2ZTEA

Mtruva form iv
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
133
structure length
133
Chain Sequence
EFMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein, recombination
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 27
structure length 133
sequence length 133
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2zteA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zteA01
1B8AA 4QWAA 1IBKQ 5IYDG 5KFHA 3UQ2A 2UUBL 4X66L 1NMGA 2MUTA 3EPGA 1MKHA 2ATLA 2N3SA 2RHQB 8ICTA 3K4GA 5J2CA 7ICPA 3RB0A 2A19A 8ICIA 4BY1H 4LF4Q 1KRTA 9ICQA 2WB1E 4RUAA 2CCZA 1HUZA 2R8JA 4X64L 1A62A 3CAMA 4NXNL 4B3MQ 3PUWA 4X62L 4J9OA 3M3YH 9ICUA 4PZ8A 4RQ7A 1OXSC 4ECRA 3W1BA 3K81C 1IL2A 2AGPA 4ED6A 4OWTB 4AQYL 3GD7A 3S24A 1UEBA 5KFSA 4LZGA 1U5KA 1ZQGA 4O2DA 3L7ZC 4BXXH 4KHPQ 3U4VA 3DM3A 4A3DH 2BHNA 4RQ8A 4DO9A 2YYZA 5H1SE 4YD1A 4XUSA 1PYBA 5J0UA 4ED3A 5IIIA 4BXOA 4K4HA 1XSNA 1IZ6A 4KI0A 5D46A 1S10A 8ICRA 4HJ5A 4QL5A 3LDAA 2NRTA 3RB3A 2JE6I 4DR7Q 4MZ9A 4F4YA 2Q2TA 7ICJA 1RXWA 1I94Q 5KFBA 3ISCA 2IT1A 4FBTA 3RH6A 4DR6L 2I9GA 2B21A 4BBSH 4JWMA 2JA5G 2W9BB 3PR4A 3BDPA 2NRZA 3IM1A 5IIOA 7ICFA 4DL4A 1N33L 1NOMA 2I5LX 1I50H 3RJGA 3AFQA 2I5HA 4BXOB 8ICAA 4YCVA 9ICEA 3KFUA 1PH4A 3T1HL 4P71A 1YI2A 4UAWA 4QWDA 2IHFA 3G48A 4DOCA 4HJ9A 5KG0A 3KHGA 1XNQL 1BPYA 2F3IA 3HOZH 1PV4A 4QZ9A 4DV0L 2F4VL 3Q8RB 4JOIC 1ZYQA 1HNWQ 4QY7A 3NTUA 3CCEA 5FJ8G 2W8LA 5IYCH 2ZJPA 4I2AA 2NVQH 2C28A 4C3JH 4QGUA 3J7A5 3FKIG 4IJLA 4QZGA 4IR1A 4ECXA 1WCMG 4GKJL 2VANA 4DL7A 3ZD8A 4DFPA 1XTDA 1S0VA 4PGXA 1X3GA 4TQUS 1TXYA 3RN5A 1B70B 4AYBG 4JV0A 2UUAQ 3H3VI 4DL3A 1SL0A 5EWEA 4LF7L 3RJIA 2J6SA 4QZBA 1YZ6A 1RIPA 4F5RA 3PMLA 3PV8A 5J2EA 4GS3A 3KHRA 4A3BH 3HFZB 1JJ2A 2UU9L 8ICWA 9ICNA 4DK3C 4O3OA 2E2HH 1VQ4A 2BCUA 5KFYA 3JPQA 3PO2H 4LUZA 3GIKA 5DKWA 3NBHB 4A3KG 1PA6A 2XY7A 3PX6A 9ICTA 1IBML 4A3FH 4JI3L 4OO1G 3RNUA 4IQWA 1K8AC 3TAPA 2PNHA 1VQAA 1ZQFA 4YWLA 9ICCA 4A93H 4RNOA 2JA8G 2Y0SG 4PHPA 1Z9FA 5IP7G 4ECWA 1SKRA 1MQ3A 5K36G 1X9NA 2HHHL 3RZDH 1NK4A 4KLDA 1K3RA 4FS1A 1ZJNA 2NRWA 4QZ8A 1NKBA 5J2GA 4DOBA 4I29A 4LF8Q 2KFZA 4ELTA 1ZQZA 5ELOA 4NY8A 2R8KA 1A63A 3SGIA 3BJYA 3C1YA 7ICOA 4YN4A 1EQRA 3PX0A 5J2JA 3GDEA 4DK6C 5DB8A 5KFRA 4F5PA 4B3SQ 5KG7A 4GNXB 4DR4L 1V1QA 5KFAA 4A4IA 4CCHA 3MR3A 4J9MA 2YTVA 1R9TH 4QW8A 2HHVA 5M5YH 4I2BA 3FKIH 2FPMA 4EYIB 4IPGA 1BPBA 1NMFA 4J9LA 1I3QH 2ZTCA 4F50A 4B3SL 4PHEA 1Q12A 3KOJA 3PMNA 1L3SA 9ICGA 1YNXA 1S0NA 1UA1A 1TWHH 2MNAA 4UP7A 3RRGA 3J81c 4O3RA 5J2KA 1SL2A 2JK8A 4O0AA 7ICRA 4KLEA 1EWIA 5BPCA 4DV1L 4RNNA 1B7YB 2MAXA 2ASBA 1VQ5A 4JI5L 3GDXA 4JBWA 9ICRA 5C4XH 4DV2L 1N34Q 3AU6A 4X6AH 2OTLA 2A1AA 4M6WA 5C3EH 4GN4B 4QWCA 5KT4A 4NXZA 3RJKA 4HJ7A 4FO6A 1YEZA 4APVA 3CMAA 4B3TQ 5HGQA 1L0WA 4DOAA 3MEFA 1E1TA 1QSSA 4ED1A 2AGOA 1NKCA 3V7KA 4RPYA 4RQ6A 1SROA 3V6HA 3IHQB 3S1NH 3UE1A 2P6UA 4A3JH 2C2RA 4KLKA 2AJQA 3GTGH 5J2FA 2XO7A 3RR5A 3CC4A 2V9WA 2JA5H 1QUQB 1GKHA 1D8LA 2CQOA 5DG8A 3OSPA 1WYDA 2PXIA 4J9QA 1UE7A 2ASLA 1XWLA 5KFWA 9ICAA 3GV8B 1ZQQA 4KLTA 1IYJB 2VA2A 1RZTA 1PZNA 9ICWA 4JI2L 1IBLL 5BOLA 4DNIA 2FLPA 2JZBA 1Y88A 3GTJH 5CJ7A 2R7DA 4DSEA 3T1HQ 3ULPA 3PNCA 4JI0L 3KHHA 1EUJA 4HIKA 5F9LA 4JUZA 4P73A 5IWAQ 2K52A 1S76D 1TAUA 3GFKB 3PW5A 2BDPA 2MFIA 3G71A 3OHAA 4A3CG 2E2IH 1SR3A 1NBWA 2DUDA 3SZ2A 2CKZB 4H02A 3ULJA 3S14H 4NM2A 4NLKA 4O3SA 3TQYA 4M2YA 1PYSB 2K14A 3JC66 4XIGS 3JAMi 3S2HH 4PHAA 2R8IA 4F91B 2AHOB 5KG1A 2VZAA 2FLLA 4QIWE 5CR0A 3E9IA 3SYZA 1EFWA 1UT8A 2DPIA 1TVAA 3K75D 2MO0A 9ICBA 2UVUA 1MSWD 2PQAB 3K8AA 1U45A 4DUYQ 4C2MH 4ECZA 8ICZA 3H8SA 4M0AA 4RU9A 4RQ3A 2M9NA 2ISOA 4IR9A 3IRBA 4I2IA 2K5NA 4BWJA 1ASYA 3CXCA 9ICHA 2KENA 2HIXA 4JI6L 5F9NA 5J0RA 1GVPA 3CC2A 5IYDH 3GIMA 3TS2A 4R64A 3EIVA 4YP3A 1E3PA 4IO9A 2F1JA 1X9MA 4B3TL 3TARA 2R6GA 4A3MG 3RLOA 4IJHA 4B3ML 5DGAA 3G6VA 5CHGA 4YQWA 1YJNA 4M9NA 4KLQA 1IXRA 3I2ZA 4QZHA 4QZDA 1QZHA 5C4JH 2XGPA 4A3CH 3U58A 3T5JA 1BVSA 1ASZA 2JEAI 3I55A 3NGDA 3TI0A 1M90C 4JBKA 4JI5Q 1T7PA 3RJHA 2W9BA 2Q2HA 2ID0A 3F1ZA 2IHMA 7ICSA 1SE8A 4K0KQ 4DV1Q 3RB4A 2H5XA 4DUZQ 4F2RA 1D9FA 4EZ9A 3MDCA 1K1SA 1SZPA 5TZVA 3C2LA 1L1OA 3CCUA 4F4KA 3H4DA 3KF6B 4XA5A 4P4MA 5C3EG 4P74A 4R8UA 1QLNA 5IP9H 4POFA 1U0LA 3HT3A 5GAGC 2W9AA 1LV5A 4BA1I 2DFLA 1X9WA 4IRCA 4P72A 5IWAL 1OXXK 2FPLA 2I5MX 3JPNA 2IHEA 4GKKQ 2XTIA 4A3IH 1NE3A 3F2BA 4X65Q 4YY3L 1P16A 1O7IA 3GTLH 2XGQA 9ICXA 2Z6KC 3CMEA 1NK6A 3JPOA 5IYBG 5L9XA 3CPWA 4LF6L 4IOAA 4YR0A 5HHIA 2RDJA 3K80C 3RTVA 1VQ6A 3Q8QB 3KF6A 4F5OA 1XPOA 2VS1A 2JJQA 1JX4A 4LFAL 4I2HA 1N36Q 3ISBA 1ZQPA 3H4BA 3U4ZA 1NK5A 5DBAA 4DS5A 2PFQA 1A77A 2KZMA 8ICXA 3C5FA 5KFVA 4TQSA 1L3TA 2R92G 4DR2Q 2ZJAA 2KFNA 3BQTA 2D62A 4GOPA 3OSNA 2IA6A 1JIHA 5FLMH 1BPDA 1D8YA 3NELA 4NXMQ 4L5SA 3FHWA 4KLGA 4R4QA 5J2AA 3W5OA 8ICHA 8ICGA 3ISDA 4BA2I 1AE2A 4LF7Q 4NXML 4A3LG 4NLGA 4YD2A 4IQTA 1AH9A 4J9RA 1UE5A 4LF9L 4ECQA 4IPDA 3OW2A 8ICOA 2MO1A 7ICNA 1HZCA 4A3KH 4NPSA 3EBEA 2BCRA 3CCLA 2RHSB 4PHDA 3M8RA 3J7ZC 1QSLA 4JI1Q 3T1YQ 4BDPA 3ZD9A 3JPPA 4XQ8A 2JZBB 1S0OA 4ECUA 2XY5A 1ZQIA 5J2DA 4M9GA 5M3MG 1BBUA 4BBSG 3PX4A 2BPFA 1J5EL 5IINA 1VQGA 3Q8PB 4B9SA 3LGJA 5KT6A 3FP9A 1UWVA 3EWAA 4ECSA 4YFKA 2K50A 1XJVA 5C0XG 1NJYA 4UB4A 4RT2A 3B0YA 1ZQAA 4LUVA 1HNZL 1YJ9A 3C2KA 2DPJA 1TK0A 1NJWA 5DB9A 1S72A 3HOVG 9ICPA 4YCXA 1SKSA 1ZQDA 3HOWH 3AYHB 3I4NG 5E7NA 2WP8J 4P4PA 1OTCA 5KFQA 1KFDA 3CQZH 1Q1BA 3HOUG 7ICLA 3STBD 3BZCA 4MFCA 4LF5Q 2JQOA 4DQIA 3PR5B 1A8VA 5DLQE 4C8MA 4J9SA 7ICKA 4DR1L 7ICVA 2MUTB 2A8VA 3CW2C 8ICNA 1VQIA 4Q45A 4POGA 1PH7A 4PGQA 4BBRG 5KT3A 5IE8A 2A1JA 3UDGA 4UB1A 8ICEA 2UVWA 5HP4A 1SMXA 1Y1VG 2Q2UA 1C0AA 4HYKA 4JBJA 4F4WA 4EBCA 1X65A 5DB6A 4BY7H 4O5CA 1K8GA 2C35B 4IOCA 3OJSA 3G4SA 2UVVA 4IPCA 1K73C 2FPKA 4ED8A 3ZDAA 4M04A 2K4KA 4TUPA 1S40A 3U50C 4JI6Q 2W9CA 4ME3A 2VQEQ 5EWGA 2VNUD 1L1OC 3PY8A 2A1JB 4DV5Q 1KTQA 2GN5A 2I1QA 2ALYB 3QE9Y 1VQPA 1N48A 1FVIA 3OHBA 2CWAA 4GKJQ 4DF4A 1ZQRA 1QVFA 2E8GA 1U48A 5C44G 4AH6A 4DUYL 5HY6A 4I2GA 5FLXc 3K7AH 4A3MH 4RQ4A 3CCVA 1H38A 1VQEA 3MGIA 4GLXA 2BA1A 4RQ2A 1B43A 2JA7H 4K4IA 4F4ZA 4B3RL 1JB7A 5J2BA 1ZQWA 4EEYA 2YV5A 1GO3E 2YTXA 2ZM6L 5J2HA 4LZDA 3UXPA 4OXPA 1N9WA 3KDFB 4A3GG 3HOXH 3H3VH 4DL6A 1WFQA 3E9HA 1HJPA 1KRPA 2V4RA 7ICHA 4GLVB 1ZQCA 1NK7A 4DR6Q 4RPZA 5KG5A 2W9CB 1HNZQ 4MF2A 5GQOA 4L5RC 3MGHA 1IBLQ 1RYSA 1VQFA 3H7IA 1I94L 5EAYA 4TQRA 4B3RQ 2BKEA 1V9PA 4KN7A 1LYLA 8ICVA 4UB2A 5IY0A 4M9LA 3MBYA 4B9NA 5DDYA 1XMOL 4DSFA 1E1OA 3KJPA 2BQRA 5KFFA 3PV0A 3RBEA 1KSPA 2I0QA 4LFCQ 1EXNA 1ZQOA 3T1YL 2UXCL 1ZQLA 4KLSA 1AE3A 9ICFA 5M3FG 1MC8A 3C2MA 2PI5A 1E22A 4R63A 4JG2A 1ZQNA 2RDIA 2PFPA 4TUQA 4QJFA 1PH1A 3ZDDA 2B3GA 4GNXA 3RZOH 5DBCA 4R4OA 1QTMA 2OQKA 2PI2A 1KD1C 4YR2A 4X62Q 3PF5A 2PI2E 3RH5A 5M5XH 3PF4A 9ICIA 4EBDA 3I4MG 1TAQA 2AMCB 1YJWA 3OYYA 2HHQA 2WB1G 1JN3A 4IFDG 2PFNA 1L2FA 2JEBI 4M9HA 1YHAA 1XS9D 4EQ5A 1XSPA 1KFSA 4OO1I 2NZOA 7ICMA 3JAMc 5L1LA 4DKAC 4OONA 2N78A 4YHHL 2BH2A 3HOWG 5J0QA 4A3LH 1N34L 5KTQA 4KLHA 4GC7A 1VQ7A 4LNQA 3V6JA 2UUBQ 3ZJYC 4RNMA 4LVSA 4UP8A 1UT5A 5JEAG 3S15H 4PZ6A 1N36L 1PH5A 2K5HA 2Y1IA 3RLFA 4HIDA 3A5ZB 1IM4A 1ZQEA 1N8RC 1KQSA 3MFHA 1RL2A 2JEGA 4GOPC 5KFMA 1CEZA 3PO5A 7ICIA 3PIOA 7ICTA 1HZ9A 3MR2A 3HPOA 1EQQA 1VQOA 5KG3A 4JI7L 2ASDA 4YY3Q 2VA3A 1Z00B 2C2EA 1YHBA 1Q8KA 5C4XG 4QWEA 4JWNA 4GXIA 1Q86C 4IFDJ 2JA8H 1C7YA 5LMUQ 3BJUA 2ALZA 4JI7Q 2R7ZG 4QZCA 4A93G 3ER0A 4RPXA 1Y14B 1ZQMA 2RCNA 1MJCA 5LMNQ 4JI8Q 1XPUA 4DQRA 1JT8A 3HOYG 3A0JA 3CC7A 3F8TA 1J5EQ 3PUYA 4GN3B 9ICKA 3H0GH 2OTJA 4P2HA 2ZTDA 3FDSA 2UXBL 5GAHC 4X5VA 4JC0A 5DLFA 2NVTH 2HHHQ 4M47A 4NLNA 3S2DH 3MABA 8ICSA 1KXLA 4A3EH 3KDFA 4WJ3M 3GTQH 4YHHQ 4RUCA 2HHWA 2JA6G 4YG2A 1G291 3PVXA 2UUCL 1TK8A 5M5WH 1IBMQ 1XMQQ 2BCVA 4ED2A 4QZAA 4Z6FA 4UAZA 4LUOA 5LMNW 3ERSX 4O3QA 1X6OA 8ICYA 1L3VA 4PG3A 4L5TA 1Z00A 2V1CC 1HZAA 4UPAA 3S1MH 4LFBL 3J80c 5J29A 2F1HA 1KDHA 3CP0A 2NRVA 3B0XA 4DR2L 3PUXA 2AKWB 4F8RA 4DFMA 4J9KA 2R93G 4JI4L 3CF5A 1SLJA 3F2DA 1X2IA 3T5LA 4LFCL 5JJKA 1ZETA 4DF8A 5J3BA 4ECTA 4F93B 3VDYA 1HZBA 4DLEA 3GQCA 4B9LA 3L0OA 5CP2A 4HJAA 4DV0Q 1MQ2A 1XNQQ 3V72A 3TQ1A 1Q1EA 1PVOA 1HNWL 4WJ4A 3ZDEA 5KFOA 1YVCA 1S9FA 5BR8Q 3PW4A 2P66A 4LF6Q 3C21A 4DV3Q 1HR0L 2HHSA 3TFRA 4IRKA 4X65L 4F5NA 3S1RH 1N32L 1KL9A 3SV3A 1BPZA 2LXKA 1W2BA 4UQGA 4R4IA 4RQ0A 3HKZG 4O9MA 4MEXA 4F2SA 2OWOA 1OXVA 1TKDA 1N56A 4DR5Q 4IQUA 1N33Q 3KLWA 5C44H 3HP6A 4J9PA 1Q46A 4GC6A 1SFOH 3BQ0A 2ZUBA 2AQ0A 2ZJ8A 2JEFA 1P8LA 4Q8FA 2WFWA 2ZM6Q 7ICUA 3K7UC 4PH5A 4JYAQ 2VQFQ 2R7FA 4GXKA 2EQSA 4DUZL 1KFTA 3H8JA 4K0KL 4O3PA 2W8KA 1SN8A 4I2CA 1T3NA 3GTPH 8ICFA 5GROA 2VA8A 2F52A 4DV6L 3M4QA 1WI5A 3UDFA 5KT2A 2NZHA 2P6RA 3TREA 3L2PA 2Q2IA 4FDBA 5KFTA 2FXQA 1FJGL 4R4TA 4L5QA 3C1ZA 3ICEA 4ED7A 1CKMA 4KHPL 5DBBA 5J0XA 4UBBA 3N4MB 1ZQYA 2E2JH 3QEAZ 8ICLA 2E5LQ 1RYRA 2D0PA 1EYGA 4K4GA 3RLNA 4MTNA 5CWRA 4KLIA 4QZIA 1NY4A 3KTQA 3ETLA 3J81i 2E5LL 3MR6A 2AWOA 3MFIA 1VQ8A 4NXNQ 4JCVE 3AU2A 3HX0A 1WJJA 1X3FA 1PH2A 2ATWA 1FJGQ 1TV9A 1SKWA 1UA0A 5CB1A 1FL0A 2KCMA 4LF4L 3LWLA 4A3DG 1VCIA 2F1IA 4QZEA 5D49A 2V4QA 3MXNB 1JMCA 4EBEA 2HHTA 3THVA 1C9OA 3TAQA 3GILA 3A5UA 1G6PA 2OQ0A 1NTGA 2QEXA 4DR1Q 3BQ1A 4BWMA 1BGXT 3G6XA 5L1IA 4DSKA 1CUKA 3Q8KA 2YU9H 3C5GA 1HUOA 4C8NA 4DR3L 4LF5L 3ULLA 1AROP 4Q43A 5AJ3Q 4RQ5A 4YWKA 1QUQA 3RJJA 1UE6A 4LW1A 2VQFL 3OJUA 2HHUA 5HMLA 5KFDA 4IPHA 3HW8A 4B9VA 3V6KA 2HQLA 2ASJA 4BY1G 1Q82C 1EIYB 2QA4A 4GXJA 2KHIA 1TK5A 1PH9A 4HJ8A 1QVGA 2RF4A 1D9DA 4G3IA 2J6UA 1VQCA 1T9HA 1Y1WH 5GAEC 4BBRH 4I2DA 1L1OB 4DWIA 3RJFA 3GIIA 1NJZA 4DS4A 1HH2P 4HIMA 3G6EA 1VS0A 2IBKA 3KHLA 4F4XA 4B9TA 1HR0W 3RB6A 2XGTA 1Z47A 4JI2Q 3OTOL 2IX1A 4MNOA 5BR8L 4DSIA 9ICSA 2ZJRA 5JJLA 4UB3A 1VQNA 1TWFH 4M6WB 2HVIA 4DFJA 1E24A 1M1KC 1RPLA 3RRHA 3GTKH 5L1KA 2R7ZH 4B9UA 3ZDCA 4UB5A 1VQMA 4KLJA 1K0RA 2UXDL 5KFUA 3OGUA 2AGQA 4ELUA 4JI4Q 1T8EA 3A74A 5IIKA 2C2DA 4DV4Q 1U9LA 5KFPA 2GWSA 1LTLA 4A3EG 5L1JA 3T5HA 3TANA 2XCAA 3NEMA 4QQBX 3M9NB 1VQDA 5KFXA 2KBNA 3EN2A 3CCMA 2LYHA 3M7NA 1X9SA 5KFZA 3PO4A 2IY5B 3HOYH 4KHZA 3CD6A 2GVBA 3M8SA 5KFEA 3QZ7A 4I27A 4Y7NH 3RBDA 2K75A 1JJGA 3TS0A 4ELVA 1XO1A 1ZQJA 4I2FA 4AIMA 2UUAL 4OWWB 3TEHB 2XC9A 2NVYH 4DV2Q 2UUCQ 2BH8A 5KFCA 4A3IG 3UXNA 1EIFA 2VUMH 3SV4A 1CKNB 4YCUA 2FMSA 4YMOA 4JV5Q 1NK9A 4LFAQ 2J6TA 1YBYA 2AU0A 5HHHA 8ICBA 5DLGA 5IIJA 1KAWA 3W1GA 1ZQVA 5IILA 4YCWA 3KJOA 1HNXQ 2CWPA 5IP9G 1S0MA 1X55A 4ECVA 9ICLA 5IIMA 3PUVA 5HMMA 1PFSA 2ISPA 4YMMA 2FLNA 8ICQA 1X56A 5M3MH 2C22A 4JV2A 3AFPA 3STBC 4DEZA 5LMNL 4TUSA 1PHJA 5IT9c 1LB2B 1XNRL 4O0IA 4AYBE 4JOIA 2N8NA 1MJEA 4J9NA 5KFGA 2Z0SA 1CKNA 4YR3A 3MR5A 4J15A 1XNRQ 3GO5A 1QVCA 2ZJ5A 1L5UA 1U49A 1XSLA 2D0OA 4DR4Q 4EX5A 2B29A 1EOVA 2Q0ZX 3ZDBA 4C8LA 1OXUA 2KCTA 3C23A 4NB3A 2Y1JA 5IYBH 4RZRA 2NVXH 4F3OA 2KHJA 5CA7A 3F2CA 3MDAA 5AJ3L 4IFDI 2HT1A 4RQ1A 5KT5A 1QSYA 1U4BA 4RT3A 1KLNA 4DR7L 1J6QA 2Y0SE 3I4MH 3CCRA 4GLAC 5J0PA 4FBUA 2BQ3A 1K83H 2WAQG 2BGWA 5EOZA 1TWAH 5M3FH 3EW9A 3QEBZ 1SL1A 2B63G 3V7LA 4MEYA 2NN6I 7ICQA 3PIPA 1XU4A 3UPQA 3HOXG 2LXJA 4A3GH 3M9MB 1RXVA 2DGYA 4DFKA 3NENA 2PMZE 4DV7L 3HWTA 2FMQA 2BCQA 1JXEA 2N49A 4AQYQ 3RH4A 4C8KA 3GV5B 4GNXC 4KITB 1VQBA 3J80i 1NK8A 2XCPA 4O3NA 5IYCG 3PUZA 3PO3H 5FJ8H 3RAQA 3H15A 1VQKA 2UU9Q 3I56A 1GD7A 3RN2A 4BGDA 5J0SA 1MIUA 4UBCA 4KLOA 4GOPB 1NJXA 4Z6CA 1WCLA 1DGSA 5HNKA 2AQ4A 4LWCA 1KIXA 4X64Q 4O5KA 3WWVA 3PSIA 4DAYB 2KZ3A 3I4OA 1D7QA 3RJEA 4PPXA 2VW9A 3BQ2A 2FMPA 4DL2A 8ICJA 9ICOA 5KT7A 5KFNA 1U47A 3M9BA 3PCOB 4NM1A 3AQQA 4X66Q 5J0WA 5BOMA 3LK9A 1IBKL 1PH3A 3Q8MA 4I28A 4UAYA 1LM0A 3PW0A 4EYHB 1BPEA 1H95A 3TFSA 1WCMH 3GIJA 1Y1VH 4DL5A 4PMWA 4DR5L 3S1QH 5J2IA 4YMNA 5KG2A 1BBWA 3QZ8A 1ZQTA 4R4CA 3AEVA 1XC9A 4JI0Q 3E2EA 4RMFA 2YTYA 1CKOA 2JA9A 2IHNA 1NKEA 2R93H 2OCEA 5DDMA 4R66A 4TURA 4DV3L 3T3FA 1HR0Q 1I5FA 4DR3Q 3RAXA 4DPGA 2JEIA 3PO3G 3S16H 1Q7YC 1VQHA 3M85A 2HIVA 4Q8EA 2BR0A 4DSLA 2PQAA 3BU2A 2JEJA 2CFMA 3HOVH 2BPCA 4R8UB 5DQHA 4BY7G 4P4OA 8ICMA 4HIOA 2ZUCA 4FS2A 3GV7B 1VQJA 3UDIA 1S97A 2MQHA 3JPTA 2BA0A 3CCJA 4DV5L 3GTOH 1ZQBA 1ZQHA 7ICEA 4YXMA 1E7ZA 4ED0A 2IMWP 1DOQA 1LUZA 2VQEL 5DG9A 3GTMH 4R1JA 4LFBQ 2L15A 3JPSA 5KFLA 1BPXA 4DAMA 3JPRA 3CPFA 2BPGA 4PGYA 4KLFA 1JJCB 2AWNA 4DV7Q 4R65A 4OWXB 3H0GG 2K5VA 4ECYA 1TFRA 2EIFA 1TWGH 4A3JG 1VQLA 5DB7A 1XMQL 5DQIA 4JBMA 2NN6G 1COOA 4DV6Q 4ALPA 1KRSA 5EWFA 4QW9A 2ZTEA 1ZQSA 4KN4A 1BKBA 5DGBA 3I4NH 1CSQA 1TWCH 5J0YA 1B22A 3T5KA 1X54A 3EPIA 4IQVA 3ORYA 3B6YA 2UXBQ 4F5QA 4JYAL 1KEJA 1I6HH 1JE5A 3I7FA 3EYZA 3SI8A 5JEAJ 4B9MA 1JMSA 3FYHA 4Z6EA 4UP9A 1PH8A 1YHQA 4A76A 4YWMA 4JI8L 3TRZA 1ZQKA 1NK0A 4KLUA 2B63H 1UE1A 2JA6H 4I2JA 3PW2A 3LWMA 4DQPA 1N32Q 5D4BA 5JJIA 2VUMG 3CCSA 1W3SA 5IP7H 3H8WA 1S77D 2VY3A 5KFJA 4EZ6A 4OX9L 3M4PA 2BCSA 4UY8C 2WAQE 2KZZA 1VQ9A 3HOUH 4QZFA 1S3OA 1NJIC 8ICUA 4ZH4A 4DLGA 2GVAA 4DSJA 4LF8L 5J0OA 4RG1A 2PFOA 1HNXL 1YITA 4JV5L 2R8HA 4YXJA 2ZJQA 3V7JA 5C5JA 4JI1L 4MF8A 7ICGA 2QGQA 4XRHA 3RR8A 1K1QA 1L3UA 2R8GA 4C8OA 1JXLA 3CCQA 1K9MC 5FLMG 3DLLA 2Z6KA 2NRXA 1SRUA 4F92B 3KF8B 1QZGA 2ZUDA 1ZJMA 3G6YA 4LF9Q 4JI3Q 1XPRA 3UQ0A 1ZQXA 2XY6A 4Y52H 3HKZE 8ICKA 3EZ5A 5JUMA 4C3HH 2HHXA 3D31A 4I2EA 1CSPA 4DQSA 4NLZA 9ICVA 4O5EA 5DG7A 3KYHC 8ICPA 4KLMA 1WCNA 4YVZA 1T4GA 5GADC 4TVAB 2W9MA 4Z6DA 2HW3A 2LSSA 4P75A 4A75A 2PI4A 1A76A 5ELNA 3RR7A 2UVRA 4DV4L 1Q81C 1Y1WG 3HKSA 4GN5A 4XTCS 2KTQA 5KFKA 2KN7A 1ZQUA 3K0XA 4KLLA 2UXDQ 1KC8C 4Q44A 3S17H 4KTQA 3UXOA 3H40A 1X3EA 2UXCQ 4QWBA 8ICCA 3M4OH 5KG4A 3Q8DA 2VL6A 3PO2G 2F4VQ 1XMOQ 1Z3EB 5KG6A 1KHIA 3UE0A 3D0FA 3PGZA 2HVHA 4A3BG 2ES2A 5KFIA 1FGUA 3UDXA 2WTFA 4DQQA 3AUOA 1OXTA 3OTOQ 4OX9Q 1GM5A 2R92H 5LMUL 2JA7G 4PZ7A 5DQGA 1A0IA 4C3IH 4MFAA 2EXDA 4IRDA 5C0XJ 4GKKL 3M9OB 4E0DA 5J0TA 4MFFA 4KMUA 3E0EA 2BQUA 3PW7A 3HOZG 4JK1A 9ICMA 5C0XI 3N97B 1PH6A 4A3FG 3Q8LA 4M9JA 4BXXG 4JV1A 1YIJA 1V43A 3BZKA 9ICJA 3Q8SB 1G51A 1WOCA 2IX0A 3J81j
chains in the Genus database with same CATH superfamily
2F0SA 3R2TA 4IC9A 1B8AA 1DYQA 5AKEA 2DBYA 5IGEA 4QWAA 2HCCA 3M4OB 3I91A 1IBKQ 1EU4A 5IYDG 5KFHA 5JU5A 4CKCA 2PKEA 3UQ2A 2UUBL 4X66L 4XYQA 2VJ5A 2ZIUB 1TAMA 2MUTA 1LTBD 3EPGA 1NMGA 3AMUA 1MKHA 2ATLA 1AN8A 2F0UA 2L0CA 3E6ZX 2N3SA 2RHQB 2GOLA 5F2DA 5AM5A 2J4XA 3NWSA 3DWPA 1HPCA 8ICTA 1K3BC 3K4GA 3QX7A 5J2CA 7ICPA 2NVYB 3RB0A 3WK7A 2A19A 4M1UB 4ZUJA 1IYUA 4KK7A 4Y2UA 8ICIA 4BY1H 2WINB 1RDPD 4LF4Q 1KRTA 9ICQA 2WB1E 1ONLA 4RUAA 2CCZA 1HUZA 2R8JA 1SMYD 4X64L 4A3MG 1A62A 4C80A 3CAMA 4NXNL 4O3MA 4XT3B 4B3MQ 2B39A 1DZ1A 3PUWA 4X62L 4K2KA 2DL0A 5KRUA 4J9OA 3M3YH 1NR2A 1Y8PB 2EJGC 1HIWA 1SNQA 9ICUA 3GTMB 4M8AA 2LMRA 3E58A 2MUYA 4PZ8A 4RQ7A 2EYHA 3SXHA 1BDOA 1OXSC 4ECRA 1E0BA 3W1BA 3K81C 1IL2A 4G4KA 2DKZA 2YX8A 2RSNA 3DWQA 2AGPA 2LFNA 2C5CA 4ED6A 3BDLA 1A0PA 4OWTB 4AQYL 3GTPB 3GD7A 2B2TC 1DK2A 4NV0A 1UEBA 5KFSA 4LZGA 1U5KA 1ZQGA 4IUNA 4O2DA 3S24A 1JOQA 2NWGA 3L7ZC 4BXXH 4P0QA 4KHPQ 4HMJA 3U4VA 4ID6A 3DM3A 4A3DH 1U9RA 5AI5A 2BHNA 5G3LD 2F1MA 2QDBA 3PZPA 4NL9C 4RQ8A 4DO9A 1LT5D 2YYZA 5CBEE 3GTJB 5H1SE 4O1NA 4YD1A 4XUSA 1PYBA 3KBXA 1ILPA 1J2MA 1H9SA 5J0UA 4ED3A 3Q23A 5IIIA 2L11A 3SE0A 5E4WC 1CM9A 3I4NB 4BXOA 4K4HA 1XSNA 1IZ6A 3MVVA 4KI0A 2M9VA 2XWBB 5D46A 1S10A 1IKLA 3QJYA 8ICRA 5AKGA 4P2CB 4HJ5A 4QL5A 1LTRD 4JMUA 3LDAA 2NRTA 3RB3A 2JE6I 3HOUB 5IGBA 4DR7Q 4R8IA 4MZ9A 2F0LA 1B53A 4F4YA 2Q2TA 7ICJA 1RXWA 1I94Q 5KFBA 2ZXRA 4HTHA 4QIWF 2Z9HA 2B2TA 3S14B 4L6TB 3ISCA 2IT1A 4FBTA 4BJQA 2LKYA 3RH6A 3PO3B 4DR6L 3HZXA 4CDCC 5ALKA 2DQNB 2HDLA 2I9GA 1I4GA 2B21A 4BBSH 3MGVA 4JWMA 3WKCA 1SNOA 2LS01 5JPMC 4XQJA 2JA5G 1L0XB 2W9BB 5JTIA 3PR4A 3BDPA 2NRZA 3IM1A 5IIOA 7ICFA 2ENBA 4DL4A 1N33L 3S1NB 1U4LA 3KKAC 1DONA 2Q8IB 1NOMA 1RG6A 2A69C 5ISRA 3WOEA 2I5LX 5AI6A 1A3UA 4DNRB 1I50H 2EPBA 3RJGA 3AFQA 2I5HA 4BXOB 8ICAA 2DNCA 9ICEA 4YCVA 3KFUA 1PH4A 3WKEA 1SE2A 3T1HL 5CGKA 3MFGA 4P71A 3DEEA 1YI2A 4UAWA 4QWDA 1XWEA 3SQIA 5AKZA 2IHFA 2SNSA 3G48A 4HR7B 4Y2RA 1IW7D 4DOCA 4HJ9A 2EYLA 5KG0A 3KHGA 3BDOA 1XNQL 1NUCA 3K5LA 1BPYA 2F3IA 3HOZH 1PV4A 4QZ9A 4DV0L 2F4VL 3BDCA 3Q8RB 4IUUA 4JOIC 1ZYQA 5J1ZA 3HOVB 1S4ZA 1HNWQ 4U6PA 4FNFA 4QY7A 3NTUA 3CCEA 2X6LA 5FJ8G 3SR1A 5BN4A 2W8LA 2EYMA 2W55A 3OIPA 5IYCH 2ZJPA 4I2AA 2KIWA 3S17B 2NVQH 2C28A 4C3JH 2RLTA 4C3HG 5L37A 3FKIG 4IJLA 4QZGA 4IR1A 1RHPA 4ECXA 4QGUA 1WCMG 3J7A5 3HKZB 4GKJL 5AI4A 1O80A 3RUZA 1TS5A 4PNYA 2VANA 1QILA 3EA6A 3ZYYX 3IFTA 3HILA 4DL7A 3ZD8A 4DFPA 1XTDA 1S0VA 2A6HC 5IGDA 2BDNA 4PGXA 2G06A 1X3GA 4TQUS 5I9OA 2B2UC 1TXYA 3RN5A 1B70B 4AYBG 5A2QE 4JV0A 4J8QA 2UUAQ 5IGCA 2B2WC 3KZIU 3H3VI 4DL3A 1BQQT 1CHQD 2JH7A 1SL0A 3SR6A 4K5VA 5EWEA 4LF7L 2XNAC 3RJIA 2J6SA 2KHVA 4QZBA 1IL8A 2A6EC 1YZ6A 2KEYA 1RIPA 2Z1CA 3UI2A 4F5RA 3PMLA 3PV8A 5J2EA 4GS3A 3KHRA 1HHVA 4A3BH 3JAML 1L7NA 3ED5A 3HFZB 8ICWA 5M9OA 1JJ2A 5JVH3 2UU9L 9ICNA 4DK3C 1ZRMA 4BUGA 3EQLC 4O3OA 2E2HH 3AN1A 1VQ4A 2BCUA 5KFYA 3JPQA 4C1NI 1A6XA 1TE2A 1BCPB 3PO2H 1PRTF 1WTXA 4LUZA 3GIKA 5DKWA 3NBHB 4HEDA 4A3KG 1DRGA 1PA6A 5M5YB 5ALOA 1N61A 2XY7A 2NUCA 3PX6A 9ICTA 5CV9A 5CC4A 1IBML 4KX5A 2E76C 3SEIA 4A3FH 2CQAA 4RCOA 4JI3L 4OO1G 3RNUA 4IQWA 5EE9A 3NBHA 1K8AC 1EFID 3TAPA 1B9MA 5C6AA 2PNHA 1VQAA 3VR3A 1ZQFA 1V1PB 1PRTB 2K8CB 9ICCA 4IALA 4YWLA 4CJ0B 4UW9A 2XN9C 3EVQA 5CV8A 1SJED 4A93H 4RNOA 2JA8G 2Y0SG 4PHPA 1Z9FA 2HSZA 3V05A 5IP7G 4ECWA 2B0CA 1SKRA 2LMCB 3H91A 1MQ3A 5K36G 1X9NA 3LWUA 4DXGA 4UATA 3RZDH 1NK4A 4KLDA 2HHHL 2VUMB 1K3RA 3E0FA 5KYLA 4FS1A 3IN5A 1ZJNA 4KX3A 2NRWA 1F2ZA 4ZK9B 2JA7B 1W6KA 1ET9A 4QZ8A 4B6JA 5J2GA 4DOBA 1NKBA 2AQ1B 4I29A 4LF8Q 1LTTD 5C0XH 2KJ9A 2G08A 2DJFC 2KFZA 4RGTA 4ELTA 1ZQZA 5ELOA 3J7AV 4NY8A 2R8KA 1A63A 3SGIA 5I6YA 4UAUA 2CW0D 3BJYA 1EY7A 3C1YA 7ICOA 2YTUA 4C7YA 4YN4A 1I4RA 2JHDA 1EQRA 3PX0A 1VF5C 5J2JA 1ZD3A 3LVWA 3GDEA 5DB8A 1VF7A 4DK6C 5KFRA 4F5PA 4K5XA 5CRXA 4B3SQ 3P75A 3U26A 5KG7A 4ILWA 4GNXB 4DR4L 4ULLA 3IV6A 1V1QA 5KFAA 3ALRA 4A4IA 1SV0C 1WVLA 4CCHA 3MR3A 2QARB 4J9MA 4QUFA 2YTVA 1R9TH 4QW8A 4C3IB 2OM6A 2HHVA 5M5YH 1NNXA 1EY4A 4I2BA 1LTGD 1ECWA 2F0KA 2DUYA 1JALA 3FKIH 3TBIB 3F2UA 2FPMA 4EYIB 1D5XC 4IPGA 1BPBA 3T4AC 1NMFA 1KBUA 2N55A 3J80L 2O5JC 4J9LA 1I3QH 2QB0A 4OJLA 2ZTCA 3QU2A 3D4RA 4B9XA 2Y9TA 4F50A 2BE5C 4B3SL 4PHEA 1Q12A 4BY7B 2YMPA 3EUB2 3KOJA 3O0FA 3PMNA 2QB1A 1L3SA 2JV3A 4ZLTF 9ICGA 2LY7A 1YNXA 1S0NA 1UA1A 4PMBA 4C0ZA 5K5PA 1TWHH 5AK3A 2PW7A 2MNAA 4UP7A 3RRGA 1HRJA 3J81c 4O3RA 2ODGA 5J2KA 1SL2A 2JK8A 4O0AA 7ICRA 4KLEA 1EWIA 2YY6A 5BPCA 4DV1L 1MI2A 4RNNA 1B7YB 4G57A 2MAXA 2ASBA 1VQ5A 1JB3A 2KJXA 1NZPA 5AFWA 4JI5L 2PMZB 3GDXA 4JBWA 1B2TA 5JOBA 4JW0A 9ICRA 3MXPA 5C4XH 3VR5A 4DV2L 1N34Q 3AU6A 3F5EA 5E1FA 4X6AH 1ZRNA 4FF4A 2OTLA 2A1AA 4M6WA 5C3EH 5ALJA 4GN4B 4QWCA 4C3JG 4TSSA 5KT4A 4EVOA 4NXZA 5G5HA 3RJKA 4HJ7A 4FO6A 1JE4A 1YEZA 4DFDA 4APVA 1TWGB 3FRPB 3CMAA 3HOYB 5JAVA 1X40A 3TACB 5CV7A 4B3TQ 1SMYC 5HGQA 3GTOB 1JOOA 1X9XA 1L0WA 4XXEA 4DOAA 3MEFA 1E1TA 1QSSA 3Q0AA 4ED1A 2AGOA 1NKCA 2HQEA 4C4TA 3V7KA 1LTID 4RPYA 4RQ6A 1O7LA 1SROA 3V6HA 3BYYB 5IODA 1V85A 3IHQB 2VKQA 1JOKA 3S1NH 3UE1A 3A55A 4WFN3 1Q3UA 2P6UA 3BYTB 3FVQA 1D8BA 4A3JH 2EQYA 2C2RA 4KLKA 2AJQA 5J39A 4BBSB 4CF3A 3T79A 1GO3F 5C4XB 3GTGH 5J2FA 2XO7A 3RR5A 4KJOA 1RM6C 3S6JA 1F2LA 3CC4A 2V9WA 2KQ3A 2JA5H 2B6GA 1QUQB 1BNOA 1GKHA 1D8LA 2CQOA 1JCKB 2EZXA 1GHJA 3QWNA 3C3LA 2AH5A 3FPPA 2WB1B 5AICA 5DG8A 3N7RC 3OSPA 1EY6A 2JA5B 1WYDA 2PXIA 4J9QA 1UE7A 1CA6A 2GH1A 2ASLA 3D2QA 1XWLA 2H4OA 2W43A 5KFWA 9ICAA 3GV8B 1ZQQA 2IOFA 4G9BA 4KLTA 1IYJB 4X3SA 5IOCA 1ED1A 2VA2A 1RZTA 2BDOA 1PZNA 9ICWA 4JI2L 1EIGA 1IBLL 3H0LB 3QU9A 5BOLA 4DNIA 2FLPA 2JZBA 1Y88A 3GTJH 5CJ7A 2K89A 2R7DA 4DSEA 2NYVA 2X69A 3PNCA 3GV6A 3ULPA 3T1HQ 4JI0L 3KHHA 2HOQA 1RD9D 4CNQA 1EUJA 2KVMA 1PUZA 1A2UA 4HIKA 5F9LA 4JUZA 2QKQA 2YMMA 1TIID 1PYWD 4FVMA 4P73A 3CP8A 5IWAQ 2NVXB 1AZPA 1GUNA 3NQIA 4MTKA 2K52A 1S76D 4RGNA 1IKMA 2IOHA 1TAUA 2G09A 2EJFC 3GFKB 1JRPA 3PW5A 2BDPA 3MHBA 1I4PA 4QF4A 2MFIA 3G71A 2JXJA 3OHAA 4A3CG 2E2IH 1DXMA 3D4DA 3QNMA 1NBWA 1SR3A 3SZ2A 2CKZB 1HTLD 2DUDA 4H02A 4RQMA 4NM2A 4NLKA 3ULJA 3S14H 4O3SA 3M3YB 5AIAA 4M2YA 1PYSB 1STBA 2K14A 3JC66 3TQYA 4XIGS 1F9RA 3JAMi 2O6KA 3S2HH 4PHAA 2R8IA 1FD7D 2AHOB 4F91B 2NO4A 5KG1A 2A69D 2VZAA 4L8JA 1DK3A 1F5SA 2FLLA 2ZG6A 1XX8A 4QIWE 5CR0A 3E9IA 3SYZA 4MHVA 2KOLA 3V2TA 1EFWA 2R61A 2JR5A 1UT8A 2K4PA 2DPIA 3VYTA 1TVAA 2EDUA 4IUPA 1NI3A 3K75D 1EEID 2MO0A 1EIHA 9ICBA 3IDWA 2KVCA 2UVUA 2KOBA 2QF7A 1MSWD 2PQAB 3K8AA 1U45A 3HS0C 4IUTA 1L7MA 4DUYQ 3KKAA 3MA2B 4C2MH 4ECZA 8ICZA 3H8SA 4M0AA 4TKOB 4RU9A 4RQ3A 2M9NA 5TISU 2ISOA 4IR9A 3IRBA 4I2IA 2K5NA 3A8KE 4BWJA 1CQVA 5E79U 5FO7B 1ASYA 3CXCA 1Z19A 1A3VA 1KDCA 3BQ7A 9ICHA 2KENA 2HIXA 2XIWA 2NB0A 5HR7A 1F9QA 1ENAA 1HTPA 2RDFA 4JI6L 5AM3A 5F9NA 5J0RA 1GVPA 2M00A 3NQTA 1LTAD 3IFDA 3MTSA 3CC2A 5IYDH 3GIMA 2WKDA 4KJNA 4R64A 2W7PA 3EIVA 3TS2A 4BBRB 4YP3A 1E3PA 2WHEA 4IO9A 4IL6U 1SWVA 4CBVA 2F1JA 1X9MA 3A8JE 1ET6A 3FPUB 5C4HA 2AQ3B 4B3TL 3TARA 3WK5A 2R6GA 3G7LA 5K4LA 3K6OA 3UMCA 5DGAA 4H0LC 3A7AB 4IJHA 5D65A 3RLOA 5ALHA 2W54A 1BF4A 1T94A 2EY1A 3G6VA 5CHGA 3NBIA 3PO2B 4YQWA 1YJNA 4M9NA 4KLQA 2FMMA 4CKBA 1IXRA 3I2ZA 4QZHA 1EY0A 4H7BA 4QZDA 4CDFC 1QZHA 5C4JH 5KNIA 1Z1BA 2K33A 5ALRA 2XGPA 4A3CH 3U58A 3RMHA 1Y69U 4N8X1 3T5JA 1BVSA 1SB3C 2GA4B 1ASZA 2F03A 2JEAI 3I55A 2F0GA 3NGDA 3TI0A 1M90C 4JBKA 1YZ7A 2RP5A 2PZTA 3Q6SA 4LK1C 4JI5Q 3H3VC 1T7PA 3RJHA 2W9BA 2Q2HA 2ID0A 3F1ZA 2IHMA 2NBFA 4L63B 5IGFA 7ICSA 1SE8A 4K0KQ 3SEBA 4DV1Q 1O03A 3MEHA 4A8EA 3RB4A 2EYJA 3SVMA 3PIO3 2H5XA 4C3IG 4DUZQ 4F2RA 1D9FA 2OH2A 4EZ9A 3MDCA 1K1SA 1SZPA 5TZVA 1LTSD 1KDAA 3C2LA 2K05A 1BXTA 1N60A 1L1OA 3CCUA 4F4KA 3H4DA 5JJZA 3KF6B 3I4LA 4XA5A 2L4NA 4P4MA 1EOTA 5B5EU 5C3EG 2F8LA 4P74A 5ALGA 1B4FA 2XICA 4R8UA 1HQRD 5C3XA 2W3SA 1QLNA 4POFA 5IP9H 1J97A 1T3QA 1U0LA 3QUBA 4MIUA 1PFMA 3SAHA 1EQTA 3HT3A 5GAGC 2W9AA 2G0AA 1IIPA 2MU2A 1LV5A 1W6JA 2DFLA 1X9WA 4BA1I 4FXDA 1KLUD 4IRCA 1T5XD 1SFOB 4P72A 5IWAL 1OXXK 4ZRZA 2FPLA 1FFUA 2FJ2A 3JPNA 2I5MX 5IT9E 1R9TB 3T51B 2IHEA 3RFAA 4GKKQ 2XTIA 1NZBA 2CW0C 1AP0A 4A3IH 1NE3A 3F2BA 3I28A 2BZFA 4X65Q 5C3EB 4P0QB 4AYBB 1MN8A 2R3ZA 2PYKA 4YY3L 1P16A 1O7IA 3GTLH 2XGQA 1M4VA 9ICXA 2Z6KC 5FLXL 4NDXA 2RKSA 1NK6A 3JPOA 5IYBG 5L9XA 4HN7A 5CBAE 3CMEA 3CPWA 4LF6L 4IOAA 4DGZA 1X66A 5HHIA 2M0NA 2JRZA 4YR0A 2RDJA 1ENCA 3K80C 3RTVA 1STEA 4UAVA 3FEWX 5ELDA 2KV2A 1VQ6A 5ALFA 1S5DD 3HP3A 2L55A 3Q8QB 3KF6A 4F5OA 4NL9A 4C3JB 4EX7A 1XPOA 2VS1A 2JJQA 5KL1B 1UAPA 1JX4A 3IL8A 3TP5A 1ZYRD 3BG3A 5ALEA 3BZDB 5ELFA 4LFAL 5T14A 4A3KB 2W11A 4I2HA 1N36Q 1TWHB 3ISBA 2H3QA 1ZQPA 2PCFB 3H4BA 1SEBD 3U4ZA 1NK5A 5GTHU 5DBAA 1I4HA 4DS5A 2PFQA 1A77A 2KZMA 5D3DA 8ICXA 2I6XA 1S5CD 1QJOA 4BS9A 3C5FA 2O2LD 5KFVA 1AEXA 2F0FA 4TQSA 3NP8A 1L3TA 2R92G 1TS3A 1WG8A 1AW7A 2ZJAA 4DR2Q 2KFNA 3BQTA 2D62A 2KVSA 1H9SB 4GOPA 3OSNA 2IA6A 1JIHA 3F5AA 5AK5A 1ESFA 2F3VA 3OSOA 5FLMH 4IN3A 2L5TA 3HEJA 1BPDA 3QYPA 1D8YA 3NELA 1N62A 2RBMA 4NXMQ 4L5SA 2L9HA 3FHWA 5CV6A 1NR4A 5DNFA 1Q3VA 3KLSX 1H9RA 4KLGA 4R4QA 2J7ZA 5J2AA 1PRTC 3W5OA 8ICHA 4G7OC 1GUTA 3M6KA 8ICGA 1ENFA 3AU7A 1A2TA 2E8MA 4WJWA 3X3NA 5KIXA 3ISDA 2MHVA 1H9MA 1KLGD 4BA2I 1ZXIA 1AE2A 5K36H 5LHY1 2OEOA 3M6ZA 4LF7Q 4NXML 3LYSA 2FFKB 4HMIA 1LT4D 2F0HA 1QQ7A 2NZ1D 2FE9A 2B2YC 3CRXA 4NLGA 4A3LG 4ZAIA 2RRDA 3W2DA 3I1YA 4YD2A 1DOKA 4IQTA 3DEPA 4J9RA 1UE5A 3DMUA 1AH9A 4F8MA 3NTKA 2EZYA 2A73B 1ICWA 1SBBB 4LF9L 4NKLA 4ECQA 3EROA 1XTCD 2NN6H 3HKZF 3MXUA 4IPDA 4KY7A 3OW2A 8ICOA 2MO1A 7ICNA 1HZCA 3HG9A 1I6VC 2F0DA 4A3KH 4NPSA 3CKIB 3EBEA 2BCRA 3CCLA 2RHSB 4PHDA 3M8RA 3J7ZC 1QSLA 4JI1Q 3T1YQ 4BDPA 3ZD9A 3QUCA 3JPPA 1YNJC 4XQ8A 2JZBB 1S0OA 1D5ZC 5C3WA 5FOBB 4ECUA 4OJ6A 2XY5A 1ZQIA 5J2DA 4M9GA 5M3MG 3KK7A 1BBUA 1GUWA 1M8AA 4BBSG 3PX4A 2BPFA 2DKXA 5EKIA 5IINA 1VQGA 2F0NA 5KGUA 1J5EL 5ALNA 1UCVA 3Q8PB 4B9SA 1BCPD 2HD3A 5CV4A 3WOFA 3LGJA 5KT6A 1GUSA 1UWVA 3EWAA 3FP9A 4ECSA 5C4ZA 3D8GA 4CHTB 4YFKA 2K50A 2K32A 3BS1A 1XJVA 2K5DA 1LLRD 5C0XG 1NJYA 4UB4A 4RT2A 3O13A 3B0YA 3WK6A 1ZQAA 4LUVA 1HNZL 1YJ9A 1SWWA 2ZJQA 1EQVA 4S3SA 3WK8A 4DK0A 2HDMA 3C2KA 2DPJA 1S5ED 5AKIA 1TK0A 1NJWA 5DB9A 5AKYA 5I6WA 1S72A 3HOVG 3D6JA 2E74C 9ICPA 1SYBA 2PZWA 4YCXA 1SKSA 1ZQDA 1FNVA 3HOWH 4UASA 4JK1C 1LT6D 3AYHB 3I4NG 5E7NA 3ERQA 1LVHA 2WP8J 5L1MA 3IAYA 4P4PA 2MGSA 1OTCA 4HCSA 5KFQA 2YN4A 5AM0A 1KFDA 1EYCA 3T13A 3CQZH 5F3XB 1Q1BA 3Q24A 1V97A 3HOUG 3ETRA 7ICLA 2CH4A 3R3OA 3STBD 2PMZC 3BZCA 4MFCA 4J1MA 5M5WB 4LF5Q 3WKDA 2JQOA 1B0XA 4DQIA 4GZYC 3PR5B 1A8VA 5DLQE 4C8MA 5EE1A 4J9SA 7ICKA 4DR1L 7ICVA 2MUTB 3A0BU 2A8VA 3I3CA 3CW2C 1UNSA 5COYA 2D9UA 8ICNA 1VQIA 4Q45A 4POGA 4AP9A 3CHBD 4B08A 4F87A 3FAHA 1PH7A 4PGQA 4ZKCB 4BBRG 5KT3A 1X3QA 5IE8A 3WDNA 2A1JA 3UDGA 4U68A 2NV3A 5ALPA 4UB1A 2PNRC 2F3WA 3M4YA 5I2XA 2Y0SC 8ICEA 1WTQA 2DY7A 3VR6A 2UVWA 3EJIA 5HP4A 1SMXA 4OGQC 1Y1VG 2Q2UA 4FYDA 1TWCB 1C0AA 3LX0A 1ZQ1C 1GXDC 1I4QA 4HYKA 1MHWC 4JBJA 4F4WA 4EBCA 1X65A 5I2YA 3DUZA 3QU7A 1JI7A 5DB6A 3KFUF 3TADA 3KLRA 1PVRA 1B9NA 2ZIVB 4BY7H 4O5CA 2EVBA 1K8GA 3TP8A 1R4QB 2C35B 4IOCA 3OJSA 3G4SA 1D5MC 2UVVA 4IPCA 2XRSD 2HBKA 2LM4A 2K03A 1K73C 4QCLA 3N7PD 2FPKA 4ED8A 2IJ0A 1EZ8A 3ZDAA 4M04A 2K4KA 2SDFA 2KHQA 2W04A 1Z4OA 4TUPA 1QWYA 1GJXA 2Y9UA 1FYCA 3U50C 1S40A 4JI6Q 2W9CA 1ZXTA 1Y1VB 2VB3X 2EAOA 1BNPA 5GTIU 4ME3A 1F77A 2VQEQ 1S5LU 3CRKC 4KKTA 3I90A 5EWGA 2VNUD 3S1QB 1L1OC 1UEAB 3C46A 3GU3A 4NWIA 2A1JB 3PY8A 4DV5Q 1KTQA 1JWUD 4A3EB 1CFMA 2GN5A 3RZOB 2I1QA 2ALYB 4K14A 5I4DA 5AHXA 3DHQA 1RKNA 2FDRA 3QE9Y 1VQPA 1N48A 1B4OA 5FLXE 1FVIA 3OHBA 3K1RB 2HOFA 4PZNA 2B2WA 2CWAA 3ND8A 4GKJQ 4WJ3B 1ESRA 5C5LA 4DF4A 1EWCA 4DA2A 1ZQRA 1A15A 1QVFA 2R18A 5ALTA 1U48A 2E8GA 4K8IA 4PMCA 5C44G 4DAVA 4AH6A 4DUYL 1SNDA 4EELA 3PMFA 4DF7A 5HY6A 2N1RA 2ESEA 4ACOA 5A0LA 4I2GA 5FLXc 2KHSA 2A6HD 4NMZA 4KMUC 3G6JB 1TS2A 1CA5A 3K7AH 5BN5A 4RQ4A 4A3MH 2RHFA 1H38A 1VQEA 3CCVA 2PW5A 2K8AA 3MGIA 4GLXA 3GP7A 1STHA 2E1EA 3I8ZA 2BA1A 2ZIXB 1DM0B 4RQ2A 1B43A 4X3UA 1X42A 4K2LA 3C2PA 4K4IA 2MPMA 2WFAA 4F4ZA 2JA7H 4B3RL 1JB7A 5J2BA 3OHXC 1ZQWA 1GUGA 4EEYA 2YV5A 2CH4W 1GO3E 2YTXA 2ZM6L 5J2HA 4A3IB 4LZDA 4RGOS 3UXPA 4Y7NB 2YMQA 3FMCA 4OXPA 1N9WA 3KDFB 4A3GG 1I3QB 2G07A 1H9JA 3HOXH 4RFBA 1O78A 3H3VH 1AFPA 1KNAA 3N52A 1I4XA 1FIQA 4DL6A 4A3DB 1AQ6A 1WFQA 2F77X 3J81L 2WF5A 2JP1A 5AIBA 2O4XA 2QILA 1O7YA 3E9HA 1HJPA 1KRPA 2V4RA 1KABA 2E2DC 2EANA 5EPKA 7ICHA 4GLVB 4IURA 5M5XB 4RWSC 1ZQCA 2LM1A 2Q8RE 1NK7A 4DR6Q 4RPZA 4Q0FA 1S5FD 5KG5A 2W9CB 3SK4A 3C28A 1HNZQ 1VMCA 4KKSA 4MF2A 5GQOA 4L5RC 5ALQA 3MGHA 4RH6A 5ALLA 1IBLQ 1RYSA 1VQFA 2A68C 2E8PA 3H7IA 1I94L 5EAYA 2B2UA 3MZ5A 4TQRA 4TRDA 1FFVA 3QIAA 1BCPF 5AM4A 4B3RQ 4OCZA 4UDUC 2BKEA 1V9PA 4KN7A 1LYLA 1VJ5A 4B3ML 1BBXC 3CNHA 4KN4C 2XIDA 3SAFA 8ICVA 4UB2A 5IY0A 4M9LA 3MBYA 4B9NA 5FO8B 5DDYA 1XMOL 4DSFA 4BY1B 1E1OA 1EZ6A 1WWVA 2QKIC 2V4DA 3KJPA 4U673 2BQRA 5KFFA 2CPRA 2F8KA 3PV0A 3RBEA 1KSPA 2I0QA 3CQZB 4LFCQ 1EXNA 2HBLA 1ZQOA 1TS4A 3T1YL 2UXCL 4ZYSA 2EAMA 4OJ5A 1ZQLA 4KLSA 4FF2A 3S15B 2WF9A 1AE3A 9ICFA 2HI0A 5M3FG 1MC8A 4Y2YA 3C2MA 4DCCA 1G8ZD 2PI5A 1I50B 3F53A 3NWTA 3SDZA 1WTPA 1E22A 4R63A 2GO7A 2H1EA 4FF3A 4JG2A 3SK5A 5ELEA 3SK6A 4F88A 5KL8B 4EENA 1ZQNA 2RDIA 4FE3A 1PZJD 1SXTA 4QUCA 2PFPA 1QB5D 2JGAA 3ZI4A 4TUQA 4QJFA 1PH1A 1PTOC 3ZDDA 2B3GA 2DN8A 4GNXA 3RZOH 5DBCA 4R4OA 3SENA 1QTMA 2OQKA 2PI2A 2TMPA 2ZT9C 3T56B 1KD1C 4YR2A 4X62Q 1N63A 3PF5A 2PI2E 3RH5A 5IT9L 5M5XH 4Y2QA 3PF4A 9ICIA 2WAQB 3KUPA 4FF1A 4EBDA 3UMBA 3I4MG 1XXGA 4B9WA 1TAQA 2AMCB 1YJWA 5M3FB 3K0YA 3NVYA 3OYYA 1JUDA 1Z6HA 4LMQD 1WTWA 5T1IA 4OO1J 3E0JA 1F9SA 5KAFU 2HHQA 4FXKC 2WB1G 1JN3A 1KTKA 4IFDG 2PFNA 1JWMD 1L2FA 2JEBI 4M9HA 5LL6S 2YMLA 2XVSA 2RDHA 1YHAA 1URJA 1ICFB 1JQYD 3LWEA 1XS9D 5EPLA 4C56C 1SDFA 4EQ5A 1XSPA 1KFSA 4OO1I 2DY8A 5ALYA 1K8OA 2NZOA 1ZYRC 7ICMA 5E3FA 3JAMc 5L1LA 4DKAC 4OONA 2OHFA 2N78A 4Y2VA 4YHHL 2BH2A 3HOWG 5J0QA 4A3LH 1N34L 5JRTA 5KTQA 4KLHA 4GC7A 2WACA 4NP5A 1VQ7A 1E2ZA 4LNQA 3V6JA 2UUBQ 3OTQA 3ZJYC 2CRXA 3HOZB 1C20A 4RNMA 2F0JA 4LVSA 2K28A 4UP8A 5HR6A 5CR3A 1UT5A 5JEAG 2IW3A 4CKEA 4R9WA 5D14A 4PZ6A 1N36L 3S15H 5ELBA 1PH5A 3IG8A 2K5HA 2Y1IA 3RLFA 4HIDA 4V190 3A5ZB 1IM4A 1ZQEA 1N8RC 1KQSA 4EQNA 3NRWA 1SIJA 3GZFA 5EE3A 3M7DA 3MFHA 1RL2A 4IS7A 3GTQB 3H0MB 3H0GB 2JEGA 5J8YA 4GOPC 5KFMA 4CDGA 5CORA 1CEZA 3TN2A 5EE0A 4Q5VA 3PO5A 5CMDA 7ICIA 3PIOA 7ICTA 3I76A 3MR2A 1HZ9A 3HPOA 1EQQA 1VQOA 5KG3A 5NUCA 2JXMB 2K01A 2ASDA 5C4JB 4YY3Q 4JI7L 2VA3A 1Z00B 2C2EA 1YHBA 5M3MB 1Q8KA 5C4XG 4QWEA 2E5SA 4JWNA 2E8OA 4GXIA 3P7JA 5KNDA 1Q86C 2JN4A 4EQOA 4IFDJ 1B1ZA 4DAPA 2FJ6A 2XI9A 1C7YA 3V96A 5LMUQ 2JA8H 3BJUA 2ALZA 4JI7Q 2R7ZG 4QZCA 4A93G 3ER0A 4RPXA 1Y14B 1AZQA 3OOCA 1ZQMA 4H44C 1MSHA 4HSVA 1KQQA 2RCNA 1MJCA 4C2MB 3D2NA 2EYOA 5LMNQ 2CVRA 3MWYW 4JI8Q 1XPUA 4DQRA 1JT8A 1IYVA 4PZOA 3DXJC 4G7HC 4UB8U 2Q4TA 3I73A 4EGVA 2WF8A 3A0JA 3CC7A 3QUTA 5AK4A 3F8TA 1J5EQ 3HOYG 2D2CC 3PUYA 4GN3B 1RTOA 5AKLA 1QNKA 9ICKA 4CDDC 2F44A 3H0GH 2OTJA 4P2HA 2ZTDA 3FDSA 2UXBL 5GAHC 4N9PA 4X5VA 4JC0A 5DLFA 2NVTH 4A93B 1F2YA 2HHHQ 4M47A 4Y2TA 4NLNA 1R4PB 4FXGC 2F0PA 3MABA 3S2DH 2YU9B 8ICSA 3NVZA 4KY5A 1KXLA 1LO5D 3KOOA 1L0YB 4A3EH 2EE1A 4KY6A 1JORA 3KDFA 4RGMA 4WJ3M 3GTQH 4YHHQ 4RUCA 2HHWA 1EYDA 2JA6G 4J6HA 4YG2A 1N5XA 4C1NK 1G291 4RCNA 3PVXA 5AI8A 3NVWA 2MJ8A 1YNJD 2UUCL 1TK8A 5M5WH 1IBMQ 5DEHA 1XMQQ 2BCVA 4ED2A 4QZAA 4Z6FA 4UAZA 4LUOA 1WD0A 2ZIXA 5LMNW 1STAA 3TZUA 3ONNA 2JMGA 1WTHA 4Y2JA 2SEBD 3ERSX 1KKXA 4C7ZA 4N9TA 2ZXPA 3SMVA 3MC0B 1VLBA 4DU9A 4O3QA 1X6OA 8ICYA 2KMDA 3VCBA 4P0PB 1L3VA 4PG3A 4L5TA 1Z00A 2V1CC 1SNCA 1HZAA 4UPAA 4OIKA 3S1MH 4LFBL 4IUVA 3J80c 5J29A 4K6LA 3PSTA 2F1HA 1KDHA 3CP0A 2QLTA 4RA8A 1F44A 2MSNA 2K4HA 1RTNA 1PK1B 2NRVA 3B0XA 4DR2L 3PUXA 1O08A 3SAGA 2AKWB 3R2IA 4F8RA 4DFMA 4J9KA 3A56A 1I6HB 3J80E 2R93G 2K60A 4JI4L 1EY8A 3CF5A 1CK1A 1SLJA 1PZID 3F2DA 1SE4A 1K8MA 1X2IA 1K0SA 3U9OA 2E75C 3T5LA 4LFCL 5JJKA 1ZETA 4DF8A 5J3BA 4ECTA 4F93B 3OMCA 2XVTA 3VDYA 4IFDH 2F3NA 1HZBA 4DLEA 3GQCA 4B9LA 1SYCA 2LKVA 3L0OA 5CP2A 4HJAA 4DV0Q 1MQ2A 1XNQQ 3V72A 3TQ1A 1Q1EA 2FMCA 2HBJA 1JC7A 1PVOA 1HNWL 1RF2D 4WJ4A 4CF4A 2F0OA 3ZDEA 1HA6A 3QO2A 5KFOA 3HRDD 1YVCA 1S9FA 5BR8Q 3PW4A 2ICEC 2P66A 5LL6X 3C21A 4DV3Q 1HR0L 2HHSA 4LF6Q 3QOLA 3TFRA 4OJPA 4N8FA 5KNBA 3TADC 2KKPA 4IRKA 4X65L 4F5NA 3RF9A 3S1RH 2N88A 1Q90A 1N32L 4I65A 4AYBF 1KL9A 3SV3A 2L1BA 1BPZA 1HFGA 3BVMA 4PV1C 3FKIB 2LXKA 3NK9A 1W2BA 4UQGA 4R4IA 4EEKA 1OW5A 4RQ0A 3HKZG 1S8OA 4MEXA 4F2SA 4O9MA 2OWOA 4RAUC 2LBOA 4ABNA 1OXVA 1TKDA 1N56A 2K7VA 2XWJB 4DR5Q 1DJRD 4IQUA 1N33Q 4US8A 1TQOA 3KLWA 5C44H 3HP6A 4J9PA 1Q46A 4GC6A 4G7ZC 2ZXOA 1SFOH 2KKVA 3BQ0A 1PFNA 2ZUBA 2AQ0A 3UMGA 2ZJ8A 4UHVA 3CYMA 2JEFA 1P8LA 4Q8FA 2WFWA 2ZM6Q 7ICUA 4K8JA 3K7UC 4PH5A 4NJ8A 4F72A 2BCOA 4OL7A 4JYAQ 2VQFQ 2R7FA 4GXKA 1TVXA 2EQSA 4DUZL 1KFTA 3TP7A 2D8CA 3TSSA 3H8JA 2EYPA 2HUGA 5FK9C 4K0KL 4H13C 5EQ0A 4HSPA 1TWAB 4O3PA 2W8KA 4NLCA 2Y0SF 4I2CA 1SN8A 5ALWA 3QOJA 1T3NA 3A7LA 3GTPH 3I72A 1SZHA 3KBBA 8ICFA 5GROA 2VA8A 3M1YA 2AUKA 1RDFA 2F52A 4DV6L 4Y2XA 3M4QA 1L8LA 1WI5A 5KT2A 2KUMA 3UDFA 1SNMA 2NZHA 2YB4A 2E2IB 2P6RA 3TREA 2Y0SB 3L2PA 2Q2IA 4FDBA 1WWUA 4JVZA 5FP0A 3C1EA 3FC4A 5KFTA 4KV6A 2FXQA 2A5HA 2H3IA 1FJGL 4R4TA 4L5QA 3C1ZA 3ICEA 4ED7A 1A6SA 1CKMA 4KHPL 4UBBA 5DBBA 3N4MB 5J0XA 5TSSA 1ZQYA 2E2JH 3QEAZ 8ICLA 4PL1A 3OMGA 1ZD4A 5AKHA 2E5LQ 1RYRA 2D0PA 1EYGA 4K4GA 3RLNA 1QQ6A 4MTNA 1KNEA 5CWRA 4KLIA 4QZIA 1NY4A 5KNCA 3KTQA 3P20A 3ETLA 3GQBA 4OD0A 3J81i 2LYAA 2WIIB 4ZKBB 2DGZA 2KEEA 2B63B 2E5LL 3MR6A 2AWOA 3MFIA 2EYFA 1VQ8A 3D6WA 4NXNQ 1TY0A 1PK1A 3AU2A 1YNNC 4JCVE 4O42A 4ZUIA 3PIP3 2PQEA 4Y2PA 3P1HA 3HX0A 1QE6A 2HMXA 1WJJA 1X3FA 5FKAC 1PH2A 2ATWA 1FJGQ 1TV9A 3MC1A 1SKWA 1UA0A 5CB1A 2MP1A 1PTOD 1FL0A 2KCMA 1VDVA 3LWLA 4LF4L 4A3DG 1VCIA 2F1IA 3H94A 2WB1C 4QZEA 5D49A 2V4QA 2O5IC 3MXNB 5EGTA 1JMCA 2ZIWB 4EBEA 1A3TA 2HHTA 1KAAA 3DEOA 3THVA 1C9OA 2JH1A 2I46A 3TAQA 3GILA 4J03A 2WKCA 3MXGA 3A5UA 1B3AA 1BO0A 4PQXA 1GUOA 1G6PA 2OQ0A 1NTGA 2QEXA 1NCVA 1UPHA 2KNJA 2KICA 4DR1Q 1TKWB 3BQ1A 2IX3A 4BWMA 3RZDB 1BGXT 3G6XA 5L1IA 4DSKA 1CUKA 3Q8KA 2YU9H 3C5GA 1HUOA 1ILQA 4C8NA 4DR3L 3ONAB 4LF5L 3ULLA 1AROP 3CRLC 4Q43A 4RHRA 5AJ3Q 4RQ5A 4YWKA 1HA5A 1SYDA 2K8BB 1QUQA 2EY6A 3RJJA 1UE6A 4LW1A 2BOSA 4DXFA 2VQFL 1QCBD 3OJUA 2HHUA 3HRZC 5HMLA 5KFDA 4IPHA 3HW8A 4B9VA 3V6KA 1TWFB 2HQLA 2ASJA 4BY1G 4GFJA 1Q82C 2QA4A 1EIYB 2KEDA 3L5KA 4MN3A 3BVZA 5CEHA 1PFBA 2F0TA 4GXJA 2IPKD 2A68D 2KHIA 1TK5A 4RQNA 1PTOF 1RYUA 4PJ0U 5CYUA 4HJ8A 1QVGA 2RF4A 1D9DA 1PH9A 4G3IA 1TT2A 2J6UA 1X6IA 1VQCA 3GTLB 2ZIWA 1T9HA 4EQPA 3AB9A 1Y1WH 5GAEC 4BBRH 4I2DA 2G9DA 1L1OB 2IWHA 4DWIA 3RJFA 2R92B 2K04A 3GIIA 1NJZA 2E2HB 1HEKA 1PTOB 1BUVT 4DS4A 1HH2P 4HIMA 3G6EA 1VS0A 2IBKA 2F0EA 3KHLA 4F4XA 4C4RA 4B9TA 1QOHA 5KYIA 1HR0W 2KIVA 2GLEA 2ZIVA 5CV5A 3NASA 3RB6A 1JICA 2XGTA 2MRLA 3IP4B 1BR9A 2HDOA 1Z47A 3E5SA 4JI2Q 3OTOL 2IX1A 4MNOA 1G2SA 5BR8L 4DSIA 9ICSA 1EY9A 2MA1A 2ZJRA 5JJLA 4UB3A 1Y8OB 2OT2A 2WF6A 4UAIA 1VQNA 3H0RB 1V8QA 1TWFH 5E4XA 4DFAA 3R9KA 2YQEA 4M6WB 2HVIA 4DFJA 1E24A 4QIWB 1M1KC 1X3PA 1RPLA 3RRHA 3GTKH 2KJ8A 5L1KA 2A74C 1UQVA 3A8IE 4B9UA 2R7ZH 2K6AA 2KD1A 3ZDCA 1UUPA 1BNZA 2LPEA 3GTKB 3E3XA 1SYGA 4UB5A 1VQMA 4FZLA 3GTGB 4KLJA 1IV8A 1K0RA 5KFUA 3S1MB 2UXDL 3OGUA 1J2NA 1PRTD 1X32A 2AGQA 4ELUA 4AYBC 4JI4Q 3ND9A 1T8EA 3A74A 5IIKA 1JWSD 4KHVA 2E8NA 2C2DA 1U9LA 3WKAA 3AMZA 5KFPA 2GWSA 2HOIA 1LTLA 4DV4Q 1PTOH 4A3EG 5L1JA 5DAUA 3VR2A 1FGBD 2W7OA 3T5HA 3VYRA 3TANA 2RVLA 2XCAA 3NEMA 4QQBX 1SV0A 3DV9A 2OEHA 2R93B 3M9NB 1VQDA 1Q8IA 5KFXA 1U4PA 2KBNA 3KZXA 1K28A 4ODGA 1C4QA 1MGSA 2DNEA 3EN2A 3ITPA 5BN3A 1MBYA 2LYHA 5EBDA 3CCMA 1H9KA 4ZOHC 3NXWA 3M7NA 1X9SA 5ALUA 5KFZA 3X3MA 3PO4A 1CTMA 1STNA 3K58A 3HOYH 2IY5B 4U7CA 3IG5A 3TMEA 3L4PA 3H6MA 2OXOA 4KHZA 2GVBA 3CD6A 3M8SA 1JR0D 1FEZA 3L3OC 5AI9A 1YT3A 5KFEA 3QZ7A 4I27A 2G5IB 4Y7NH 3T16A 3RBDA 3OWEB 2KG5A 3LVVA 2K75A 1JJGA 3TS0A 4ELVA 1EU3A 1XO1A 3C29A 1ZQJA 4I2FA 2QEJC 4ME5A 4AIMA 2UUAL 4OWWB 3I70A 3TEHB 1B50A 2XC9A 2NVYH 2B2VC 4DV2Q 4DN4M 2UUCQ 2KE7A 5KFCA 2BH8A 3UXNA 1EIFA 4A3IG 2VUMH 3J7AF 2KA7A 3SV4A 1CKNB 4YCUA 2FMSA 1STGA 4YMOA 4JV5Q 4BWGB 1NK9A 1V38A 3A0HU 4F71A 4LFAQ 2J6TA 3QG1A 1YBYA 2AU0A 4Z9CB 5HHHA 8ICBA 5DLGA 1IW7C 1FNWA 3W3AA 2RQ5A 4NW2A 5IIJA 1KAWA 3W1GA 1ZQVA 5IILA 4YCWA 3KJOA 1HNXQ 2CWPA 5IP9G 1S0MA 1X55A 4V0BA 1SXDA 3UM9A 3DWAA 4ECVA 9ICLA 2W03A 5IIMA 4A3MB 3PUVA 5HMMA 5EKLA 1PFSA 1UHUA 2ISPA 1QNUA 4YMMA 1P7DA 2EZZA 2FLNA 8ICQA 1X56A 5M3MH 3AM9A 2K4EA 3DDHA 3ICXA 5EPJA 2C22A 4JV2A 1KW4A 3OPXA 3AFPA 1F9PA 2EJMA 3STBC 4DEZA 5LMNL 4TUSA 4F7XA 1PHJA 5IT9c 1LB2B 4RKLA 4O0IA 2Q8TA 4JOIA 4AYBE 1N5WA 1SNPA 2N8NA 2WAQC 1XNRL 2RSOA 2RQXA 4USAA 4LJXA 4Y2SA 4K6DA 1MJEA 2QARA 4J9NA 5KFGA 5C0YA 2Z0SA 1CKNA 2BE5D 5JEAH 4YR3A 3MR5A 4J15A 4ZQ3A 1XNRQ 3CU7A 3GO5A 3K1ZA 2P5ZX 1QVCA 2ZJ5A 1L5UA 5H2FU 1U49A 1XSLA 2D0OA 1HQMC 4DR4Q 1E2VA 2B29A 4EX5A 1EOVA 2Q0ZX 3ZDBA 3PQIA 3AQEA 4C8LA 4OJOA 2Z4IA 1PVPA 1OXUA 2KCTA 3C23A 3N6RA 5AKXA 4NB3A 2Y1JA 2B8GA 4RZRA 5IYBH 3S1RB 2NVXH 3OW7A 4F3OA 2PPBC 2KHJA 5CA7A 3F2CA 2OXPA 4A3BB 2PMZF 1DOLA 1LT3D 3MDAA 4KTAA 5AJ3L 4IFDI 2HT1A 4RQ1A 1QQ5A 4WORA 1DGJA 2NVQB 5KT5A 1QSYA 1U4BA 5A35A 4RT3A 3KF8A 1DOMA 1KLNA 4DR7L 5G5GA 1J6QA 2Y0SE 3I4MH 3NE5B 1COKA 4GLAC 3CCRA 1RQLA 5J0PA 4FBUA 3S9WA 3K59A 2BQ3A 1K83H 2WAQG 4PL2A 1YNND 3K57A 2BGWA 3NS1A 1EL0A 4XQNA 2VJ4A 1FO4A 4LJZC 2G5HB 5EOZA 1TWAH 1WUDA 3EW9A 1LABA 5M3FH 1FNUA 3QEBZ 1SL1A 2B63G 3V7LA 4MEYA 4QMGA 2NN6I 4JPBW 3RD4A 1JROA 2NYZD 3TP6A 4KMOB 2XRQD 2OYYA 7ICQA 5EJWA 3PIPA 2KP7A 1XU4A 3HJEA 3UPQA 2KECA 3HOXG 1G6ZA 3NTIA 2LXJA 4A3GH 3M9MB 1RXVA 2DGYA 4DFKA 3NENA 2PMZE 5DM73 4DV7L 3HWTA 2FMQA 2NO5A 2BCQA 1JXEA 2N49A 4AQYQ 3RH4A 4C8KA 1E2WA 4CE6A 3GV5B 4GNXC 4KITB 1VQBA 2EZVA 3J80i 3QXGA 1HUNA 1NK8A 2XCPA 4O3NA 2NTSA 1TU2B 1ZKOA 3NTHA 3PUZA 5FJ8H 3RAQA 5IYCG 1O7ZA 3H15A 1VQKA 2UU9Q 3PO3H 3I56A 1GD7A 2AQ2B 3RN2A 4BGDA 5J0SA 4I7ZC 5C5MA 4KKUA 1MIUA 4UBCA 4KLOA 4GOPB 1NJXA 1B44D 4CGYB 4Z6CA 1WCLA 4OELB 4XQQA 1DGSA 5HNKA 2AQ4A 2Z7JA 1L8OA 1LACA 4XYOA 4LWCA 2P35A 1KIXA 4X64Q 4O5KA 5EKKA 3WWVA 3PSIA 3C1FA 2EDGA 4DAYB 2H3ZA 1GHKA 2KZ3A 1K83B 2F0IA 1WD1A 5HURA 5JVG3 3I4OA 3OPOA 1D7QA 3RJEA 2DWQA 4KD3A 4PPXA 2VW9A 2F4IA 3SHLA 3BQ2A 2FMPA 1LKYA 3BS7A 4HCEA 2HCFA 4DL2A 2D6FC 8ICJA 4E6IA 4NLBA 9ICOA 5G3LF 4OEMB 3J7YW 2F2AB 5KT7A 1PZKD 1HCZA 2EAPA 5KFNA 4WRDA 1U47A 1HXYD 3M9BA 1ZOLA 3PCOB 2Z6BA 1ZD5A 4NM1A 5D3IB 3TKAA 3AQQA 4X66Q 2F0VA 2QB0B 5J0WA 5BOMA 3MFYA 3LK9A 1SXEA 1XYIA 1IBKL 1PH3A 2BDUA 2WV6D 1RCVD 1L7OA 1J8IA 4FP5D 2JA8B 3Q8MA 5J22A 4I28A 4UAYA 2X6GA 3QR8A 4I7AA 1RJTA 1TY2A 2NVTB 1LM0A 3PW0A 4EYHB 1BPEA 4CGZA 1Z4NA 2H3FA 1SYEA 1H95A 3WKBA 4KN7C 3TFSA 1WCMH 1PK3A 3GIJA 1BOSA 1PLFA 1Y1VH 1D2BA 1C48A 4CF5A 2JYOA 4DL5A 4PMWA 4DR5L 3S1QH 5J2IA 4YMNA 5KG2A 1BBWA 1ZEQX 2E2JB 1ML0D 3N28A 3QZ8A 1KN5A 1ZQTA 3PSPA 3S2HB 3AEVA 4R4CA 1XC9A 5IIFA 1EWHA 3HGBA 1EEFD 4JI0Q 5JPNC 5EBCA 3E2EA 3KLSA 4RMFA 1BCPC 2EH9A 1DD2A 2YTYA 5ALVA 1CKOA 3R8BA 2JA9A 3H09A 4HAEA 1G2TA 1CRXA 4JB3A 1SGGA 1NKEA 2IHNA 2OCEA 5DDMA 2R93H 4R66A 4TURA 4KD4A 1X6JA 1ZD2P 3WK9A 3T3FA 1SYFA 1PVQA 1I5FA 4DV3L 4DR3Q 1HR0Q 1PXUA 3RAXA 4DPGA 1PDQA 3K7AB 2KSOB 1LV9A 1U4RA 3LNNA 1DXSA 2JEIA 1HFNA 1WTOA 3PO3G 3S16H 3L9AX 1Q7YC 1VQHA 3QUQA 2EXZA 3M85A 2HIVA 2OF1A 3MAQA 4Q8EA 5ALSA 2BR0A 4DSLA 3EFXD 2PQAA 3BU2A 4QIWC 3KBGA 1STYA 2JEJA 2CFMA 3HOVH 2BPCA 2QCPX 1C8CA 4R8UB 5DQHA 1VMPA 1WYGA 3BS5A 4P4OA 8ICMA 4BY7G 4HIOA 1CI3M 2ZUCA 1M6YA 4FS2A 3GV7B 1KDBA 4BX9C 4ZCKA 3NUQA 1VQJA 2DF4B 5ALXA 3HOWB 2KCNA 5ALDA 4QJFB 3UDIA 1S97A 2B2VA 2MQHA 3JPTA 1CT1D 2BA0A 3CCJA 4DV5L 3GTOH 1ZQBA 4K5WA 2IOFK 1ZQHA 7ICEA 4YXMA 1E7ZA 4ICAA 4ED0A 2F0QA 3BVGA 3M7GA 2JSOA 2IMWP 1DOQA 1LUZA 2VQEL 5DG9A 2C9OA 3GTMH 4R1JA 4LFBQ 3N7SC 2G5DA 2L15A 3JPSA 5KFLA 1BPXA 4DAMA 2WF7A 3JPRA 3CPFA 2BPGA 1F0MA 3VYUA 4PGYA 4KLFA 2Z8LA 3AL0B 4FZMA 1JJCB 2AWNA 5KAIU 2QW7A 4DV7Q 4R65A 4OWXB 5AKKA 3H0GG 4LAAA 2K4IA 5AM2A 4ECYA 1SE3A 2K5VA 3H8MA 1TFRA 2EIFA 1MA7A 1TWGH 3NRZA 3TZDA 4A3JG 3K5OA 1VQLA 3URYA 2JA6B 5DB7A 4CRXA 5DQIA 2K5WA 5AM1A 1XMQL 4JBMA 5ALIA 3OIQA 5HGTA 3BS5B 2NN6G 1COOA 4DV6Q 4ALPA 1KRSA 1XNSA 1GOZA 5B66U 5EWFA 3QB3A 4FZNA 4QW9A 1Z1VA 2ZTEA 4KN4A 1ZQSA 1RQNA 2KJ5A 4XDXA 1BKBA 3B9JA 5DGBA 3I4NH 4RHSA 1CSQA 1TWCH 4UARA 2PO4A 3QU4A 5J0YA 1B22A 3T5KA 2LI6A 5I9PA 1X54A 3EPIA 2AXTU 5AK6A 4EX6A 2YB1A 4IQVA 1CQFA 1Y8NB 3ORYA 3B6YA 3FM9A 2UXBQ 4F5QA 4MHEA 4A3JB 4JYAL 3GV3A 1KEJA 1I6HH 1JE5A 3I7FA 3EYZA 3SI8A 5KEEA 4FO2A 1DCZA 2WAQF 3NPPA 4B9MA 2D5DA 5JEAJ 1JMSA 3FYHA 4Z6EA 2B2YA 4UP9A 3VA5A 1PH8A 1SAPA 1U4MA 1YHQA 4A76A 1Z7TA 4YWMA 4JI8L 4IZ8A 2IL8A 2Z4HA 2PZUA 3Q22A 3TRZA 3TDQA 2EY2A 2F0MA 1ZQKA 1LKYB 1NK0A 4KLUA 2B63H 1UE1A 2JA6H 1CHPD 4I2JA 5ALMA 3PW2A 3LWMA 1CZWA 1MSGA 4DQPA 2K1BA 1QH9A 2LHTA 1N32Q 5D4BA 5JJIA 3PSFA 2VUMG 3CCSA 3WK4A 5AKJA 3QU5A 1W3SA 1SSOA 5IP7H 2F76X 3H8WA 1S77D 2VY3A 4R8NA 5KFJA 4EZ6A 2FHTA 4OX9L 5T1GA 3M4PA 2BCSA 1EYAA 4UY8C 2WAQE 4C3HB 2L5YA 1FR3A 4UB6U 4QNLA 2KZZA 2XSCA 1VQ9A 5IGGA 3HOUH 4QZFA 4FFDA 2F0WA 3NVVA 1MD2D 5ALZA 1IHZA 1S3OA 1NJIC 1SV4A 8ICUA 2HBMA 4ZH4A 3A54A 4DLGA 2GVAA 4DSJA 1K5OA 4LF8L 4P0PA 5J0OA 1N2XA 4C4SA 2J0TD 3L3FX 4RG1A 2PFOA 1HNXL 1YITA 1HUMA 2R8HA 4YXJA 4JV5L 4GIBA 3V7JA 2CHBD 3HKZC 5C5JA 1CZGA 2EOTA 1F2MA 1VDZA 4MF8A 2RCFA 4JI1L 7ICGA 2QGQA 1SJHD 4XRHA 3RR8A 1NAPA 1L7PA 1K1QA 4X3TA 1L3UA 2R8GA 1RODA 3S2DB 4RKBA 4C8OA 1JXLA 2RDGA 3CCQA 1K9MC 5FLMG 2K5QA 2A3VA 3DLLA 2AUJD 2NRXA 2Z6KA 1SRUA 3VC8A 4F92B 3KF8B 1QZGA 4CJ1B 2VIXA 2ZUDA 1ZJMA 2FINB 3MXNA 3D3RA 3G6YA 5C44B 4LF9Q 3S16B 3SK8A 1XPRA 4JI3Q 1D1KA 1OUQA 3SD7A 2A6ED 3J81E 3UQ0A 1ZQXA 2XY6A 2ZXHA 4OHJA 4Y52H 3HKZE 8ICKA 3EZ5A 5JUMA 3VYSA 4C3HH 2W3RA 2HHXA 2ZXIA 3D31A 1NNLA 1T5EA 1NSNS 4I2EA 4US9A 1WCMB 1Q3LA 3U9SA 1CSPA 4DQSA 1QCKA 4NLZA 9ICVA 5DM63 4IUQA 1XO0A 4O5EA 2G9HD 1G91A 5DG7A 3KYHC 8ICPA 4KLMA 1V1OA 1WCNA 4YVZA 1T4GA 2E1FA 5GADC 2M2LA 4TVAB 3KD3A 2W9MA 1II3A 4A3GB 4Z6DA 2HW3A 2LSSA 5J8YC 2CXYA 4P75A 5A2QL 3K5NA 2VXWA 4A75A 2PI4A 3NHHA 1A76A 2RA4A 5ELNA 3RR7A 2UVRA 2D3DA 4DV4L 2ES6A 1L6NA 1PMRA 3R93A 1Q81C 1Y1WG 3HKSA 4GN5A 1QG7A 4XTCS 2KTQA 5KFKA 2KN7A 1ZQUA 3K0XA 4KLLA 1D1IA 4YIJA 4CJ2C 2UXDQ 2KCCA 1KC8C 2LYBA 4Q44A 4KTQA 3UXOA 2E3TA 3H40A 1X3EA 2NTTA 3S17H 2UXCQ 3WU2U 2SOBA 4QWBA 1D6EC 3VR4A 8ICCA 1B3QA 4DAYA 3M4OH 5KG4A 1WTVA 3Q8DA 2VL6A 2I07B 3PO2G 2F4VQ 1XMOQ 1Z3EB 5KG6A 1KHIA 1V1PA 3UE0A 3OWFA 3D0FA 3PGZA 3I4MB 2HVHA 2L12A 4A3BG 2FI1A 4XT1B 2VB2X 3DM1A 3NSWA 2ES2A 4HAIA 1OO9B 1Y1WB 5ELCA 5KFIA 1FGUA 3UDXA 2WTFA 4DQQA 3AUOA 1OXTA 3AQFA 3OTOQ 4A3FB 4OX9Q 1GM5A 2R92H 2H3VA 4X3KA 1CI4A 2ICIA 3D2SA 5LMUL 1J9OA 2HCIA 2JA7G 4PZ7A 5DQGA 1A0IA 2ZIUA 4CDEC 4C3IH 2R7ZB 2TSSA 3JAME 4MFAA 2EXDA 4IRDA 5C0XJ 4GKKL 5AI0A 3M9OB 4E0DA 1WTRA 2DJGC 5J0TA 3D6CA 4MFFA 2B8FA