2ZVJA

Crystal structures of rat catechol-o-methyltransferase complexed with coumarine-based inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
212
structure length
212
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of rat catechol-O-methyltransferase complexed with coumarine-based inhibitor
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 81
structure length 212
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zvjA00
2ZIEA 4FZVA 1I9GA 1QAOA 4QTUB 1X1BA 4XUDA 3H2BA 3MGGA 3THRA 2PVCA 2PSSA 4DZRA 1QZZA 4E32A 3VC2A 2CWWA 1X1DA 3G8AA 4GBED 4MTLA 2O05A 4IV0A 5LQRA 8MHTA 4DKJA 2Z6AA 1XDSA 1KIAA 4YV0A 1XJ5A 3BXOA 2XBMA 2UYOA 3BWCA 1KHHA 1KPHA 1N7JA 4P7JA 5FA8A 5GWXA 5T6BA 3REOA 3WSTA 5CVJA 4C4AA 2R6ZA 2XVMA 3P9CA 2NP7A 3P97A 4HGZA 4PYIA 2GLUA 3NW9A 2HWKA 3CC8A 3BWBA 3HVJA 3I5UA 3NTVA 2UYCA 3Q7EA 1WZNA 2YUIA 3FUWA 1AF7A 5DM2A 4CKBA 4X61A 5ICCA 2HR1A 1IXKA 3ME5A 2IBTA 3LGAA 2PX5A 5F2KA 5ICFA 4E2ZA 5LQJA 1D2GA 2NXCA 3QV2A 1VLMA 1FP2A 3OE4A 3DR5A 3LPMA 4RV9A 2DULA 4K6MA 3KQOA 3GRZA 3EEYA 4KDRA 1JTFA 1N2XA 1ZGJA 3CVOA 1XVAA 4M38A 5DM1A 2BR4A 5P8WA 1R00A 3KQQA 2EG5A 3OU6A 1WXXA 1YUBA 2YXEA 2ZCJA 2V7EA 4FP9A 4X63A 3CJRA 5EEGA 3KR1A 2HMYB 1BKYA 4KIGA 5ERGB 2P8JA 4Y30A 5F2NA 1XTPA 4BLVA 3FYCA 2JHCA 2IH2A 2IBSA 2OY0A 1WY7A 3KKZA 1RI3A 1Q0SA 1PRYA 2ZSUA 3P9KA 3PX3A 4FT4A 4M7RA 3OU7A 1D2HA 5FWAA 3THSA 3NDIA 4A6EA 5K05A 1X19A 3ELWA 3LCVB 1M6EX 4HC4A 5HIMA 3VSEA 4V0QA 1EQAA 3JWIA 1NBIA 2UYHA 5EQJB 2PXXA 5GM1A 3NMUF 3LDFA 2ZULA 5HIJA 4GOMD 3MTIA 3UZUA 3LSTA 3OCJA 2R3SA 1M6YA 3UJ7A 4PYMA 1Q0TA 5E9WA 2PBFA 4C04A 5E1OA 3L8DA 4PNEA 4KVZA 1EJ6A 2IFTA 5DPMA 3DMHA 3MQ2A 5DM0A 1G55A 2PX8A 3DLCA 1SG9A 3FRHA 3OZRA 5K0GA 3R6TA 2JH9A 3LBYA 5C0OE 2UZ4A 1KPIA 3TRKA 5EZSA 1KR5A 1R18A 5B1SA 5BW4A 3HM2A 3MCTA 2AOUA 4RTLA 3PLAE 4E2XA 3MERA 4LECA 5DX1A 2YX1A 4PWYA 2P3OA 5HZMA 5EGSA 2XYRA 2HV9A 2ONZA 2G72A 2JJQA 3G89A 1R8XA 3NWBA 4GOND 4FGZA 3LDGA 5BW5A 4KRGA 5E9JA 1INLA 1WXWA 2XVAA 3FUVA 4GF5A 3ER8A 2GPYA 3I53A 1FBNA 3MB5A 1VL5A 5DX8A 2WA1A 5DXAA 1G38A 4P7KA 3PTAA 2ERCA 1L3IA 3KQMA 5EOVA 1AQJA 1YF3A 1JG3A 3FPGA 5DXJA 5HFJA 4CTJA 2AOTA 2NNWB 3FZGA 4DQ0A 3MTEA 1F38A 4PIMA 1KP9A 2XYQA 4C08A 5K0JA 5LQNA 2C7RA 2PWYA 4YMGA 1WS6A 3I9FA 3HCDA 2O0LA 2VZ9A 2WK1A 2JHAA 1TPYA 5DRYA 2BM8A 3DTNA 5EMJA 3TMAA 3GU3A 3HNRA 3K0BA 3B3JA 5BXYA 1G8SA 3EGIA 3LKDA 4ZTBA 3O7WA 2ORED 3HA5A 4PYQA 2GH1A 5E1DA 2OXTA 1NV9A 10MHA 3HTXA 2ZIFA 4Y2HA 5K0FA 2YR0A 3BGDA 4C07A 3BKXA 2AOTB 4CKEA 3PS9A 4ER5A 1RJDA 3BZBA 3C3PA 3EVBA 3FUUA 4A6DA 2P40A 3DUWA 1JQDA 4RSRA 2O07A 3G5TA 5GIPE 4HH4A 3SM3A 1L1EA 9MHTA 4DCMA 2VDWA 2YXDA 1VQ1A 1UFKA 5LQUA 3DMFA 2YVLA 3CCFA 1VPTA 3G5LA 3R24A 2PX2A 4AZSA 5MHTA 2P3QA 4M36A 1XCLA 4YUXA 1L3BA 2P7HA 3A26A 3M6UA 2AZTA 2EJTA 3CKKA 3D2LA 3PFHA 4LWPA 3UJ9A 1I1NA 4CKCA 4ER3A 2QRVA 5LSAA 5EEHA 3KHKA 3UA4A 2PXCA 4F85A 2ZBPA 4KW7A 3M70A 2BR5A 3PT9A 1MJFA 4EKIA 1ZQ9A 4IWNA 5DRTA 1NW7A 2Z6UA 4DF3A 1VP3A 3OU2A 5T67A 2C7QA 4GEKA 4RTQA 4MWZA 3T7RA 5JUWA 1YB2A 5EZQA 3OFJA 4RTMA 4RTRA 3JWJA 1RI4A 3EVCA 3LECA 5T64A 3TLJA 4BP3A 4LWOA 1P1CA 3QOWA 1UWVA 5EHIA 3P2EA 5K8VA 3U81A 4X1OA 4WVLA 5E1MA 3MCZA 5E2BA 4DCGA 3SSOA 4RTKA 2PJDA 1NW8A 4E2WA 1VP9A 3NDJA 3FTDA 4HSGA 5K0LA 1EIZA 2B9EA 2VDVE 3P2IA 2PY6A 3AJDA 1I4WA 1NW5A 3HCAA 4QVKA 2HNKA 5DTRA 4PYKA 3A4TA 5DTMA 3V8VA 2JG3A 3DH0A 4HGYA 4R8RA 4P58A 5LQKA 2OB2A 3HVIA 3EVDA 4P7GA 4FR0A 4E70A 4QDKA 2JHPA 1RI2A 4YUZA 2OB1A 4OBXA 3KQPA 3EGEA 3GCZA 3OE5A 1KYZA 2Y1WA 5U4XA 3CJQA 3M33A 2I9KA 1RJFA 2PX4A 3A27A 2BM9A 2ZTHA 3M4XA 4PGHA 3HEMA 3E23A 3IV6A 1IM8A 4PIPA 5BP7A 2UYQA 2IPXA 3C6MA 4RTJA 2ONYA 4RX1A 3DXZA 1JG4A 2AOWA 3O31A 1O9GA 2AR0A 1YFJA 1R74A 2PT6A 3SSNA 1MHTA 5LQCA 3TM4A 3B89A 3TKAA 5IKMA 2C7OA 4RTOA 3HCBA 1PJZA 3CGGA 1JG2A 5FCDA 3TM5A 1G8AA 2CKDA 2GS9A 2P7IA 5K01A 5ICGA 2AOUB 5K0CA 3RIEA 2AOXA 2OBFA 3BWYA 3DXYA 4F84A 2FK7A 3P9IA 3FPHA 5FULA 7MHTA 3P71T 4QVGA 1KXZA 5FADA 2Y1XA 5GINE 4PCAA 5E8JA 2AOVA 5DWQA 4B17A 1ZKDA 4OA5A 5E2AA 2B25A 2B2CA 4HG2A 2H00A 2G8NA 1H1DA 3FTCA 4QTTB 4PYLA 4AZTA 1RJGA 4YUYA 2AN4A 3FUTA 3KPUA 2DPMA 3TFWA 4E30A 5EIWA 3GIWA 2IIPA 5FUBA 3C0KA 1JR4A 2K4MA 2PWPA 3A25A 4PYNA 4BP1A 1RI5A 2FPOA 3HVHA 2ZZNA 3DOUA 3TQSA 4ISCA 4JXJA 4ATNA 4OA8A 5E8RA 3EVZA 2QRVB 5DT2A 2QE6A 2QY6A 3G88A 5H02A 3EMBA 5CVUA 4GUAA 4MHTA 5CUQA 3UBTA 3E8SA 1EJ0A 2EFJA 2ZFUA 3PX2A 3ELYA 4FSDA 4HTFB 1X1CA 3EGVA 3ORHA 3B3FA 4BLUA 3MAGA 4IKPA 3OZSA 5EIFA 3SGLA 3SMQA 4UOEA 1R8YA 5HIKA 1HMYA 2KW5A 3GGDA 3UWPA 1EAMA 1O9HA 4CTKA 1M0EA 5K09A 1EG2A 3GDHA 3IHTA 4MIKA 3PFGA 4LG1A 3K6RA 3V97A 5CVEA 2CMGA 2PT9A 2Z6QA 4POOA 3MHTA 2NP6A 1D2CA 5CIYA 2IP2A 2VDUE 3DULA 3GRVA 3FTFA 1JG1A 4WXHA 1FPQA 3P9NA 2A14A 4OQDA 2EJUA 4L7VA 4XUCA 2ZWAA 2FYTA 4QPPA 1KPGA 2BZGA 1XCJA 4ER7A 4QQNA 2F8LA 3JWGA 2ESRA 3B7PA 1SQFA 5CD1A 1VE3A 4F86A 2GB4A 3AXSA 2OPBA 4OQEA 5KVAA 4PYOA 1AV6A 2HTEA 2Q41A 4NECA 1SKMA 2AVNA 3KR2A 3G2QA 4AZVA 4YUWA 1RI1A 5GOZA 5EPEA 1YZHA 1Y8CA 1OR8A 4KIFA 3LL7A 5GM2A 3CJTA 2VP3A 5C9ZA 5CCBA 4PYJA 5ICEA 2IDKA 2ZVJA 3GRYA 3NJRA 2IH5A 4X41A 4R8SA 3UJBA 3OPNA 4DA4A 2AN3A 3M6VA 4KWCA 4R05A 3C6KA 5GIOE 3ID6C 5C1IA 2ZWVA 5KQRA 3KR9A 4AZWA 3RODA 2BH2A 5EC8A 1XXLA 4OX9Y 4E2YA 1SVUA 4AUKA 3DLIA 3E7PA 1YFLA 3BUSA 4FT2A 3UA3A 4DM3A 5K0EA 4ER6A 5GP1A 5K03A 5LQAA 2YXLA 5FA5A 3F4KA 4QQKA 4YUVA 3E05A 4GQBA 2O06A 5KS2A 3A7EA 3P8ZA 5FTWA 4RVDA 1BOOA 1T43A 1L9KA 1XDZA 2ADMA 2H11A 3LHDA 2PLWA 2JH8A 2PKWA 3HVKA 3DXXA 5DSXA 3GRRA 4HTFA 4RTNA 4R6WA 3G2PA 5CCXA 5EKUA 3BGIA 3HCFA 4ER0A 2ZBRA 1JSZA 1UIRA 2EX4A 4IV8A 2I62A 3ANXA 3GO4A 3FYDA 4FSXA 5LR6A 4BLWA 3LCCA 3C3YA 5IH3A 3T0IA 2AS0A 3LKZA 5DM4A 4V0RA 5EMMA 3DMGA 5M5BA 3HP7A 3Q87B 3P2KA 5D1HA 1ZGAA 2IGTA 1O54A 1BC5A 2YQZA 5G02A 3X0DA 5DSTA 1Z3CA 3GWZA 3KPVA 2C7PA 3ELUA 1NT2A 1AQIA 2I7CA 3A7DA 3KPJA 3CBGA 4RVFA 5FQOA 3SVZA 3M6XA 1WG8A 1SUSA 3FTEA 3UJAA 3HA3A 4CXMA 1N7IA 3KPWA 1VIDA 4KDCA 1JQ3A 3LBFA 2VS1A 5EMKA 4PINA 2FRXA 2GAFA 2V74B 3KQVA 3EPPA 1XDUA 1QAMA 5FHQA 4EMSA 2OYRA 2IH4A 4YMHA 4O29A 2E5WA 2FHPA 3AY0A 3I64A 4E33A 3FRIA 5K0BA 1RJEA 5EG5A 2ZBQA 4OBWA 2LD4A 5EHGA 1JSXA 4Z2YA 2PGXA 1YZ3A 3PVCA 1QANA 1NW6A 1P39A 3R3HA 3BKWA 5EKXA 4YV2A 4C06A 4GC9A 3GNLA 3RW9A 3UJCA 2I6GA 3LCUA 3R0QA 4GC5A 2BR3A 3VYWA 5HOQA 3R9XB 4QPNA 2G71A 4PGGA 2QYOA 3OFKA 3SR4A 5F2OA 4U7PB 4H0NA 4HRAA 3IYLW 3HCEA 3UJ6A 4RTSA 3FPEA 3G2OA 4M37A 4C05A 1NBHA 3KQSA 3SSMA 1ORIA 3KR0A 3KU1A 4GOLD 3ERCA 4G56A 5CVDA 2QM3A 3BGVA 2WA2A 3GXOA 3OZTA 5FWDA 3ER9A 3EVFA 1P91A 3EVGA 3NVKI 5HIIA 2FK8A 3G2MA 3GRUA 4CWAA 1NE2A 3I58A 3LDUA 3TOSA 2P3LA 3UJDA 3KPYA 1ZG3A 3M6WA 5CVVA 3KQTA 4RVGA 4XCXA 1B42A 3ELDA 1FJXA 3IEIA 4P7FA 3BT7A 5DLYA 1V39A 3EMDA 1G6Q1 2IDJA 4RVHA 3DP7A 2GA9A 3EVEA 3S68A 4GOOD 1P1BA 4PCLA 3AXTA 5JR3A 5E1BA 5KYGA 1HNNA 1QYRA 2P1DA 3EVAA 4YV1A 2ZIGA 2G1PA 3FPJA 5DTQA 1NV8A 3UJ8A 1NW3A 3T7SA 3NVMB 4QDJA 2XYVA 4EQZA 3EEOA 4R6XA 1TW3A 1VBFA 1JTEA 4E31A 1SQGA 3GJYA 3PB3A 2NXEA 5HEKA 2NXJA 5FQNA 5DX0A 2NYUA 4EVIA 2P35A 2AVDA 2P41A 5E9QA 4RYLA 3JWHA 2ZW9A 4PONA 1DCTA 5CM2Z 5EVJA 4XUEA 1QAQA 4EKGA 3LX6A 1X1AA 3AWIA 3TR6A 1ZHFA 2YTZA 3SX0A 2H1RA 3SXJA 5K0NA 3T7TA 3KQWA 2PV0A 3B5IA 3QOXA 1U2ZA 3G8BA 1IY9A 5FHRA 5KQSA 3KQYA 1DL5A 1R6AA 1NKVA 3B3GA 1KYWA 1ORHA 5HILA 4BY9E 2OZVA 3VC1A 4FS8A 3TPZA 2B3TA 3O4FA 4DMGA 2ZZMA 3G7UA 3NWEA 1L3CA 2NXNA 2G70A 3HA7A 2B78A 1SUIA 1FP1D 1G60A 2O57A 1F3LA 2ZZKA 2PXAA 4RWZA 4U7TB 3FPFA 3FUXA 3UFBA 1DUSA 1TW2A 2N47A 3BWMA 4X60A 2OO3A 2AN5A 3TKYA 4EK9A 1BHJA 2ZLBA 3HCCA 2CL5A 5EMLA 4C03A 2CMHA 5D1NA 4MQ4A 2FCAA 1JQEA 2OKCA 4RTPA 4AX8A
chains in the Genus database with same CATH superfamily
3ORQA 2P75A 2BI7A 4JLMA 4LDJA 3UGJA 5KWSA 3NKFA 1LX7A 3C1OA 3CRNA 4ND8B 1L4GA 2WHQA 4I9FA 4E32A 5D87A 1ECBA 2QAGA 5IMBA 8MHTA 5CB0A 3WLQA 3MS7A 3PEUA 4R0NA 3H5NA 4U7JA 3FZYA 3QVVA 1KPHA 4M55A 3GFOA 4F3YA 2HK9A 4R1OA 1KDZA 4BNGA 4ZEVA 4EVQA 1S5PA 4EGSA 4K0RA 2ZAIA 1PR0A 3P97A 3IBCA 4EW6A 4J7XA 1TEXA 3NHMA 3R0JA 2EOAA 4DA6A 3JYOA 3HVJA 3U44B 3DFIA 1DQSA 4Q48A 2I4IA 5HGJA 1UBKS 4WX2B 4O2LA 9LDTA 1DB3A 4Z3OA 2OILA 1JG7A 2H57A 2JD0A 1PR5A 1COWD 2IBTA 1PLKA 4DLSA 3TQTA 3TVTA 2VN8A 3QV2A 2Q8QA 2HJGA 3WRVA 1C3VA 2P3SA 3RWOA 3PC8A 2TS1A 3TUJC 2Q1XA 3FSEA 2HCBA 3NHUA 3ES9A 4DDWA 3LKVA 2YV2A 4DIDA 5WRFA 1SHJA 2VZLA 2GVNA 2HN9A 1WABA 2PE5A 1ZGJA 4LGVA 5BV1A 3HB7A 4LJ9A 4NG4A 3AL2A 4WA8A 1K5DA 1MUUA 4EUSA 2Q1TA 2H2HA 3B1XA 1WQ4A 3C14C 4G1VA 2QN8A 1VKHA 4BO5A 1JLLB 2QX4A 4KGDA 2W2OA 2PD3A 3T52A 4EKDA 1T3LA 2BKAA 4KIUA 2FH5B 1KU0A 5B53A 1H6DA 1K1EA 1MT0A 3NOXA 1IG0A 2Y1EA 3AY6A 3A37A 3PX3A 4PQRA 4CMIB 4BS9A 5MF6A 4AY6A 1FC0A 1XPUA 3CLTD 1MFZA 1L5LA 3RC8A 4P3PA 2VT6A 2BYTA 1RHQA 4M76B 1NUSA 1FNNA 1NAHA 4G36A 3PWZA 5EAIA 1SD1A 4O2RA 4O2BF 4M0KA 4TM8A 5I47A 3JATB 3LE8A 2H7YA 4C04A 4ZU1X 1V0JA 3OX4A 3V80A 3W5BA 4PNEA 1L5WA 2ECQA 3CXRA 3NKLA 4TMVA 3D0KA 2GBLA 3BH0A 4JXZA 1HGXA 1EVLA 2NQ8A 1OH6A 1EJ2A 3LBYA 2XQVA 3VHRA 4YP9A 5C1PA 2DOKA 4HADA 2VDLB 1D9ZA 4KIWA 4RMHA 3O91A 5BW4A 4HWOA 3ZVRA 3GJZA 2UZ1A 2DUNA 1P1HA 2IQIA 2WOJA 4FQ7A 3M89A 3ZHOA 2IZOA 2BD0A 4QYWA 2GN0A 3E8MA 2Q6IA 5TRTA 1TKAA 3B7WA 3JQ8A 3P0IA 4D3YA 4LV8B 1VCNA 1ZSYA 3JXEA 1E2BA 1KZ9A 4YRRA 1AC5A 2I1LA 3JAKA 1IBKB 1S2MA 4CEIB 2QJFA 1J70A 4UFOA 1R9GA 2NPIA 3I4CA 3ICWA 3JWEA 1X7HA 1UWKA 3PQ6A 4BHTA 4OI2A 1UBGA 1JBQA 4INJA 5ALEA 3U4QA 1CY8A 3KQMA 2QTWB 4M1SA 2PKXA 3EIWA 2AQKA 2V9CA 3C7KA 5DB4A 3SVTA 2ZI5A 2VH1A 5U4QA 2IGBA 1HWYA 1FNBA 3QHPA 4C08A 2ZI6A 4P7BA 4YMGA 1UMKA 3GGPA 2OGUA 4PX3A 3EIHA 3RTEA 1HKUA 2G6TA 2YOFA 5E95A 1EDZA 1OC2A 2ZCUA 2VTBB 1E1QD 3ZZ0A 3WL4A 4L4ZA 1OPRA 4TKMA 4P53A 4XB6B 2P0YA 4R84A 1WQ3A 1CRQA 3PXBA 3DLBA 5B2EA 1K88A 3WGHA 1UWLA 2I76A 5F77A 2YXDA 2BMFA 1BNCA 2QN2A 1YOVB 4O2BA 3T7EA 4CG3A 3FWHA 3ECAA 2PNJA 4G2NA 4UZFA 3TSCA 2CHQA 5IULC 3T7DA 5EZYA 3LVQE 3H13A 3TR5A 1B16A 2BEJA 1T4CA 4QOFA 4ARCA 4Q1VA 1A98A 1TL7C 4L9SA 4GH5A 4PNPA 5AKHA 1G2IA 3SP1A 3I1IA 3OJXA 5JSKA 2XTZA 4H7IA 3MK31 3OI7A 1ES9A 1N3IA 1R8JA 2C7QA 2FN4A 3AVQA 1T1SA 3OPXA 4C4OA 1JILA 5IFLA 1QTNA 2F17A 1QG4A 3D6MA 3FROA 3IDOA 4Q15A 4YWJA 1PGNA 1LBSA 4MW4A 4R69A 1IOVA 4Y2TA 2NN3C 4B3FX 4UFPA 2VTBA 5EIEA 3VNUA 3CVXA 2V55B 1UJ6A 1KDYA 4MQFA 2YVQA 4HB4A 1FIUA 1UKVY 1N8SA 1ZL2A 3AEQB 3AM5A 3JVEA 1XHEA 3SDSA 4FYIA 4AWBA 4D46A 4F12A 2V1XA 3K20A 1Z2EA 3VHXA 2XMBA 2G5GX 4XJTA 5EE9A 1V95A 3ZZTA 1UK6A 3V9AA 1X70A 2VUUA 4YP5A 3LFTA 3MMSA 3PR3A 1ZN2A 2R85A 3CUEF 2A4MA 4QGFA 1PFKA 3PI6A 4RMGA 5BSUA 2GGSA 4PM4A 2PGOA 4NJMA 4WBSA 5HK8A 5LQKA 4ZV9A 1MXFA 2OZPA 4YR7A 3AVTA 1XRLA 3GJ3A 3JQFA 3TO5A 4DR7B 2G77B 4KPUA 3O4VA 4JBGA 2VPIA 2C0QA 1ISMA 1NDUA 1YB4A 3AM3A 4JSTA 1GAQA 3BCUA 3G82C 4IIDA 4TTIA 1YQXA 1A8HA 2ORWA 3C6MA 1K3UB 1SIUA 3DQZA 4QU0A 3I1FA 3G0OA 4RX1A 1KF0A 1WCIA 1XWFA 3AYZB 1NUHA 1JAIA 3TECE 3OCCA 4ZN6A 3ADDA 2A33A 1QVRA 3AR2A 3PC3A 5I7HA 4GOXA 1IIBA 1E1CB 2ZRAA 3H97A 4OQ4A 2C7OA 3AK4A 4IG9A 1LY1A 1T4MA 1V3QE 2B8TA 2CKDA 3QLTA 4WNAB 2UZ1B 4L15A 3VOTA 3K1AA 5K3AA 4WNCA 3RIEA 1AUXA 3VU8A 5CX1B 5KYYA 3DBOB 5KB3A 2CLLB 4AKSA 1IB6A 1YKFA 1Y48E 4IF4A 5E8JA 1U2GC 3WA6A 2QRQA 1QE3A 4ZYWA 2EYUA 3LWZA 2AL7A 3U4GA 3IT3A 2OV6A 3ESCA 2Y1LA 2VJCA 3O83A 2PGIA 3WAKA 3GZNB 3WQHA 1N2GA 4MJ7A 4DQXA 4UHKA 4L5AA 4NJOA 5D86A 4ZYTA 5DHSA 4UVDA 1U2DC 5ESWA 4XRGA 4BKRA 5EHQA 2K4MA 4OHRA 1VE6A 2H1IA 5AP9A 2I2AA 2LCFA 1JP7A 1EBBA 4J1SA 4JXJA 4PRKA 4LUCA 4JOCA 2YFHA 4CUKA 1O6BA 1UL1X 2ERXA 3AT1A 2XKBA 2V7TA 1EINA 3C6QA 3IOEA 5LZ5A 4DCPA 4Z51A 1QLHA 5EFZA 4BNNA 2ZT8A 2XNDD 2ONKA 4ZVSA 3RI3A 1FVHA 1LI5A 1Y42X 2XWSA 3UKOA 3AG6A 1XGKA 4Q1AA 1IQPA 1FDSA 2QX8A 4PR3A 1OROA 4AF7A 1HMYA 1IUPA 4MB2A 3VZRA 4IIHA 1VPVA 4LKRA 3UMRA 1UC4B 4ZICA 1ILEA 2VXCA 2CK3A 3FMOB 1EDBA 3O8NA 5CX1A 5KYYB 4H0CA 4L08A 2WJGA 5A5DA 1OZGA 4WXHA 1Z08A 2A14A 4WNAA 5K0FA 4WCFB 3LCMA 3QFHA 2O2GA 4MUHA 1WULS 5JH7F 2CEKA 2X8JA 1WX1A 1G63A 4QNRA 1ACMA 1ZPDA 2RKBA 4LRYA 1RBMA 3SZMA 4DCUA 1D2EA 5CYOA 4F4IA 2P9EA 3I5XA 5A5FA 3AVPA 1VE3A 4CM8B 1CUGA 5ELMA 3T0GA 1UMBB 3V4SA 2OPBA 1ST2A 3S6JA 1VJ1A 5CP8A 2WJ6A 2HTEA 3THOA 5CH8A 3SQOA 1UBCA 1RXSA 2WEKA 4PLPA 4DC1A 3SYNA 1OFUX 3H2KA 1SY7A 1VRCA 3I42A 4Z3DA 1OXBB 4JDUA 1SOVA 2W4IA 3VO8A 3EG5A 5G0VA 5A4IS 4YO8A 2F55A 3C97A 5B3KA 3UJBA 1UC5B 1FDOA 2BUCA 1AQNA 3EZ2A 3AESB 1YR9A 2Z4TA 5F52A 2Z5LA 4XW2A 5FLKA 3E9QA 3C6KA 4JEUA 3QNMA 1W30A 1TM3E 1B43A 5T4EA 2ENUA 1I1HA 4XIJA 3RODA 1FSGA 5EC8A 4AF6A 4K5QA 2C20A 2OM6A 1MEJA 4MRAA 1R0BA 1Z5VA 1ZH0A 3A9RA 1OXKB 2BFCB 1H5QA 4QBHA 3RAJA 2HPAA 1T3SA 3E7PA 1VIYA 1L4YA 1US8B 2EW8A 3MWJA 4GRDA 4RPLA 1DHRA 1KK1A 3IA7A 3DVRX 1CYEA 2HQ1A 3MSXA 2V59A 2G88A 5FFMA 3T9BA 4IVQA 3UUWA 5B7NA 5BUSA 5FPPA 3TGPA 1X2BA 4XCVA 2LP4Y 3ROEA 4MWBA 2X9NA 3OIDA 2I4RA 1RXIA 4NJEA 1HG1A 2IF2A 3ANXA 3C5HA 1VC2A 1G5TA 4RA9A 3RSHA 1HLFA 3AIMA 4BUZA 3X2EA 3H5IA 3PJFA 3WWEA 2BTQB 1OV6A 2ZTLA 2OGZA 3NBFA 3ESDA 2AS0A 2ODQA 4R2WA 3SS7X 5DM4A 1FRVA 4JC4A 4P4UA 5FBRB 3DE0X 1OBFO 1V1RB 3A9WA 4N8DA 3RFVA 5IABA 4RA6B 1TX4B 3VI4B 3HCRA 4WK0B 2ATVA 3GWGA 2GF2A 4L3WA 2Z1NA 5JPCA 2PNFA 2GF9A 3A4IA 5CJ2A 3VMMA 5KYUB 4TX1A 2W11A 2FSHA 1PI3A 1V1JA 3CBGA 3QTLA 4WV3A 3HM9A 4ND6A 1O96B 1YUNA 1U5AA 4H6XA 4C4ZA 3U4MA 1N7IA 4PF1A 5KKAA 4D9GA 5I7AA 4AY4A 1ZH4A 1FCJA 2VP6A 1NXQA 1RNLA 3EOZA 4E21A 1U9IA 1G3MA 1BXZA 3OCYA 4RADA 1CUIA 3F8WA 4U02A 4IXNA 5E6RA 4HYEA 2HQSA 3WWCA 2WWGA 3UHPA 3K70B 1NUAA 2XCTB 5DU2A 3ZK8A 5HW0A 4XVHA 5B1IA 1T5LA 2GBLC 4KLRA 3RLIA 3R9WA 3IHKA 1SH7A 4TRMA 4C89A 2JLSA 1H2YA 3LPLA 4IG4A 4R8KA 4D44A 2Y9MB 1EX9A 2DCUA 1F60A 3NOQA 3RC7A 5LVAA 5H70A 1DBIA 2EVWX 2XCLA 4JLKA 5LOVF 1IN6A 3FNFA 4LXIA 3MHPA 4EAQA 1QYXA 2VSOA 4X3PA 3TXXA 4RLHA 2JAPA 2O3QA 1Q57A 2WZQA 4LZOA 3GF4A 3UYLA 4E03A 1EXWA 4BQNA 2GAIA 1RKBA 1ZWLA 5BW6B 3ZWKA 3ZJ5A 1DOHA 4URVR 2C7BA 4DIMA 2XUDA 3A6FA 3RVBA 3JQ8B 3KCNA 3WRXA 1Z18A 1C0LA 1A2KC 2GWRA 3EVGA 2DKFA 3PGXA 1MB3A 5IFKA 1PT6A 3JRXA 2JDID 3MUEA 1NOIA 1VLHA 4YAGA 2HU8A 5D7BA 3UJDA 1U9YA 3D4IA 1XCBA 1CP3A 2YHIB 3E9ZA 1GQSA 1B76A 2COKA 2IHVA 3OE1A 4Z8XA 3VPBA 2O7NA 2NAPA 4GIBA 3ZCXA 1C2YA 2FF7A 3IAM1 2R751 3R77A 5CNIA 2QRJA 3MXOA 3TCNA 3ORRA 3Q3HA 5JR3A 1TVEA 4BYGA 2W8BB 2V4MA 1T10A 1HNNA 2C2XA 1XKQA 1LRJA 4G81A 5B4TA 1XCGB 1KYTA 4RHFA 4INPA 3AR5A 3I2HA 1G64A 4QEKA 1NW3A 5JBIA 2JAUA 3ADOA 4QDJA 3DTVA 3Q6MA 4PRZA 4R6XA 5IDVA 4A23A 3R5TA 5AVWA 5DXFA 3TW8A 3CEPB 2E2WA 3CSUA 3MWEB 2HX1A 4L8GA 4GPBA 1GTG1 1ZZGA 4JT2A 1M7BA 2P41A 3TLEA 2ZDGA 2JIZA 5G0WA 2BGIA 4GR9A 5KC9A 1UXKA 4R54A 2H6EA 4G65A 5JZOA 1ZHFA 1J9GA 2OVBA 1QHIA 2VJQA 1U5CA 1T5TA 2PV0A 4ND1A 3WBBA 1HDIA 3VV2A 4B48A 5JQGA 4QC2A 3MIZA 1P5ZB 4Z9XA 3EXEB 3V8BA 4JH0A 3ZD6A 3H05A 1WV0A 4RHYA 4G67A 1PD0A 2FX3A 4ALLA 2Q62A 1HY3A 2C04A 3RYCB 1PK9A 4HLQB 2PHZA 1UXHA 2AK3A 3B5EA 2EP7A 2JCYA 1UH5A 3LQ4A 4OPMA 2N47A 2PR2A 1HLPA 3FYTA 2XT0A 4FGWA 4X71A 3HCCA 4D9FA 5SZJA 1QIMA 1ZSVA 3GX1A 4AJJA 4MQ4A 3DKVA 1U0JA 2Y68A 4BZXA 3UMYA 1E4OA 1Y89A 2WYHA 3VR5H 3U37A 2ZIEA 1XL1A 1O2DA 3AGQA 1PT5A 3H2BA 5DNVA 5DHTA 3BRSA 2ACVA 3QVLA 4J9UE 4AN4A 3Q7RA 2H2FA 3NYIA 4WGGA 1FFYA 1I6MA 1QIHA 4UBJA 4LHXA 3B53X 2KI5A 5CAEB 2R1UA 4DIOA 4LHVA 1U1IA 1XD9A 3RK4A 2B69A 1MIOA 2XD4A 5B6JA 2O0HA 2UYOA 4N9QA 1G5QA 1N7JA 2FOIA 5AM3A 4HAUA 4NCJA 4JENA 1RWQA 4RY2A 2CLKB 5F7ZA 4HV4A 1O7JA 2R6ZA 3GFVA 1SOAA 4QLBA 2NP7A 1HETA 1ZXXA 4WE3A 1L4KA 3UUFA 5DLQC 3K9CA 4JBNA 1B1CA 1L2TA 1JE1A 5KSZA 1CY4A 3LWBA 1FU8A 1YU6A 3THWB 1CQJB 2R7LA 2AF4C 2XA9A 4NARA 1U4NA 1LBQA 1UK7A 4G4SP 4C6TB 4CKBA 5AVQA 5T5QA 1A9SA 5KSOA 1IN7A 1D6SA 2I7DA 3W5CA 5K45A 3BSFA 4LGYA 1TYCA 3OQIB 1KDPA 4GQIA 2CDCA 3VSCA 4UMDA 4LQLA 4ZGBA 4IJQA 2JLUA 3LPMA 1LPPA 2YRXA 3IKLA 1N32B 3OTOB 2I7XA 4B6JA 2QX6A 1TF5A 4ES6A 3DPIA 3PQ7A 3ANNA 1E2LA 1Z2CA 1JU9A 1LPBB 2BR4A 4ZCQA 5THXA 1IG3A 4DV4B 1LSJA 3I2KA 5CDYA 4FMPA 1AKRA 4N9WA 2RJ3A 1PFWA 3AGPA 3LUGA 5FX2A 1XTVA 2ZYHA 4IEIA 4BOYA 2P8JA 3CZ5A 5F2NA 1XTPA 3WLTA 4G5OA 1YZYA 1MW8X 1D1PA 2JGDB 2ZQYA 3IOMA 1FNMA 1YACA 3OU7A 4MR9A 4MW2A 5FWAA 3OEED 3LKBA 2G67A 4RVOA 4DTIA 5K05A 5EXSA 2GRAA 2WP8J 1DTWB 3BH6A 2BEKA 2ZBDA 3A10A 2YXPX 1XCOA 3NUQA 2O52A 4XFKA 4CKWA 1TVKA 1OOEA 2RAFA 4OKIA 4IWXA 1YS2X 5J5VA 1T0UA 1TU0A 3FZEA 4LRQA 3WL5A 2GKOA 5CGZA 1CR4A 2PBFA 5LKRA 2V0NA 3L8DA 1G21B 3PICA 2VYVD 5LLDA 4DLLA 4GWKA 4N01A 2XMSA 1SG9A 1SB8A 2JH9A 1NPTO 3PQ2A 2OSVA 5J4LA 5AVTA 6Q21A 2CNWD 2YWRA 4JQCA 3OKFA 2DTXA 1JYEA 5JSYA 3X1YA 3HM2A 1P61B 3MCTA 4WFJA 4UQLA 5HKKA 1I4EB 1XZGA 3MERA 3DZ8A 4P3XA 1YHNA 4N39A 3O9MA 4QJ4A 2Q3JA 3UB2A 3UQZA 2PO7A 1TQ8A 3I6MA 3TOZA 3ITKA 1MOZA 4HQOA 2DLNA 1VKZA 3EA0A 3JQCA 3OMLA 4K9KA 4ZO9A 1RWVA 3VH2A 4ZEWA 2OKGA 3DDHA 2BGGA 5JADA 1YDFA 3NWBA 1ZOOA 2QIOA 3REQA 4KFSA 1BH2A 2D3TA 1YVUA 1QIGA 4BO6A 5BRAA 3A1TA 3ADPA 3TCKA 3RRFA 4EENA 1Y1TA 4LRXA 1VL5A 2OFXA 1SAYA 1UIMA 4QGGA 3FPGA 2J3IA 2AOTA 2F4NA 1Q21A 1KMCA 1Z5OA 1KP9A 2XYQA 1F9AA 1NTRA 2FN7A 3E0QA 1SPBS 4GWGA 2PWYA 5LQNA 1W4RA 1WNFA 3FYHA 4FBMA 2DX7A 3CH7A 4EEZA 2CLIB 1WHTA 2GK4A 4GO1A 3UXHA 1N34B 1U3TA 1NE7A 2UVPB 2V65A 3GU3A 5CITA 4RCVA 3KTDA 4J07A 3PF8A 3IPRA 3ZS8A 1KKMA 1UQTA 1P1JA 3X2FA 4EFDA 1TTHA 4RZ2A 1JHDA 1N0VC 1Q84A 5CAEA 5LDDC 3HXQA 4L9AA 1SVWA 3B70A 3F6PA 4TRNA 3HL0A 2RK4A 3FMVA 4FINA 1PKXA 3UTDA 4ZT3A 3R75A 4JJAA 3RF7A 1DKPA 3TQCA 3V1LA 3IELA 4KPFC 1YBMA 3H6KA 5BSRA 1LX6A 4OHKA 1U7WA 4ZT6A 4LX8A 1K7XB 5U1PA 1QPBA 4CHTA 3E82A 2HT6A 3IL2A 3KSRA 1J0DA 1E1QA 2B4QA 2EF1A 3CKKA 3CRMA 1JEYA 1E32A 4NBUA 2WT8A 3M49A 1A95A 1YQWA 3ZS9A 3FCUB 2OBNA 3TBFA 4R01A 1NC1A 3GA0A 3LT5A 3V4VB 3RGGA 1B7GO 4RHXA 2VCHA 1USVA 1OJLA 4B74A 4XM1A 1XCMA 2CXUA 2JPDA 1CY1A 4XWKA 8LDHA 4AU1A 4GEKA 1RQ7A 2AJCA 1FW8A 1FU4A 5HKKD 2ZBGA 2I3DA 1RI4A 1YJXA 3CEHA 2VK2A 1YBFA 2XWPA 4IVNA 4JP2A 4IRXA 4LYDA 1CIPA 2C3UA 3TZEA 1X7GA 3R0ZA 3OX2A 3IAM6 3PHGA 3SR3A 4PC7A 4EUKA 4GZMA 4INZA 5E2BA 1AGPA 1XG5A 2HBRA 3OEHA 1K6JA 3CKLA 3F71A 5BSMA 4DMHA 3WC4A 5LZ4A 1XZHA 5E2IA 2QRKA 5EUCA 1AZSC 2YHBA 3DTVB 3KZMA 4LCEA 2VF8A 5IRCD 1K6EA 1P4RA 4UPVA 3CNOA 1K97A 1J2YA 3PXCX 4IJWA 3FSGA 2JG3A 2RHOA 3QUAA 3HBFA 4YK7A 2R11A 1JU3A 3CVUA 3HFGA 2FMFA 3NO4A 4HNHA 1HYQA 3LWDA 4P58A 5TT0A 3KTAA 1YD7A 1FYFA 4FZJA 5K0ZA 1I3OA 1R3DA 4MGIR 4QULA 3HCWA 3DFKA 5JWHA 4EZIA 1QHFA 5JEEA 1SQ0A 5CT9A 4KN9S 5LYJF 1VIVA 2OD9A 2BFOA 2PFKA 3KQPA 5JFTA 2QPLA 4Q9NA 2YYSA 3PL1A 2Z6VA 4MCAA 3SBXA 4CTNA 5TMDA 3LT1A 4JLJA 4KN8A 1KFBB 4LFBB 2IPLA 2FWNA 3CUUA 3R4CA 3I04M 3MJTA 4BTLA 1HI9A 3HWWA 3BEDA 4MI1A 3BMNA 2BEUA 3FPBA 4OJNA 2IPXA 4JT8A 4XIYA 1M8GA 3CZCA 3DDNA 1MH1A 1R88A 5F9HA 1ZUNB 1O9GA 2IUUA 1JA0A 4EARA 4BNIA 1X1RA 3K2QA 3RREA 1E8MA 1QHGA 1R74A 2PT6A 3FHLA 4OREX 4E5NA 1E0KA 5AVOA 3VVMA 3TM4A 2JGKA 3ICEA 5FOSA 2IZ1A 5DBFA 1OT3A 1QNFA 2PZKA 3T4EA 3ZDCA 3WAJA 2FPXA 3I5MA 4BZQA 5LC1A 3PJEA 1Q12A 3NHYA 1R37A 1RKVA 4JVLA 4L6IA 3MOSA 1XAGA 3LRTA 1YIAA 3MYRA 1TMKA 1OXMA 5GINE 3HCPA 5FNVA 1Z16A 1NC3A 1Y6QA 4NDNE 2Q3EA 2AHRA 5GOTA 3KLOA 3D8HA 5T57A 3TGWA 1DIHA 4EZBA 3SJUA 4Z3KA 3TOVA 3KSAC 3WRXC 5J9FA 1KMNA 2RONA 1Z2NX 2OCIA 3FDZA 4MS4A 5IXYA 5FJJA 3RVQA 2ZYDA 4W5WA 5AKLA 4YAKA 1C5KA 1M6HA 2ODAA 2X4LA 4FGJA 4XWTA 3NVAA 2W5UA 3K15A 3PYMA 2ZANA 3DEAA 3S99A 4MI6A 1ODJA 2VSQA 4HZUB 4LSWA 4RKEA 3S5UA 4CMAA 3T6KA 1Z63A 1JW9B 3KWJA 1KI4A 1YDEA 3PIDA 3EUAA 4NRDA 1S9DA 5E3IA 4Y2RA 4C9BA 2X4DA 5CJPA 4CMHA 1RBYA 2JBAA 3GRKA 3URMA 5JOQA 1EDEA 1MQ9A 1KETA 2XGJA 2WSBA 1WD5A 1OTXA 3FMGA 3N9IA 3U49A 3BZWA 5BV8A 3WB1A 2C5GA 2XMCA 1BEZA 3PFGA 4PAWA 4TL7A 4W99A 4HXYA 1I3CA 4YRIA 4BGIA 4POOA 1NM5C 1YGPA 4KVGA 4D45A 2IP2A 1QTIA 4Z54A 3MJRA 1FLNA 2C3PA 2PX0A 4OQDA 1J42A 1I24A 1P0CA 3EHEA 2I4NA 4A2WA 1Y8ZA 2D4HA 2WTEA 2CUNA 3WJ1A 2EJBA 5FBZA 4GDFA 1RQRA 1TJYA 1F3OA 4PG8A 2OOSA 2WSIA 4CL2A 3AQIA 3PNBA 2F3PA 3IE2A 4F86A 4RW0A 5BQXA 1SWVA 5ITWA 2H2IA 3IS3A 4G26A 4HB3A 4QWMA 3ZW9A 5I3CA 5F7XA 3C45A 2VLIA 4NECA 3O4IA 3RC2A 3R3ZA 1QUEA 3NJ4A 3R6DA 2IKQA 2PN1A 1SVNA 3HU2A 3WNVA 3CNQS 2I1QA 3VU9A 1ZCJA 1PGPA 3R7BA 3KJGA 3P4YA 4GZLA 4JUFA 3EN0A 3U3RA 3WV5A 4OB8A 3T5PA 5CCBA 1BU8A 4KKVA 4CT5A 2CXRA 2ZVDA 4CU5A 1XRSB 3PE3A 4B3IA 3DOEA 1IEVA 4GICA 4S05A 2ZWOA 2EZUA 1JEOA 2XJ9A 2EX1A 3P9XA 3PUYA 4HDMA 1KAEA 3O7MA 2XY4A 2PS1A 3F98A 3Q7QA 4NI5A 4TYMA 2KE5A 1KK0A 4GXQA 3U4DA 4DDTA 4AY5A 1RQ2A 1YB1A 1XRMA 1MB9A 1H6AA 3WNQA 5JCOA 2CBXA 3LZCA 2I55A 4G9BA 3I8XA 5ERXA 3A4VA 4K3VA 4JT4A 4Q3DA 1SVUA 3EY4A 2B98A 1NVXQ 3GGJA 4BP9A 1N0WA 4FT2A 4GKAA 5EQTA 2X2EA 1L5OA 1I32A 3IMKA 4K6HA 3NTUA 3MQ4A 3KLNA 2ZTUA 2VJYA 3AINA 3HLTA 4NQRA 4J91A 2VPXA 3S8YA 2Z95A 3CF4G 4MW0A 4H59A 4CL3A 3G5AA 1B3BA 2W48A 3AUUA 3O84A 1IAQA 4TUYF 2G0TA 2YJ3A 5ALMA 3AI2A 3FPCA 2EP8A 3EXIB 1JSZA 2GX6A 3OE7D 4TWIA 2G36A 2IWHA 4D9MA 2PKEA 4Q7JB 4JP5A 3KYJB 4XIFA 5LR6A 4ITRC 1OI4A 3W05A 3L0YA 1M2KA 3W2HA 4X7RA 5IM4A 2RKOA 3FR7A 1YE3A 2IIQA 1E77A 1XELA 2XOKD 2FG6C 3K8ZA 2WYUA 4PLWA 5BSVA 2A57A 3LD9A 2Q5FA 3P2KA 4S12A 1KQNA 2JJ1A 5CD9A 1MB4A 4Q3OA 4WACA 1P7CA 5H1YA 4LXQA 4PTLA 3KKKA 3KPVA 4C29A 4TTPA 2UUPA 1ZFNA 5T41A 2FXVA 3KPJA 2DU8A 1U3FA 1G20B 3ZK7A 1BQEA 3W2IA 4NYMR 3WB0A 3FN4A 3KKEA 4UU7A 5AHRA 5D5HA 1JGTA 4BRZA 1JQ3A 5DNAA 1JAXA 2J6HA 4H4EA 1XPRA 4KYUA 4DCNA 5AQ1A 4C5CA 2C8KA 3MBIA 4CKWB 3EIEA 2O8CA 1DAOA 1GPMA 1PQ4A 1V6CA 1G9XA 1JI0A 1T8WA 3CURA 1BWRA 3IMEA 4DQUA 3U3OA 4Q12A 2FHPA 3BORA 5K0BA 4NBSA 1REQB 1N2SA 3HWX1 2A7QA 1BFDA 1C50A 1WU7A 4IKEA 4JNKA 1YIOA 3MGAA 4P2BA 2PKRA 2TMYA 3T1QA 2PGXA 3DL0A 1KSFX 3GJ8A 2X0DA 1I5OA 3VHLB 4LNUB 1TUIA 1CHNA 3R3HA 3CU5A 1N3LA 4KMMA 1YC2A 4MDEA 4OB6A 2O50A 2FX2A 1GG8A 4UMFA 4DADA 1KGDA 3RSQA 2HMVA 1EUCA 3U62A 1XEWY 2WM2A 4TGLA 5I4IA 5CXSA 1O4WA 4YJFA 3BTUA 4DCOA 3UJ6A 2Z57A 2O7RA 3BHJA 4J8PA 2ECKA 4OJQA 4Q4AB 3NDPA 3KR0A 4XB1A 4R9SA 4D96A 3IQWA 3WYCA 3N6XA 5HCIA 1YKGA 4AP5A 3V4PB 1WCIB 2IYXA 4FYHA 3WK8A 4UBOA 1IWBB 3QOYA 4MCHA 1PW5A 1XPJA 5E4YA 5H3CA 3PEWA 2OAQ1 3AV0B 3GVXA 4O8CA 3I58A 3STWA 2XMGA 3OJOA 3G23A 1Z75A 4Q1BA 1T5HX 3MLBA 5LPNA 1OLSA 3JVIA 2HUPA 4JKOA 2XCUA 2O8CB 2D2VA 4YJKA 3V33A 3UWMA 1V9CA 1CVIA 1O89A 3PA6A 1RQNA 5DCLA 5JNWA 3FLEA 1MIOB 1V3UA 1VI6A 5HUHA 1E5XA 1O57A 2YXBA 3R40A 3A06A 4JUBA 4GLJA 3ZV4A 2D59A 1NJ5A 1G0OA 2OXEA 1ZJYA 5TY0A 3H17A 3QPCA 3SIRA 3HP4A 3QUBA 4UHEA 3SIPA 5AKEA 2JATA 1IBCA 3JQAB 4KNVA 4O3FA 4UU8A 1R4NB 1RXCA 3GMSA 1Q77A 4RXUA 1GTSA 3DV0B 3OF3A 1CQWA 3V8RA 4Q18A 5LU8A 4E31A 1JTEA 1VBMA 2EJVA 4DDVA 1SQGA 3OTHA 1NXSA 2H63A 2GM9A 2M9MA 3GGOA 4ZOLA 3RNOA 2GO7A 4RK0A 3PNLA 4F8JA 2QR3A 1Y8AA 2AR7A 4RYLA 3T1OA 1I7DA 2NSLA 4TXMA 4WSOA 5K5EA 5AVYA 3QYAA 1BMFD 4X24A 3HJUA 1G21A 2HYIC 5K0NA 4H1VA 2WWYA 3SZUA 2AZ4A 5FHRA 1HPLA 2ZSKA 4LF6B 3GLFB 2F4VB 3KSUA 1LDEA 4AJLA 2IPMA 4EPWA 5AVZA 5DEIA 3CBQA 3L0IB 1KQ3A 2JW5A 2YBEA 3R5KA 4LBYA 4W5RA 3NWJA 5FUVA 4ZD6A 4MA0A 4P4SB 1YU9A 2JI6A 3C41J 3O1HB 5AW7A 2OCAA 3UFBA 1KEKA 1CQPA 3VU0A 4MP6A 1U1EA 2WFMA 3SK0A 5BP7A 1R8SA 2Q2QA 4LMRA 1O97D 1H8ED 4KXVA 1RAIA 1FW6A 5HSGA 1HOTA 2F3UA 1M7HA 1Y3AA 4QTUB 1P0MA 1X1BA 3GZTB 4XUDA 1SHKA 1HKHA 3SQLA 5HX7A 5KJCA 4PQFA 4D4GA 2ORYA 1QZZA 1TMOA 3DONA 4EHFA 1O8BA 2QY9A 3TPFA 3MILA 5F12A 3A6PC 2H5LA 4PS1A 1GL9B 1L4MA 3ICQB 5AI8A 1M76A 1WP4A 1KJJA 2XBMA 1A9TA 3GYGA 4NE7A 3VKHA 4F7DA 1F48A 4J76A 2G82A 3M1YA 1TCCA 4U1RA 4C0SA 1DBSA 1ZMBA 4Q1CA 1E1RA 4PYIA 4BQQA 4EJSB 5I6DA 4ZARA 5KNCD 2DTDA 2HWKA 1HR0B 1X7ZA 4MMXB 4DFDA 5JDCA 3DMDA 3STUA 4NX2A 1CQJA 2ZUCA 1DZ3A 2JC3A 1GOTA 4ZVLA 1MJGA 3TTUA 3LGAA 4RFVA 2Q5JA 5F2KA 4TV8A 4I1PA 1O5IA 5K3SA 4P9NA 1BROA 2LE0A 1UOEA 2RHTA 3GHYA 1E9FA 4G8BA 4MVXA 4P4SA 3D8UA 4YJ2B 2ZBFA 2DULA 2E85A 2W2LD 1T29A 3WDLA 1X13A 4BB9A 1GKLA 1F7UA 1DZIA 1QQTA 1BE1A 1B0ZA 2AJ8A 3CLTC 4I99A 2DB3A 4WXEA 1JV2B 3EEYA 3GRZA 1DAHA 2JGAA 1X9GA 1XVAA 4XLTA 5DM1A 4DA0A 3G1WA 4YCSA 1E61A 4IIBA 2CVZA 2HIAA 3B6ZA 1WXXA 3CUKA 3OU6A 1NL3A 3FETA 4URZR 1YFZA 3QBJA 3VJLA 3VKUA 5EEGA 1N2BA 1P7YA 4H1UA 1TZCA 4CMKA 5B6IA 1OI2A 1W88B 2BKXA 4Q37A 2WVJA 1RSZA 4YBZA 5HFAA 5JTUA 1FZTA 4KQ6A 1QB8A 4MAFA 1NRWA 2ZSUA 3P0JA 4ERNA 2NO9A 4G0YA 4HBZA 4HQFA 3NS7A 5I9TA 3TSOA 2PH7A 2X0JA 2AT1A 4GI1A 4MCJA 4N0MA 3S40A 4DTCA 3IEUA 3LZDA 4EJFA 3CVJA 3GUYA 3PQEA 2B1JA 4BFWA 5TXGA 4RELA 3KAJA 4OGGA 5JBQA 2IZ7A 5EGNA 2JZOA 4EA7A 3FCEA 3FDZB 1U5BB 5FWYB 1II8B 3HWRA 1L7AA 3ELBA 1WB5A 3DKKA 4HFMA 3V46A 1ZN7A 4U63A 1G55A 4P82A 2VWPA 2DXIA 4Q3NA 4FU0A 4AECA 1VHTA 3AILA 4OQMA 3TZLA 1R18A 1JQBA 4BO8A 1P77A 3QWIA 1AS3A 1CFZA 1PUJA 2R6CA 3ZE9A 5AD1A 2FDXA 3DE3X 1KJ8A 3DAOA 5EIBD 4FDTA 5COBA 2IV2X 4BV8A 1J9EA 1T9KA 1FFXB 2DMRA 2NZJA 2Q3LA 1YWGO 2ZB4A 4GI3A 1D0SA 3DZIA 4ANFA 5KMGA 3IAXA 4NLLA 1A5BB 4RESA 4XX0B 5CURA 3IEXA 4L74A 5BR4A 3R3UA 1AS0A 2VPZA 2X5KO 3B78A 3CN9A 1TT5A 3MJFA 3ZLUA 3ZGLA 4DNFA 2PZMA 1FBNA 3IP1A 2AMYA 3WB9A 1QHXA 1GUDA 3ABIA 2J5RA 1B2RA 3EBPA 1JMVA 1GGEA 3WAGA 9ATCA 1KOGA 3LW8A 3FNIA 3U1BA 2Q5LA 3AP2A 3F1KA 2IE8A 2YV1A 2QVBA 5J4HA 3DVLA 1LTKA 1I5EA 3ODGA 1U0BB 2IU0A 3JQ6A 4CM5A 2C4HA 1PGJA 5BV0A 1GP2A 2LRHA 5EMJA 4PZEA 3ZV7A 4GRAA 5BXYA 1OASA 3Q6NA 1Z26A 2NZ8A 3L0BA 3S2GA 3W8FA 3CLKA 5HZHA 3HTXA 4UBIA 2QI9C 4C7MA 1I2CA 2AOTB 2OBYA 3B8HA 4GZ5A 3USCS 2DEUA 1I14A 3GLTA 3C3PA 3TNFA 3P9ZA 1A4IA 1V5EA 1AQUA 3AB7A 4RXTA 4N76A 2HNAA 3L8HA 4D2IA 1PLLA 4YP6A 3G5TA 4NMWA 5LD2C 2H54A 1R4MA 1BCRB 4K9DA 4J0HA 4G8DA 1VQ1A 3DDSA 3VTKA 5HR5A 5JU6A 3LU1A 3NAMA 4ED9A 3BS4A 3WL7A 2PKCA 4LK3A 1A50B 1O87A 1Q6ZA 1AK9A 1KAGA 4OAPA 1L3BA 1I6LA 2CCKA 1U9ZA 1AXRA 3MCAA 3TDMA 2HV8A 5AHWA 1HTBA 2VRBA 4JGBA 2QRVA 4KDFA 5I7VA 2QTVA 3U56A 1FYEA 4YGYA 3LV8A 4ZHQB 4N5LA 4YPFA 3KG2A 3PT9A 3SR0A 1ZQ9A 3K35A 1CRWG 1DOAA 4PR0A 4RKRA 4W1PA 5DRTA 5TPWA 4C0WA 4C7BA 4FDLA 3W77A 1Y6RA 4N5HX 3OPYB 4DR2B 3FF1A 1YB2A 2J85A 3RVKA 3TIFA 3GRPA 4RTRA 2PTHA 4IH9A 5DYWA 4RJTA 1H8HD 4OSPA 3UIEA 1FRQA 4C7OB 1TUBB 3MS2A 1T9ZA 1EP3B 4PZCA 4Z4GA 2RAUA 3L0OA 3KDPA 1DG9A 5FL3A 2PPLA 5BMVF 3PRJA 2GWHA 4TWAA 1TCBA 1O94A 2EQAA 1C3OB 3ADKA 3BIFA 3NTQA 4GYKA 2P2GA 1QV9A 2F48A 1H2EA 5C52B 3C70A 2MSWA 4BU1A 4JUAA 1KFEB 4AB1A 3BCSA 1Q22A 4L0DA 3U40A 5EJAA 2JIZD 3G68A 1Z88A 4UZEA 3UHAA 3PGLA 1YS6A 4AF8A 5JZMA 3V8VA 1Y4UA 3KL2A 1ZBQA 2IW1A 2DUUA 1YQ9A 3FUCA 2ZJ4A 3B60A 2H51A 3MC1A 4BFLA 3DCJA 3DP9A 2WNHA 1JZTA 4TUYB 3PCTA 3TAUA 5F4BA 3WMWA 1NRXA 4G5FA 4F5YA 3IMGA 1RS0A 5CFZA 3T38A 2AZMA 2VYQA 4NFSA 2FWAA 3R41A 4JP8A 4JQZA 3HI4A 1ADYA 3EJ6A 4PG6A 1JJIA 3RK1A 1Y98A 2PX4A 2VWHA 4CM7A 3HKBA 4EY6A 1H5NA 4UCWA 4RENA 3ZCTA 4PGHA 3D8SA 5EJMA 3PEEA 2HHHB 1QS0A 1X80B 2UYQA 1P1RA 2Y0DA 3S70A 3PA8A 1WUYA 4KQWA 2J0UB 3HFJA 3OCXA 3II6X 4M88A 1AQYA 4BB6A 2AR0A 4FS3A 1ECJA 3HN7A 3K6KA 2IYLD 2DLCX 3B2QA 3FJYA 5IZCA 3FNGA 4S1VA 2DWQA 2JCBA 1MO2A 2QYTA 3OFNA 4Z0NA 2XE7A 4HWKA 4UC0A 4UCXA 2PBRA 3ZZNA 1YZFA 2EW2A 3T5GA 1CQXA 1SXGA 3J80A 3K0KA 1K75A 2C7VA 4EB8A 3P9IA 3L6UA 2EYQA 4JDPA 3ZD9A 4ZMSA 2WQZA 2AOVA 1REQA 1JF8A 4RABA 3RFFA 3WYDA 2IEBA 2I6UA 4LCBA 1GU0A 1GCAA 2CXSA 4PYLA 5GJBA 1AE1A 2D1FA 3GP3A 2RARA 1SELA 3AUAA 3B82A 2WUFA 4Q82A 1EK5A 4DCVA 2I9PA 1FMTA 1GKUB 2NU6A 4M1OA 2NTJA 1TXGA 3UWKA 1R5JA 3GFSA 4GX1A 3LIPA 3TLMA 5AW1A 3FVTA 4AJNA 1W6RA 1FLVA 1U8UA 4U00A 2W0SA 5DT2A 2QE6A 3P2YA 4X8HA 5CLQA 4DIEA 3QI7A 5BYJA 4M22A 5IBPA 4DNQA 1EFDN 5AUNB 1EJ0A 3ILYA 4RC9A 4DMMA 4U0JA 2GLTA 4OQXA 5JSZB 5J23A 1LPNA 3T15A 1Q7EA 1M54A 4BNLA 3TB4A 2JHGA 1R6XA 5JD6A 5DM70 2MINA 4PSUA 1GFIA 2OHJA 3SGLA 2ISCA 2OBBA 3WFZA 2IS1A 1PF7E 3Q2OA 4BU0A 2BHNA 3K9HA 5DK6A 1UR5A 2WUDA 5D00A 3JTEA 4N7RA 3MB8A 3VR4H 1G98A 3BDIA 1VCOA 1QQ6A 2FE4A 4J1QA 4JT9A 4K9NA 2GEUA 3FZQA 2XPCA 3C8UA 5HJEA 1UJCA 2OENG 3MINA 1J8MF 1E6EA 3NNNA 5H8WA 4ZAVA 1KPGA 5F73A 4TS9A 3DPSA 2PUWA 5D7NA 4L0QA 4UNNA 4J16A 3F4LA 1FXUA 5FV7A 3EEFA 4D3DA 3TRIA 3DZDA 3TXYA 3O03A 3K0HA 2NQ2C 1AV6A 1W9HA 4PN3A 2CYCA 3JQGB 2FQQA 3K31A 3KSDO 5CFLA 2A9QA 3ABRB 5IT5A 4GMGA 4BN0A 1YJCA 2HEGA 4MQ5A 1FTSA 4DR3B 1DC4A 3CLUD 4WJZA 1JDUA 5EIHA 1CUVA 3FAZA 5F23A 5E38A 1U0FA 2JLRA 3FMIA 4R1MA 2O1XA 3DWGA 4BVAA 5A1JA 1SD2A 1YR7A 3STYA 2C5SA 1KYIA 3IAAA 3KTAB 3KUXA 1YS9A 1H66A 4CMCA 2EXXA 4NBTA 1G5RA 4RPIA 4IQFA 1WZIA 1JHYA 4UEOA 6LDHA 1CNMA 3K32A 3W2EA 3ZE2B 1JEQA 3K05A 1JKJA 4QUIA 1RRKA 5CEFA 2DFKB 2HJSA 3SKXA 4I55F 1PL8A 1XWWA 1HDCA 3KOWA 2B4RO 4KODA 1SBCA 3WXBA 2OQRA 1XR3A 3TZKA 1FX1A 4GQBA 1LB1B 5T6MA 1FYWA 1J23A 4TZKA 5AOBA 3LLVA 4DNPA 3H4TA 3F7OA 1POXA 4HO1X 4X9XA 5ALPA 3UH0A 2CXQA 3B51X 4WOJA 1BD4A 2ZBRA 4JI6B 4UNSA 3U3MA 3FA2A 3H11B 3TB6A 3PLNA 2ZXFA 2HEIA 4IV8A 1I51A 2W90A 3AF2A 4U7GA 2GN9A 3T1VA 2FW0A 2GR9A 3L6CA 2FN3A 1DP4A 1C0EA 2VWGA 2FB9A 2CY0A 3OQMA 3F67A 2VFAA 4X3OA 1YK1A 3GVIA 4YHBA 4DOMA 1KWKA 4G8JA 4DABA 2CLEB 1FFGA 1Q3TA 2KJQA 2XLCA 4NH4A 2B83A 5GONA 1HDEA 2YQZA 1BA3A 5IK2A 4Z1OA 3PZRA 4BXOA 4Z5XA 3D6JA 4MQFB 4WY8A 1J07A 3AU8A 5DE3A 4YYEA 4D4KA 4TSRA 2XQJA 2DWPA 3TNLA 4TL8A 1SZDA 3Q8XB 1XD2B 3DBRB 2QN6A 4JOSA 4ND7A 4NZMA 2GUWA 3N8GA 3M6MD 1OI3A 2IU4A 4HAVA 3MT8A 3TW8B 2BJWA 2XQKA 5FTJA 4RF3A 3NPAA 3J7AC 2J0QA 5KNCA 1AKNA 1H2ZA 2WIAA 1NUUA 3B48A 1T24A 1B8NA 3HPRA 3P9RA 4XASA 1WCV1 2DFNA 4F2PA 3QUSA 4AM8A 4OLFA 1P2BA 1KWGA 1KL7A 1JUDA 4TKLA 3TQFA 5B64A 3AZPA 3D3KA 1EFHA 2YJ4A 4F4HA 1DWUA 2C9ZA 2BLLA 2ZBQA 3V8MA 4L73A 5TJHA 4TXHA 1XVIA 1EFRA 3VSBA 1YR8A 1QANA 4BAGA 5KWIA 2C95A 2HYDA 3CX7A 5B7GA 4G5RA 1SVLA 3S2IA 1Z12A 2NO6A 4OM7A 5FEUA 2Q3BA 3DBHB 3E3OA 1Z4MA 3JR7A 4LOHA 4QFCA 5FPKA 1XNRB 2Z2YA 4V0NA 4F5DA 1VJ5A 1WXIA 5LL6P 2Q9UA 2WJ4A 3L7BA 4R0MA 4C05A 2FAXA 3PFWO 5AI6A 3OOSA 4KUGA 4J4TA 2BEUB 2WAYA 3KEOA 3LMKA 2XECA 1G8YA 1U2PA 3EGXA 1AUVA 5GZ6A 3GXOA 2E6UX 2X0FA 5JNLA 1K86A 3Q40A 2VRNA 9LDBA 3LLMA 4D3ZA 2JFYA 4YDRA 3FKJA 5DGTA 3KOUA 4GXRA 5HKOA 3KPYA 4LV6A 2LKCA 1U4OA 1YHYA 2VZEA 3AUTA 1KVRA 1OB2A 2X5NA 2HRBA 3NH6A 1LKZA 1W73A 4X45A 4I4IA 4IOMA 4C0XA 2XSZA 3IUSA 5JSHA 1ZMTA 3SAJA 1V1RA 1DUVG 2H8GA 2QVGA 4MV3A 3LY9A 3TMYA 4CIDA 5F98A 2P4EA 2Q0HA 4WKPA 2OUKA 4XIIA 3U7HB 5ALWA 4KREA 3KZNA 1SKYE 1KJWA 2ARKA 1UADA 4HH1A 5JASA 2P1DA 3A70A 5E9AA 3U7QA 1N33B 1H23A 3P27A 4O4LA 2PMKA 1ENPA 1H2WA 5IF3A 3O8OB 1YI0A 1UEXC 3IAUA 3PD1A 1U6IA 5GY7A 3VU1A 3MOIA 1ZDMA 3VPDA 1WSAA 1XHFA 4TKUA 1PQUA 4LZAA 3T5DA 1W36B 1O6FA 3C8HA 2WNIA 4KSCA 4OHXA 2X8AA 1A04A 3GMDA 2P62A 1DCTA 1QAQA 2VK4A 1YJAA 5EUMA 1DINA 2B34A 4FE3A 3TR6A 1RADA 3AWDA 2H1RA 2CDNA 3A1SA 3DMRA 5AM1A 1SHUX 3DAGA 2YMMA 5TC4A 4LDPA 4DV6B 3PL5A 5GGYA 2QMOA 3C7TA 4PSCA 5KVQA 1ULBA 3STHA 5JXHA 4FVTA 1TI7A 1HFEL 1HLGA 3EH2A 3SZLA 3U7EB 2OZVA 1MC5A 1U9JA 1QIIA 2DETA 2P9HA 2JI4A 3HADA 4R8MA 1L3CA 4BO2A 4GZ3A 3AF4A 2G70A 2WAAA 2ZYSA 4PBSA 2XA1A 4TXJA 1FP1D 2O57A 2W9XA 3A9CA 2ZZKA 2UZ3A 1Q5PA 4TLCA 5AJHA 1XALA 4DR4B 4LFAB 4QYIA 1M5RA 4AKHA 1A8PA 4Y1GA 5EMLA 3LI2A 1QYDA 4C03A 1RXVA 3I23A 1YVEI 1A4RA 4IXMA 4XGKA 3SYMA 1J25A 2JVIA 4MVJA 3B13B 1ORDA 3V3KA 4Y6OA 2CV2A 4ESOA 2GXAA 1JAZA 3EOBI 2X40A 2XYPA 4OQZA 3ZY5A 4TROA 4O3MA 5L51A 1G4HA 5C8ZA 1OH7A 1ORRA 2BFCA 3DWEX 1D0VA 1NW4A 3TR0A 3U19A 1KIAA 3A3PA 3W8EA 4C0BA 4RZXA 3IDSA 1JSLA 3FPLA 4LC1A 1SVOA 4MR8B 4P7JA 3JSAA 1GTZA 2PRIA 3NLLA 3ETLA 3HR7A 2D3WA 3L07A 4PLTA 1DLIA 2WWTA 4AJPA 2BSAA 3AUFA 3NW9A 1W76A 3I3SR 2WWFA 2G28A 4W1RA 5CW2A 1WZNA 4N8SA 3UJ3X 4YJHA 1JJBA 2I2XB 4J9VA 2WKQA 5TVGA 2ONJA 1BHSA 1IU9A 4CPDA 4DARA 4U2KA 5D84A 1RYMA 2I80A 1NHWA 3WSWA 5JJ5A 2OO5A 4K87A 2CWDA 4YPOA 3DR5A 3OKAA 4RJ2A 3WIOA 2RE8A 3IEKA 2Q7XA 4OQLA 4ZCSA 4LJ6A 1SUPA 2W6MA 3IUNA 1PJBA 4H7DA 3RHFA 3GPBA 5BWNA 2JHFA 4G0OA 3CVOA 5HP4A 3GLGA 2G1JA 1J2JA 3SYLA 2EG5A 3NG1A 3FOWA 4LPSA 1ARZA 2TSYB 4DNOA 2ZUFA 1HC7A 3CW2A 1WB9A 4BFUA 2NAFA 4MUNA 2AWNA 3JYNA 3N07A 2HB6A 1R50A 1WD7A 3PUZA 4AMVA 2IH2A 3BFJA 1RI3A 1Q0SA 3OM8A 4FT4A 2DFDA 2FMKA 4WUTA 5B1HA 2P30A 1PO7A 2J0EA 4D80A 4NSNA 3A8TA 1QF9A 2PL5A 3EWNA 4QVIA 1FQKA 1NFQA 1EQAA 2J5KA 2WD7A 4V0QA 2UYHA 1NN3A 2Z3WA 1C3JA 2PXXA 1P75A 4A9AA 3RGWS 3L7MA 3ITDA 4PFSA 2JKYA 5FRDA 2G9ZA 2GI4A 3I0MA 5AW9A 1UDCA 2QR5A 1Q91A 1FE8A 3PJGA 4A73A 4B8YA 4L95C 4NL4H 3A1EA 3WHKA 3KXLA 4F45A 5A04A 5AW2A 4RCYA 2R5WA 3DMHA 4E5PA 2PX8A 3IKVA 3KCQA 2M1XA 1Y9DA 2A0XA 2QYSA 1M5TA 2WE7A 1RC0A 4U39A 4UDYX 4KMRA 3ABOB 4YQZA 1N2JA 4JJIA 2XDYA 5BO5A 3FDJA 4K9OA 4LECA 2YX1A 4EMBA 4DCCA 1V8DA 1DLJA 2XDQA 1PLJA 3RQIA 2IX3A 2BN4A 5FFNA 1XTUA 4O4LB 4RE5A 2O8EA 1PEYA 5ILGA 1USIA 5AVJA 1TGVA 1WEHA 2R00C 5BWMA 5F64A 4YRSA 3GJXC 1B6GA 1P3JA 1YZTA 1S4QA 1KOJA 4KBFA 4CEHB 2PBZA 5D6OA 1ZL0A 3N0WA 2VNKA 1RWPA 1Z8HA 3QLJA 4WCFC 3E1KA 1T9DA 4DQ0A 5FOQA 2GD1O 2I3GA 2BZ1A 4CQLB 4D26A 1RYBA 4TYWA 3ZPXA 3ENKA 4J16C 4WESA 3NV7A 1MO5A 2C4KA 3FR8A 2AEMA 3L82B 4JWTA 4ENVA 1I8TA 4WJLA 2JFZA 4AXXA 5DRYA 4BZPA 2B2XA 3R76A 4KH1A 1V3TA 4GEGA 2J0VA 5C1DA 3CINA 1NMZA 2GSDA 4XR4A 1APBA 4ZO7A 1I10A 2BWJA 2OORC 1L4LA 2HBQA 3AEUB 3FVWA 5JLAA 4ZOLF 1E5LA 2NM0A 2DPLA 2YZGA 4G5XA 3RVMA 3MFYA 1EFPB 3M6AA 2QVXX 4UFNA 1YA4A 4XXHA 1IQUA 2NZ2A 2GHIA 3H1TA 3CMCO 4U2DA 1RE0A 3MXTA 3B3QA 1QP8A 4A36A 4EEXA 4OKNA 1ADCA 1QK4A 5EXTA 2QTLA 2I3ZA 3DMFA 4XSGA 1JDNA 1UAYA 5CT8A 2PX2A 1IK4A 2P3QA 3Q9SA 1PZXA 1SEPA 4IHAA 5DCYA 5KYUA 1X2EA 4MQEA 4E46A 1T3GA 4X7MA 1OA0A 2AZTA 5ALXA 3W5HA 1TTPB 4MVJI 4XJSA 4RBNA 1II0A 2VP0A 3CX3A 1P4SA 1KS2A 1Z62A 1C0PA 3FH0A 3NHPA 1CZKA 4LZZA 2VSFA 3W1VA 2V6IA 1OWLA 4FW9A 4RPJA 4UEWA 4YFVA 2WJAA 4MPPA 4A8HA 4EEKA 4EKIA 3X1MA 3GP8A 1Z29A 5EKTA 1VP3A 1MOPA 1VRVA 3MN1A 1Q7RA 4RQUA 4MWDA 3QE9Y 4MWZA 2X1MA 4MS1B 1XAHA 3P4XA 5K8TA 3JWJA 1SVKA 4LAFA 4MQEB 4QUBA 1NPDA 2XB2A 2QTMA 1JN0A 2ZJZA 3LECA 2XZTA 3RAEC 2GCEA 5B58C 1ID1A 1VDMA 2VXOA 1X3SA 4JU9A 1Z28A 3TLXA 4DCGA 1V71A 1KZ1A 2FN9A 4QQFA 1YR6A 3WGIA 4KR6A 5GONB 2CNKA 4OJMX 5DBHX 1DFHA 1QFJA 2ZQ5A 1NYLA 4C4SA 4E08A 3ND8A 3O74A 1BEUB 1JFFB 2HNKA 2YHUA 4KWTA 4QVKA 2XT9A 5FPQA 1Q0LA 3OEEA 3VNQA 3UMCA 1P0IA 1M66A 4LHWA 4RDHA 4MRMA 1JXOA 4M86A 4UUMA 4UCFA 5SZKB 1FQWA 5I4BA 2IHKA 5MDHA 1V8OA 4QDKA 2WI8A 1QH8A 5TMEA 4IICA 2PMBA 4OBXA 4HBGA 2NU7A 3ROXA 3AKEA 3GCZA 1AKWA 2XADA 1KYZA 3OE5A 1RCTE 3GAFA 1RJFA 1JBKA 3ZCSA 4B84A 4C3VA 3HLKA 1H5UA 3ZJVA 3VTAA 4G1FA 1GARA 2GBCA 2HC9A 4RY8A 2H2GA 1ULZA 3BMCB 4XPIA 5A7HA 5TQVA 1KZHA 1ADFA 1EAYA 3EY9A 1FS5A 4TTRA 4US1R 3ZNPA 1A82A 3JV7A 3L46A 1GZUA 1FDUA 2Y92A 3TZ6A 1YTUA 4AP9A 1ECFA 2OV1A 4OG2A 1XA0A 2CNLA 4XRRA 2AEJA 4TVBA 3DM5A 3VTFA 4DG5A 3IO5A 1FNCA 5ETJA 3CRZA 5FCDA 2Q0XA 2JCXA 3L7AA 3WL6A 1O5OA 2EZ4A 3K0AB 5GZ3A 3ZH2A 5LMNB 1CUZA 2R7AA 2DKOA 1W1WA 2IEIA 1MDFA 2VQ3A 1Z13A 1MQAA 3HDVA 1CJUC 4BX2A 4F1WA 4HEA6 3QYFA 1Y1PA 2IX9A 3RRBA 1K5HA 3W2GA 4RJIA 3R4VA 5IAJA 4JKIA 5KSPA 4MS1A 1CVRA 3P96A 3BSSA 2M6SA 1HE5A 1O95D 1NT4A 2A9OA 4ZQHA 2CV1A 3AM1A 4QAQA 2WNSA 2BHRA 1FOEB 4HP8A 3Q3JB 4JI2B 5C53B 3NX4A 1FXWF 5HKAA 2FWPA 2WMNB 2C97A 4PYNA 5EI5A 1RPNA 3DOUA 4OFBA 1L1QA 1U3DA 1L7DA 4LRWA 1Z15A 2OPHA 2WKRA 3A04A 1HUQA 5IJ0A 5H02A 4RVSA 3NHJA 4ZYVA 2FR1A 4C5AA 1XTZA 421PA 1U04A 1FX0B 3ELYA 1RZVA 4OHWA 1E9EA 5EVCA 5I4KA 4MDHA 4ALNA 4HXFB 5C35A 2WJVA 1JKFA 3JYHA 1GUAA 1T2FA 4RJLA 2WVHA 2YIMA 2YZ7A 1OA1A 3S2FA 1S6YA 4BIMA 4WOPA 3NIFB 4G1MB 4Q7QA 3U7FB 1GAEO 2F1KA 1IOLA 3L6BA 4Q0MA 1XQVA 2G9RA 3BREA 3BTVA 5LB2A 3UJPA 3DULA 2AQIA 2XMPA 1XNJA 5AJTA 3D8TA 4DJTA 5JZBA 2GJSA 2FP4B 1ZD8A 3TVYA 4IJKA 1ZD4A 1Q14A 3I4LA 5AUOB 1VXOA 3FPSA 3ACBA 2BZGA 1XCJA 2GRJA 4P5EA 5AVXA 4OUDA 3O2NA 3W4IA 2NSYA 3PQ5A 2MCFA 4JYBA 3EIQA 3R9XA 4BO3A 4RHCA 3GYBA 1GITA 2R4UA 2ZOSA 1BX3A 1I0LA 4LJ8A 1NVAA 1W8DA 4YUWA 1JJAA 2OZLA 3N6VA 4WRRA 1Y8CA 1F51E 3IILA 4KVAA 3EYAA 1CB7A 4UULA 5TEVA 1XEXB 4PYJA 2OCPA 3ETNA 3G9ZA 2YJ6A 2W2MA 3OPYI 1MFPA 1SKQA 1EFVB 2JI9A 4DMCA 2XEXA 2BFNA 2O8EB 821PA 1NYRA 4WKBA 2QHXA 4B7CA 3I12A 3K70C 5BYBA 1CUFA 2QLBA 4GRIA 2GEDA 2VIIA 2PEZA 5LBUA 2GN8A 2IHTA 3AH8A 2C82A 4BJ5A 1BXRB 1Q95A 5HZGA 2Y2VA 5JVDA 4NBKA 1TO6A 3PFBA 4QLAA 4N5MA 4DWJA 1FP7A 2FEMA 2V58A 1TA0A 1TYBE 2Z04A 4IDFA 3UA3A 3EZFA 3EK2A 4EA9A 5KX5A 5LN1A 1EWRA 1JVBA 1O6ZA 3PV0A 4Q21A 4UUPA 3DDUA 3ZHQA 3BH7A 1BYUA 4ZJUA 4MSUA 5HBRA 2RI6A 3HUDA 4O5OA 3MA0A 2XX3A 1TJNA 2GSWA 5EKUA 3EFBA 4FYXA 4XX1A 1DFIA 3K9WA 3LSYA 3EZGA 2HMTA 3T3OA 2WE8A 2YMPA 4YECA 1Z2DA 2B21A 4X97A 3V7UA 2C2GA 1WBBA 3C3CA 3COZA 2X13A 4W1QA 1EVZA 1XU4A 1KORA 4XVCA 4YT5A 3W5UA 4TOIA 1R10A 2BFFB 3V6LA 3G85A 2PL3A 5CFOA 1EUZA 3KJIA 1T1RA 1MT3A 4L3VA 2NUTA 4LOAA 1XZCA 5CLLA 2PXHA 1DELA 3WMFA 3FOBA 4O4IF 4MZXA 3UB3A 2B99A 1Z36A 1QFMA 3ECCA 4FXOA 1ODLA 2OBMA 2M98A 3OX3A 1AUOA 1ZJJA 4CV1A 4M7OA 3U7RA 3IX7A 4MDYA 4F9FA 2HLNA 2I87A 3RS5A 1N5IA 2I2FA 5JVDB 4OY3A 4GKJB 4HYTA 3G7SA 2I7VA 3IQXA 3HBJA 2CHVA 1MRSA 8ATCA 3ZE7A 4C76A 2UAGA 4COKA 4AN1A 4PINA 1RQXA 1ISRA 3H4VA 1TAQA 2Q5EA 2VUTA 1IVNA 4L07A 4NMLA 3VSAA 5A4DA 1G2QA 4D81A 4N18A 4FDMA 4M46A 4B73A 4PPQA 1GN9A 1SOMA 3FM9A 3G9UA 3KXKA 4FC6A 1F2UB 3CF6R 4GVLA 4XM0A 3LVBA 2QTTA 4NE9A 2VXYA 2GZSA 1JSXA 3PNQA 5A3SA 3ZNOA 5C46F 3PVCA 5JIBA 2P9ZA 1KYQA 4N82A 4FCCA 3DEKA 2PUDA 1BFKA 5C8XA 4XWGA 4BO0A 4HF7A 1BTOA 4M87A 4U3JA 1OVMA 1H0SA 1WUHS 2VPYA 2ZS7A 1I5RA 3IIJA 3VYWA 5HRCA 4ZGGA 3CY6A 5BV7A 2EDCA 3SR4A 3EEIA 2CT8A 1GUFA 2QQEA 2WSSA 1PJ8A 3ZWNA 1PT8A 3EZ7A 4LQCA 4BNMA 3LXMA 1K7EB 2CYBA 2OHXA 3MRXA 1TD1A 2Q0SA 4UAUA 3SHOA 4MUJA 2QM3A 4RK6A 4XARA 2OFFA 4RK4A 3TVDA 1W4CA 1JFFA 5LMZA 1UDWA 3OZTA 3VISA 1VXRA 4IP0A 4TV8B 3AEZA 4WN9A 4C14A 4ZAGA 2PA0A 5KOYA 2ID8A 3P9PA 3QG1A 1VG0B 3N1UA 4KXFB 4O4HF 5DWDA 5K3DA 3R8CA 1TTQB 3ZDYB 5ES3A 3KQTA 3C5EA 4DJEC 3PUJA 1TD9A 4J4BA 2JFQA 1JJFA 3MGCA 4WDRA 1YL5A 2WIBA 5E7IA 5LYYA 1J2TA 3DMYA 1P5HA 1S89A 4GR4A 1QBKC 3T9CA 2PYIA 3N05A 4II7A 1PS0A 5CDFE 3DFFA 4MYCA 4N7BA 4Q4DA 5D6NA 5SICE 2BMAA 2YJ5A 4CLRA 4O4LF 1J8YF 2QZ4A 1XV5A 3BMQB 2AXQA 4FONA 2RBKA 5TJ9A 1TE2A 4OLHA 3G13A 2W7TA 3QFCA 2GO1A 3I3OA 3M6LA 5GVRA 5BQPA 1Z4QA 3IERA 3CNEA 3HY6A 3SY8A 3RC9A 3GJYA 3RAPR 5FQNA 4ZJZA 3I2JA 4F71A 2F3TA 2E48A 3SQMA 3IQHX 2GPTA 1Z0AA 4N6NA 5DYGA 3UG7A 3QVXA 4PAOA 4X64B 3HABA 1L4EA 4RD1A 2ZJ0A 5C7OO 4HWSA 2PVPA 3AWIA 2HZBA 2O2IA 1W36D 1JXAA 1M74A 4LRUA 1DAFA 4XOUA 4D5EA 4HN9A 4YJ3F 5KQSA 2HQBA 2HU7A 2Q6LA 1BKDR 5DYNA 3Q8KA 3N70A 1LFAA 1EFPA 1HYGA 2C4NA 2XOXA 2HZ7A 3I0ZA 1TNDA 2PBLA 3IMFA 4P36A 3TPZA 4XWAA 1SC4A 2IODA 2BMEA 3EXG1 3LBHA 1XLTA 3NWEA 3ZCVA 2PUBA 1KHTA 3S8EA 2B92A 1RXEA 2FWRA 3LVFO 4RWZA 4A0QA 1WLYA 2FOXA 4ZI3A 3UGKA 5CEJA 3CVVA 2O8FA 1T8YA 4LGMA 4UTOA 1EESA 2ZRDA 4YAIA 4KR9A 3WZMA 3OLQA 4R3WA 3GUZA 3JQQA 2ZYIA 5L3ZA 5JSQA 4J2TA 1J5PA 2Q2WA 1NUPA 3GAAA 3MWDB 3H99A 1OUMA 2QNIA 3IPAA 3FNHA 1NQWA 2FVYA 3MGGA 4J49A 3JQPA 2PSSA 3PNSA 2XDAA 4P4NA 3QSYA 4MAMA 4F6LA 5EZ5A 4I46A 1UBSB 4M1QA 3GG9A 3VFDA 4CTMA 2CLSA 2HWXA 1U0NA 2AFHB 2WHPA 2X8BA 3F3SA 3H42B 4J1NA 3WGZA 2BGTA 4ND4A 4J2HA 3UK6A 4WWHA 3NBUA 1C9KA 3K3PA 4J6FA 1M9NA 4MEBA 4NAHA 3O4HA 4PANA 2YC2C 3REOA 1X94A 4FJ0A 4ZEOA 3WI7A 2I3AA 3TJMA 1RT9A 1FTYA 1AF4A 5I7OA 4AS2A 4DC0A 3PJDA 3TAXA 1UPFA 2FCRA 3S4YA 3S44A 1PHRA 4F2GA 3I5UA 1LVGA 4IS2A 4RLQA 4UU0A 4XWOA 3FUWA 3OIYA 1VMKA 4GHWA 5G40A 3EDMA 3G17A 4EFNA 4M8SA 3PQ4A 3ODPA 5A3QA 4LTMA 3TEFA 3WGJA 1Z0DA 2QVYX 3OUUA 3ZUPA 5E7JA 5KTSA 5GONF 4LW8A 4ER0A 1F8UA 2PAFA 3JY6A 4HGNA 1EG7A 2XGSA 3KQOA 2CNOA 4IDEA 3ZDXB 4CKYA 2Z4RA 4G09A 2Q8PA 3GL9A 2ZEJA 1AGNA 3K6JA 1H94A 4YONB 4LGCA 4WZAA 1WY5A 3CKMA 1NBEA 5JV5A 1J24A 2ZR8A 3KRTA 3OM0A 4KIGA 1CZHA 2SHKA 2F59A 3FYSA 1UOOA 1BH6A 2NUPB 2R6HA 3KKZA 5BR7A 2P6PA 3EW7A 2IEYA 4BO9A 2P4UA 1N2OA 3GEIA 1KYVA 1NTOA 4J3JA 3TLAA 5AKGA 1VI5A 3CTMA 4P1ZA 2VXBA 3GUUA 4EITA 1H0HA 2E4UA 1P7ZA 3LW7A 1NYTA 3OQPA 3MTAA 4HQNA 2V4ZA 4GOMD 3SEAA 2R6AA 2XZLA 3H5WA 1CHDA 3HLYA 1VCHA 5CR9A 5CLHA 4HDSB 4QE3A 2CC2A 3ZHCA 3VR6H 2C2BA 1RW4A 2IITA 3FRHA 3D3WB 1P2DA 1VHWA 3WA7A 3SG0A 1NURA 3RS8A 3U31A 1CV2A 1P1IA 3PNVA 1RWOA 1GGKA 3WRYA 2AKYA 2AOUA 4IINA 4PX9A 4ZVNA 4CI9A 1U3WA 4XJVA 1KSGA 2ZSIA 4DV0B 3VH3A 2GK7A 3LCRA 4ZDKA 2BFEB 4XVRA 1L4UA 2Z5GA 1VJGA 2QTZA 5CFQA 1I7SB 1LW6E 5HQJA 4XR9A 4JOQA 4FFPA 4WEOA 2JZCA 4FGZA 3IOBA 1QRRA 3KZ1E 4XB2A 1FFEA 1T4GA 1L7EA 4QODA 5BW5A 1P80A 1Z68A 3AERB 4G41A 4TWJA 2OK8A 5BNZA 4DM4A 4GF5A 3ANLA 2I99A 4CNQA 4JAVC 1MD9A 2GCOA 1DIGA 3E81A 3GJ6A 2W6QA 5C4MA 1AKVA 2I2BA 3GGCA 1A76A 7ABPA 1W5FA 2CHGA 1RLJA 4G89A 2QV0A 1NMSA 1JH8A 5COQA 4TQUS 4KXXA 4ARAA 4I4LA 4HNTA 5FUXA 2FZKA 4RY9A 3B7GA 2DF8A 5IAKA 2XCSB 2XMRA 4DIUA 3I04A 2PUHA 1NI5A 3RYFB 1FJ2A 4BKPA 3PDUA 3LK7A 3LKDA 2IYUA 1XTKA 1FSZA 2R60A 2FGKA 1M33A 2GH1A 4CR6A 4XEHA 1TQDA 4R1SA 1FP4B 1OKKD 1T9GR 2HSEA 1WLSA 1HE8B 2ZITA 1T8TA 2DJIA 3DUFA 3I01A 1KJQA 3PK0A 1L4FA 4L4SA 4CF3A 5BN5A 1Z5PA 2WTXA 1KEEA 4RK1A 2IYOA 2V5VA 5HCUA 2P11A 5HJ2A 2WWHA 1U0GA 2QJTA 1K6IA 1YA6A 2I78A 1XNGA 3LUAA 4W7HA 2GJ4A 1YB5A 3Q10A 5LQUA 1K89A 5TS2A 2CNBA 3CCFA 5TQ0B 2GYUA 3DGEC 2ZUSA 2P6MA 3FB4A 3CQ9A 3HNOA 1PYDA 2FR8A 4JVMA 1KO1A 2XWQA 2P7HA 3A26A 3M6UA 2GPNA 1Y3HA 4HMOA 3PXEA 3KHSA 2QRZA 1G20A 2GN1A 3QKWA 1NN0A 3F3MA 4KO1S 3WGMA 3X1KA 5LSAA 2CUZA 1E4EA 1I2ZA 4KLNA 4F85A 1H05A 3MM4A 4DZZA 4L3OA 2ZB8A 2LDXA 3EXHC 3O2QB 2NPFA 5E4JA 5JECA 4H31A 3R6LA 1P4GA 1NZFA 1M3SA 3OU2A 2RGCA 4MITA 4O5AA 1DC8A 3EF3A 2Q5OA 2XMDA 2A0FA