PF5A 2KFZA 1ZQSA 4DO9A 2IHMA 1RODA 9ICXA 1VQFA 1KLGD 1V9PA 4DR2Q 2E2JH 2R93H 5IT9E 3VCBA 4POGA 4KHPL 4Y2XA 3JAMi 3DV9A 2YU9H 2LXKA 2K5QA 3HOXH 4F4WA 1U49A 4JI4L 3CP8A 1C4QA 5EBCA 7ICJA 3KK7A 4X3KA 1DK3A 1F2LA 9ICPA 5AKJA 3RBDA 1TR5A 2K28A 4JI1L 3WWVA 1R9TH 1L0XB 1LTAD 5J2HA 2EAPA 3MXNB 4A3CG 4A93G 2OWOA 1F77A 3GTOB 2N88A 3P75A 1ZQBA 1S77D 2V1CC 1WWUA 2VANA 1X56A 3H3VI 3FHWA 5AK3A 5D3IB 2VXWA 3CU7A 2FHTA 5A2QE 3BDLA 1ZETA 3EBEA 4UP7A 2EZYA 2KICA 4GXJA 1FIQA 2WB1F 3Q8KA 2C22A 1U4LA 1VMCA 5AM4A 2LS01 1N36Q 3K80C 4MFAA 4P74A 5CHGA 4KLTA 1FNWA 5KG2A 4KN7C 2WTFA 4QZBA 2KKVA 2C2EA 2PW7A 1WTRA 1J97A 2XGTA 4RG1A 4YG2A 1SYDA 1SFOB 2DGYA 3NTIA 1X9WA 3O13A 1K8OA 4C3HG 1UQVA 1ZQTA 1NMFA 4LJZC 4US9A 5L9XA 2BQ3A 2KK0A 3AQEA 4QWDA 1SNMA 1VQJA 5KT5A 3DWPA 3J80E 2O5IC 4IUUA 2M9NA 3A8IE 3F53A 5DLGA 3GDXA 9ICCA 3G6JB 4QW8A 1TAUA 2KIWA 3ND9A 2KTQA 3H15A 1D5MC 1K3RA 2D8CA 4EEKA 3S1NB 3QOLA 1XNRQ 4APVA 3OWFA 4JI5L 1UE5A 1STHA 2Z9HA 5GQOA 4FF3A 3EIVA 2F0OA 1ONLA 3UDIA 1VQNA 4CGYB 2JZBB 1NJYA 1VQBA 1KEJA 1O03A 1NJIC 5AK6A 3ZJYC 2E2HB 4ECUA 4NV0A 9ICAA 1GVPA 1GM5A 2FE9A 3C2LA 2D6FC 2JYOA 1OXTA 2EYJA 4A3DB 4QIWE 4TQRA 5ELCA 3SENA 4ECVA 2F3WA 4HN7A 5CGKA 1J5EL 1A62A 5KT4A 1B8AA 1AN8A 4HJ8A 1PYBA 1B0XA 2E8OA 1JOKA 4CRXA 2JEBI 4I2BA 2WB1B 1ZQCA 4ZCKA 3CYMA 7ICTA 4QIWC 4P2HA 8ICFA 4LUOA 4UB3A 1O7ZA 3HZXA 1STYA 5IGCA 5KG4A 4DOCA 1ZQKA 9ICNA 2ZJQA 4MFFA 2XIDA 3RJIA 5G3LD 3KZIU 1S0VA 3TRZA 3KHRA 1EWIA 5IILA 4FNFA 1RXVA 5AICA 2W3RA 5DB6A 4FS1A 2W9CA 4O5EA 3D31A 3K8AA 3MGHA 4A3MH 3RD4A 3RZOB 2Q2UA 4POFA 1KRSA 4RWSC 3L9AX 4GLVB 3H0GH 7ICVA 7ICRA 4TVAB 2RHQB 3CPWA 3NVYA 4RQ3A 1DONA 2KNJA 4AYBF 4DAPA 2R93G 4C7YA 4J9QA 4C8MA 5KTQA 3O0FA 4P0PB 1ZKOA 4RGTA 3GTOH 1PRTF 2K89A 1Z47A 3MEFA 3QXGA 3BVMA 3DMUA 1JT8A 2IW3A 3THVA 3OJUA 4HEDA 1STBA 4IUQA 4F8MA 4UB2A 5KFCA 2X6GA 2UVWA 4DA2A 4BBSH 2GO7A 4KLFA 3QZ7A 2BCOA 4J15A 4ZKBB 7ICQA 1VQDA 4IPGA 3ETRA 5M9OA 1OTCA 1X9SA 3K81C 2WB1C 5C44B 5DBAA 3LX0A 3HOWB 4JPBW 3CCQA 2IHEA 5LMNQ 1L0YB 3IFTA 4GLAC 4AIMA 1CKNB 1RYUA 8ICQA 5M3MG 2HT1A 2H5XA 3F2DA 2F8KA 3T5JA 1PH3A 3PO3H 4Y2RA 1JN3A 4C4RA 1K5OA 3B6YA 2PFOA 5COYA 2LYAA 3OW2A 4GNXA 4YIJA 4J9MA 1CTMA 5ALFA 5DDMA 5EWFA 2FXQA 2LSSA 1TWAB 1CKOA 1QSSA 1PLFA 3VR3A 2QF7A 1QILA 5C0YA 4JOIC 2HHWA 1EQQA 3S17B 5D49A 4CBVA 2C2RA 4PHDA 1TWGB 3BQTA 4YHHQ 2RCFA 1SYFA 2Q0ZX 3X3NA 5CBEE 1Y8OB 2BA0A 2K75A 4YHHL 2GA4B 2K4PA 4EQNA 3NEMA 1D1IA 3Q8RB 1PFNA 5CMDA 1ZQQA 4LF4Q 3GTJH 3I2ZA 4KLDA 1M6YA 1MSWD 1BDOA 2BE5C 3T4AC 3GILA 2CFMA 3MDAA 1XPOA 5HURA 4DK3C 1V85A 2WFAA 8ICEA 4PZ6A 4CHTB 3GTPB 1G6ZA 3CCVA 4JI4Q 1IL2A 3KLRA 4DGZA 2ZTCA 1RKNA 1Y8PB 3RH4A 1V43A 3D4DA 2WV6D 4IZ8A 4IQWA 3MA2B 2CW0C 2J7ZA 9ICBA 3HJEA 2G5HB 1N5XA 4GOPC 2OM6A 3G7LA 3W1BA 4KKUA 4NXNQ 4DR3L 1N34Q 1KFTA 1MQ2A 3MVVA 4A3BH 1HTLD 2HOFA 2I9GA 1A76A 4GXIA 1EIGA 4KTQA 4R8NA 5FLMH 4KLOA 3JPSA 2DKZA 2G9HD 5KFFA 4KLEA 4X3TA 4E6IA 2KE7A 4YQWA 1J9OA 1CT1D 1GOZA 1QZHA 1PDQA 3KF8A 3SEIA 5DBBA 2JR5A 5KFRA 2DY7A 3WK8A 5T14A 3T5HA 2LMCB 4X64L 1WTWA 1Y69U 1C0AA 2A5HA 4JVZA 2OQKA 1JX4A 2DBYA 5KFTA 8ICTA 2DNEA 1MHWC 4OEMB 2DL0A 9ICJA 2UVUA 1NOMA 1KLUD 2WAQG 5HGTA 1UWVA 1CFMA 1X32A 2ENBA 4MTNA 4YVZA 1GXDC 4I2AA 2HQEA 3I72A 3WOEA 4I28A 2AHOB 5LMNL 2JA6H 2RRDA 2Z4IA 3ONAB 3VYUA 2NRXA 3CC7A 4U68A 3TS2A 1LACA 2K04A 3A74A 4IC9A 2PO4A 3TS0A 1LT4D 4C3JG 3JAMc 5IYDH 4I2CA 3U58A 4LFAL 1ILPA 5KFWA 2K50A 4UDUC 4A3MB 3RZOH 1RPLA 5BN3A 1L5UA 2KA7A 3T56B 3KJOA 5C44H 1ET9A 2RBMA 4KK7A 2CWAA 1MA7A 2EANA 5KFUA 1KTQA 3G6VA 5DM73 2W8LA 3S14B 5JPMC 4UPAA 3TANA 4LF8Q 1UA0A 1ZQRA 4U7CA 2A6EC 3BU2A 3NQTA 5J2JA 3H94A 4K2KA 1N60A 4LNQA 4UQGA 2Y9UA 2YV5A 4KI0A 2KECA 2YY6A 4JI5Q 4ELVA 5J0RA 4NXZA 4DSIA 3QNMA 2UUCQ 4OHJA 2R7ZB 2LFNA 3UDFA 1JE5A 1EY9A 3NBHB 1O08A 1RTOA 1L3UA 1VCIA 5C4XH 3ZD8A 1SWVA 2MSNA 1TY2A 1LTBD 2RSOA 4DK1A 5K5PA 2E2IB 1X9NA 5CYUA 4O3OA 1IBKL 4IOAA 3DM3A 4DV2L 3S2HB 2FMCA 1L7MA 3MFYA 1TV9A 5EE0A 2A69D 4OIJA 3MC1A 1IL8A 3DWAA 3NVVA 2PZTA 2RHSB 2B2WC 2B8FA 1UEBA 4BY1B 4C3JB 2ASDA 4ELUA 4JI0L 3RLNA 2UUAQ 5EGTA 1T3NA 1IBML 2FLPA 3S24A 1UUPA 1E22A 1JB3A 1AZPA 4KLUA 4AYBE 2D5DA 3HKZG 4TURA 2KVSA 2ODGA 5AM1A 1SV4A 2WFWA 2R8KA 1ENFA 1YNXA 4K0KL 5AM0A 1NMGA 1NK0A 1ZYRD 4IRCA 4B9XA 1A15A 3KF6A 2UU9L 3C1YA 3FAHA 2NVYB 4UP9A 1HUNA 3TP7A 4A3EG 4L6TB 2KHIA 4RQ1A 3DEEA 4FO6A 3SXHA 2F1JA 5HNKA 4CF3A 3UPQA 5DBCA 1RYSA 1SAPA 1A77A 2EYLA 3P20A 4OIKA 1SRUA 2K32A 9ICQA 5EPJA 3FKIB 3J81j 5KFZA 1ZQHA 3SV4A 2W9CB 3OHBA 3MDCA 1RD9D 3CRLC 3PW7A 1SXEA 2F0MA 1WTQA 2R8HA 2KJ5A 4PG3A 3HOXG 3PGZA 4V0BA 3HOZB 1A3UA 3MXGA 3WKEA 1JMCA 1MIUA 3CCLA 4CDCC 3F2BA 3DEOA 1DD2A 3PV8A 1KFDA 2W11A 3BQ7A 3FDSA 2EZVA 1NZPA 3CMEA 3GIJA 4F91B 4RQ0A 3CQZH 1DZ1A 1JICA 4JB3A 3MZ5A 2IX3A 4DV6Q 4C3IG 5ALMA 2YMLA 3G4SA 2WAQF 4CE6A 1A6SA 3NQIA 2FMPA 3EW9A 1CSQA 4RCNA 3SGIA 2ZIVB 3SK5A 4KTAA 4C3HB 4NL9C 2WAQE 1SJHD 2PMZF 3QEBZ 4MNOA 3MEHA 3CF5A 1NCVA 3CHBD 2I1QA 2IOHA 3PNCA 4LVSA 2AJQA 1LTGD 4CGZA 1DXMA 3E3XA 4ZAIA 2JA6G 3CNHA 3PMLA 1H38A 2ICIA 3K5OA 3M4OB 5ALXA 4C8KA 4MN3A 2LHTA 4B9LA 3OIPA 2NN6I 1B7YB 4JC0A 3TMEA 1XNSA 1N33L 1EYDA 1JIHA 2K01A 2JA7H 4YY3L 4XQQA 4DV5Q 4GKKQ 4NP5A 2NYZD 1H9SA 4KMUC 3J7YW 3E0JA 4HMIA 4Z6CA 1CSPA 4QQBX 1ZQNA 2XGPA 1PH6A 5T1IA 1HR0W 3NPPA 3DLLA 1ILQA 1KQQA 1HXYD 3H0LB 2PI2A 3BQ0A 3SYZA 5LL6S 1F2ZA 4F71A 3UDXA 1SMXA 2KJ8A 4EYHB 3MC0B 4CF4A 4P0PA 1KDAA 3V6HA 5JJZA 4B3RQ 3VYRA 2ZJPA 1T7PA 2NVYH 3WK9A 5T1GA 1WTOA 4KD4A 1Q90A 5CV6A 1L3SA 3RJKA 2P5ZX 2ZUCA 5AKXA 3V96A 4YR3A 2BCVA 3GQBA 4OJPA 5E79U 3CPFA 4AQYL 1ZXIA 4RT2A 2E5LL 5HHHA 4K8IA 2KV2A 4I27A 3EJIA 1IYJB 2F0JA 2KZZA 4F4KA 1K3BC 1C8CA 2IA6A 4H44C 4YCXA 2D9UA 3RMHA 3RRGA 1S0MA 4BY1H 4P75A 3LYSA 3J80i 1UE1A 1GUTA 1M8AA 2WACA 2ZIWB 4DV4L 1RG6A 1GO3F 1ZQVA 3CRKC 5ELNA 1YBYA 1L8LA 1PVQA 3HRZC 5I4DA 2EZXA 1B22A 4ZUJA 1K8GA 4DR6L 1WTVA 4P4OA 4AYBG 2MQHA 3I4MH 4LUVA 1YZ7A 5DQIA 1GHKA 2Z4HA 2C28A 2K14A 2UUBL 2F0TA 4DV7L 1O7LA 2F0HA 3PX0A 4XQ8A 1RDPD 2WB1E 1ZD4A 4DV3L 4JK1A 1XNQL 2E1FA 3L2PA 2AUKA 5IIMA 2EXDA 5J2EA 4F5NA 4CJ2C 4FXDA 3TADA 4XUSA 4BBRH 4UASA 2NV3A 4FBUA 1SV0A 3JPRA 4Y2TA 2LKVA 1QG7A 3KLSX 1PH9A 3D4RA 4NLGA 2Q8TA 1L7NA 1BUVT 4LK1C 1L1OB 4F3OA 2ASBA 3BZDB 4DF4A 3G48A 4GN3B 3FYHA 3OPXA 4YD1A 1BQQT 4CKEA 2JH1A 5IP7G 2H3ZA 2AMCB 2YTXA 2XRQD 3NHHA 2MU2A 2VNUD 9ICEA 1NJXA 2FPLA 4QZ9A 1HNXQ 3RLOA 5J39A 2FMMA 2W7PA 2PPBC 4RQNA 4QJFB 1PFBA 2XI9A 1BPYA 1KABA 4M04A 2KZ3A 2X69A 4A3BB 1Y1WG 1BBXC 2W9MA 4I2GA 2K5WA 3S1QB 4I7ZC 3H0RB 2MGSA 3Q8PB 1MD2D 3PUWA 4WJ4A 4KX5A 4JMUA 4PL2A 4UB8U 2XIWA 2HIXA 1DOLA 2KHSA 2ZJAA 4EYIB 1QVCA 5GADC 4B3TQ 3QZ8A 2BQUA 3ZI4A 3CQZB 1B9MA 4RCOA 5EPLA 1PVOA 1ASYA 2NZHA 2JSOA 3A54A 1HH2P 4B3TL 1SB3C 2ZIVA 1KRPA 1J6QA 4JBKA 1K83B 3EPGA 2JEJA 5J22A 1WCMB 2ZJRA 3I4NH 4ED7A 5KAIU 3SVMA 2DNCA 2ZM6L 4ALPA 3IN5A 3V6JA 4QW9A 4R4OA 1J8IA 4GOPA 1L6NA 1KNEA 2E5SA 1K8MA 4DOBA 2MUTA 3WDNA 4DWIA 2E75C 4RKBA 1JB7A 4QZIA 3PO4A 1G6PA 1XXGA 1Y8NB 3OSPA 5EQ0A 2G07A 5FLXL 2KD1A 4UAIA 1HZAA 4M8AA 5AKEA 4A8EA 2K5HA 4A3IH 1DGSA 3FMCA 1HA6A 2F8LA 2DY8A 4A3CH 2HBMA 5L37A 4HIDA 3QE9Y 5C5LA 2G08A 5JJIA 2A1JA 4ED8A 3HP6A 2AKWB 8ICKA 5CV5A 2UVVA 2X6LA 4FE3A 2NWGA 4Q43A 4KD3A 1Y14B 2HCIA 2F44A 5BOMA 2G9DA 1HNZL 3DDHA 1CI4A 3S1RH 1TWFH 3PIOA 1SBBB 1RTNA 1PRTC 2ZM6Q 4J1MA 2JA5B 3OMCA 4KN7A 2PI4A 1NAPA 1CQVA 3PO5A 3KFUA 5DM63 3AUOA 3NUCA 4Y2YA 4ED0A 2K5NA 1ZQEA 3JPPA 2LM4A 5BN5A 4BJQA 1RYRA 3QU9A 3Q22A 4R9WA 1LT6D 2KP7A 2ZXPA 1KDBA 4X62L 2LKYA 1TY0A 1EY8A 4GKJL 2AQ0A 4JBMA 4QL5A 3K5MA 3UE0A 5JEAG 5M5XB 2HHVA 3I4NB 3ISCA 3L5KA 4KLHA 2EYPA 2OT2A 4JI8Q 2LYBA 1MJCA 1KD1C 4ZH4A 1K83H 1NUCA 4QZ8A 3H4DA 2EY2A 2EY5A 1YJNA 2PYKA 2G5DA 2PZUA 3KF6B 4K2LA 3R93A 3U9OA 3OHAA 4NL9A 4Q5VA 5EE3A 3EFXD 1T4GA 3J80L 1SL1A 3M4PA 1JWSD 3URYA 1HNXL 4Q45A 2J6SA 4M0AA 5CBAE 1X3PA 4RQ2A 2EDGA 4H7BA 2HUGA 1BCPD 2R92G 2NVXH 3HKZF 2HD3A 5M3FB 1TAMA 4Z9CB 4O0AA 2DQNB 5I9OA 5A35A 4UB5A 1F44A 2BH2A 4RQ4A 3FP9A 2VQEQ 4DK0A 3QEAZ 4BUGA 4GXKA 8ICVA 4PZ8A 3S16B 3S16H 2EH9A 2XC9A 3HPOA 5BN4A 1XSPA 2DUYA 3A0BU 1WWVA 5KFPA 9ICKA 4DV3Q 4A3KB 4O5CA 2CWPA 3M7NA 4DFKA 1ENCA 2EOTA 2XNAC 2MO0A 2F3NA 2B6GA 2VB3X 3CMAA 2VQFL 1AROP 5M5YH 4A3DH 2LM1A 1HHVA 4EX7A 3CD6A 2WF5A 8ICRA 3L3FX 8ICJA 1ICWA 1S8OA 9ICFA 1SMYC 2NVXB 1IV8A 3RAQA 3RJFA 1A2TA 4K5XA 4DV5L 2OCEA 4GKKL 2W8KA 1HEKA 2B2VC 5G3LF 3TZDA 1N33Q 1QNUA 1TU2B 2ZXRA 3TQ1A 1TWCH 5KFBA 3G71A 4M9HA 3SR1A 4IUTA 4HYKA 3UE1A 1SN8A 1X9XA 2CQOA 4HSPA 1TK5A 4J9KA 3K59A 1YITA 1YVCA 1DOMA 5C6AA 2ALYB 1I3QB 1TIID 3D3RA 3L3OC 3P7JA 5D65A 1F2MA 4MF8A 1Q46A 3M8SA 1JOOA 1U4MA 2V4RA 1PH7A 5L1JA 1EIFA 3KKAC 1L7OA 1SFOH 3BG3A 1XMOL 4P4MA 1ENAA 5IYBG 4RH6A 4J9SA 4RAUC 4CKBA 4YR2A 5GAHC 2G5IB 4NY8A 2E2HH 1CUKA 4DV0Q 2AWNA 3MFIA 3MWYW 4TQUS 5C0XI 4LFBL 4IQUA 1PTOB 3QOJA 4GOPB 4X5VA 5EE9A 2P6RA 3A5UA 2OTLA 4KKSA 2AQ3B 3D6WA 3I70A 3U9SA 3V6KA 1MQ3A 1WYDA 4EQ5A 2IX1A 5KL8B 2I07B 3QG1A 1GUGA 4ICAA 2KQ3A 3KBXA 1E1TA 3VDYA 8ICCA 2NVTH 1XWLA 3TFSA 4JI3L 3N7PD 1EZ8A 4DQSA 4DEZA 1O7YA 3Q6SA 3M9OB 5F9LA 1KXLA 2Y9TA 1VQCA 1XWEA 3C2KA 9ICTA 2PZWA 3D4WA 2OXPA 1PK1A 3TAQA 1OXJA 4IFDJ 3HFZB 1LUZA 1H9RA 2KFNA 4BBSG 1X66A 3NUQA 1YZ6A 4DNIA 2MFIA 2HIVA 2ISOA 5IY0A 1T5XD 4RFBA 3PY8A 2HCFA 2Y0SC 5M5YB 1SE3A 4UAYA 4N8FA 1I4PA 2D0PA 4ZLTF 1N32L 1T3QA 1TQOA 4K4IA 1TVAA 1WTHA 1ZXTA 4HIMA 2ZTEA 3SQIA 8ICAA 4TSSA 4PMCA 1WCMG 1SR3A 3NWSA 4NPSA 1HJPA 1PFSA 2RVLA 2A8VA 2VUMH 2L5TA 3H6MA 4RUCA 3LWEA 1II3A 5E4XA 3GTMH 5C5MA 4FF1A 3MAQA 5J2BA 2KUMA 3E9HA 3AQFA 5AKZA 4O3PA 1FGUA 4YXMA 3FM9A 1NR4A 1CKMA 1RL2A 1X3EA 2P35A 2IX0A 8ICYA 3HOUG 3DWQA 1XPRA 4KY6A 4P4PA 2R92B 1D7QA 4F5OA 2PQEA 3CCSA 2KKPA 2F0LA 2BOSA 1JALA 4RHRA 4EVOA 5NUCA 4G7OC 5AM3A 2FFKB 3K0XA 1FR3A 5KRUA 4QJFA 2EJMA 5M3FH 1IKMA 1EUJA 2L0CA 1IBLL 4HSVA 4JWNA 1WOCA 1PZJD 4QZEA 3PR5B 1F9QA 2YTYA 1KBUA 3C1ZA 3PSPA 5KFVA 2JZBA 1RQNA 4AP9A 4JYAL 5EBDA 4R4IA 5GTIU 3A0HU 1RHPA 2UUAL 4DSEA 4XT3B 1JRPA 2UVRA 1PTOF 4YMNA 4XYOA 1D8LA 4KY5A 3V7LA 3GIKA 2KOBA 2GN5A 2YX8A 3GFKB 3HEJA 1J2MA 5JU5A 3Q24A 3V05A 4R64A 4C8OA 7ICUA 1A3TA 2VL6A 5IWAL 1Z4NA 4DV2Q 4QZGA 4DQPA 3D6CA 3GV8B 2MNAA 7ICKA 2EQYA 2IHNA 5LMNW 3I4MB 3K0YA 5K36G 1QCKA 3NBIA 2LI6A 3RB3A 2QEJC 5ALQA 1URJA 4IN3A 3AQQA 4XT1B 3VR5A 4QB4A 4KLSA 2WAQC 3R2TA 2PMZE 2N3SA 3H0MB 8ICNA 4BWGB 5C44G 2BDNA 3ZDBA 2R61A 1TS3A 4RZRA 1SNDA 5J0UA 5KFDA 2UUCL 1SZPA 5AK5A 2PMZC 3I4LA 1ZQAA 2ES2A 4I2FA 8ICIA 2A6ED 4GIBA 4JV2A 1ZQZA 1I6HH 1XU4A 2L55A 3GTPH 4LJXA 3QU5A 5CV4A 4NXNL 4IPHA 3FPPA 9ICMA 5AIAA 4ECRA 1IXRA 1SNPA 2UXDL 1I50B 2IWHA 4KLIA 3U50C 5EKKA 4B9NA 4DKAC 5E3FA 3OGUA 3J7A5 1Z19A 2CN1A 2KVCA 3K1RB 1YEZA 3BDPA 1TE2A 3GDEA 4P72A 5DLQE 2QB1A 3RLFA 1BPEA 4A3JG 4KITB 1S97A 9ICUA 3PUVA 3AU2A 1B4FA 2HHHQ 3RR5A 7ICOA 3E0FA 2GLEA 3OIQA 2HBJA 5CB1A 1TKWB 1PYWD 2YMQA 1LVHA 4CJ1B 4LF4L 4R4TA 2EQSA 4JK1C 4DSJA 4TRDA 1I94Q 3A0JA 2FDRA 2NVQH 5FJ8H 5G5GA 2F0VA 1KN5A 1E7ZA 1OXVA 1MKHA 5DKWA 4M9JA 4G7ZC 4DNTB 2AQ1B 4JWMA 4S3SA 2MAXA 3PO3B 4QF4A 4YN4A 2JA7B 1Q12A 4K14A 4GNXB 1Y1VG 3H3VH 2QDBA 2A1AA 2E2DC 3ERSX 4RNMA 2R7FA 1ZYRC 3K7AH 4RHSA 4PNYA 1N62A 3I1YA 1T5EA 1NR2A 1QE6A 4FS2A 3IV6A 1V1PA 5J0QA 7ICEA 3CCMA 1CA5A 5J0TA 5EE1A 3PW2A 5FK9C 4DS5A 3D2SA 1EYCA 3FC4A 5KT7A 1NKBA 5EPKA 4YWMA 1F9RA 4A3FG 1C7YA 5HMMA 2JA8H 1L3TA 2W43A 1VQ5A 1Z00A 1RJTA 1SXTA 4DSKA 5JUMA 3EVQA 1HNWQ 3VA5A 4IR9A 1E2ZA 2Z8LA 4ECYA 2F4IA 1PTOC 1BBUA 2HOQA 8ICOA 4C2MH 4WJWA 4DR4L 2D3DA 3TKAA 2B21A 2PFPA 4JV5L 5KIXA 2AU0A 1AQ6A 3KUPA 2C9OA 2JH7A 3HGBA 3KDFA 1Q1BA 3A7LA 4ZRZA 2HBLA 3E2EA 4IJLA 2K4HA 1ZD2P 4J9RA 5HR6A 2Z6BA 4UHVA 4CDEC 2JEAI 3W1GA 3RJGA 5IT9c 2K1BA 3WKBA 5C3WA 1IYVA 2MP1A 3NVWA 3IHQB 4KMUA 4XDXA 2K60A 3PO3G 3RB6A 5L1MA 2GH1A 3SK6A 2B2YA 4DXFA 1I4HA 3GZFA 2BCQA 4OL7A 4Y2UA 2DFLA 3KOJA 2K4IA 1SNOA 3NTHA 1Q86C 2TMPA 1IW7C 5IYCH 2L5YA 1XTDA 1TFRA 4PZNA 2BDPA 1FEZA 1ZQYA 4UBCA 4IOCA 3HOZG 1AEXA 4YMOA 5E4WC 5M5WB 2ALZA 4ZOHC 3RTVA 5DG9A 5I9PA 4KN4A 1G2TA 2CHBD 5KL1B 9ICOA 1BBWA 1HTPA 2EIFA 4XIGS 2UXDQ 2FI1A 4F5RA 2A69C 1NI3A 1TKDA 3T3FA 2JEGA 5CR0A 3HOUB 4GN4B 1Q81C 1E2WA 1XC9A 1SMYD 4IUPA 1HR0L 3GTKB 1VQ6A 2ZXHA 1K9MC 2G09A 2J6TA 1TS5A 2EJFC 1RF2D 2RP5A 1DGJA 3KHLA 4QZCA 3PX4A 1PH4A 2R7ZH 4QCLA 3ULPA 4J9NA 2HDMA 4QZAA 2B2VA 4O3MA 4B08A 4WJ3B 3I3CA 2ZIUA 2YTUA 3AN1A 5DB9A 3RZDB 1M4VA 1H95A 4DFDA 4DU9A 4FYDA 3PX6A 1SL2A 1CEZA 1VQAA 2M9VA 3QWNA 4R4CA 3NS1A 1FFUA 1JORA 1K0SA 3S1QH 4BY1G 4LZDA 3IFDA 4UY8C 5LMUL 1YIJA 2I46A 1GUNA 1VQ9A 2UXBQ 5IOCA 4PGYA 2N49A 2WF8A 4ZKCB 4F5QA 2HHQA 2RDGA 4R8IA 4ME3A 2YQEA 1VF7A 1D8BA 1XX8A 2YB1A 2PCFB 1QQ5A 2DGZA 1PFMA 5HY6A 3GTLB 1ZQDA 4DR7Q 5KG3A 2K8AA 3HKZC 2BGWA 3H8MA 2RLTA 4QIWB 3MR6A 2BPCA 3A56A 3ZDAA 4YD2A 4RU9A 4MFCA 1F9PA 3LWUA 4DAVA 4H0LC 3KJPA 5FLXE 3RH6A 1IBLQ 3C46A 3HOXB 1O7IA 3W3AA 4HCEA 2MO1A 5IP7H 4LF6L 4G57A 2NB0A 2CH4W 3RN2A 2L12A 3BJYA 4B3ML 2AQ4A 2E1EA 3MXNA 4OGQC 5IYDG 2VW9A 4DL6A 5J2IA 1JJCB 1O80A 2Z6KA 3VYSA 1XNRL 1FO4A 3SHLA 3SK8A 5DGAA 1DOQA 3S15H 2AXTU 2NVQB 4ECXA 4IPCA 1WVLA 3IG5A 1JMSA 3IL8A 5AI4A 1VJ5A 4RMFA 1PUZA 1EFWA 1HNWL 1C20A 4ECSA 1VQMA 5A0LA 1SNQA 5JAVA 4N8X1 1GUOA 2D62A 3PV0A 3W5OA 4JI3Q 5J2KA 4B9MA 3CAMA 1TT2A 3ND8A 2O2LD 2RDJA 4QGUA 5ALJA 4B9UA 3AMUA 2YMMA 4UARA 2K4KA 5DB8A 5E7NA 3HKZE 3UM9A 3FPUB 1COKA 1TWAH 4M1UB 3HWTA 1S4ZA 3R9KA 5CJ7A 2P66A 5KFNA 3H8JA 3HRDD 3C28A 3VC8A 3Q8DA 3TEHB 1XO1A 4DUYL 3HOVB 4OO1H 5JVH3 4DL7A 2A6HD 3BQ2A 1STNA 3M3YH 4IFDI 2F4VQ 1ED1A 2EYOA 3K1ZA 1HUOA 1KL9A 3PUXA 3IAYA 2DF4B 1F9SA 2MA1A 3IKJA 4B3SL 5IP9H 3EROA 1PTOH 3E6ZX 7ICPA 1K73C 1HUMA 5CV7A 2VZAA 4FZNA 3DEPA 5GTHU 1FJGQ 2L1BA 4DQRA 1JC7A 5C4JH 3S2DH 1DYQA 4UB6U 1B3QA 3C29A 1B1ZA 1FNUA 2R7DA 4FVMA 3I90A 5ELFA 4C1NK 4O3QA 4ECTA 4A3IG 1KNAA 5KGUA 3OTOL 1Y1WB 3GTQH 1EQTA 1YNJC 5KFGA 1D9DA 1S9FA 3SK4A 1LT3D 1Y1VB 4I2JA 1H9SB 3T53B 1K8AC 5CV9A 2W04A 1BR9A 3PMNA 1A8VA 2M2LA 2IT1A 3SE0A 3ULJA 1RM6C 5GAGC 1OO9B 4RKLA 4C3JH 3ULLA 3I7FA 5M3MB 3UMCA 1Q3UA 1X40A 1A0IA 3EA6A 4B9WA 3TACB 1O78A 4DR1L 4DR2L 3QU2A 3S9WA 1MJEA 2WF9A 4FXGC 4JI7Q 5ALZA 1LB2B 1ICFB 2BE5D 5KFSA 1K1QA 1HPCA 3HP3A 1KRTA 1MBYA 3SMVA 5F3XB 3MBYA 2F3VA 2ATWA 1VDVA 2SNMA 4MEYA 3CCJA 5I6YA 2W54A 4F72A 1HFGA 2A74C 4HR7B 5IGBA 4OO1G 1MC8A 1BGXT 5JEAH 4O3RA 5EWGA 4L63B 4FZLA 4TUSA 5IWAQ 3PIO3 4DL5A 4OJ6A 3E58A 3C23A 3R2IA 4RGOS 1EY4A 4DNRB 4QWBA 2XY7A 4L5RC 2WHEA 4QUCA 5FO7B 1VQIA 3I55A 4DSLA 2DUDA 1BPDA 5KNBA 2Z1CA 3X3MA 1NKCA 1Q82C 3JPTA 5L1IA 2F0NA 1T94A 4QWAA 4KLKA 1JXLA 3JPNA 1BCPF 5J1ZA 4YXJA 3NSWA 4NM2A 4XQNA 4Y7NH 3S6JA 3PUYA 1M90C 1TWFB 1ZQUA 1EU3A 1W6KA 2IJ0A 3UXOA 9ICVA 1ZJMA 1P8LA 1V1PB 4L5SA 2FPKA 3HOVG 2WF6A 2JA6B 1T8EA 2W55A 2K52A 3BDCA 3GTKH 4F92B 2BH8A 1XSNA 2Q2IA 4DCCA 2A73B 1GO3E 2IBKA 4IO9A 3LK9A 3QYPA 4DF8A 4F93B 1X42A 1AZQA 1HNZQ 1NJWA 1VQPA 4ELTA 1BF4A 4LFCQ 1YNND 1X3FA 3KDFB 1NNLA 4A75A 4HAIA 3M9BA 3N97B 3KHGA 1I5FA 2RHFA 4RQ6A 5AFWA 3NWTA 1ZQLA 2O5JC 1EOTA 2MUTB 1D6EC 5HGQA 2O4XA 3SD7A 3IG8A 8ICGA 3OSOA 4DN4M 3MR3A 5KFYA 2OH2A 5KFKA 4YP3A 3QUQA 1LV5A 2C35B 4NLCA 4GKJQ 4BA1I 4UBBA 4IJHA 1I4GA 5CA7A 5DB7A 1EIYB 2GVAA 2LPEA 2NN6H 1KAAA 4MEXA 4A3BG 5ALDA 2ZIUB 2FMSA 1N32Q 1JJGA 3S17H 1ZQPA 2B0CA 3OWEB 4MHEA 1WUDA 5B66U 3RB4A 1UNSA 4CCHA 8ICHA 1SYEA 1SKWA 1YNJD 1V97A 3N6RA 5AHXA 1EU4A 4KLQA 1QQ6A 3WK4A 5ALSA 1PZID 2YU9B 1D8YA 2K5VA 3PO2G 4PMBA 8ICZA 4EENA 2HBKA 1S5FD 2F1IA 2EAMA 4CF5A 3GTJB 4PGXA 3PSIA 4RQ8A 2BPGA 4KHZA 4XXEA 3GU3A 1QUQB 4BBRG 4F87A 1Z4OA 4YFKA 5TZVA 3RJHA 2R92H 4KLJA 2ZIWA 3HS0C 3PUZA 5BPCA 4X66L 5BR8Q 3QUCA 3HKZB 2Y0SE 1TS2A 3L7ZC 5FO8B 1JXEA 4NWIA 4A3FH 1LYLA 3IDWA 1I4RA 2K6AA 2JA8G 4OX9L 3KF8B 2QEXA 3HOWH 1NE3A 2H1EA 5KG7A 1IG6A 2WP8J 3DM1A 4GNXC 1IM4A 3TP5A 5BOLA 2K5DA 5ALRA 2KOLA 4IR1A 3FKIG 4A3KG 3E0EA 2R8IA 5AJ3Q 3SAHA 1Q7YC 2KN7A 3OYYA 4OELB 2VUMB 1YHBA 3QJYA 1G91A 1EOVA 2IOFK 2F0SA 3MFHA 3M8RA 5IIKA 1EY5A 3AMZA 4DAMA 3ICXA 2JEIA 1BCPC 1Z9FA 4QMGA 5K4LA 4A76A 3W2DA 4LWCA 4O42A 1FGBD 1L1OA 4R8UB 5L1LA 1SKSA 1Y1WH 2WKCA 2RDIA 4QZHA 1R4QB 3WU2U 1U4RA 3GV7B 4DV7Q 1T9HA 1KDCA 3I56A 3AU7A 3H09A 2LMRA 2B63G 4Z6FA 1N5WA 1PV4A 5J2GA 4EELA 2WKDA 4YCVA 1VQ8A 4A3JB 4HTHA 3S1NH 3D8GA 4CKCA 4UAUA 2JHDA 1KLNA 4G9BA 2VQFQ 3SAGA 4PPXA 1NNXA 2EE1A 2WAQB 2XICA 2QARA 1BNOA 9ICWA 4J6HA 1VQLA 3KLWA 1K1SA 2JXMB 2FPMA 3A7AB 3HOYH 4BY7H 2KMDA 1UEAB 1COOA 1X6OA 2JXJA 2NRZA 3U4ZA 4C56C 2G0AA 4JI7L 3BS5B 2BHNA 2DN8A 3PW4A 2BR0A 2HQLA 1BPZA 1MI2A 4O1NA 1Z6HA 4DAYB 3EWAA 3J81E 3P1HA 1TWHB 3C1FA 1S72A 4FFDA 2QILA 1Z3EB 1IHZA 5IE8A 1QNKA 1EQVA 1WTXA 1EL0A 4QWCA 1MGSA 4Y2SA 2XY6A 1CI3M 2B29A 2ZTDA 2KIVA 1A6XA 2RDFA 3DUZA 3MGIA 4Y7NB 1RIPA 1HZ9A 5AKYA 5C4XG 1U9LA 1UHUA 3AFQA 3TQYA 1Q8IA 1RCVD 4K5WA 5CR3A 4AH6A 4DUZQ 1CQFA 4JBJA 2A1JB 3NK9A 4R65A 4N9TA 4NXMQ 4DL4A 1DJRD 4XRHA 5J0WA 1KW4A 1ZQJA 4B3SQ 3NRZA 2KSOB 2XVSA 4TQSA 4DFJA 2NZ1D 1UPHA 3M85A 2Z6KC 4F4YA 4G4KA 2B63H 3CCEA 1WCMH 4JI6Q 3SEBA 3RN5A 1D1KA 4A3LG 7ICLA 5J29A 1EEFD 4ULLA 5K36H 1MN8A 3I73A 1JR0D 4JUZA 1R9TB 3SZ2A 1B50A 1DK2A 2SDFA 4EX5A 1GKHA 4KY7A 2Q2TA 3Q8MA 4C80A 3C1EA 4EZ9A 4I65A 5DG8A 4ZUIA 3HILA 1ZEQX 4V190 1G51A 3PW5A 4Y2QA 4BWMA 5FO9B 3CC2A 5J0PA 2V9WA 1TS4A 5J8YA 3D0FA 3I91A 1B9NA 2GVBA 3H0GG 3VYTA 5M5WH 5DQGA 1LKYA 3C21A 4YY3Q 2JA9A 4R4QA 7ICGA 2UXCQ 4IQTA 1UAPA 3LDAA 4AYBC 3C5FA 2VA8A 2F76X 4X65Q 3C2PA 4F4XA 1EY6A 3T13A 2W9BA 4B9VA 1KAWA 4KLLA 1XNQQ 1W3SA 3TN2A 4C1NI 4LF7L 3HOWG 4TUQA 2ZJ8A 1XTCD 1SYBA 2UU9Q 1HRJA 4OD0A 3ZD9A 3PMFA 1PK1B 2B2UC 1PTOD 2ATLA 1MSHA 1R4PB 1LTID 2ICEC 2E8GA 4IUNA 4OO1J 3STBC 3T1HQ 1LTTD 5ELBA 5JOBA 1YT3A 3M7DA 3AFPA 5M3MH 3CKIB 1NK5A 5J2FA 2JQOA 1ZQWA 2RA4A 4ID6A 3QX7A 4PHAA 3UMGA 5B5EU 4H13C 3C2MA 4EBCA 3AEVA 2M00A 4A3GG 3I76A 1TXYA 1SWWA 4UATA 2QLTA 4YMMA 4F2SA 1VDZA 1Y1VH 2SEBD 1BVSA 7ICSA 3TBIB 3PR4A 2BCRA 2UXBL 3N28A 1PXUA 3LWLA 2K33A 1B4OA 2F1MA 4HIKA 1S0NA 1NK7A 1HFNA 4BGDA 4DLEA 5IGGA 5AI6A 1PH8A 3LVVA 2QKIC 5KFEA 2QGQA 1FYCA 2BA1A 3K5LA 5KAFU 1G291 1LM0A 2QCPX 1KKXA 1LT5D 1F2YA 1DM0B 5TISU 2WF7A 4K0KQ 3E9IA 4HIOA 4WJ3M 3U4VA 1WJJA 1JOQA 1V38A 1EXNA 3J80c 2N55A 3IM1A 1VQHA 3NTUA 2KJ9A 2E3TA 4I2HA 2B2YC 3BS5A 5IIJA 1IKLA 1HR0Q 5CORA 1NSNS 1ASZA 1DRGA 1Y88A 2FJ2A 3CP0A 2PMZB 3JAML 4BA2I 2WIIB 3FDTA 2JA8B 2AGQA 5EWEA 5FP0A 4DR6Q 1A2UA 5FOBB 1GD7A 1QOHA 3V72A 3K6OA 3QO2A 4DQQA 1EYGA 4BXOA 3Q0AA 4ED2A 1S5LU 1AE2A 3HG9A 1L0WA 9ICRA 4L5TA 1BNPA 1J2NA 3RF9A 1KC8C 2EYFA 5C0XG 4R63A 3VR4A 1FD7D 3PIP3 2H3QA 2VKQA 3HKSA 5ALUA 5I2YA 4PGQA 1BOSA 5AM2A 1LTSD 3CXCA 5D3DA 4ZQ3A 5KG5A 3GV5B 2ASLA 5AI9A 4M9NA 3RRHA 5C3EH 1SZHA 1WCNA 5KFXA 4C4SA 7ICMA 5HHIA 4DR1Q 1C9OA 4BS9A 3GTQB 5AKLA 2P6UA 1GJXA 2H3IA 7ICNA 2HW3A 4OJLA 2ESEA 4JW0A 3HOUH 1ZJNA 4PJ0U 1I4QA 4TUPA 4J03A 4ODGA 3EQLC 1NBWA 4XA5A 4GC7A 1QWYA 3KHHA 3T5LA 1RZTA 2F0EA 2CRXA 2NTTA 4LFAQ 2G06A 5HR7A 2R8JA 1ZQIA 2JEFA 5KFHA 3OTOQ 4LF9L 1I6VC 4A3MG 1SE2A 3BDOA 4Z6DA 2MRLA 4GLXA 1X3QA 2PQAA 3C3LA 1FJGL 3TADC 5CP2A 5A2QL 2PFQA 5CRXA 1I50H 4NLZA 2EYHA 1G2SA 1JQYD 2CCZA 3WKAA 2A3VA 2DKXA 1W6JA 3GV6A 2IHFA 4KJNA 2I5HA 3M7GA 1A0PA 4RGMA 3VR6A 3B0YA 1KQSA 4CJ0B 4RPYA 1RQLA 4B3MQ 3GQCA 1CZWA 4FBTA 2F4VL 1ZYQA 1RXWA 4DAYA 4A3EB 3PSFA 3OHXC 4DUYQ 2SOBA 4C8NA 3D2QA 1S5ED 3V2TA 3S14H 1LO5D 3N52A 5KEEA 1E0BA 2OXOA 2KG5A 2HHSA 3DXJC 1M1KC 4O5KA 1PVPA 1HUZA 4Q8FA 3MHBA 8ICSA 4UAZA 4DLGA 3OTQA 4P0QB 2QA4A 5ALTA 4EGVA 1QLNA 1U47A 1U9RA 5JJLA 5DAUA 4NB3A 2NO5A 8ICLA 3Q8SB 4Q0FA 4US8A 4DSFA 2F0PA 3F2CA 2XRSD 2A19A 3M9NB 2FMQA 4A93B 4IURA 5ALEA 2F0WA 1JE4A 2I5LX 4UW9A 2ASJA 1N56A 2RQXA 4L8JA 3A8KE 1JWUD 3ZDCA 1AP0A 2J0TD 5J0YA 2O6KA 4F4ZA 1JWMD 5LMUQ 2EY1A 5GROA 2W3SA 1FVIA 2N78A 2HVIA 4EEYA 5J3BA 4BBSB 4UB4A 3AYHB 4JBWA 3S1MH 5AKIA 4C3IB 4DXGA 4PL1A 4WRDA 3LNNA 3T51B 3PQIA 1NK8A 1LV9A 2E8PA 2LBOA 2K7VA 3SI8A 2CH4A 4FDBA 3T1YL 2W03A 1ECWA 2JE6I 3MR2A 3AB9A 3QR8A 3UMBA 2ZXOA 2F0UA 3M4QA 3BZCA 5M3FG 4DR7L 8ICMA 5KNDA 4JG2A 2DWQA 1E1OA 1ZRMA 5AK4A 1LLRD 8ICBA 1U4PA 3BJUA 1U45A 3NTKA 2KHQA 1SE8A 4HJ7A 5ALVA 4I7AA 1IBMQ 3RNUA 2PNRC 2EAOA 2I0QA 4JI0Q 1VQGA 1AFPA 4JI2L 4O9MA 4IS7A 1KSPA 1KTKA 1P7DA 3GO5A 4WFN3 5IYBH 1PH2A 3M1YA 5IGEA 2ZT9C 1L1OC 5IIIA 4F8RA 4DFMA 1X55A 3GTLH 4UAWA 4A3LH 4A3DG 2EZZA 2CXYA 1UT5A 2AUJD 4KLMA 1IBKQ 4ME5A 4JI2Q 3OOCA 3WKDA 3B0XA 4ED3A 2HDOA 2GOLA 5KFJA 3PSTA 8ICUA 1EWCA 5E1FA 1HZCA 4ECQA 2Z0SA 2H3FA 1LTLA 3RB0A 5AKGA 4M9GA 1CRXA 2Q4TA 4EZ6A 4OJOA 5J2DA 3M9MB 2F0KA 5H1SE 3T1YQ 1JUDA 1D5XC 3IRUA 3HT3A 3HX0A 1X3GA 1XMQQ 1L7PA 3ISDA 2EYMA 1J5EQ 3K57A 1U5KA 1LKYB 4ECZA 2PFNA 4ABNA 5I6WA 3J81i 1STAA 8ICPA 4I2IA 4OWXB 4NLKA 2D0OA 1SXDA 2Y0SF 4JCVE 5D46A 3C5GA 1CKNA 1QJOA 3GTGB 1EY0A 3JC66 1XMQL 3F5EA 1VQKA 4IRKA 3ERQA 2XVTA 3NASA 2R8GA 1SEBD 3H8WA 3FVQA 2PQAB 4FF2A 2RKSA 1UE7A 1V1QA 1X65A 5C0XJ 2AWOA 4KV6A 2DPJA 3RJJA 1WI5A 3EN2A 3T79A 5ISRA 3PF4A 3WK7A 4ILWA 4ACOA 4IUVA 3OW7A 3I8ZA 1S0OA 1TWGH 2I6XA 4HCSA 1S3OA 2A6HC 2F0DA 5J2CA 5JVG3 2NYVA 5J0XA 1NTGA 4G3IA 4C2MB 2F3IA 3BS7A 4HJ9A 1K28A 4QUFA 3UXPA 1A3VA 4DOAA 4FXKC 2R18A 2OTJA 2JJQA 3PZPA 1D2BA 4C4TA 4C8LA 1B53A 2OYYA 2YB4A 1N36L 1MSGA 4NM1A 3WK5A 4JV5Q 4OXPA 5C4ZA 4DR4Q 2DJGC 2LYHA 4A3GB 3HW8A 4MIUA 5D4BA 1UA1A 4QZFA 2BZFA 3KTQA 1SE4A 1F0MA 4XTCS 2J6UA 2QB0B 1BO0A 3H0GB 1B70B 3ZDEA 3ISBA 8ICWA 4BX9C 7ICFA 1SL0A 5KG6A 3IP4B 1XSLA 2HOIA 2OF1A 1NK4A 2OEOA 3TDQA 4F2RA 1L8OA 4DR3Q 5KT2A 3PIPA 2E8MA 4RT3A 3TARA 2B3GA 1EFID 3K7UC 3H8SA 2Y1IA 1PRTB 2EXZA 4X3UA 3G6EA 7ICIA 1Q8KA 1Q1EA 2HHHL 4A3KH 4LF9Q 2ZJ5A 4R66A 2K4EA 3AM9A 5KFOA 2BDUA 1QTMA 5C4HA 3J81c 4EBDA 5C5JA 1L3VA 3STBD 5ALYA 3N4MB 4KHVA 3PCOB 4UAVA 2ZUBA 1STGA 3RUZA 1CHQD 4PMWA 3UI2A 4YR0A 1UE6A 3PW0A 2KEDA 4BBRB 1CK1A 1ZQ1C 3QUBA 3WKCA 4IRDA 3NELA 1SDFA 4IQVA 3Q23A 2IL8A 3BYTB 3K7AB 5ELOA 3M4YA 5F2DA 1E3PA 1I94L 4I2DA 2RSNA 4WORA 5JPNC 2BPFA 2R93B 5J0SA 4K5VA 1S40A 4A3GH 2Q8RE 4MF2A 9ICIA 3GP7A 1TK0A 5ALLA 3JPOA 2MHVA 4JI1Q 3EPIA 3TI0A 1XS9D 4OO1I 1WYGA 1ZQMA 2B63B 4ED1A 3GTGH 3A55A 4K4HA 1IZ6A 2L9HA 4DK6C 5AM5A 3EYZA 3TZUA 1S5DD 4DF7A 3CC4A 4MTKA 3TAPA 1GUSA 2JK8A 2NN6G 3TREA 4KHPQ 4B6JA 1Q3VA 2Y0SG 4NKLA 4A3EH 3CCUA 1TAQA 2JRZA 2AGOA 2F1HA 2JN4A 4ECWA 2MUYA 2OEHA 2YTVA 3ONNA 4O0IA 1Z1BA 3M6KA 1VLBA 3TSSA 4F88A 4K4GA 1HQRD 2GWSA 2E74C 3RBEA 3BVGA 3EUB2 3K5NA 3SDZA 1EWHA 1YJWA 1XO0A 1HQMC 5FLXc 5C3EG 2NRWA 2XTIA 3PO2H 5DNFA 3H3VC 2KHVA 3NBHA 1WTPA 2XO7A 1SNCA 4J9LA 3WK6A 1I3QH 2PI5A 4USAA 3KZXA 2L15A 2ZUDA 3EZ5A 5IINA 4JOIA 4RGNA 1ESRA 3R8BA 3ICEA 1TWHH 2EPBA 1AW7A 9ICLA 2IMWP 3ITPA 2JA5G 1S5BD 2L4NA 1WFQA 4YWLA 2PKEA 4JI8L 2M0NA 3RH5A 4PH5A 3PO2B 5GAEC 3NENA 2K03A 4JYAQ 2AH5A 3MFGA 3T1HL 1QSYA 1OXUA 1QZGA 4BWJA 4NW2A 4PV1C 4UP8A 1KFSA 2C5CA 2PW5A 1HA5A 4Y2PA 3BQ1A 3FEWX 1KIXA 3F2UA 5KFLA 4I29A 4P0QA 4M2YA 1V1OA 3K4GA 4LF7Q 1YHQA 4EBEA 2R3ZA 3F5AA 2XWJB 1WD0A 2F77X 4KN4C 4LF5Q 1HIWA 9ICHA 4X65L 2VJ4A 4BXXH 5EJWA 3GIIA 4EQPA 1NY4A 1AH9A 2B39A 4DFPA 3GTMB 2UXCL 5DG7A 2VY3A 3K75D 1NK9A 3FRPB 5I2XA 2HHUA 3NGDA 1NZBA 2PNHA 3MR5A 3ZDDA 1NKEA 4TKOB 3RJEA 3M3YB 3H4BA 1BNZA 4QIWF 4YCUA 4Z6EA 2VS1A 3TP8A 3B9JA 5ALHA 2NBFA 2SNSA 1B43A 5EKLA 2VJ5A 2N8NA 1PA6A 2QDLA 1VQ7A 2YMPA 1QUQA 4LUZA 4K8JA 4IFDH 4CDGA 2Y1JA 1EQRA 1SROA 5AI0A 4DFAA 4Q8EA 3V7JA 2IY5B 2NZOA 1AE3A 4XYQA 4L5QA 3RZDH 4F5PA 2KCNA 4A93H 2HHTA 1BCPB 1BXTA 1YJ9A 1TK8A 3NRWA 4RUAA 2D2CC 2MPMA 5KT6A 2BCUA 3J7AF 2JA5H 4PZOA 4PHPA 3TFRA 3NP8A 1XMOQ 3ALRA 3D2NA 1CA6A 2RDHA 2XGQA 1ET6A 1Z00B 3BYYB 4HAEA 2NVTB 2B8GA 5FLMG 4IPDA 4NXML 1H9JA 2EDUA 2V4DA 4QZDA 4DUZL 5AIBA 5H2FU 1SV0C 2ZIXA 8ICXA 1B3AA 1YNNC 3H91A 5C4JB 4DV1L 3S2DB 5KG1A 5DLFA 5IYCG 4EX6A 1WCLA 4FZMA 2VUMG 4U6PA 2I5MX 1SSOA 5JJKA 4GFJA 1PH5A 2H3VA 3J7ZC 2R6GA 3OPOA 1VF5C 3KYHC 3S2HH 1QB5D 2K8BB 4KX3A 1QH9A 4Y2JA 3LVWA 4DL3A 1VQEA 2J4XA 4DQIA 3OJSA 1YHAA 2KENA 2IPKD 2L11A 4J9OA 4FP5D 2HHXA 5KFIA 3HOYB 2AQ2B 4LFBQ 4BY7B 2HI0A 4BXXG 1LABA 9ICSA 1WD1A 4DV0L 2F2AB 3RAXA 1B44D 1U0LA 2DJFC 2Q8IB 3R3OA 5KFQA 4QWEA 2F0FA 2XCPA 3DHQA 4O2DA 1PVRA 3K58A 5KFAA 2F0QA 3CW2C 1Q3LA 4KKTA 4K6DA 4RQMA 2VQEL 3QU4A 1EEID 5KYLA 2A68D 5D14A 1D9FA 1X2IA 2JGAA 2AGPA 2XY5A 4RQ7A 5ALWA 5J2AA 1KDHA 2RF4A 2WB1G 3PVXA 1C48A 5JEAJ 2HMXA 3QB3A 2UUBQ 4JI6L 1CHPD 1EIHA 1LTRD 5LHY1 4IL6U 5EAYA 3ETLA 4RNOA 3MGVA 2DPIA 2F03A 4E0DA 2ID0A 1QQ7A 1HZBA 2E76C 3SR6A 4K6LA 3BZKA 2VA3A 3TP6A 4B9TA 1S76D 2B2TA 3T16A 4HJ5A 2FLLA 1JI7A 2HVHA 1FNVA 1TVXA 2EVBA 2KCCA 2IOFA 5KNIA 2KEEA 3HOZH 4DV4Q 5TSSA 2CKZB 1N9WA 3I4NG