2ZU6B

Crystal structure of the eif4a-pdcd4 complex
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
288
structure length
284
Chain Sequence
AFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the eIF4A-PDCD4 complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Eukaryotic initiation factor 4A-I
total genus 96
structure length 284
sequence length 288
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2zu6B02
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2zu6B01
1N54A 2VSXE 3JUIA 4B89A 1H2VC 2FULA 2KZTA 2GGFA 4B8AA 2IOLA 2RG8A 4GMJA 1HU3A 1H2TC 2KZTB 2IOSA 3L6AA 1PAQA 4JHKA 3EIJA 4CT4A 4B8CB 4GMLA 1UW4B 1N52A 2I2OA 1H6KA 5ANRA 1H2UA 4C9BB 2IONA 3FEXA 4JHJA 2IU1A 1UG3A 2ZU6B 3EIQC 4LUNU 3RK6A 3D3MA 3FEYA 2NSZA 4IULA 2VSOE 2HM8A 4CRWA 4CEMA
chains in the Genus database with same CATH superfamily
3UI2A 1DCEA 4PS8A 2WXJA 5FJYA 4XKCA 3SFXA 1SA5A 4WWPA 4JHKA 3S7BA 3FTZA 1Q2ZA 2AW6A 1UW4B 2IO2C 2RKKA 1JWFA 3T8KA 2YHEA 3C3QA 3CIAA 4BSZB 4MRUA 4N3CA 3MKRA 5J08A 3TWQA 4K5CA 4HRNA 3KD7A 1H2VC 1HXIA 4GYYA 4HNAD 3V2OA 2WXOA 4KYOB 3L54A 3HXDA 2A5UA 4BWRA 3CKBA 4A55A 1NP7A 5KBAA 3EHNA 4J8SA 5FZSA 4C48B 3UTMA 3FP3A 2V5FA 1FT1A 2R05A 1HF8A 2VSXE 1HFAA 3O4ZA 3PZ1A 2OVBA 3SD5A 5KCMA 3B7UX 5G55A 1U3CA 2PL2A 2I6HA 3CVNA 1OWLA 2WXRA 2I2OA 1TN8A 4XX5A 1XGWA 4ABNA 3IXEA 4FP7A 5LCWJ 3QC1A 5EX3A 2GRRB 4U8VD 2M63A 3EHQA 3NZUA 3ONKA 4JVSA 3UT7A 3LJNA 3G2UA 1OCCE 4DI3A 3B7RL 4G25A 1INZA 2P9UG 4HOQA 2V4HC 3IEGA 2OVFA 4DX7D 2AXUA 4CCAA 1O1SA 5AARA 4H7XA 2J08A 3PEVB 2H6HA 3ABME 4Z68A 3NQPA 2IOSA 1UOHA 4U0ZA 4APFA 1RW2A 5HI7A 3ML9A 3I4GA 3QK0A 4DPRA 2CHXA 3PH0C 2NC9A 2XPZA 3L82A 1MHQA 4F53A 5CBOA 4HI8A 5LP0A 4PDXA 2CG3A 3TXMA 3TXNA 5JHBA 3NAWA 4APOA 4M7CA 3JXIA 3DXMG 4BX9A 1GW6A 4GZ6A 4BEPA 4DLQA 4G23A 5FINA 3VLDA 4CGVA 1P5QA 3QWWA 3BUAA 3JXJA 5D2MC 2WQHA 2JEKA 4L9PA 4JZYA 4RQIA 3DPYA 3IBEA 5CEAA 1NI1A 3TG4A 4CGWA 4L2LA 3UPVA 2WXKA 2IFUA 2ETCA 1S0PA 5KJKA 2PZIA 1TR4A 1UG3A 2L0IA 5ENRD 4CRWA 3PZ2A 4GYWA 4KZ0A 4CEMA 4B93B 3ZXSA 4YVOA 2OEWA 3DSWA 1JCSA 3VLEA 3LJ3A 2X3MA 4PH4B 2DVWA 5EYLA 3PREA 5EDSA 4XI9A 4LNBA 4AEZC 3Q4AB 2QZAA 4GTOA 3KS2A 2MRIA 3MA5A 3QDNA 5AQ9A 1A5EA 3ASDA 4FHJA 3QJZA 4O6FA 2A5EA 2DZOA 4W9RA 3EU9A 3C3RA 5HQ8A 2XPYA 4OYSA 4GZ5A 1N94A 1O1TA 1Z3YA 4HOSA 5FQ8A 3R7QA 4AM9A 4L1BA 1HH8A 4ANWA 3B13A 4JHJA 3FUMA 2VGXA 2XRYA 1XNFA 3D9MA 5EYPF 4TUMA 4BY6A 4AOFA 2X38A 2WXPA 3ZYMA 4I2ZA 4C0MA 4ZHBA 4LERA 3DSVA 4HOTA 3ZPJA 5BUZA 5ENOD 4BSXA 4YDWA 3SO8A 3V30A 2V4LA 3CSTA 3PZ3A 2R03A 4LCTA 5JJTA 3SGHA 1KLXA 3DEPA 1JUQA 3HYMB 5B1BE 3UIOC 3ASGA 5CBNA 2FULA 1N9AA 3E34A 5AIJA 5KJLA 3U64A 4L23A 2LSUA 4U04A 3PNLB 1WG0A 4BFRA 3Q73A 4L7TA 5FTPA 4I6GA 2GGFA 2DYRE 4HORA 3FTWA 1N4SA 2KCVA 4NQ0A 1WY6A 4E85A 3ABLE 1ZB1A 4F1SA 2IJGX 4X8QA 3SNXA 5JJ6A 3GZ1A 4ME2A 3PUJA 5HKPA 4I9EA 1KZOA 3QB2A 2P9KG 2XZDG 2R2LA 4O1PA 4UQZA 1SQMA 2Y1LE 3E30A 3QAQA 1FT2A 1H2TC 4CDRA 1TNUA 4IYPA 4R7LA 3UM1A 2XQ0A 3W9GA 5ENTD 4MLPA 4Q94A 4JXTA 2Q7FA 4EBAA 2WPVA 2IOLA 3E37A 3RSEG 2CHWA 2WQ7A 3CVWA 3EDTB 3CSFA 3HXEA 1OWMA 4B8CB 2L0TB 1H6KA 1FPPA 4EQFA 4JB8P 4ACLA 2HR2A 4TRQA 4EZLA 3IHVA 3LVQE 2BKKB 1EDUA 3FH5A 2P9IG 3OTNA 2MYOA 1E8ZA 3BU8A 5JJ7A 2F0YA 1BLXB 1E8XA 4UQXA 2KBXA 4Q69A 3NOCD 3ESLA 3Q5MA 3P2BA 4U8YD 2WXLA 3PZDA 1O5MA 5D0OD 4U95D 3V79K 3ONLA 4DX5D 1TYQG 1S64A 4JA9A 3UUXA 2I1JA 4GPMA 3JQ0A 2EQXA 4URKA 5BT1A 4U8HA 3Q49B 4DI4A 3UIPC 1HE8A 5T4YA 3CVVA 4HBDA 4YDYA 3Q75A 1HX8A 3J5QB 4JW1A 1QNFA 2LXLA 4XI0A 3TWSA 4JPSA 3I3NA 3FEXA 2WVIA 3LVRE 4EBAG 4U7EB 2VGXB 2J07A 3LPZA 2J4BA 3FULA 5FZQA 1QBQA 2GRQB 5CRUA 4I1OB 4KXKB 5CECB 1NL4A 3OXGA 1MX2A 1NFIE 3EJNA 3FUHA 3LCAA 4RLYA 2IF4A 4NRHB 4HB5A 3GZ2A 4M3OA 3P1UA 4A3VA 5BNWA 3FHEA 4G26A 3QWPA 1N52A 4GA1A 2HE0A 4F7AA 2B6CA 3Q7FA 2RD0A 3QKYA 5CEDB 3JUIA 3ZNGA 2EILE 4G11A 1G3NB 4UI9J 2RFAA 5E75A 2CHZA 4F1PA 5E76A 3Q9NC 1IYGA 2GRLA 3JCKC 4WWOA 1MJ0A 4N2QA 3FU6A 3SY2A 5JHAA 1TN7A 4UUCA 2WQ6A 5T3RA 3QOUA 3KSQA 4JA7A 1NA0A 3ML8A 3OXFA 1HS6A 3RKVA 2UWJG 4ATGA 4V3IA 3D9JA 3APDA 3Q78A 2ZGGA 2XCBA 2PM6A 3CHSA 1E8YA 3DXKG 4CDNA 2QC9A 2R02A 3CQCB 3L13A 4A3TA 4CZ2D 2XGMA 4ILGA 3NZSA 4B89A 4BT8A 1X81A 4GTPA 5BXOA 1HO8A 1YA0A 4FULA 4PUCA 3L08A 3K9IA 3PDNA 3RJVA 5AJLA 4FLBA 4UWLA 2ZU6B 3FEYA 2ILRA 4BESA 3BG1B 3FUDA 5M72A 3SF4A 3AG3E 3FTUA 2F8XK 4K03A 4LEUA 4MS6A 4HQDA 4XKBA 1V54E 3ESKA 2H6GA 2Y4TA 4PS7A 5ITZF 3HG0D 3MYVA 3PE4A 3L16A 3Q47B 3CHPA 3SFZA 1OCOE 1NZNA 4G24A 1VDYA 1IHGA 2XS8A 3ZU7B 2ONDA 3VTXA 2WXQA 4WNGA 4HRMB 2XPIA 3VLFA 3FFLA 1K1AA 2LO6A 4O1OA 2VTBA 3HXFA 4HLEA 3SI5A 3G2VA 4JD2G 3LEWA 4TXPA 4GA0A 1WDYA 3CK9A 3QARA 3MV3B 5KJMA 2DIWA 2B0OE 3TJPA 4UWGA 3ZEFA 2OEVA 1OCZE 2WMNA 3BEEA 2BUGA 4ACKA 2KM4A 1MZCA 4ILIA 2LXMA 4DX1A 2X6IA 2Y0BG 5CCMA 1RZ4A 3MKQB 5J90A 5AQAA 2NXPA 1SA4A 1TNOA 3SBSA 4O60A 2VSOE 3ZHEA 1NA3A 1K3ZD 1DVPA 3FH8A 4Y6CA 3CVPA 5LX8A 4WNEA 5HS0A 2FEZA 3SFYA 3R9AB 3D9OA 4RSYA 3CHRA 1LF8A 2WXGA 4F3VA 2DZNA 3D9KA 4LG6A 4ATZD 4N5CA 1LD7A 3X2QE 3B95A 3CK7A 4KZCA 2EIJE 2WXHA 2GRMA 3OXLA 3B7SA 3PEUB 3ASOE 4CYMD 3URZA 1IXVA 2P58C 3UM0A 3C98A 2UY1B 3HHMA 5ARGA 2XCCA 2IONA 3L22A 2CFZA 4N3AA 4DX6D 1OWPA 2AWIA 3DSSA 3GW4A 2J4DA 4N5QA 4Q96A 3DBSA 2PM7A 1WAO1 1N11A 5IY5E 5CERB 1AWCB 4FJZA 3DPDA 2VSYA 3QNKA 3O48A 2HYZA 1HG2A 5D0QD 2GRPB 1SVXA 4LSZE 3EUVA 2IU1A 3LY9A 4AY6A 3I5PA 4HI9A 1ELKA 3ZHEB 3C72A 4FHKA 3F6QA 2FF4A 1D9SA 4BTBA 1JPLA 3ABKE 5ENSD 1ELWA 3V2XA 2FO7A 3ASNE 5ENNA 1PC2A 4WNFA 1JCRA 2P9LG 4FADA 5CRVA 1N0RA 2PQNA 1OY3D 1E8WA 3ULQA 5FT9A 2EIKE 2DCPA 2XENA 3CV0A 2VTBB 2KCLA 1TNYA 4AP2A 3Q79A 5CCLA 3ASFA 3ENEA 1FCHA 5A7DB 2R5SA 3RRNB 3CVLA 4LNGA 3KEZA 2L9BA 4BX8A 1FVHA 1YYHA 3MZLB 4WNDA 1EYHA 3FTXA 4GPKA 5JA4D 4BERA 3DWLG 4UWFA 3BQOA 4YNDA 4H7YA 1UN9A 3W9FA 3G2WA 2JABA 3SQVA 4ANVA 4ZFHA 2VQ2A 3ULYA 3MEKA 1OUVA 2GW1A 2YINA 4XEIG 4KBQA 4GTSA 2GROB 3GYZA 3D3MA 3APCA 2CG2A 2ETBA 2HM8A 4AIFA 5KWDA 1QQEA 2IEJA 3L17A 3DSTA 2BEDA 2IQCA 3UMVA 4P29A 4K5BA 3ZGQA 2PQRA 2FBNA 3EHMA 2L6JA 3HXBA 3HRAA 3Q15A 2YNQA 3FTYA 1BI8B 2GRNB 2DBAA 2I9CA 5ENPD 3AU4A 4U63A 5ARFA 4I9CA 2XEVA 3J5PA 3SBTB 3ZYKA 2R59A 4UQYA 2VSNA 2H6IA 3FUIA 3LDZA 4LUNU 4GB9A 5LFAA 4OAVB 4E6HA 2C2LA 4AY5A 2J9QA 2YQ8A 1W3BA 3UKRG 2V5QC 3FY4A 3R9MA 3TWRA 2X6JA 4CDMA 1N4PA 4GCOA 3TWWA 4GU5A 2ZXWE 3C3OA 3D9PA 4GMRA 3G2TA 1QZ2A 5EKQD 3UINC 4U0SA 5G04J 4TXQA 3IHYA 1DCQA 3AJIA 4IN3B 4J0UA 5G05J 5JMND 2EINE 4WUYA 4FC8A 3D9IA 2XZTG 3ZXPA 4XIFA 4YVQC 2HO1A 3FUJA 5G2NA 4AV7A 3FUFA 5B3SE 3FUEA 3B7TA 1D8DA 1FVFA 4B0ZA 4HFGA 2H6FA 1HZ4A 4TV3A 3FU0A 3EU5A 1TN6A 4J6IA 1KT0A 3LKUA 2LNIA 4HS2A 1K8KG 4J8FA 1ZBPA 3ZVVA 2RG8A 4DK5A 2LSVA 4GZDA 4UI9C 3PE3A 3PVLA 1AP7A 4OVVA 2IY0C 1E90A 3T5VA 3FDHA 4MKTA 1Z5SC 3CGHA 4KT6B 4QFVA 3I4RB 2J49A 5LOZA 4B8AA 3U4TA 3RO2A 2ETAA 1OCRE 4NIKA 4QQIA 2QFCA 3PNTB 4NACA 1ELRA 4G1TA 3DSXA 4GTMA 2ZIRA 4PS3A 5KNGA 2AJAA 1Z3XA 3D9NA 4J8DA 5AQBA 4I43A 5BXUA 4I17A 4JC8A 2XS1A 3AG4E 4UWKA 3DEOA 3TG5A 4GTQA 3S7JA 2DWZA 5T8IA 5BV0A 3DRAA 4AXHA 2KZTA 3LYAA 1K1BA 3SHFA 5BPPA 4AVXA 3L6AA 4EHMA 3AAAC 3KSLA 5AN8A 4CT4A 2A4ZA 3ASHA 4G8KA 4C0EA 1A17A 3HVEB 1DNPA 3RRMB 3U9WA 4BETA 1S70B 1JWGA 1TNZA 4BTAA 3PZ4A 3UT4A 4N3BA 2MHKA 1ZU2A 3CEQA 1TEZA 4HXIA 1IQUA 3UM2A 4WAFA 3L9TA 5CMYA 3Q9UC 2KXPC 3EIJA 4Y6WA 3PS6A 3FUKA 5BW8C 5FQ4A 1KPSB 4OVUA 5FQ7A 4G8LA 5C1DA 2VYIA 4DLOA 5BV1A 5DIZA 4GTVA 4UWHA 1E96B 2Y3AA 4I6JA 1OWOA 3D9LA 3UM3A 2YHCA 4JEUA 3RRUA 2IO3C 4MBGA 4GZ3A 2XHEA 3WXXA 3HIZA 4RVBA 2P2CP 3PUKA 3ISMC 3APFA 4XE0A 1E7UA 1H6OA 4K5AB 1HG5A 1MQSA 2WMOA 4EECA 3KEAA 3RU0A 3CVXA 2BKGA 3U66A 3FH7A 1MX6A 2LAHA 5EX0A 4XZ4A 3TWTA 4EZKA 2WM9A 3FWVA 2V0PA 2OV8A 3UXGA 1YCSB 3NF1A 3EHRA 4FU3A 3LY8A 1Y6IA 1H0AA 4I1AA 4GYOA 3T5XA 2OCCE 3HDXA 3CLJA 3CR3A 1JCQA 3IKOB 2P9PG 1PAQA 2J09A 1SW6A 4GZCA 4BT9A 3MX3A 4JHRA 1N95A 5EIDA 4FJYA 1PY1A 3JYSA 2KATA 4IRUA 2NSZA 4YDEA 4RG6A 2X6HA 2OOEA 5A6CA 5FQ6A 4FA6A 2PNNA 4EPZA 1O1RA 3CHOA 3IV0A 5AENA 2X6KA 3S7DA 4DJAA 3UKUG 3AS4A 1UJKA 3TAXA 3RK6A 3B7BA 4F6RD 4HRLA 3D9HA 3RAUA 5HRYA 1SZAA 4GCNA 1X5BA 3JQ1A 4DRXE 3E4BA 3TWVA 5CMWA 1UJJA 2X6FA 1OWNA 5ENQD 4JL0A 3HVEA 3CK8A 1OT8A 2J8SD 5EILA 4WWNA 2CFUA 1OXJA 3HXCA 1Z6TA 4U96D 2VGEA 2LAIA 4JEHA 3SZ7A 3UT8A 4GTRA 3ZW3A 3U3WA 1U2VG 1EPUA 4HLLA 1BI7B 1U3DA 4IULA 3NOGD 5AYWD 1N0QA 4I6EA 3LY7A 3LXUX 4N39A 3ZUVB 3G2SA 3UQ3A 2NYJA 4B94A 2I1KA 3TGOA 5FIOA 3NBNB 1D8EA 1V55E 3EIQC 1DC2A 3UX4A 3Q7AA 4I2WA 1YMPA 4DX2A 1BD8A 5KNHD 3N71A 4ANUA 1QYMA 5FWQA 3AG2E 3RO3A 4ANXA 2R17C 3AU5A 5H7PA 3CHMA 4KVMA 4A63B 2MOWA 2E0IA 4GTTA 2JLBA 3S7FA 3MCXA 3FTVA 4GAAA 4UI9K 5KJNA 2L6BA 3ZYQA 3VTYA 2WXIA 3CQGB 2AXVA 2Y69E 2WXMA 5AJDA 1EF1C 1WM5A 2BTDA 4YDOA 3ZN3A 2C0MA 2LUHA 5EIBE 1H6PA 2P9SG 1IHBA 1MYOA 5G04C 3FUNA 4D10C 3MKQA 2QYUA 3OAWA 3V31A 2ZISA 3ZYLA 2RFMA 3CVQA 3T8MA 2VJ8A 3DSUA 3BG0B 2XEEA 5ANLA 3MV2B 3CVUA 2VGYA 1BU9A 1BPOA 2XRZA 2P9NG 3FU5A 4KMOA 3R7RA 2F8YA 2DYSE 3PRZA 3ZRHA 1N4RA 1L5JA 2KCKA 3AS5A 2WXNA 3LS8A 4A1SA 1TJFA 5LCWC 4G2VA 1Y8MA 3MGBA 3T9KA 3ULEG 1N54A 3RIBA 3MJWA 1HU3A 4LNUD 5C2YA 3TL5A 3QWVA 1IQRA 3KAEA 4GMLA 2AVPA 4J7WA 4HVBA 3E32A 3GZSA 5AAOA 3AG1E 3ZFWA 5FZRA 2KC7A 2C0LA 2F37A 3ZKJA 5EN5D 4U07A 4TUUA 1MX4A 4I1MA 4RG9A 3JUEA 1N4QA 3TWXA 2WB2A 4N2SA 4AJWA 4CT0A 5G05C 4C9BB 1UN8A 4EZJA 1KZPA 4J8EA 1B89A 4NURA 2Y4UA 4GMJA 2XGSA 4U0UA 3CVYA 2UY1A 1KT1A 4J8YA 4FLHA 2BF0X 3NB2A 1SZ9A 5DBKA 5AQ7A 3FU3A 2XEHA 1H2UA 3AS8A 3S2AA 1LD8A 2QYJA 1E7VA 4L2YA 4DUIA 2FO1E 2ZGDA 2V8SE 1IKND 2KZTB 2QY7A 5A23A 5D66A 2E2EA 5B1AE 5ANRA 4TXRA 1LTXA 4K0RA 2XGOA 4ILHB 3WG7E 3CKCA 2AXZA 1TNBA 4OAUC 3C5RA 2WXFA 4LRZA 2FI7A 4A1GA 5CHEE 1S63A 2EIME 3E33A 3FTSA 4HOUA 4KVOA 1TJCA 1H19A 3CHQA 3TWUA 4GA2A 3ZIMA
chains in the Genus database with same CATH topology
3ESLA 5EX0A 3Q5MA 4PS8A 3P2BA 2WXJA 5FJYA 4XKCA 4XZ4A 2DCPA 4EZKA 2WM9A 2WXLA 3CV0A 2VTBB 3PZDA 3FWVA 2V0PA 2KCLA 4WWPA 4JHKA 2OV8A 3S7BA 3FTZA 5D0OD 4AP2A 2AW6A 3ONLA 1UW4B 3NF1A 5CCLA 4FU3A 3ASFA 1JWFA 3ENEA 1Y6IA 3LY8A 2YHEA 1H0AA 4I1AA 4JA9A 3UUXA 3CIAA 4GYOA 3T5XA 1FCHA 4MRUA 2I1JA 5A7DB 4N3CA 3MKRA 2R5SA 3HDXA 3CVLA 3RRNB 5J08A 3KEZA 2L9BA 3JQ0A 3CLJA 3CR3A 3KD7A 2EQXA 1H2VC 4BX8A 4URKA 5BT1A 4U8HA 1HXIA 3Q49B 1FVHA 4DI4A 4GYYA 3IKOB 1HE8A 2WXOA 3MZLB 5T4YA 3CVVA 1PAQA 4WNDA 2J09A 1HX8A 4KYOB 3L54A 1EYHA 4JW1A 4GZCA 1QNFA 2A5UA 4XI0A 3FTXA 4BT9A 3CKBA 4A55A 4BWRA 4GPKA 1NP7A 3MX3A 4JHRA 3EHNA 3I3NA 3FEXA 4J8SA 4JPSA 5FZSA 4FJYA 1PY1A 3JYSA 2KATA 3FP3A 2WVIA 4IRUA 2NSZA 3LVRE 2V5FA 4EBAG 4UWFA 1HF8A 2VGXB 2J07A 2VSXE 4RG6A 4YNDA 2X6HA 1HFAA 3O4ZA 2OVBA 1UN9A 4H7YA 3G2WA 5KCMA 3SD5A 2OOEA 3B7UX 3LPZA 2J4BA 3FULA 5FZQA 5A6CA 5FQ6A 5G55A 4FA6A 1U3CA 2PL2A 4EPZA 2I6HA 4ANVA 3CVNA 3CHOA 1OWLA 3IV0A 2VQ2A 4I1OB 2X6KA 3S7DA 5AENA 2WXRA 2I2OA 3MEKA 4KXKB 4XX5A 1OUVA 4DJAA 2GW1A 2YINA 1XGWA 3OXGA 3AS4A 4KBQA 3EJNA 1UJKA 3FUHA 3LCAA 3TAXA 3GYZA 3RK6A 3D3MA 3APCA 2CG2A 2HM8A 2IF4A 4NRHB 4ABNA 4AIFA 4M3OA 1QQEA 3GZ2A 4FP7A 5LCWJ 3P1UA 1SZAA 4GCNA 1X5BA 3QC1A 3L17A 4A3VA 5EX3A 3JQ1A 2IQCA 3UMVA 5BNWA 2M63A 3FHEA 3E4BA 4P29A 4G26A 3NZUA 3ONKA 5CMWA 3ZGQA 3QWPA 4JVSA 1N52A 4GA1A 1UJJA 2X6FA 1OWNA 2PQRA 3UT7A 4JL0A 3HVEA 2FBNA 3CK8A 2L6JA 3EHMA 4F7AA 3G2UA 3ZIMA 3Q15A 2YNQA 4WWNA 3FTYA 2CFUA 2RD0A 1Z6TA 2DBAA 2I9CA 3QKYA 3JUIA 3AU4A 4G11A 4DI3A 4U63A 3B7RL 4UI9J 5ARFA 4I9CA 2LAIA 4JEHA 3SZ7A 3UT8A 2XEVA 4G25A 1INZA 5E75A 3ZYKA 2CHZA 3SBTB 5E76A 4HOQA 2R59A 3IEGA 1IYGA 3ZW3A 2OVFA 2AXUA 3U3WA 2GRLA 4CCAA 4UQYA 1EPUA 4H7XA 3JCKC 2VSNA 2J08A 4WWOA 3FUIA 3LDZA 4LUNU 4GB9A 1U3DA 4IULA 4N2QA 5LFAA 5AYWD 3FU6A 3PEVB 5JHAA 4E6HA 2C2LA 4AY5A 4I6EA 2J9QA 2YQ8A 3LY7A 1W3BA 3NQPA 2WQ6A 2IOSA 5T3RA 3FY4A 4U0ZA 3LXUX 4APFA 3QOUA 4N39A 5HI7A 3ML9A 4JA7A 1NA0A 3ML8A 3OXFA 1HS6A 3G2SA 3I4GA 3RKVA 3UQ3A 4B94A 2I1KA 2UWJG 3TGOA 3QK0A 4DPRA 2CHXA 2X6JA 3PH0C 2NC9A 4CDMA 2XPZA 4ATGA 4V3IA 3EIQC 1MHQA 3D9JA 3UX4A 4I2WA 4F53A 4GCOA 4GU5A 3APDA 3D9PA 3N71A 5LP0A 2XCBA 4PDXA 2CG3A 2PM6A 3G2TA 3TXMA 1QZ2A 5EKQD 3TXNA 3CHSA 4U0SA 1E8YA 4ANUA 5G04J 5FWQA 4APOA 3IHYA 3RO3A 4J0UA 4IN3B 5G05J 4ANXA 4CDNA 4BX9A 2R17C 4WUYA 1GW6A 4FC8A 3AU5A 3D9IA 4GZ6A 3CHMA 4KVMA 2MOWA 4XIFA 4YVQC 3CQCB 2E0IA 3L13A 4A3TA 4DLQA 4G23A 2XGMA 4ILGA 2HO1A 3FUJA 2JLBA 5G2NA 3S7FA 3VLDA 3MCXA 4CGVA 1P5QA 3NZSA 4AV7A 3FTVA 3FUFA 3QWWA 4GAAA 4B89A 4BT8A 4UI9K 3FUEA 2WQHA 2JEKA 3B7TA 1FVFA 1HO8A 1YA0A 4JZYA 4FULA 5KJNA 4PUCA 3L08A 3K9IA 4B0ZA 4HFGA 3PDNA 3IBEA 1HZ4A 3TG4A 4TV3A 4CGWA 3RJVA 4L2LA 3ZYQA 3UPVA 5AJLA 2WXKA 3VTYA 2IFUA 2WXIA 3FU0A 4FLBA 1S0PA 4UWLA 5KJKA 3CQGB 2PZIA 2AXVA 4J6IA 1KT0A 1UG3A 2ZU6B 3LKUA 3FEYA 2L0IA 2ILRA 2LNIA 4HS2A 4CRWA 3BG1B 4GYWA 4KZ0A 2WXMA 3FUDA 5AJDA 4CEMA 4J8FA 3ZXSA 1EF1C 1WM5A 4YVOA 2BTDA 3SF4A 5M72A 3VLEA 1ZBPA 3ZN3A 3FTUA 3LJ3A 3ZVVA 2X3MA 4PH4B 2RG8A 2C0MA 3PREA 5EDSA 4DK5A 4XI9A 2LSVA 4GZDA 4K03A 4LEUA 5G04C 4AEZC 3Q4AB 4UI9C 3FUNA 3PE3A 4MS6A 3PVLA 4XKBA 4OVVA 3KS2A 1E90A 2MRIA 3FDHA 4D10C 3MA5A 3MKQA 3QDNA 4MKTA 3T5VA 3ESKA 3ASDA 3CGHA 4FHJA 4KT6B 3OAWA 4QFVA 2Y4TA 4PS7A 3ZYLA 3QJZA 4O6FA 3CVQA 3T8MA 2VJ8A 3I4RB 2J49A 5LOZA 4W9RA 3MYVA 4B8AA 3U4TA 3BG0B 5HQ8A 2XPYA 3L16A 3PE4A 4OYSA 5ANLA 3RO2A 3Q47B 4GZ5A 3MV2B 1Z3YA 4HOSA 3CHPA 3SFZA 5FQ8A 3R7QA 1NZNA 3CVUA 2VGYA 4AM9A 4G24A 4L1BA 1VDYA 1HH8A 1IHGA 2QFCA 3PNTB 4ANWA 3B13A 1BPOA 4NACA 2XRZA 1ELRA 4JHJA 2ONDA 3VTXA 2WXQA 3FU5A 4G1TA 4WNGA 4KMOA 2XPIA 3R7RA 3VLFA 3FUMA 4PS3A 2VGXA 2XRYA 3FFLA 3D9NA 1Z3XA 1XNFA 2LO6A 3D9MA 4J8DA 3PRZA 3ZRHA 4BY6A 4AOFA 1L5JA 2X38A 2VTBA 4I43A 2WXPA 3ZYMA 4HLEA 3SI5A 3G2VA 4I2ZA 3LEWA 4C0MA 2KCKA 4GA0A 4LERA 3AS5A 3CK9A 2WXNA 3QARA 3LS8A 4I17A 4JC8A 4HOTA 3MV3B 3ZPJA 5KJMA 2DIWA 4A1SA 4UWKA 5BUZA 3TJPA 4BSXA 4UWGA 1TJFA 3TG5A 3S7JA 3ZEFA 5LCWC 2V4LA 3CSTA 4G2VA 4LCTA 5JJTA 1Y8MA 5T8IA 1KLXA 3SGHA 5BV0A 1JUQA 4AXHA 2WMNA 3MGBA 3HYMB 1N54A 3RIBA 3MJWA 3ASGA 3BEEA 2BUGA 2FULA 2KZTA 4ACKA 2KM4A 3LYAA 4ILIA 3SHFA 1HU3A 5BPPA 5AIJA 5C2YA 5KJLA 3U64A 3TL5A 3L6AA 3QWVA 4AVXA 1IQRA 4L23A 3KAEA 4CT4A 2A4ZA 4GMLA 2X6IA 2AVPA 2LSUA 3ASHA 4U04A 4C0EA 4HVBA 3GZSA 1A17A 3PNLB 3HVEB 5FZRA 3ZFWA 1DNPA 3RRMB 3U9WA 5CCMA 3MKQB 2KC7A 5J90A 2C0LA 4BFRA 2NXPA 3SBSA 4U07A 4TUUA 3ZHEA 2VSOE 1JWGA 1NA3A 1DVPA 3FH8A 4BTAA 4I1MA 4Y6CA 4L7TA 3UT4A 3CVPA 4RG9A 4I6GA 5FTPA 5LX8A 4WNEA 2GGFA 4N3BA 4HORA 3FTWA 2FEZA 3R9AB 2MHKA 1ZU2A 2KCVA 2WB2A 3CEQA 4NQ0A 1WY6A 4E85A 4N2SA 1TEZA 4AJWA 3D9OA 4F1SA 4RSYA 3CHRA 4CT0A 1LF8A 2WXGA 5G05C 2IJGX 4F3VA 3D9KA 4C9BB 3SNXA 4HXIA 3GZ1A 4ME2A 5JJ6A 3PUJA 4N5CA 4I9EA 1IQUA 1UN8A 4EZJA 4J8EA 3QB2A 1B89A 3CK7A 4KZCA 4NURA 4UQZA 1SQMA 2WXHA 2GRMA 2Y4UA 4GMJA 4WAFA 2XGSA 3OXLA 3B7SA 3QAQA 3PEUB 1H2TC 5CMYA 3URZA 4U0UA 3CVYA 2P58C 4CDRA 2UY1A 1KT1A 3C98A 4FLHA 2BF0X 2UY1B 3EIJA 3HHMA 4Y6WA 3PS6A 3FUKA 5ARGA 5BW8C 1SZ9A 5DBKA 5FQ4A 4IYPA 4R7LA 3FU3A 4OVUA 1H2UA 2XCCA 3AS8A 2IONA 3L22A 2CFZA 2XQ0A 4N3AA 3S2AA 5FQ7A 5C1DA 1OWPA 2AWIA 3GW4A 1E7VA 2VYIA 2J4DA 4MLPA 4DLOA 4Q96A 5DIZA 5BV1A 4Q94A 3DBSA 4JXTA 4L2YA 2PM7A 2Q7FA 1WAO1 4UWHA 4EBAA 1E96B 2WPVA 2Y3AA 2IOLA 4I6JA 1OWOA 2V8SE 3D9LA 2WQ7A 2CHWA 2KZTB 4FJZA 3CVWA 3DPDA 3EDTB 2QY7A 3CSFA 2VSYA 2YHCA 3QNKA 4JEUA 5A23A 1OWMA 2E2EA 3RRUA 3O48A 4B8CB 2HYZA 2L0TB 1H6KA 1HG2A 2XHEA 4GZ3A 5D0QD 5ANRA 3WXXA 4EQFA 3HIZA 4K0RA 2IU1A 4RVBA 3LY9A 2XGOA 4ILHB 4AY6A 3CKCA 4ACLA 3I5PA 2AXZA 1ELKA 3PUKA 3ZHEB 4FHKA 2HR2A 4TRQA 2FF4A 4EZLA 2WXFA 3IHVA 4LRZA 2FI7A 4A1GA 4BTBA 1JPLA 3LVQE 5CHEE 3APFA 4XE0A 5JHBA 1ELWA 1E7UA 1HG5A 2FO7A 3FTSA 5ENNA 1EDUA 1MQSA 1PC2A 2WMOA 3FH5A 4WNFA 3OTNA 4HOUA 4KVOA 1E8ZA 1TJCA 5JJ7A 4EECA 1H19A 3CHQA 1E8XA 4FADA 2PQNA 3RU0A 4UQXA 3CVXA 3U66A 1E8WA 3FH7A 4GA2A 3ULQA 4Q69A 2LAHA 5FT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N54 A;  2VSX E;  3JUI A;  4B89 A;  1H2V C;  2FUL A;  2KZT A;  2GGF A;  4B8A A;  2IOL A;  2RG8 A;  4GMJ A;  1HU3 A;  1H2T C;  2KZT B;  2IOS A;  3L6A A;  1PAQ A;  4JHK A;  3EIJ A;  4CT4 A;  4B8C B;  4GML A;  1UW4 B;  1N52 A;  2I2O A;  1H6K A;  5ANR A;  1H2U A;  4C9B B;  2ION A;  3FEX A;  4JHJ A;  2IU1 A;  1UG3 A;  2ZU6 B;  3EIQ C;  4LUN U;  3RK6 A;  3D3M A;  3FEY A;  2NSZ A;  4IUL A;  2VSO E;  2HM8 A;  4CRW A;  4CEM A; 
#chains in the Genus database with same CATH topology
 3UI2 A;  1DCE A;  4PS8 A;  2WXJ A;  5FJY A;  4XKC A;  3SFX A;  1SA5 A;  4WWP A;  4JHK A;  3S7B A;  3FTZ A;  1Q2Z A;  2AW6 A;  1UW4 B;  2IO2 C;  2RKK A;  1JWF A;  3T8K A;  2YHE A;  3C3Q A;  3CIA A;  4BSZ B;  4MRU A;  4N3C A;  3MKR A;  5J08 A;  3TWQ A;  4K5C A;  4HRN A;  3KD7 A;  1H2V C;  1HXI A;  4GYY A;  4HNA D;  3V2O A;  2WXO A;  4KYO B;  3L54 A;  3HXD A;  2A5U A;  4BWR A;  3CKB A;  4A55 A;  1NP7 A;  5KBA A;  3EHN A;  4J8S A;  5FZS A;  4C48 B;  3UTM A;  3FP3 A;  2V5F A;  1FT1 A;  2R05 A;  1HF8 A;  2VSX E;  1HFA A;  3O4Z A;  3PZ1 A;  2OVB A;  3SD5 A;  5KCM A;  3B7U X;  5G55 A;  1U3C A;  2PL2 A;  2I6H A;  3CVN A;  1OWL A;  2WXR A;  2I2O A;  1TN8 A;  4XX5 A;  1XGW A;  4ABN A;  3IXE A;  4FP7 A;  5LCW J;  3QC1 A;  5EX3 A;  2GRR B;  4U8V D;  2M63 A;  3EHQ A;  3NZU A;  3ONK A;  4JVS A;  3UT7 A;  3LJN A;  3G2U A;  1OCC E;  4DI3 A;  3B7R L;  4G25 A;  1INZ A;  2P9U G;  4HOQ A;  2V4H C;  3IEG A;  2OVF A;  4DX7 D;  2AXU A;  4CCA A;  1O1S A;  5AAR A;  4H7X A;  2J08 A;  3PEV B;  2H6H A;  3ABM E;  4Z68 A;  3NQP A;  2IOS A;  1UOH A;  4U0Z A;  4APF A;  1RW2 A;  5HI7 A;  3ML9 A;  3I4G A;  3QK0 A;  4DPR A;  2CHX A;  3PH0 C;  2NC9 A;  2XPZ A;  3L82 A;  1MHQ A;  4F53 A;  5CBO A;  4HI8 A;  5LP0 A;  4PDX A;  2CG3 A;  3TXM A;  3TXN A;  5JHB A;  3NAW A;  4APO A;  4M7C A;  3JXI A;  3DXM G;  4BX9 A;  1GW6 A;  4GZ6 A;  4BEP A;  4DLQ A;  4G23 A;  5FIN A;  3VLD A;  4CGV A;  1P5Q A;  3QWW A;  3BUA A;  3JXJ A;  5D2M C;  2WQH A;  2JEK A;  4L9P A;  4JZY A;  4RQI A;  3DPY A;  3IBE A;  5CEA A;  1NI1 A;  3TG4 A;  4CGW A;  4L2L A;  3UPV A;  2WXK A;  2IFU A;  2ETC A;  1S0P A;  5KJK A;  2PZI A;  1TR4 A;  1UG3 A;  2L0I A;  5ENR D;  4CRW A;  3PZ2 A;  4GYW A;  4KZ0 A;  4CEM A;  4B93 B;  3ZXS A;  4YVO A;  2OEW A;  3DSW A;  1JCS A;  3VLE A;  3LJ3 A;  2X3M A;  4PH4 B;  2DVW A;  5EYL A;  3PRE A;  5EDS A;  4XI9 A;  4LNB A;  4AEZ C;  3Q4A B;  2QZA A;  4GTO A;  3KS2 A;  2MRI A;  3MA5 A;  3QDN A;  5AQ9 A;  1A5E A;  3ASD A;  4FHJ A;  3QJZ A;  4O6F A;  2A5E A;  2DZO A;  4W9R A;  3EU9 A;  3C3R A;  5HQ8 A;  2XPY A;  4OYS A;  4GZ5 A;  1N94 A;  1O1T A;  1Z3Y A;  4HOS A;  5FQ8 A;  3R7Q A;  4AM9 A;  4L1B A;  1HH8 A;  4ANW A;  3B13 A;  4JHJ A;  3FUM A;  2VGX A;  2XRY A;  1XNF A;  3D9M A;  5EYP F;  4TUM A;  4BY6 A;  4AOF A;  2X38 A;  2WXP A;  3ZYM A;  4I2Z A;  4C0M A;  4ZHB A;  4LER A;  3DSV A;  4HOT A;  3ZPJ A;  5BUZ A;  5ENO D;  4BSX A;  4YDW A;  3SO8 A;  3V30 A;  2V4L A;  3CST A;  3PZ3 A;  2R03 A;  4LCT A;  5JJT A;  3SGH A;  1KLX A;  3DEP A;  1JUQ A;  3HYM B;  5B1B E;  3UIO C;  3ASG A;  5CBN A;  2FUL A;  1N9A A;  3E34 A;  5AIJ A;  5KJL A;  3U64 A;  4L23 A;  2LSU A;  4U04 A;  3PNL B;  1WG0 A;  4BFR A;  3Q73 A;  4L7T A;  5FTP A;  4I6G A;  2GGF A;  2DYR E;  4HOR A;  3FTW A;  1N4S A;  2KCV A;  4NQ0 A;  1WY6 A;  4E85 A;  3ABL E;  1ZB1 A;  4F1S A;  2IJG X;  4X8Q A;  3SNX A;  5JJ6 A;  3GZ1 A;  4ME2 A;  3PUJ A;  5HKP A;  4I9E A;  1KZO A;  3QB2 A;  2P9K G;  2XZD G;  2R2L A;  4O1P A;  4UQZ A;  1SQM A;  2Y1L E;  3E30 A;  3QAQ A;  1FT2 A;  1H2T C;  4CDR A;  1TNU A;  4IYP A;  4R7L A;  3UM1 A;  2XQ0 A;  3W9G A;  5ENT D;  4MLP A;  4Q94 A;  4JXT A;  2Q7F A;  4EBA A;  2WPV A;  2IOL A;  3E37 A;  3RSE G;  2CHW A;  2WQ7 A;  3CVW A;  3EDT B;  3CSF A;  3HXE A;  1OWM A;  4B8C B;  2L0T B;  1H6K A;  1FPP A;  4EQF A;  4JB8 P;  4ACL A;  2HR2 A;  4TRQ A;  4EZL A;  3IHV A;  3LVQ E;  2BKK B;  1EDU A;  3FH5 A;  2P9I G;  3OTN A;  2MYO A;  1E8Z A;  3BU8 A;  5JJ7 A;  2F0Y A;  1BLX B;  1E8X A;  4UQX A;  2KBX A;  4Q69 A;  3NOC D;  3ESL A;  3Q5M A;  3P2B A;  4U8Y D;  2WXL A;  3PZD A;  1O5M A;  5D0O D;  4U95 D;  3V79 K;  3ONL A;  4DX5 D;  1TYQ G;  1S64 A;  4JA9 A;  3UUX A;  2I1J A;  4GPM A;  3JQ0 A;  2EQX A;  4URK A;  5BT1 A;  4U8H A;  3Q49 B;  4DI4 A;  3UIP C;  1HE8 A;  5T4Y A;  3CVV A;  4HBD A;  4YDY A;  3Q75 A;  1HX8 A;  3J5Q B;  4JW1 A;  1QNF A;  2LXL A;  4XI0 A;  3TWS A;  4JPS A;  3I3N A;  3FEX A;  2WVI A;  3LVR E;  4EBA G;  4U7E B;  2VGX B;  2J07 A;  3LPZ A;  2J4B A;  3FUL A;  5FZQ A;  1QBQ A;  2GRQ B;  5CRU A;  4I1O B;  4KXK B;  5CEC B;  1NL4 A;  3OXG A;  1MX2 A;  1NFI E;  3EJN A;  3FUH A;  3LCA A;  4RLY A;  2IF4 A;  4NRH B;  4HB5 A;  3GZ2 A;  4M3O A;  3P1U A;  4A3V A;  5BNW A;  3FHE A;  4G26 A;  3QWP A;  1N52 A;  4GA1 A;  2HE0 A;  4F7A A;  2B6C A;  3Q7F A;  2RD0 A;  3QKY A;  5CED B;  3JUI A;  3ZNG A;  2EIL E;  4G11 A;  1G3N B;  4UI9 J;  2RFA A;  5E75 A;  2CHZ A;  4F1P A;  5E76 A;  3Q9N C;  1IYG A;  2GRL A;  3JCK C;  4WWO A;  1MJ0 A;  4N2Q A;  3FU6 A;  3SY2 A;  5JHA A;  1TN7 A;  4UUC A;  2WQ6 A;  5T3R A;  3QOU A;  3KSQ A;  4JA7 A;  1NA0 A;  3ML8 A;  3OXF A;  1HS6 A;  3RKV A;  2UWJ G;  4ATG A;  4V3I A;  3D9J A;  3APD A;  3Q78 A;  2ZGG A;  2XCB A;  2PM6 A;  3CHS A;  1E8Y A;  3DXK G;  4CDN A;  2QC9 A;  2R02 A;  3CQC B;  3L13 A;  4A3T A;  4CZ2 D;  2XGM A;  4ILG A;  3NZS A;  4B89 A;  4BT8 A;  1X81 A;  4GTP A;  5BXO A;  1HO8 A;  1YA0 A;  4FUL A;  4PUC A;  3L08 A;  3K9I A;  3PDN A;  3RJV A;  5AJL A;  4FLB A;  4UWL A;  2ZU6 B;  3FEY A;  2ILR A;  4BES A;  3BG1 B;  3FUD A;  5M72 A;  3SF4 A;  3AG3 E;  3FTU A;  2F8X K;  4K03 A;  4LEU A;  4MS6 A;  4HQD A;  4XKB A;  1V54 E;  3ESK A;  2H6G A;  2Y4T A;  4PS7 A;  5ITZ F;  3HG0 D;  3MYV A;  3PE4 A;  3L16 A;  3Q47 B;  3CHP A;  3SFZ A;  1OCO E;  1NZN A;  4G24 A;  1VDY A;  1IHG A;  2XS8 A;  3ZU7 B;  2OND A;  3VTX A;  2WXQ A;  4WNG A;  4HRM B;  2XPI A;  3VLF A;  3FFL A;  1K1A A;  2LO6 A;  4O1O A;  2VTB A;  3HXF A;  4HLE A;  3SI5 A;  3G2V A;  4JD2 G;  3LEW A;  4TXP A;  4GA0 A;  1WDY A;  3CK9 A;  3QAR A;  3MV3 B;  5KJM A;  2DIW A;  2B0O E;  3TJP A;  4UWG A;  3ZEF A;  2OEV A;  1OCZ E;  2WMN A;  3BEE A;  2BUG A;  4ACK A;  2KM4 A;  1MZC A;  4ILI A;  2LXM A;  4DX1 A;  2X6I A;  2Y0B G;  5CCM A;  1RZ4 A;  3MKQ B;  5J90 A;  5AQA A;  2NXP A;  1SA4 A;  1TNO A;  3SBS A;  4O60 A;  2VSO E;  3ZHE A;  1NA3 A;  1K3Z D;  1DVP A;  3FH8 A;  4Y6C A;  3CVP A;  5LX8 A;  4WNE A;  5HS0 A;  2FEZ A;  3SFY A;  3R9A B;  3D9O A;  4RSY A;  3CHR A;  1LF8 A;  2WXG A;  4F3V A;  2DZN A;  3D9K A;  4LG6 A;  4ATZ D;  4N5C A;  1LD7 A;  3X2Q E;  3B95 A;  3CK7 A;  4KZC A;  2EIJ E;  2WXH A;  2GRM A;  3OXL A;  3B7S A;  3PEU B;  3ASO E;  4CYM D;  3URZ A;  1IXV A;  2P58 C;  3UM0 A;  3C98 A;  2UY1 B;  3HHM A;  5ARG A;  2XCC A;  2ION A;  3L22 A;  2CFZ A;  4N3A A;  4DX6 D;  1OWP A;  2AWI A;  3DSS A;  3GW4 A;  2J4D A;  4N5Q A;  4Q96 A;  3DBS A;  2PM7 A;  1WAO 1;  1N11 A;  5IY5 E;  5CER B;  1AWC B;  4FJZ A;  3DPD A;  2VSY A;  3QNK A;  3O48 A;  2HYZ A;  1HG2 A;  5D0Q D;  2GRP B;  1SVX A;  4LSZ E;  3EUV A;  2IU1 A;  3LY9 A;  4AY6 A;  3I5P A;  4HI9 A;  1ELK A;  3ZHE B;  3C72 A;  4FHK A;  3F6Q A;  2FF4 A;  1D9S A;  4BTB A;  1JPL A;  3ABK E;  5ENS D;  1ELW A;  3V2X A;  2FO7 A;  3ASN E;  5ENN A;  1PC2 A;  4WNF A;  1JCR A;  2P9L G;  4FAD A;  5CRV A;  1N0R A;  2PQN A;  1OY3 D;  1E8W A;  3ULQ A;  5FT9 A;  2EIK E;  2DCP A;  2XEN A;  3CV0 A;  2VTB B;  2KCL A;  1TNY A;  4AP2 A;  3Q79 A;  5CCL A;  3ASF A;  3ENE A;  1FCH A;  5A7D B;  2R5S A;  3RRN B;  3CVL A;  4LNG A;  3KEZ A;  2L9B A;  4BX8 A;  1FVH A;  1YYH A;  3MZL B;  4WND A;  1EYH A;  3FTX A;  4GPK A;  5JA4 D;  4BER A;  3DWL G;  4UWF A;  3BQO A;  4YND A;  4H7Y A;  1UN9 A;  3W9F A;  3G2W A;  2JAB A;  3SQV A;  4ANV A;  4ZFH A;  2VQ2 A;  3ULY A;  3MEK A;  1OUV A;  2GW1 A;  2YIN A;  4XEI G;  4KBQ A;  4GTS A;  2GRO B;  3GYZ A;  3D3M A;  3APC A;  2CG2 A;  2ETB A;  2HM8 A;  4AIF A;  5KWD A;  1QQE A;  2IEJ A;  3L17 A;  3DST A;  2BED A;  2IQC A;  3UMV A;  4P29 A;  4K5B A;  3ZGQ A;  2PQR A;  2FBN A;  3EHM A;  2L6J A;  3HXB A;  3HRA A;  3Q15 A;  2YNQ A;  3FTY A;  1BI8 B;  2GRN B;  2DBA A;  2I9C A;  5ENP D;  3AU4 A;  4U63 A;  5ARF A;  4I9C A;  2XEV A;  3J5P A;  3SBT B;  3ZYK A;  2R59 A;  4UQY A;  2VSN A;  2H6I A;  3FUI A;  3LDZ A;  4LUN U;  4GB9 A;  5LFA A;  4OAV B;  4E6H A;  2C2L A;  4AY5 A;  2J9Q A;  2YQ8 A;  1W3B A;  3UKR G;  2V5Q C;  3FY4 A;  3R9M A;  3TWR A;  2X6J A;  4CDM A;  1N4P A;  4GCO A;  3TWW A;  4GU5 A;  2ZXW E;  3C3O A;  3D9P A;  4GMR A;  3G2T A;  1QZ2 A;  5EKQ D;  3UIN C;  4U0S A;  5G04 J;  4TXQ A;  3IHY A;  1DCQ A;  3AJI A;  4IN3 B;  4J0U A;  5G05 J;  5JMN D;  2EIN E;  4WUY A;  4FC8 A;  3D9I A;  2XZT G;  3ZXP A;  4XIF A;  4YVQ C;  2HO1 A;  3FUJ A;  5G2N A;  4AV7 A;  3FUF A;  5B3S E;  3FUE A;  3B7T A;  1D8D A;  1FVF A;  4B0Z A;  4HFG A;  2H6F A;  1HZ4 A;  4TV3 A;  3FU0 A;  3EU5 A;  1TN6 A;  4J6I A;  1KT0 A;  3LKU A;  2LNI A;  4HS2 A;  1K8K G;  4J8F A;  1ZBP A;  3ZVV A;  2RG8 A;  4DK5 A;  2LSV A;  4GZD A;  4UI9 C;  3PE3 A;  3PVL A;  1AP7 A;  4OVV A;  2IY0 C;  1E90 A;  3T5V A;  3FDH A;  4MKT A;  1Z5S C;  3CGH A;  4KT6 B;  4QFV A;  3I4R B;  2J49 A;  5LOZ A;  4B8A A;  3U4T A;  3RO2 A;  2ETA A;  1OCR E;  4NIK A;  4QQI A;  2QFC A;  3PNT B;  4NAC A;  1ELR A;  4G1T A;  3DSX A;  4GTM A;  2ZIR A;  4PS3 A;  5KNG A;  2AJA A;  1Z3X A;  3D9N A;  4J8D A;  5AQB A;  4I43 A;  5BXU A;  4I17 A;  4JC8 A;  2XS1 A;  3AG4 E;  4UWK A;  3DEO A;  3TG5 A;  4GTQ A;  3S7J A;  2DWZ A;  5T8I A;  5BV0 A;  3DRA A;  4AXH A;  2KZT A;  3LYA A;  1K1B A;  3SHF A;  5BPP A;  4AVX A;  3L6A A;  4EHM A;  3AAA C;  3KSL A;  5AN8 A;  4CT4 A;  2A4Z A;  3ASH A;  4G8K A;  4C0E A;  1A17 A;  3HVE B;  1DNP A;  3RRM B;  3U9W A;  4BET A;  1S70 B;  1JWG A;  1TNZ A;  4BTA A;  3PZ4 A;  3UT4 A;  4N3B A;  2MHK A;  1ZU2 A;  3CEQ A;  1TEZ A;  4HXI A;  1IQU A;  3UM2 A;  4WAF A;  3L9T A;  5CMY A;  3Q9U C;  2KXP C;  3EIJ A;  4Y6W A;  3PS6 A;  3FUK A;  5BW8 C;  5FQ4 A;  1KPS B;  4OVU A;  5FQ7 A;  4G8L A;  5C1D A;  2VYI A;  4DLO A;  5BV1 A;  5DIZ A;  4GTV A;  4UWH A;  1E96 B;  2Y3A A;  4I6J A;  1OWO A;  3D9L A;  3UM3 A;  2YHC A;  4JEU A;  3RRU A;  2IO3 C;  4MBG A;  4GZ3 A;  2XHE A;  3WXX A;  3HIZ A;  4RVB A;  2P2C P;  3PUK A;  3ISM C;  3APF A;  4XE0 A;  1E7U A;  1H6O A;  4K5A B;  1HG5 A;  1MQS A;  2WMO A;  4EEC A;  3KEA A;  3RU0 A;  3CVX A;  2BKG A;  3U66 A;  3FH7 A;  1MX6 A;  2LAH A;  5EX0 A;  4XZ4 A;  3TWT A;  4EZK A;  2WM9 A;  3FWV A;  2V0P A;  2OV8 A;  3UXG A;  1YCS B;  3NF1 A;  3EHR A;  4FU3 A;  3LY8 A;  1Y6I A;  1H0A A;  4I1A A;  4GYO A;  3T5X A;  2OCC E;  3HDX A;  3CLJ A;  3CR3 A;  1JCQ A;  3IKO B;  2P9P G;  1PAQ A;  2J09 A;  1SW6 A;  4GZC A;  4BT9 A;  3MX3 A;  4JHR A;  1N95 A;  5EID A;  4FJY A;  1PY1 A;  3JYS A;  2KAT A;  4IRU A;  2NSZ A;  4YDE A;  4RG6 A;  2X6H A;  2OOE A;  5A6C A;  5FQ6 A;  4FA6 A;  2PNN A;  4EPZ A;  1O1R A;  3CHO A;  3IV0 A;  5AEN A;  2X6K A;  3S7D A;  4DJA A;  3UKU G;  3AS4 A;  1UJK A;  3TAX A;  3RK6 A;  3B7B A;  4F6R D;  4HRL A;  3D9H A;  3RAU A;  5HRY A;  1SZA A;  4GCN A;  1X5B A;  3JQ1 A;  4DRX E;  3E4B A;  3TWV A;  5CMW A;  1UJJ A;  2X6F A;  1OWN A;  5ENQ D;  4JL0 A;  3HVE A;  3CK8 A;  1OT8 A;  2J8S D;  5EIL A;  4WWN A;  2CFU A;  1OXJ A;  3HXC A;  1Z6T A;  4U96 D;  2VGE A;  2LAI A;  4JEH A;  3SZ7 A;  3UT8 A;  4GTR A;  3ZW3 A;  3U3W A;  1U2V G;  1EPU A;  4HLL A;  1BI7 B;  1U3D A;  4IUL A;  3NOG D;  5AYW D;  1N0Q A;  4I6E A;  3LY7 A;  3LXU X;  4N39 A;  3ZUV B;  3G2S A;  3UQ3 A;  2NYJ A;  4B94 A;  2I1K A;  3TGO A;  5FIO A;  3NBN B;  1D8E A;  1V55 E;  3EIQ C;  1DC2 A;  3UX4 A;  3Q7A A;  4I2W A;  1YMP A;  4DX2 A;  1BD8 A;  5KNH D;  3N71 A;  4ANU A;  1QYM A;  5FWQ A;  3AG2 E;  3RO3 A;  4ANX A;  2R17 C;  3AU5 A;  5H7P A;  3CHM A;  4KVM A;  4A63 B;  2MOW A;  2E0I A;  4GTT A;  2JLB A;  3S7F A;  3MCX A;  3FTV A;  4GAA A;  4UI9 K;  5KJN A;  2L6B A;  3ZYQ A;  3VTY A;  2WXI A;  3CQG B;  2AXV A;  2Y69 E;  2WXM A;  5AJD A;  1EF1 C;  1WM5 A;  2BTD A;  4YDO A;  3ZN3 A;  2C0M A;  2LUH A;  5EIB E;  1H6P A;  2P9S G;  1IHB A;  1MYO A;  5G04 C;  3FUN A;  4D10 C;  3MKQ A;  2QYU A;  3OAW A;  3V31 A;  2ZIS A;  3ZYL A;  2RFM A;  3CVQ A;  3T8M A;  2VJ8 A;  3DSU A;  3BG0 B;  2XEE A;  5ANL A;  3MV2 B;  3CVU A;  2VGY A;  1BU9 A;  1BPO A;  2XRZ A;  2P9N G;  3FU5 A;  4KMO A;  3R7R A;  2F8Y A;  2DYS E;  3PRZ A;  3ZRH A;  1N4R A;  1L5J A;  2KCK A;  3AS5 A;  2WXN A;  3LS8 A;  4A1S A;  1TJF A;  5LCW C;  4G2V A;  1Y8M A;  3MGB A;  3T9K A;  3ULE G;  1N54 A;  3RIB A;  3MJW A;  1HU3 A;  4LNU D;  5C2Y A;  3TL5 A;  3QWV A;  1IQR A;  3KAE A;  4GML A;  2AVP A;  4J7W A;  4HVB A;  3E32 A;  3GZS A;  5AAO A;  3AG1 E;  3ZFW A;  5FZR A;  2KC7 A;  2C0L A;  2F37 A;  3ZKJ A;  5EN5 D;  4U07 A;  4TUU A;  1MX4 A;  4I1M A;  4RG9 A;  3JUE A;  1N4Q A;  3TWX A;  2WB2 A;  4N2S A;  4AJW A;  4CT0 A;  5G05 C;  4C9B B;  1UN8 A;  4EZJ A;  1KZP A;  4J8E A;  1B89 A;  4NUR A;  2Y4U A;  4GMJ A;  2XGS A;  4U0U A;  3CVY A;  2UY1 A;  1KT1 A;  4J8Y A;  4FLH A;  2BF0 X;  3NB2 A;  1SZ9 A;  5DBK A;  5AQ7 A;  3FU3 A;  2XEH A;  1H2U A;  3AS8 A;  3S2A A;  1LD8 A;  2QYJ A;  1E7V A;  4L2Y A;  4DUI A;  2FO1 E;  2ZGD A;  2V8S E;  1IKN D;  2KZT B;  2QY7 A;  5A23 A;  5D66 A;  2E2E A;  5B1A E;  5ANR A;  4TXR A;  1LTX A;  4K0R A;  2XGO A;  4ILH B;  3WG7 E;  3CKC A;  2AXZ A;  1TNB A;  4OAU C;  3C5R A;  2WXF A;  4LRZ A;  2FI7 A;  4A1G A;  5CHE E;  1S63 A;  2EIM E;  3E33 A;  3FTS A;  4HOU A;  4KVO A;  1TJC A;  1H19 A;  3CHQ A;  3TWU A;  4GA2 A;  3ZIM A; 
#chains in the Genus database with same CATH homology
 3ESL A;  5EX0 A;  3Q5M A;  4PS8 A;  3P2B A;  2WXJ A;  5FJY A;  4XKC A;  4XZ4 A;  2DCP A;  4EZK A;  2WM9 A;  2WXL A;  3CV0 A;  2VTB B;  3PZD A;  3FWV A;  2V0P A;  2KCL A;  4WWP A;  4JHK A;  2OV8 A;  3S7B A;  3FTZ A;  5D0O D;  4AP2 A;  2AW6 A;  3ONL A;  1UW4 B;  3NF1 A;  5CCL A;  4FU3 A;  3ASF A;  1JWF A;  3ENE A;  1Y6I A;  3LY8 A;  2YHE A;  1H0A A;  4I1A A;  4JA9 A;  3UUX A;  3CIA A;  4GYO A;  3T5X A;  1FCH A;  4MRU A;  2I1J A;  5A7D B;  4N3C A;  3MKR A;  2R5S A;  3HDX A;  3CVL A;  3RRN B;  5J08 A;  3KEZ A;  2L9B A;  3JQ0 A;  3CLJ A;  3CR3 A;  3KD7 A;  2EQX A;  1H2V C;  4BX8 A;  4URK A;  5BT1 A;  4U8H A;  1HXI A;  3Q49 B;  1FVH A;  4DI4 A;  4GYY A;  3IKO B;  1HE8 A;  2WXO A;  3MZL B;  5T4Y A;  3CVV A;  1PAQ A;  4WND A;  2J09 A;  1HX8 A;  4KYO B;  3L54 A;  1EYH A;  4JW1 A;  4GZC A;  1QNF A;  2A5U A;  4XI0 A;  3FTX A;  4BT9 A;  3CKB A;  4A55 A;  4BWR A;  4GPK A;  1NP7 A;  3MX3 A;  4JHR A;  3EHN A;  3I3N A;  3FEX A;  4J8S A;  4JPS A;  5FZS A;  4FJY A;  1PY1 A;  3JYS A;  2KAT A;  3FP3 A;  2WVI A;  4IRU A;  2NSZ A;  3LVR E;  2V5F A;  4EBA G;  4UWF A;  1HF8 A;  2VGX B;  2J07 A;  2VSX E;  4RG6 A;  4YND A;  2X6H A;  1HFA A;  3O4Z A;  2OVB A;  1UN9 A;  4H7Y A;  3G2W A;  5KCM A;  3SD5 A;  2OOE A;  3B7U X;  3LPZ A;  2J4B A;  3FUL A;  5FZQ A;  5A6C A;  5FQ6 A;  5G55 A;  4FA6 A;  1U3C A;  2PL2 A;  4EPZ A;  2I6H A;  4ANV A;  3CVN A;  3CHO A;  1OWL A;  3IV0 A;  2VQ2 A;  4I1O B;  2X6K A;  3S7D A;  5AEN A;  2WXR A;  2I2O A;  3MEK A;  4KXK B;  4XX5 A;  1OUV A;  4DJA A;  2GW1 A;  2YIN A;  1XGW A;  3OXG A;  3AS4 A;  4KBQ A;  3EJN A;  1UJK A;  3FUH A;  3LCA A;  3TAX A;  3GYZ A;  3RK6 A;  3D3M A;  3APC A;  2CG2 A;  2HM8 A;  2IF4 A;  4NRH B;  4ABN A;  4AIF A;  4M3O A;  1QQE A;  3GZ2 A;  4FP7 A;  5LCW J;  3P1U A;  1SZA A;  4GCN A;  1X5B A;  3QC1 A;  3L17 A;  4A3V A;  5EX3 A;  3JQ1 A;  2IQC A;  3UMV A;  5BNW A;  2M63 A;  3FHE A;  3E4B A;  4P29 A;  4G26 A;  3NZU A;  3ONK A;  5CMW A;  3ZGQ A;  3QWP A;  4JVS A;  1N52 A;  4GA1 A;  1UJJ A;  2X6F A;  1OWN A;  2PQR A;  3UT7 A;  4JL0 A;  3HVE A;  2FBN A;  3CK8 A;  2L6J A;  3EHM A;  4F7A A;  3G2U A;  3ZIM A;  3Q15 A;  2YNQ A;  4WWN A;  3FTY A;  2CFU A;  2RD0 A;  1Z6T A;  2DBA A;  2I9C A;  3QKY A;  3JUI A;  3AU4 A;  4G11 A;  4DI3 A;  4U63 A;  3B7R L;  4UI9 J;  5ARF A;  4I9C A;  2LAI A;  4JEH A;  3SZ7 A;  3UT8 A;  2XEV A;  4G25 A;  1INZ A;  5E75 A;  3ZYK A;  2CHZ A;  3SBT B;  5E76 A;  4HOQ A;  2R59 A;  3IEG A;  1IYG A;  3ZW3 A;  2OVF A;  2AXU A;  3U3W A;  2GRL A;  4CCA A;  4UQY A;  1EPU A;  4H7X A;  3JCK C;  2VSN A;  2J08 A;  4WWO A;  3FUI A;  3LDZ A;  4LUN U;  4GB9 A;  1U3D A;  4IUL A;  4N2Q A;  5LFA A;  5AYW D;  3FU6 A;  3PEV B;  5JHA A;  4E6H A;  2C2L A;  4AY5 A;  4I6E A;  2J9Q A;  2YQ8 A;  3LY7 A;  1W3B A;  3NQP A;  2WQ6 A;  2IOS A;  5T3R A;  3FY4 A;  4U0Z A;  3LXU X;  4APF A;  3QOU A;  4N39 A;  5HI7 A;  3ML9 A;  4JA7 A;  1NA0 A;  3ML8 A;  3OXF A;  1HS6 A;  3G2S A;  3I4G A;  3RKV A;  3UQ3 A;  4B94 A;  2I1K A;  2UWJ G;  3TGO A;  3QK0 A;  4DPR A;  2CHX A;  2X6J A;  3PH0 C;  2NC9 A;  4CDM A;  2XPZ A;  4ATG A;  4V3I A;  3EIQ C;  1MHQ A;  3D9J A;  3UX4 A;  4I2W A;  4F53 A;  4GCO A;  4GU5 A;  3APD A;  3D9P A;  3N71 A;  5LP0 A;  2XCB A;  4PDX A;  2CG3 A;  2PM6 A;  3G2T A;  3TXM A;  1QZ2 A;  5EKQ D;  3TXN A;  3CHS A;  4U0S A;  1E8Y A;  4ANU A;  5G04 J;  5FWQ A;  4APO A;  3IHY A;  3RO3 A;  4J0U A;  4IN3 B;  5G05 J;  4ANX A;  4CDN A;  4BX9 A;  2R17 C;  4WUY A;  1GW6 A;  4FC8 A;  3AU5 A;  3D9I A;  4GZ6 A;  3CHM A;  4KVM A;  2MOW A;  4XIF A;  4YVQ C;  3CQC B;  2E0I A;  3L13 A;  4A3T A;  4DLQ A;  4G23 A;  2XGM A;  4ILG A;  2HO1 A;  3FUJ A;  2JLB A;  5G2N A;  3S7F A;  3VLD A;  3MCX A;  4CGV A;  1P5Q A;  3NZS A;  4AV7 A;  3FTV A;  3FUF A;  3QWW A;  4GAA A;  4B89 A;  4BT8 A;  4UI9 K;  3FUE A;  2WQH A;  2JEK A;  3B7T A;  1FVF A;  1HO8 A;  1YA0 A;  4JZY A;  4FUL A;  5KJN A;  4PUC A;  3L08 A;  3K9I A;  4B0Z A;  4HFG A;  3PDN A;  3IBE A;  1HZ4 A;  3TG4 A;  4TV3 A;  4CGW A;  3RJV A;  4L2L A;  3ZYQ A;  3UPV A;  5AJL A;  2WXK A;  3VTY A;  2IFU A;  2WXI A;  3FU0 A;  4FLB A;  1S0P A;  4UWL A;  5KJK A;  3CQG B;  2PZI A;  2AXV A;  4J6I A;  1KT0 A;  1UG3 A;  2ZU6 B;  3LKU A;  3FEY A;  2L0I A;  2ILR A;  2LNI A;  4HS2 A;  4CRW A;  3BG1 B;  4GYW A;  4KZ0 A;  2WXM A;  3FUD A;  5AJD A;  4CEM A;  4J8F A;  3ZXS A;  1EF1 C;  1WM5 A;  4YVO A;  2BTD A;  3SF4 A;  5M72 A;  3VLE A;  1ZBP A;  3ZN3 A;  3FTU A;  3LJ3 A;  3ZVV A;  2X3M A;  4PH4 B;  2RG8 A;  2C0M A;  3PRE A;  5EDS A;  4DK5 A;  4XI9 A;  2LSV A;  4GZD A;  4K03 A;  4LEU A;  5G04 C;  4AEZ C;  3Q4A B;  4UI9 C;  3FUN A;  3PE3 A;  4MS6 A;  3PVL A;  4XKB A;  4OVV A;  3KS2 A;  1E90 A;  2MRI A;  3FDH A;  4D10 C;  3MA5 A;  3MKQ A;  3QDN A;  4MKT A;  3T5V A;  3ESK A;  3ASD A;  3CGH A;  4FHJ A;  4KT6 B;  3OAW A;  4QFV A;  2Y4T A;  4PS7 A;  3ZYL A;  3QJZ A;  4O6F A;  3CVQ A;  3T8M A;  2VJ8 A;  3I4R B;  2J49 A;  5LOZ A;  4W9R A;  3MYV A;  4B8A A;  3U4T A;  3BG0 B;  5HQ8 A;  2XPY A;  3L16 A;  3PE4 A;  4OYS A;  5ANL A;  3RO2 A;  3Q47 B;  4GZ5 A;  3MV2 B;  1Z3Y A;  4HOS A;  3CHP A;  3SFZ A;  5FQ8 A;  3R7Q A;  1NZN A;  3CVU A;  2VGY A;  4AM9 A;  4G24 A;  4L1B A;  1VDY A;  1HH8 A;  1IHG A;  2QFC A;  3PNT B;  4ANW A;  3B13 A;  1BPO A;  4NAC A;  2XRZ A;  1ELR A;  4JHJ A;  2OND A;  3VTX A;  2WXQ A;  3FU5 A;  4G1T A;  4WNG A;  4KMO A;  2XPI A;  3R7R A;  3VLF A;  3FUM A;  4PS3 A;  2VGX A;  2XRY A;  3FFL A;  3D9N A;  1Z3X A;  1XNF A;  2LO6 A;  3D9M A;  4J8D A;  3PRZ A;  3ZRH A;  4BY6 A;  4AOF A;  1L5J A;  2X38 A;  2VTB A;  4I43 A;  2WXP A;  3ZYM A;  4HLE A;  3SI5 A;  3G2V A;  4I2Z A;  3LEW A;  4C0M A;  2KCK A;  4GA0 A;  4LER A;  3AS5 A;  3CK9 A;  2WXN A;  3QAR A;  3LS8 A;  4I17 A;  4JC8 A;  4HOT A;  3MV3 B;  3ZPJ A;  5KJM A;  2DIW A;  4A1S A;  4UWK A;  5BUZ A;  3TJP A;  4BSX A;  4UWG A;  1TJF A;  3TG5 A;  3S7J A;  3ZEF A;  5LCW C;  2V4L A;  3CST A;  4G2V A;  4LCT A;  5JJT A;  1Y8M A;  5T8I A;  1KLX A;  3SGH A;  5BV0 A;  1JUQ A;  4AXH A;  2WMN A;  3MGB A;  3HYM B;  1N54 A;  3RIB A;  3MJW A;  3ASG A;  3BEE A;  2BUG A;  2FUL A;  2KZT A;  4ACK A;  2KM4 A;  3LYA A;  4ILI A;  3SHF A;  1HU3 A;  5BPP A;  5AIJ A;  5C2Y A;  5KJL A;  3U64 A;  3TL5 A;  3L6A A;  3QWV A;  4AVX A;  1IQR A;  4L23 A;  3KAE A;  4CT4 A;  2A4Z A;  4GML A;  2X6I A;  2AVP A;  2LSU A;  3ASH A;  4U04 A;  4C0E A;  4HVB A;  3GZS A;  1A17 A;  3PNL B;  3HVE B;  5FZR A;  3ZFW A;  1DNP A;  3RRM B;  3U9W A;  5CCM A;  3MKQ B;  2KC7 A;  5J90 A;  2C0L A;  4BFR A;  2NXP A;  3SBS A;  4U07 A;  4TUU A;  3ZHE A;  2VSO E;  1JWG A;  1NA3 A;  1DVP A;  3FH8 A;  4BTA A;  4I1M A;  4Y6C A;  4L7T A;  3UT4 A;  3CVP A;  4RG9 A;  4I6G A;  5FTP A;  5LX8 A;  4WNE A;  2GGF A;  4N3B A;  4HOR A;  3FTW A;  2FEZ A;  3R9A B;  2MHK A;  1ZU2 A;  2KCV A;  2WB2 A;  3CEQ A;  4NQ0 A;  1WY6 A;  4E85 A;  4N2S A;  1TEZ A;  4AJW A;  3D9O A;  4F1S A;  4RSY A;  3CHR A;  4CT0 A;  1LF8 A;  2WXG A;  5G05 C;  2IJG X;  4F3V A;  3D9K A;  4C9B B;  3SNX A;  4HXI A;  3GZ1 A;  4ME2 A;  5JJ6 A;  3PUJ A;  4N5C A;  4I9E A;  1IQU A;  1UN8 A;  4EZJ A;  4J8E A;  3QB2 A;  1B89 A;  3CK7 A;  4KZC A;  4NUR A;  4UQZ A;  1SQM A;  2WXH A;  2GRM A;  2Y4U A;  4GMJ A;  4WAF A;  2XGS A;  3OXL A;  3B7S A;  3QAQ A;  3PEU B;  1H2T C;  5CMY A;  3URZ A;  4U0U A;  3CVY A;  2P58 C;  4CDR A;  2UY1 A;  1KT1 A;  3C98 A;  4FLH A;  2BF0 X;  2UY1 B;  3EIJ A;  3HHM A;  4Y6W A;  3PS6 A;  3FUK A;  5ARG A;  5BW8 C;  1SZ9 A;  5DBK A;  5FQ4 A;  4IYP A;  4R7L A;  3FU3 A;  4OVU A;  1H2U A;  2XCC A;  3AS8 A;  2ION A;  3L22 A;  2CFZ A;  2XQ0 A;  4N3A A;  3S2A A;  5FQ7 A;  5C1D A;  1OWP A;  2AWI A;  3GW4 A;  1E7V A;  2VYI A;  2J4D A;  4MLP A;  4DLO A;  4Q96 A;  5DIZ A;  5BV1 A;  4Q94 A;  3DBS A;  4JXT A;  4L2Y A;  2PM7 A;  2Q7F A;  1WAO 1;  4UWH A;  4EBA A;  1E96 B;  2WPV A;  2Y3A A;  2IOL A;  4I6J A;  1OWO A;  2V8S E;  3D9L A;  2WQ7 A;  2CHW A;  2KZT B;  4FJZ A;  3CVW A;  3DPD A;  3EDT B;  2QY7 A;  3CSF A;  2VSY A;  2YHC A;  3QNK A;  4JEU A;  5A23 A;  1OWM A;  2E2E A;  3RRU A;  3O48 A;  4B8C B;  2HYZ A;  2L0T B;  1H6K A;  1HG2 A;  2XHE A;  4GZ3 A;  5D0Q D;  5ANR A;  3WXX A;  4EQF A;  3HIZ A;  4K0R A;  2IU1 A;  4RVB A;  3LY9 A;  2XGO A;  4ILH B;  4AY6 A;  3CKC A;  4ACL A;  3I5P A;  2AXZ A;  1ELK A;  3PUK A;  3ZHE B;  4FHK A;  2HR2 A;  4TRQ A;  2FF4 A;  4EZL A;  2WXF A;  3IHV A;  4LRZ A;  2FI7 A;  4A1G A;  4BTB A;  1JPL A;  3LVQ E;  5CHE E;  3APF A;  4XE0 A;  5JHB A;  1ELW A;  1E7U A;  1HG5 A;  2FO7 A;  3FTS A;  5ENN A;  1EDU A;  1MQS A;  1PC2 A;  2WMO A;  3FH5 A;  4WNF A;  3OTN A;  4HOU A;  4KVO A;  1E8Z A;  1TJC A;  5JJ7 A;  4EEC A;  1H19 A;  3CHQ A;  1E8X A;  4FAD A;  2PQN A;  3RU0 A;  4UQX A;  3CVX A;  3U66 A;  1E8W A;  3FH7 A;  4GA2 A;  3ULQ A;  4Q69 A;  2LAH A;  5FT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...